(data stored in SCRATCH zone)

HOGENOMDNA: SAENT2_3

ID   SAENT2_3; SV 1; empty ; DNA; empty ; PRO; 106516 BP.
XX
AC   NC_003385;
XX
PR   Project: 57793;
XX
DE   Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM2,
DE   complete sequence.
XX
OS   Salmonella enterica subsp. enterica serovar Typhi str. CT18
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Salmonella; Salmonella enterica subsp. enterica
OC   serovar Typhi.
XX
RN   [1]
RP   1-106516
RX   PUBMED; 11677608.
RA   Parkhill,J., Dougan,G., James,K.D., Thomson,N.R., Pickard,D., Wain,J.,
RA   Churcher,C., Mungall,K.L., Bentley,S.D., Holden,M.T.G., Sebaihia,M.,
RA   Baker,S., Basham,D., Brooks,K., Chillingworth,T., Connerton,P., Cronin,A.,
RA   Davis,P., Davies,R.M., Dowd,L., White,N., Farrar,J., Feltwell,T.,
RA   Hamlin,N., Haque,A., Hien,T.T., Holroyd,S., Jagels,K., Krogh,A.,
RA   Larsen,T.S., Leather,S., Moule,S., O'Gaora,P., Parry,C., Quail,M.,
RA   Rutherford,K., Simmonds,M., Skelton,J., Stevens,K., Whitehead,S. and
RA   Barrell,B.G.;
RT   "Complete genome sequence of a multiple drug resistant Salmonella enterica
RT   serovar Typhi CT18";
RL   Nature 413 (6858), 848-852 (2001)
XX
RN   [2]
RP   1-106516
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2004) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-106516
RG   NCBI Microbial Genomes Annotation Project
RT   "Direct Submission";
RL   Submitted (16-JUN-2003) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AL513384.
CC   REFSEQ gene predictions performed by GeneMark 2.4/Genemark.hmm 2.0
CC   with comparison to original submitter provided annotation; tRNA
CC   sequences predicted using tRNAscan-SE 1.21.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..106516
FT                   /sub_species="enterica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:220341"
FT                   /strain="CT18"
FT                   /serovar="Typhi"
FT                   /plasmid="pHCM2"
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhi str. CT18"
FT   gene            complement(join(106342..106516,1..29))
FT                   /db_xref="GeneID:1251389"
FT                   /locus_tag="HCM2.0001c"
FT   CDS_pept        complement(join(106342..106516,1..29))
FT                   /locus_tag="HCM2.0001c"
FT                   /gene_family="HOG000266932" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.45C, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1119, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:21426763"
FT                   /db_xref="GeneID:1251389"
FT                   /translation="MAVTLAGLEIEKTSGYWRAKGFKQPGVLEREDGVIVHQRREWRMY
FT                   DPETGKLTTKAGTLWGLLKKIH"
FT                   /protein_id="NP_569473.2"
FT   gene            complement(29..334)
FT                   /db_xref="GeneID:1251390"
FT                   /locus_tag="HCM2.0002c"
FT   CDS_pept        complement(29..334)
FT                   /locus_tag="HCM2.0002c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative periplasmic protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.46C, Yersinia
FT                   pestis hypothetical protein from plasmid pMT1; similar to
FT                   YPMT1.46Ac (EMBL:AL117211) Yersinia pestis hypothetical
FT                   protein from plasmid pMT1"
FT                   /db_xref="GI:18466667"
FT                   /db_xref="GeneID:1251390"
FT                   /translation="MKTVLDTLLLIVSIAFVLDCIFTGAIRKALAPVNGAMVVDSGEQF
FT                   YVVRDDRVLSSPYLTKRNGKLSGVGEDKFVYNKSGDVYGVHAKNASYLFDDCKEVG"
FT                   /protein_id="NP_569474.1"
FT   RBS             complement(36..43)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(375..650)
FT                   /db_xref="GeneID:1251391"
FT                   /locus_tag="HCM2.0003c"
FT   CDS_pept        complement(375..650)
FT                   /locus_tag="HCM2.0003c"
FT                   /gene_family="HOG000266917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.46BC, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1117, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466668"
FT                   /db_xref="GeneID:1251391"
FT                   /translation="MKILVRISASTDYDVYPLFMVKCDGLNDEEIQAAIERNLVEYTGM
FT                   DADSVYVDDDGVCWHNGSCWYVDDTMTVSDEDAAHLERILGISTFE"
FT                   /protein_id="NP_569475.1"
FT   RBS             complement(658..663)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(719..1129)
FT                   /db_xref="GeneID:1251392"
FT                   /locus_tag="HCM2.0004c"
FT   CDS_pept        complement(719..1129)
FT                   /locus_tag="HCM2.0004c"
FT                   /gene_family="HOG000266918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.47C, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1116, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466669"
FT                   /db_xref="GeneID:1251392"
FT                   /translation="MKKLYDAANAALDVVDTEIAQGFPEPEWATQLREAIAEMNAPEPS
FT                   EDEADWQRFIRMYAEEVGPTPTAEQAMLLKYFKEAGENLPVDDTPHWFHAAWRKFDVIY
FT                   TRGMGSKDMVVWHLMHIDKAVDRTLEKFFPPA"
FT                   /protein_id="NP_569476.1"
FT   misc_feature    complement(737..988)
FT                   /note="hypothetical protein; Region: PHA02053"
FT                   /db_xref="CDD:177336"
FT                   /locus_tag="HCM2.0004c"
FT   gene            complement(1113..1484)
FT                   /db_xref="GeneID:1251393"
FT                   /locus_tag="HCM2.0005c"
FT   CDS_pept        complement(1113..1484)
FT                   /locus_tag="HCM2.0005c"
FT                   /gene_family="HOG000119320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:X78401) ninX, Bacteriophage P22
FT                   NinX protein; similar to (EMBL:AL117211) YPMT1.48C,
FT                   Yersinia pestis CO-92 hypothetical protein from plasmid
FT                   pMT1; similar to (EMBL:AF074611) Y1115, Yersinia pestis
FT                   KIM5 hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466670"
FT                   /db_xref="GeneID:1251393"
FT                   /translation="MKNYSEMTDFEINCLVAEATGHRPLISQYGWKGSQEGDYTAVVAI
FT                   GPNGAGTFDWCNDPEDAWDIIYRHRIGVIPARQPGEWRAAHRKVDSSTPQHLIQNPNPF
FT                   RAAMTVFLLMQEKKHEETV"
FT                   /protein_id="NP_569477.1"
FT   misc_feature    complement(1140..1481)
FT                   /note="Protein of unknown function (DUF2591); Region:
FT                   DUF2591; cl11584"
FT                   /db_xref="CDD:159559"
FT                   /locus_tag="HCM2.0005c"
FT   RBS             complement(1137..1141)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   RBS             complement(1492..1497)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_recomb     1565..1621
FT                   /note="57 bp repeat 1"
FT   gene            complement(1647..2489)
FT                   /db_xref="GeneID:1251394"
FT                   /locus_tag="HCM2.0006c"
FT   CDS_pept        complement(1647..2489)
FT                   /locus_tag="HCM2.0006c"
FT                   /gene_family="HOG000250479" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative lipoprotein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AE001907) DR0482, Deinococcus
FT                   radiodurans B-cell receptor associated protein-related
FT                   protein; similar to (EMBL:AL117211) YPMT1.49C, Yersinia
FT                   pestis CO-92 putative lipoprotein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1114, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466671"
FT                   /db_xref="GeneID:1251394"
FT                   /translation="MKKGLLAVALTAICTMGLTGCDRVEPGYVGIKVNKLGEDKGIGEV
FT                   VGVGRQWTGLNTELYTFPTFKQMKTYDEPFTFQMSDGTAIGHKIGVAYLVNRDKVTTVF
FT                   QTYRKGVDDITDTDLRQKIADSLNRLASRMTTDTFIDGGKASLLDNALKDIQAEMSPVG
FT                   IEVISLSWVGKPDYPDTVIESINAKVTANQKTLQRQQEVEQRKAEANMLREQAEGEADG
FT                   EADAIRKRAQAEADAIKLRGEALRQNPNVMELEAINKWNGQLPQYMTEGANTPFIALK"
FT                   /protein_id="NP_569478.1"
FT   misc_feature    complement(1668..2489)
FT                   /note="Membrane protease subunits, stomatin/prohibitin
FT                   homologs [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: HflC; COG0330"
FT                   /db_xref="CDD:30678"
FT                   /locus_tag="HCM2.0006c"
FT   misc_feature    complement(1743..>2195)
FT                   /note="The band 7 domain of flotillin (reggie) like
FT                   proteins. This group contains proteins similar to stomatin,
FT                   prohibitin, flotillin, HlfK/C and podicin.  Many of these
FT                   band 7 domain-containing proteins are lipid
FT                   raft-associated.  Individual proteins of this...; Region:
FT                   Band_7; cl02525"
FT                   /db_xref="CDD:164020"
FT                   /locus_tag="HCM2.0006c"
FT   gene            complement(2493..2693)
FT                   /db_xref="GeneID:1251395"
FT                   /locus_tag="HCM2.0007c"
FT   CDS_pept        complement(2493..2693)
FT                   /locus_tag="HCM2.0007c"
FT                   /gene_family="HOG000266919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.49AC, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466672"
FT                   /db_xref="GeneID:1251395"
FT                   /translation="MIKGYLMAVSAVISVCFIYGLLVPSLISAKSDLALFIGLAIAVVF
FT                   PVALLKAGRRYINSLNKTKEK"
FT                   /protein_id="NP_569479.1"
FT   RBS             complement(2499..2505)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   RBS             complement(2699..2703)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(2785..3861)
FT                   /db_xref="GeneID:1251396"
FT                   /locus_tag="HCM2.0008c"
FT   CDS_pept        complement(2785..3861)
FT                   /locus_tag="HCM2.0008c"
FT                   /gene_family="HOG000266920" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative recombinase"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:L20680) recA, Thermus aquaticus
FT                   RecA protein; similar to (EMBL:AL117211) YPMT1.50C,
FT                   Yersinia pestis CO-92 putative recombinase from plasmid
FT                   pMT1; similar to (EMBL:AF053947) Y1113, Yersinia pestis
FT                   KIM5 recA-like protein from plasmid pMT1"
FT                   /db_xref="GI:18466673"
FT                   /db_xref="GeneID:1251396"
FT                   /translation="MAKGKSALALALKKKIGSNDEIQKVSHWIDSGFPPLNKAISGRYD
FT                   GGFPCGRIVEVFGPPSAGKTFLATAAMVSAQKQDGLAVFLDHENSFDVGLAVANGLNAD
FT                   EDDGQWVYKQPDTFEDSVELIGTILKLVRDEELIPETAPICIVADSLASMVPNSKAEKF
FT                   DKMAEGTAKDKDQLNMNDNTALARATSANFPTLALWARKYNACIIFLNQVRTKIGVMFG
FT                   DPTTSPGGDSPKFYASVRIRLGASVMKDGKEKIGQDVGAECIKNKVAPPFGKCSWKFYF
FT                   DPTRGLDVIESLVEYMLEEGYLPKNASGRVEIGDKKYTKSQIVEMYREKPLPEIIAALQ
FT                   AIDERRAKESSPAETEEA"
FT                   /protein_id="NP_569480.1"
FT   misc_feature    complement(2938..3726)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="HCM2.0008c"
FT   misc_feature    complement(order(3667..3675,3685..3690))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="HCM2.0008c"
FT   misc_feature    complement(order(3412..3417,3601..3606,3610..3612,
FT                   3667..3675,3685..3687))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="HCM2.0008c"
FT   misc_feature    complement(3415..3429)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="HCM2.0008c"
FT   gene            complement(3864..4130)
FT                   /db_xref="GeneID:1251397"
FT                   /locus_tag="HCM2.0009c"
FT   CDS_pept        complement(3864..4130)
FT                   /locus_tag="HCM2.0009c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.50AC, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1112, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466674"
FT                   /db_xref="GeneID:1251397"
FT                   /translation="MLKSIINGGATTPTMLAKEIVFCHGEHAVVALPNILGAAGISATE
FT                   REFALVSEQVVKIIARVAKHLNHDAIKFDEAAASKRINESKGA"
FT                   /protein_id="NP_569481.1"
FT   RBS             complement(3869..3874)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(4130..5074)
FT                   /db_xref="GeneID:1251398"
FT                   /locus_tag="HCM2.0010c"
FT   CDS_pept        complement(4130..5074)
FT                   /locus_tag="HCM2.0010c"
FT                   /gene_family="HOG000266909" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative exonuclease"
FT                   /transl_table="11"
FT                   /note="similar to exonuclease domain of bacterial DNA
FT                   polymerase I (EMBL:J04479) polA, Streptococcus pneumoniae
FT                   DNA polymerase I; similar to (EMBL:AL117211) YPMT1.51C,
FT                   Yersinia pestis CO-92 putative exonuclease from plasmid
FT                   pMT1; similar to (EMBL:AF074611) Y1111, Yersinia pestis
FT                   KIM5 hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466675"
FT                   /db_xref="GeneID:1251398"
FT                   /translation="MNYLFVDGNSLGYYHQQSDKLHNGEMEVQAAFGFVKNVRRYASIL
FT                   HARPMILWDGFSDKRRDFYPEYKANRDDDPDMKKMKEGFAIQKPYILKMMTALGVNQLI
FT                   AKDAEADDMAGMLVSRLAPQPTVDHIYLLTGDGDWLQLVRENVSWVSLREDAKHKQVNF
FT                   EQFAELTGLPTPRAFLEAKALQGDNSDNIKGVGGIGDGGAKELLHEWGSVAAMVRGIND
FT                   GSIVINKGRYKTAFNKLAKNAFNEKTGCRMLEAFKRNMMLMNLIDTKFPPSEIESIKGA
FT                   RDMNAFEQMCYELNFRSFLEDLEVFVLPFERYC"
FT                   /protein_id="NP_569482.1"
FT   misc_feature    complement(4319..5071)
FT                   /note="5'-3' exonuclease; T5 type 5'-3' exonuclease domains
FT                   may co-occur with DNA polymerase I (Pol I) domains, or be
FT                   part of Pol I containing complexes. They digest dsDNA and
FT                   ssDNA, releasing mono-,di- and tri-nucleotides, as well as
FT                   oligonucleotides, and...; Region: 53EXOc; cd00008"
FT                   /db_xref="CDD:28892"
FT                   /locus_tag="HCM2.0010c"
FT   misc_feature    complement(4238..5065)
FT                   /note="5'-3' exonuclease; Region: 53EXOc; smart00475"
FT                   /db_xref="CDD:128751"
FT                   /locus_tag="HCM2.0010c"
FT   misc_feature    complement(order(4667..4669,4742..4744,4748..4750,
FT                   4913..4915,5054..5056))
FT                   /note="metal binding site I; metal-binding site"
FT                   /db_xref="CDD:28892"
FT                   /locus_tag="HCM2.0010c"
FT   misc_feature    complement(order(4832..4834,4841..4843,4862..4900,
FT                   4901..4903))
FT                   /note="putative ssDNA interaction site; other site"
FT                   /db_xref="CDD:28892"
FT                   /locus_tag="HCM2.0010c"
FT   misc_feature    complement(order(4505..4507,4514..4516,4661..4663,
FT                   4667..4669))
FT                   /note="metal binding site II; metal-binding site"
FT                   /db_xref="CDD:28892"
FT                   /locus_tag="HCM2.0010c"
FT   RBS             complement(4138..4142)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   RBS             complement(5082..5087)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(5135..6163)
FT                   /db_xref="GeneID:1251399"
FT                   /locus_tag="HCM2.0011c"
FT   CDS_pept        complement(5135..6163)
FT                   /locus_tag="HCM2.0011c"
FT                   /gene_family="HOG000266910" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.52C, Yersinia
FT                   pestis CO-92 hypothetical protein; similar to
FT                   (EMBL:AF074611) Y1110, Yersinia pestis KIM5 putative
FT                   regulator"
FT                   /db_xref="GI:18466676"
FT                   /db_xref="GeneID:1251399"
FT                   /translation="MSKSLLDLLNKTRGDIASKRGNNVDLTRLKDGNNYLRIFPNKDDP
FT                   NGVFFQTFGMHYVKHQNEEGKDVTTAYICEQHTHGHACQLCEMVMEGRARFKDNKAMEE
FT                   RINSMRATPRYLVNGVLSAREDFADAEKCQLIELPSTVFDDICKVMSEDIADDIGNPLS
FT                   KEEGYAFLIKRTGSGRDTKYDVSPKRKVYKGDIPEKLWTTQHDLIAYANQADETRLLST
FT                   ARTMGRLIGIAAPAATMSSPAISSAAKSAAAELPGFGSITGHTEGAAAVATAHTPAPES
FT                   TSLVDEEILRAAEAEFKPETKPEEVKAPEAAAAASASASAAAASVPADEGLDDLLAELD
FT                   AL"
FT                   /protein_id="NP_569483.1"
FT   RBS             complement(6170..6175)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(6283..6714)
FT                   /db_xref="GeneID:1251400"
FT                   /locus_tag="HCM2.0012"
FT   CDS_pept        complement(6283..6714)
FT                   /locus_tag="HCM2.0012"
FT                   /gene_family="HOG000266911" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.53C, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1109, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466677"
FT                   /db_xref="GeneID:1251400"
FT                   /translation="MSTDIYEKIMSDLEFDRDNLEEVWRQQPRLLMEYGSKLARAEREV
FT                   ADAKLSLDAIEAKIYDNERKNLSMNGIKFNESVLEAKVRTNPQYLAKRQKLDDARHIAD
FT                   LYKHAVAAFSHRRDMIVQASKMAIVEIERLGAERFHSPR"
FT                   /protein_id="NP_569484.1"
FT   RBS             complement(6723..6726)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   RBS             6943..6947
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            6960..7550
FT                   /db_xref="GeneID:1251401"
FT                   /locus_tag="HCM2.0013"
FT   CDS_pept        6960..7550
FT                   /locus_tag="HCM2.0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="contains a possible membrane-spanning region; lies
FT                   within a region of low G+C composition relative to
FT                   surrounding sequence"
FT                   /db_xref="GI:18466678"
FT                   /db_xref="GeneID:1251401"
FT                   /translation="MFDIYNLLKQIEENTKPDNSAIWIAIISSISAIAGAAIGAFLLYR
FT                   GTNKQIKSAAATEDKKLKATIITAERLRWLQELRSRSSEFYANLDMNYSLLKRQINPQT
FT                   TPAYQQAGDELAKTVMIECNQIILLLNPKKHNQQTMRDKCNEALTFFQECVELRNRGSF
FT                   NFDDVKYAEIKSQYFNALTEIGIETWKQIKELS"
FT                   /protein_id="NP_569485.1"
FT   gene            complement(7644..8087)
FT                   /db_xref="GeneID:1251402"
FT                   /locus_tag="HCM2.0014c"
FT   CDS_pept        complement(7644..8087)
FT                   /locus_tag="HCM2.0014c"
FT                   /gene_family="HOG000266913" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.55C, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF053947) Y1107, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466679"
FT                   /db_xref="GeneID:1251402"
FT                   /translation="MNKENTMNEAQKIAQALAAIPADFQDKAVAATMRSQFWEIIDCPV
FT                   TLDLALAFAGLDGADRISRLRKCARALALKTQDPKACQYLLEIYESDNPDEQLEAFKVF
FT                   RNRLVLKVAKEFMEVNKIGDVRQYRLKRQTRVTLSNIFGKKVA"
FT                   /protein_id="NP_569486.1"
FT   gene            complement(8084..11602)
FT                   /db_xref="GeneID:1251403"
FT                   /locus_tag="HCM2.0015c"
FT   CDS_pept        complement(8084..11602)
FT                   /locus_tag="HCM2.0015c"
FT                   /gene_family="HOG000266914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA polymerase III alpha subunit"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AF062920) dnaE, Thermus aquaticus
FT                   DNA polymerase III; similar to (EMBL:AF074611) Y1106,
FT                   Yersinia pestis KIM5 putative DNA polymerase III , alpha
FT                   subunit from plasmid pMT1"
FT                   /db_xref="GI:18466680"
FT                   /db_xref="GeneID:1251403"
FT                   /translation="MKALMVRTDFSLGESALKAENAVKIARDAGYTAVISADSMNIASV
FT                   IPLQRAAGDDMAVICGVKLNVVDDPTYEHRAHLAKESGGCMESLVRDRSYCFTALIKNE
FT                   QGYRDVCELMTLANKREQFYFVPRLALDQLAAAYAKGNIILLTSDIGSVFQRRDFAKII
FT                   GTLVTAGGRDNFYSVVYPHPTPFYDQINVRAMKVASELKIEPVAFYPAYYEAVDDADIK
FT                   DIAHMVTNNIKIDQPHRLRIPHQRDNAVNGRRHLLEALKAFSVRMDVPVTAAMASTTQD
FT                   TIIEACTWRWHELPPALPKMADDEPATLMKLAVAGLRKRLTTKEFGYTPPASEHRVYVD
FT                   RLKYEMDTLTRLGFCGYFLMVRDLMNHSRETGIPVGPGRGSSAGSLVAWCIGITNVDPI
FT                   RHGLLFERFINPERLDLPDADLDFSQARRHEVIEYLNERYGEDYVAGIPNFTYLGAASA
FT                   LRDTARIYGVDAADMAVSKEFKNLEDDSLSLEELREQLASLDKYATKNPEAFKAACKLQ
FT                   SLMRGFGRHAAGMIVAGVPLVERTPVELRGNARCIAFDKRYCEAMGLIKLDVLGLATLD
FT                   LLDSAKRYIKESTGDDINLDAIPLDDRKVLDGFAAGYTQGVFQLESGPMRKLLKDLGGG
FT                   IEPMSFKTVVATTALFRPGPIQSGMLDDYVSVAKGFMAPQSLHPVLDELTAETNGVILY
FT                   QEQTMNATRLLAGFTMAEADGVRKAIGKKDMEKMKSMGEKFVVQAQAGWIDVEMEDGTT
FT                   QRIHRAEHFKCGDGALRTVEEALEAGVKLPMAAVRVTGSQPGLSETKAKEIWDAFEKNG
FT                   AYQFNKSHSVAYSLISYQSMWLKTHYPAEFFAAALTILGEDKHQGLVKDALTYGIRVLP
FT                   PDVNVSSNRIEIRTLEDGSQVLYAPFSAVKGCSENGCQAIMRAREKVGGKFESLEQFEE
FT                   AVEKRACNSRVRESLQKVGAFASIEPGSLPATDPERLRDQAELMGNLVIDAVKASRPFE
FT                   MNPKRSAEVNVLMTRMAAEMGLGDDLIRPSIGIKPKIMVILDHANGNDGRTGYFMENGY
FT                   DDFKAKLLTAGDLRMGDLYVTGVCKKVKDKEKDYTKDEIGQFTDFMREELNLVRPTYVL
FT                   TCGSRATSLFNNKSKPSDLVGRKEYLPELDVTVFYGFNPNILYFRPEEGEKLEAILAEV
FT                   AETISK"
FT                   /protein_id="NP_569487.1"
FT   misc_feature    complement(11399..11593)
FT                   /note="DNA polymerase alpha chain like domain; Region:
FT                   POLIIIAc; smart00481"
FT                   /db_xref="CDD:128757"
FT                   /locus_tag="HCM2.0015c"
FT   misc_feature    complement(<8672..11332)
FT                   /note="DNA polymerase III subunit alpha; Validated; Region:
FT                   dnaE; PRK07374"
FT                   /db_xref="CDD:168927"
FT                   /locus_tag="HCM2.0015c"
FT   misc_feature    complement(9380..10678)
FT                   /note="Bacterial DNA polymerase III alpha subunit; Region:
FT                   DNA_pol3_alpha; pfam07733"
FT                   /db_xref="CDD:149024"
FT                   /locus_tag="HCM2.0015c"
FT   misc_feature    complement(8102..8551)
FT                   /note="Uracil DNA glycosylase superfamily; Region: UDG;
FT                   cl00483"
FT                   /db_xref="CDD:186027"
FT                   /locus_tag="HCM2.0015c"
FT   RBS             complement(8099..8102)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(11783..13018)
FT                   /db_xref="GeneID:1251404"
FT                   /locus_tag="HCM2.0016c"
FT   CDS_pept        complement(11783..13018)
FT                   /locus_tag="HCM2.0016c"
FT                   /gene_family="HOG000266915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative porphyrin biosynthetic protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:M62869) cobS, Pseudomonas
FT                   denitrificans protein involved in cobalt
FT                   insertion-mediating reactions of cobalamin biosynthesis;
FT                   similar to (EMBL:AL117211) YPMT1.88, Yersinia pestis CO-92
FT                   putative porphyrin biosynthetic protein; similar to
FT                   (EMBL:AF053947) cobS, Yersinia pestis KIM5 cobS"
FT                   /db_xref="GI:18466681"
FT                   /db_xref="GeneID:1251404"
FT                   /translation="MTATALQQEEHLPEAIVCKWCGKSFHYLKSHISMGRCENIPESAK
FT                   GLDVDEVVKMYTSAFPDEPTISRTALAKLNEKRAEKHSGEGKVAEISAHPGYAGTVEYK
FT                   TELVAAHELLGVTIKELGTPRGKPLQVTVNVNTPYPEFVPEAKKNYVYGDFDLIKDIFM
FT                   MLEIGIPGYLWGHAGTGKSSLPTQLCALLNRPLIRAQHTASMEEAHVTGQILARDGSTY
FT                   FEPGLLALAMKNGWVYLADEYDFAFPQILGVYQPVLEGKPLIIKEATPDWRRITPHKRF
FT                   AFIGTGNTNGSGDETGLYQGTNIQNAANFSRFGIVSNVKYMSTKAEVNMLAEAGVIREY
FT                   AEKMVKFANLVREGYEQHLISQPIGPRELLLSAKIGMMRGDFSAGIEKSFINKLPSTSA
FT                   QAAREVVQKIFG"
FT                   /protein_id="NP_569488.1"
FT   misc_feature    complement(11786..>12496)
FT                   /note="cobaltochelatase, CobS subunit; Region: PD_CobS;
FT                   TIGR01650"
FT                   /db_xref="CDD:130711"
FT                   /locus_tag="HCM2.0016c"
FT   RBS             complement(13026..13031)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(13115..15277)
FT                   /db_xref="GeneID:1251405"
FT                   /locus_tag="HCM2.0017c"
FT   CDS_pept        complement(13115..15277)
FT                   /locus_tag="HCM2.0017c"
FT                   /gene_family="HOG000266904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:M62869) cobT, Pseudomonas
FT                   denitrificans protein involved in the transformation of
FT                   precorrin-3 into cobyrinic acid; similar to (EMBL:AL117211)
FT                   YPMT1.87, Yersinia pestis CO-92 putative porphyrin
FT                   biosynthetic protein from plasmid pMT1; similar to
FT                   (EMBL:AF074611) cobT, Yersinia pestis KIM5 putative
FT                   porphyrin biosynthetic enzyme from plasmid pMT1"
FT                   /db_xref="GI:18466682"
FT                   /db_xref="GeneID:1251405"
FT                   /translation="MSKAMTRSVLKEVQDFRDCVKRVVAMLSGKQIPVAERGNEAYVRY
FT                   NRRGEPVLVNIPSIPDDASPTLMNAVRGFLDHEVAHILFTDPKVAMKMREKGKAPSTGL
FT                   WNALEDVFIERRMGQVFNGTRRNLLATQNLVIDKYFKGKVSEAVSICHGNQRELFLKFF
FT                   LCPVVRAWDGQSPFIDFMEEHWHLIEKPVALLKEHGIDVAVRNMSNTEDCVKVAAAIAQ
FT                   IMQDMKDKPEGKLPELKSSARKPSKSEDESEEAPESGDKPTHSESAPKRAKGEDDDKEE
FT                   QEDDASEEEESGDSDLPESLNKDLPTEDKEVSDTESKYTEAGEVASEDTPESDDAADHT
FT                   DGEGKENEDAAEAPEDSESGFVPAPDEMTLEDALKALDEMEEETGEMTEDALSATISKE
FT                   LMSTSLSEYRPYDRSYDFIGLIDEAEEHVKRTRKTFGAIPMHSPVDRYRMVPEGRKLFE
FT                   LKIEKHLSAGVSSTLAKDLERAIASRNRVQFIPGQRRGRIHGANLYRLAMNDDRVFRKK
FT                   EDHRAVNACVQQVIDLSGSMGGRKIQLALASAYTIADALDRINVPNIITGFTTFGSPDY
FT                   ETMSKRGFTRFEALMLPIIKNWNEKANSPEIRARMGCVCETFPLLNNVDGESVAQLATL
FT                   FAGRMEDKKIMLVMSDGAPCAAGDGFHQHLRTVTKEIETLSEIDLMAIGVLTDAPRRYY
FT                   KNYALVNSVEELGPSVVTELSRIILG"
FT                   /protein_id="NP_569489.1"
FT   misc_feature    complement(14270..15265)
FT                   /note="Cobalamin biosynthesis protein CobT; Region: CobT;
FT                   pfam06213"
FT                   /db_xref="CDD:148051"
FT                   /locus_tag="HCM2.0017c"
FT   misc_feature    complement(13118..14929)
FT                   /note="Cobalamin biosynthesis protein CobT
FT                   (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole
FT                   phosphoribosyltransferase) [Coenzyme metabolism]; Region:
FT                   CobT; COG4547"
FT                   /db_xref="CDD:34192"
FT                   /locus_tag="HCM2.0017c"
FT   misc_feature    complement(13193..13705)
FT                   /note="Von Willebrand factor type A (vWA) domain was
FT                   originally found in the blood coagulation protein von
FT                   Willebrand factor (vWF). Typically, the vWA domain is made
FT                   up of approximately 200 amino acid residues folded into a
FT                   classic a/b para-rossmann type of...; Region: vWFA;
FT                   cl00057"
FT                   /db_xref="CDD:185787"
FT                   /locus_tag="HCM2.0017c"
FT   misc_feature    complement(order(13325..13327,13409..13411,13682..13684))
FT                   /note="metal ion-dependent adhesion site (MIDAS); other
FT                   site"
FT                   /db_xref="CDD:29222"
FT                   /locus_tag="HCM2.0017c"
FT   RBS             complement(15285..15289)
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(15387..15599)
FT                   /db_xref="GeneID:1251406"
FT                   /locus_tag="HCM2.0018c"
FT   CDS_pept        complement(15387..15599)
FT                   /locus_tag="HCM2.0018c"
FT                   /gene_family="HOG000266905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.86A, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466683"
FT                   /db_xref="GeneID:1251406"
FT                   /translation="MKNITSKLTALEVGHAYALGLDGVATILTELHAEELPIDLIDTTV
FT                   FKFELSNKHFTLINTGCGSLAVRTY"
FT                   /protein_id="NP_569490.1"
FT   gene            15861..16247
FT                   /db_xref="GeneID:1251407"
FT                   /locus_tag="HCM2.0019"
FT   CDS_pept        15861..16247
FT                   /locus_tag="HCM2.0019"
FT                   /gene_family="HOG000266906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AL117211) YPMT1.86C, Yersinia
FT                   pestis CO-92 hypothetical protein from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1102, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466684"
FT                   /db_xref="GeneID:1251407"
FT                   /translation="MATNETEIKQGRYAAYIDSLITISPKSQATIAKEVGYKNANNLSL
FT                   IKSGKIPLPVDKVRALAKALDADPVRLMLMVLEERHPELLEFFREEGTAPLSADEKLVL
FT                   EAFRNRFNGQQGASEKVVEAIKSL"
FT                   /protein_id="NP_569491.1"
FT   gene            complement(16239..17129)
FT                   /db_xref="GeneID:1251408"
FT                   /locus_tag="HCM2.0020c"
FT   CDS_pept        complement(16239..17129)
FT                   /locus_tag="HCM2.0020c"
FT                   /gene_family="HOG000266907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="similar to (EMBL:AF099172) int, Vibrio cholerae SXT
FT                   element integrase; similar to (EMBL:AL117211) YPMT1.85,
FT                   Yersinia pestis CO-92 putative integrase from plasmid pMT1;
FT                   similar to (EMBL:AF074611) Y1101, Yersinia pestis KIM5
FT                   hypothetical protein from plasmid pMT1"
FT                   /db_xref="GI:18466685"
FT                   /db_xref="GeneID:1251408"
FT                   /translation="MPHISEVKVSDISRVLVNQLVNPLILEGKIVQGRRVFSLMKQFLS
FT                   WCAFQGLIDTSPLNDMSLNRVAGGAKPVPRERKLTDAEVWVFWNVWDYFNVCEGTKWAA
FT                   RLCLVAARRPDEVLRARKDEFNLQRDVWNQGTRNKSARQHALPLSPLMRQCVEELFEYG
FT                   KGSQWLVPSNKKKGVDTPMSKVAIAQALRRILERPELMEVESFTPRDLRRTARSYFPAL
FT                   GINQEVARKIMNHSLEGIDRVYDRHDYMDEMRDALNNFSAYIASIVNQTDLDEIDHKFK
FT                   GDRLATELIRVNFSQ"
FT                   /protein_id="NP_569492.1"
FT   misc_feature    complement(16356..>17126)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="HCM2.0020c"
FT   misc_feature    complement(order(16398..16400,16503..16511,16713..16715,
FT                   16788..16793))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="HCM2.0020c"
FT   misc_feature    complement(order(16398..16400,16425..16427,16494..16496,
FT                   16503..16505,16713..16715,16791..16793))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="HCM2.0020c"
FT   misc_feature    complement(order(16398..16400,16425..16427,16494..16496,
FT                   16503..16505,16791..16793))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="HCM2.0020c"
FT   gene            17197..17385
FT                   /db_xref="GeneID:1251409"
FT                   /locus_tag="HCM2.0021"
FT   CDS_pept        17197..17385
FT                   /locus_tag="HCM2.0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:18466686"
FT                   /db_xref="GeneID:1251409"
FT                   /translation="MNNMKAEENDMSPSNLAVDIVDKPEARSRYSMASREVFSAARALS
FT                   KVFFIVHSLSEAFLLYV"
FT                   /protein_id="NP_569493.1"
FT   gene            17606..18097
FT                   /db_xref="GeneID:1251410"
FT                   /locus_tag="HCM2.0022"
FT   CDS_pept        17606..18097
FT                   /locus_tag="HCM2.0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:18466687"
FT                   /db_xref="GeneID:1251410"
FT                   /translation="MPGHSHDILHDELQGFDVFRYTDISFVFSGDATRQITFRLVFCKD
FT                   GEQGHQLHELYGEELATLTVSVVSFYNVEAENNEECDTMFDKPPGAPDLTAAEALYLYR
FT                   TLVDIILRIAETENIQILTFQAYSEELRRVYDRLVRKYATIKNLETHIEGACYVIRTEN
FT                   "
FT                   /protein_id="NP_569494.1"
FT   gene            complement(18262..18507)
FT                   /db_xref="GeneID:1251411"
FT                   /locus_tag="HCM2.0023c"