(data stored in ACNUC7421 zone)

HOGENOMDNA: SHEAM_1

ID   SHEAM_1; SV 1; empty ; DNA; empty ; PRO; 4306142 BP.
XX
AC   NC_008700;
XX
PR   Project: 58257;
XX
DE   Shewanella amazonensis SB2B, complete genome.
XX
OS   Shewanella amazonensis SB2B
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4306142
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Munk,A.C.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Gilna,P., Schmutz,J., Larimer,F.,
RA   Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Fredrickson,J. and
RA   Richardson,P.;
RT   "Complete sequence of Shewanella amazonensis SB2B";
RL   Unpublished
XX
RN   [2]
RP   1-4306142
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-DEC-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4306142
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Munk,A.C.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Gilna,P., Schmutz,J., Larimer,F.,
RA   Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Fredrickson,J. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (13-DEC-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000507.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  3634604
CC   Source DNA and bacteria available from Jim Fredrickson
CC   (Jim.fredrickson@pnl.gov)
CC   Contacts: Jim Fredrickson (Jim.fredrickson@pnl.gov)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4306142
FT                   /strain="SB2B"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella amazonensis SB2B"
FT                   /db_xref="taxon:326297"
FT   gene            complement(70..510)
FT                   /db_xref="GeneID:4606043"
FT                   /locus_tag="Sama_0001"
FT   CDS_pept        complement(70..510)
FT                   /locus_tag="Sama_0001"
FT                   /gene_family="HOG000030545" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavodoxin"
FT                   /transl_table="11"
FT                   /note="An electron-transfer protein; flavodoxin binds one
FT                   FMN molecule, which serves as a redox-active prosthetic
FT                   group"
FT                   /db_xref="GI:119773143"
FT                   /db_xref="GeneID:4606043"
FT                   /translation="MAKIEILIGTTLGGSEYVADELAAVLSDAGHECHSHLDPSLDSLD
FT                   TSALWLLVSATHGAGDLPDNLQPFAKSLMLTMPDLSTVRFALCAIGDSSYDTFCEGPEQ
FT                   LVELLSDAGAKPFVDKIRIDVQADPVPEEPAIQWLQQWIGKL"
FT                   /protein_id="YP_925883.1"
FT   misc_feature    complement(73..510)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Sama_0001"
FT   gene            657..1571
FT                   /db_xref="GeneID:4602259"
FT                   /locus_tag="Sama_0002"
FT   CDS_pept        657..1571
FT                   /locus_tag="Sama_0002"
FT                   /gene_family="HOG000275410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vpa:VP2298 hypothetical protein"
FT                   /db_xref="GI:119773144"
FT                   /db_xref="GeneID:4602259"
FT                   /translation="MTNKQKIVVWLSAALIALLIGLLMTVLVKIPDVPRVVLGESAMVL
FT                   THQGRCFYREDSGTALDDSPIDERGVIALLVWNIHKQSDGEWPKALWTQGLHWQLLLLQ
FT                   EVELNTDFTAALDNHQVSWSMMPAFRFQGLDYGVMLASRRPPLEGCGLLKVEPWIRLPK
FT                   AALYGLYALSNGEILLVVNLHGINFDPNLQEWEDQLAPLLGLVMQHRGPVILAGDFNSW
FT                   GERRSQKLEKLIEPLGLKAAIFEPDERIRVFGTPLDWVFYRGLHLKKAQSPTTNVSDHA
FT                   PLMVQFELISGSTSDDETPGVHR"
FT                   /protein_id="YP_925884.1"
FT   sig_peptide     657..743
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.726 at
FT                   residue 29"
FT                   /locus_tag="Sama_0002"
FT                   /product="hypothetical protein"
FT   misc_feature    759..1529
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:174238"
FT                   /locus_tag="Sama_0002"
FT   gene            complement(1522..2367)
FT                   /db_xref="GeneID:4602260"
FT                   /locus_tag="Sama_0003"
FT   CDS_pept        complement(1522..2367)
FT                   /locus_tag="Sama_0003"
FT                   /gene_family="HOG000263929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: sdn:Sden_3766 carboxylesterase"
FT                   /db_xref="GI:119773145"
FT                   /db_xref="GeneID:4602260"
FT                   /translation="MTLELVSANRSFDGWHKQYSHQSSSLDCKMRFAIFLPPQAETQSV
FT                   PVLYWLSGLTCSDENFMQKAGAQRLAATLGLAIVAMDTSPRGEGVADDPDGAWDFGLGA
FT                   GFYLNATEAPWNKHYRMYDYVVKELPKLIETNFPVSSKRSIAGHSMGGHGALTIALKNP
FT                   GRYASVSAFSPICNPSQSPWGQKAFGNYLGKDRESWREYDSCELIGRGAEPIPMLVDQG
FT                   DADSFLEAELMPQRLQHAADNADFPLNLRMQPGYDHSYYFIASFIDEHLEFHHHWLTRR
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_925885.1"
FT   misc_feature    complement(1546..2367)
FT                   /note="Predicted esterase [General function prediction
FT                   only]; Region: COG0627"
FT                   /db_xref="CDD:30972"
FT                   /locus_tag="Sama_0003"
FT   misc_feature    complement(1531..2361)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Sama_0003"
FT   gene            complement(2377..3510)
FT                   /db_xref="GeneID:4602261"
FT                   /locus_tag="Sama_0004"
FT   CDS_pept        complement(2377..3510)
FT                   /locus_tag="Sama_0004"
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase, zinc-binding"
FT                   /transl_table="11"
FT                   /note="KEGG: sdn:Sden_3767 alcohol dehydrogenase,
FT                   zinc-binding"
FT                   /db_xref="GI:119773146"
FT                   /db_xref="GeneID:4602261"
FT                   /translation="MSASFIKSRAAIAWGPGQPLSVEEVDVMLPKAGEVLVRIVATGVC
FT                   HTDAFTLSGDDPEGVFPAILGHEGGGIVEMVGEGVTSVAVGDHVIPLYTAECGKCKFCT
FT                   SGKTNLCSAVRATQGKGLMPDGTTRFYKDGEPIYHYMGCSTFSEYTVLPEISLAKVNPE
FT                   APLEEVCLLGCGVTTGMGAVLKTAKVKKGDTVAIFGLGGIGLSAVIGATMAGASRIIGI
FT                   DINDSKFELAKKLGATDCINPKDYDKPIQDVIVEMTDGGVDFSFECIGNVNVMRSALEC
FT                   CHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPGIVEQYLRGEF
FT                   ALSDFITHTMGLDAINEAFDLMHEGKSIRSVIHYDRK"
FT                   /protein_id="YP_925886.1"
FT   misc_feature    complement(2392..3495)
FT                   /note="class III alcohol dehydrogenases; Region:
FT                   alcohol_DH_class_III; cd08300"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Sama_0004"
FT   misc_feature    complement(2389..3492)
FT                   /note="S-(hydroxymethyl)glutathione dehydrogenase/class III
FT                   alcohol dehydrogenase; Region: adh_III_F_hyde; TIGR02818"
FT                   /db_xref="CDD:131865"
FT                   /locus_tag="Sama_0004"
FT   misc_feature    complement(order(2557..2559,2629..2631,2989..2991,
FT                   3229..3234,3310..3312,3337..3345,3370..3372,3376..3378))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Sama_0004"
FT   misc_feature    complement(order(2989..2991,3307..3312,3376..3378))
FT                   /note="catalytic Zn binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Sama_0004"
FT   misc_feature    complement(order(2404..2406,2554..2562,2632..2637,
FT                   2689..2694,2704..2709,2827..2829,2839..2844,2902..2916,
FT                   2977..2979,2989..2991,3370..3375))
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Sama_0004"
FT   misc_feature    complement(order(3178..3180,3202..3204,3211..3213,
FT                   3220..3222))
FT                   /note="structural Zn binding site; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Sama_0004"
FT   misc_feature    complement(order(2557..2574,2581..2589,2596..2619,
FT                   2626..2628,2653..2664,2683..2688,2719..2721,2734..2736,
FT                   3175..3177,3181..3183,3187..3192,3196..3198,3205..3210))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:176260"
FT                   /locus_tag="Sama_0004"
FT   gene            3686..4558
FT                   /db_xref="GeneID:4602262"
FT                   /locus_tag="Sama_0005"
FT   CDS_pept        3686..4558
FT                   /locus_tag="Sama_0005"
FT                   /gene_family="HOG000233519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR, substrate-binding"
FT                   /transl_table="11"
FT                   /note="KEGG: sdn:Sden_3768 LysR, substrate-binding"
FT                   /db_xref="GI:119773147"
FT                   /db_xref="GeneID:4602262"
FT                   /translation="MRWEGICEFVAVAEAQSFTAAAGRLGISTAQVSRQVRELEERLGS
FT                   KLLYRTTRKVSLTEDGQLFYRHCRQVLDGLDEAERAVSSLKSEPRGLIRMTAPVTYGEQ
FT                   YVMPIVLAYMQQFPQVEVQCELTNQQLDLVQGGFDLAIRLGVLPDSSMMARKLAERVQY
FT                   LVASPDYVSRHGAPHSLSELSRHQCLLGSLPFWRFQEEGKLRSLKVKGRLSCSSGNTLL
FT                   AAALAGMGIAQLPGYYVDEAIRDGRLLVLLKPFQEPKEGIWGLYPHNRQLSPKIGHLMN
FT                   MLADKLPKA"
FT                   /protein_id="YP_925887.1"
FT   misc_feature    3686..4552
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="Sama_0005"
FT   misc_feature    3710..3871
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Sama_0005"
FT   misc_feature    3956..4546
FT                   /note="The C-terminal substrate binding domain of an
FT                   uncharacterized LysR-type transcriptional regulator
FT                   CrgA-like, contains the type 2 periplasmic binding domain;
FT                   Region: PBP2_CrgA_like_1; cd08470"
FT                   /db_xref="CDD:176159"
FT                   /locus_tag="Sama_0005"
FT   misc_feature    order(3986..3988,3998..4000,4115..4117,4157..4159,
FT                   4163..4165,4337..4339,4388..4390,4469..4471)
FT                   /note="putative effector binding pocket; other site"
FT                   /db_xref="CDD:176159"
FT                   /locus_tag="Sama_0005"
FT   misc_feature    order(3989..3994,4004..4009,4013..4018,4025..4027,
FT                   4037..4039,4043..4063,4244..4246,4319..4333,4352..4357,
FT                   4364..4366)
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176159"
FT                   /locus_tag="Sama_0005"
FT   gene            4686..5186
FT                   /db_xref="GeneID:4602263"
FT                   /locus_tag="Sama_0006"
FT   CDS_pept        4686..5186
FT                   /locus_tag="Sama_0006"
FT                   /gene_family="HOG000001548" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO0302 hypothetical protein"
FT                   /db_xref="GI:119773148"
FT                   /db_xref="GeneID:4602263"
FT                   /translation="MKNFTAGLNNFWVGLVTGLLMPLIVVATLLYLTVDKLTGVVQDSA
FT                   ISPFLERSEQTLDKVDSLLVTLDSKVDSADLKDLELLTPLKNANILPDLQDIASAAAEL
FT                   KTKVNDIDRETVITALRHKLTTSLAGKFPEEKAQELAIHLESIARLLAQQSDEFEQNTP
FT                   VTQ"
FT                   /protein_id="YP_925888.1"
FT   sig_peptide     4686..4769
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.808 at
FT                   residue 28"
FT                   /locus_tag="Sama_0006"
FT                   /product="hypothetical protein"
FT   gene            5295..6401
FT                   /db_xref="GeneID:4602264"
FT                   /locus_tag="Sama_0007"
FT   CDS_pept        5295..6401
FT                   /locus_tag="Sama_0007"
FT                   /gene_family="HOG000116234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase, FAD/FMN-binding"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_3389 oxidoreductase, FAD/FMN-binding"
FT                   /db_xref="GI:119773149"
FT                   /db_xref="GeneID:4602264"
FT                   /translation="MRQALNSGFQFAKAGVRLKNRSVLAPLTHNMSDSHGNPSPAELDW
FT                   LEHCANGGFGLLIAAATQVWPGGRCWQGQPALMTDLQQQAYSRFAEATRAHGALALVQL
FT                   HHGGVRAAPALNGTAPVGPSSEAPDSRYPLGVTELDEDAIQQLIGAFVTAAERAYRAGL
FT                   DGVELHAAHYYLLCNFLNPVLNRRTDRWGGSVENRTRILIEIIRGIRQQLPRQFLVGVR
FT                   LSPENYANVVGIELQNQLAVANLLAAEDIDYVHFSMGDSFKLANGKNTALLSEVINALT
FT                   GKTTLMMAGNIRDGEAAERVLSAGADLVAIGTSALGNPDWIYKVTNGVPLVTPPFADTL
FT                   LQAHGFNEAGITYLGAVPGLVVISKPKT"
FT                   /protein_id="YP_925889.1"
FT   misc_feature    5337..6278
FT                   /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE
FT                   was the first flavin-dependent enzyme identified, however
FT                   its true physiological role remains elusive to this day.
FT                   Each monomer of OYE contains FMN as a non-covalently bound
FT                   cofactor, uses NADPH as...; Region: OYE_like_FMN_family;
FT                   cd02803"
FT                   /db_xref="CDD:73369"
FT                   /locus_tag="Sama_0007"
FT   misc_feature    order(5370..5372,5376..5378,5475..5477,5601..5603,
FT                   5814..5816,5958..5960,6228..6233)
FT                   /note="active site"
FT                   /db_xref="CDD:73369"
FT                   /locus_tag="Sama_0007"
FT   misc_feature    order(5370..5372,5376..5378,5475..5477,5601..5603,
FT                   5958..5960,6228..6233)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73369"
FT                   /locus_tag="Sama_0007"
FT   misc_feature    order(5808..5810,5814..5816)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73369"
FT                   /locus_tag="Sama_0007"
FT   misc_feature    5814..5816
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73369"
FT                   /locus_tag="Sama_0007"
FT   gene            complement(6502..7863)
FT                   /db_xref="GeneID:4602265"
FT                   /locus_tag="Sama_0008"