(data stored in ACNUC7421 zone)

HOGENOMDNA: SHEB2_2

ID   SHEB2_2; SV 1; empty ; DNA; empty ; PRO; 88311 BP.
XX
AC   NC_011664;
XX
PR   Project: 58775;
XX
DE   Shewanella baltica OS223 plasmid pS22301, complete sequence.
XX
OS   Shewanella baltica OS223
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-88311
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Meincke,L., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Brettar,I., Rodrigues,J., Konstantinidis,K. and
RA   Tiedje,J.;
RT   "Complete sequence of plasmid1 of Shewanella baltica OS223";
RL   Unpublished
XX
RN   [2]
RP   1-88311
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (06-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-88311
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Meincke,L., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Brettar,I., Rodrigues,J., Konstantinidis,K. and
RA   Tiedje,J.;
RT   "Direct Submission";
RL   Submitted (04-DEC-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001253.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003209
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..88311
FT                   /strain="OS223"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella baltica OS223"
FT                   /plasmid="pS22301"
FT                   /db_xref="taxon:407976"
FT   gene            254..874
FT                   /db_xref="GeneID:7090204"
FT                   /locus_tag="Sbal223_4329"
FT   CDS_pept        254..874
FT                   /locus_tag="Sbal223_4329"
FT                   /gene_family="HOG000245285" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PBPRC0031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRC0031 hypothetical protein"
FT                   /db_xref="GI:217975548"
FT                   /db_xref="GeneID:7090204"
FT                   /translation="MVKWLTISYFDMHSVNSSYDFCDVLDNALLHLYLSVAETERFTPK
FT                   AKRNDILIRYLKPMIKDKHYQQAKKEIRSLISLGRIASYDLESKIVGLYELSQRYDQQA
FT                   TKAKQLFDLLTFIEAELTLPTRFLNVRGNERKLPNTIYMLQEHIENGFTVSGEQVAPVS
FT                   LFLESDKVIDVVDLVNAKGLFLAEIQQHNVDEKQGHLMLHPKK"
FT                   /protein_id="YP_002360218.1"
FT   gene            967..1239
FT                   /db_xref="GeneID:7090205"
FT                   /locus_tag="Sbal223_4330"
FT   CDS_pept        967..1239
FT                   /locus_tag="Sbal223_4330"
FT                   /gene_family="HOG000000460" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SARI_00053"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ses:SARI_00053 hypothetical protein"
FT                   /db_xref="GI:217975549"
FT                   /db_xref="GeneID:7090205"
FT                   /translation="MIDLTAEQRHLAKIVHDYACRFPLTEEGDAQLLKSCYDYMDAFKR
FT                   VMDCASKVQMDYICLQYPGYFRFAKWMERLAQGIAVGVIDIPKDH"
FT                   /protein_id="YP_002360219.1"
FT   gene            1566..1808
FT                   /db_xref="GeneID:7090206"
FT                   /locus_tag="Sbal223_4331"
FT   CDS_pept        1566..1808
FT                   /locus_tag="Sbal223_4331"
FT                   /gene_family="HOG000008424" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /codon_start="1"
FT                   /product="bifunctional antitoxin/transcriptional repressor
FT                   RelB"
FT                   /transl_table="11"
FT                   /note="Qin prophage; bifunctional antitoxin of the
FT                   RelE-RelB toxin-antitoxin system/transcriptional repressor"
FT                   /db_xref="GI:217975550"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="GeneID:7090206"
FT                   /translation="MGTINIRIDDELKERSFAVLEKLGVSPSEALRQMLEYVATSGAMP
FT                   FKPVLLTAEDEALISLVKERLASPRKGIEVSLDDL"
FT                   /protein_id="YP_002360220.1"
FT   misc_feature    1566..1805
FT                   /note="RelB antitoxin; Region: RelB; cl01171"
FT                   /db_xref="CDD:186367"
FT                   /locus_tag="Sbal223_4331"
FT   gene            1798..2082
FT                   /db_xref="GeneID:7090207"
FT                   /locus_tag="Sbal223_4332"
FT   CDS_pept        1798..2082
FT                   /locus_tag="Sbal223_4332"
FT                   /gene_family="HOG000219994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /codon_start="1"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG:
FT                   ypi:YpsIP31758_2227 addiction module antitoxin"
FT                   /db_xref="GI:217975551"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR012753"
FT                   /db_xref="GeneID:7090207"
FT                   /translation="MIYKLVFDPRALKEWNKLGDPIRQQLKKKLAEILQHPHIGANKLR
FT                   DLPDCYKIKLRTSGYRLVYQVQDERITVFVVAVGKRERLAVYSTAEKRL"
FT                   /protein_id="YP_002360221.1"
FT   misc_feature    1798..2058
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Sbal223_4332"
FT   repeat_region   2201..3258
FT                   /mobile_element="insertion sequence:ISSod12"
FT   gene            2281..3204
FT                   /db_xref="GeneID:7090208"
FT                   /locus_tag="Sbal223_4333"
FT   CDS_pept        2281..3204
FT                   /locus_tag="Sbal223_4333"
FT                   /gene_family="HOG000231492" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   shm:Shewmr7_3098 transposase, IS4 family"
FT                   /db_xref="GI:217975552"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7090208"
FT                   /translation="MSKPRYKTTNWKQYNQALINRGSLTFWIDEDAIAKWKAKVEQPKK
FT                   GRPQVFSDLAITTALMVKRIFSMPLRALQGFINSVFKLGDIPLSCPHYTCISKRAKTVN
FT                   IAFKTKTRGAIEHLAIDSTGLKVYGEGEWKVKKHGTDGKRRVWRKLHIAVDTHSHEIIA
FT                   AELSLSGVTDAEVMPNLLKQTHRKIRNISGDGAYDTKACHEAVRRKRALVLIPPREGAA
FT                   LWEQGHPRNLAVSWQQLHGSNKQWKKRYGYHRRSISETAMYRIKQLLGGTLSMRNYNAQ
FT                   VGETYAMIRALNKLTGLGMPETHYVA"
FT                   /protein_id="YP_002360222.1"
FT   misc_feature    2614..3159
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Sbal223_4333"
FT   repeat_region   3327..4657
FT                   /mobile_element="insertion sequence:ISSba8"
FT   gene            3408..4436
FT                   /db_xref="GeneID:7090209"
FT                   /locus_tag="Sbal223_4334"
FT   CDS_pept        3408..4436
FT                   /locus_tag="Sbal223_4334"
FT                   /gene_family="HOG000255700" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /codon_start="1"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: ppr:PBPRB1640 hypothetical protein"
FT                   /db_xref="GI:217975553"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="GeneID:7090209"
FT                   /translation="MDIKVIGIDLAKNVFQVCVCLMDNSVMTNKKVNRNKLLDKIRQFP
FT                   EGSLIAMEACGTAHYWGRQFQALGYQVQLIPAQHVKPFVANQKNDANDALAICEAVFRP
FT                   NIHMVPVKTVEQQDIKALRCVRSRLVQNRTAMVNQIRSLASESGVIFSVGRLQLQASLS
FT                   RILANNEHELSHTLHYLLKLLYEDLCVLNERINQIERDIKALCQIQPRYNALLSIPGFG
FT                   PLVTASFMSELGSGHQFKNGRQLSAWCGLVPSQSSSGGKVRLGSITKNGSSELRVLLIH
FT                   GARAVGRFASKRDDRLGRWFNALALRQGRHKAVVALANKIARIGWRILTSNDNFDVNKA
FT                   FA"
FT                   /protein_id="YP_002360223.1"
FT   misc_feature    3417..4388
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3547"
FT                   /db_xref="CDD:33349"
FT                   /locus_tag="Sbal223_4334"
FT   misc_feature    3600..3860
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="Sbal223_4334"
FT   misc_feature    4041..4274
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="Sbal223_4334"
FT   repeat_region   complement(4658..5911)
FT                   /mobile_element="insertion sequence:ISSba5, truncated"
FT   gene            complement(4660..5837)
FT                   /db_xref="GeneID:7090210"
FT                   /locus_tag="Sbal223_4335"
FT                   /pseudo
FT   repeat_region   complement(5920..7002)
FT                   /mobile_element="insertion sequence:ISSba3, truncated"
FT   gene            complement(5920..6935)
FT                   /db_xref="GeneID:7090211"
FT                   /locus_tag="Sbal223_4336"
FT                   /pseudo
FT   gene            7004..7234
FT                   /db_xref="GeneID:7090212"
FT                   /locus_tag="Sbal223_4337"
FT                   /pseudo
FT   gene            7508..8380
FT                   /db_xref="GeneID:7090213"
FT                   /locus_tag="Sbal223_4338"
FT   CDS_pept        7508..8380
FT                   /locus_tag="Sbal223_4338"
FT                   /gene_family="HOG000114768" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   pin:Ping_1815 integrase, catalytic region"
FT                   /db_xref="GI:217975554"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:7090213"
FT                   /translation="MQAATISREFSRNTGKRGYRFKQAQTSTIRRRLAACKAIKMTTTT
FT                   VELIESKINAKWSPEQVSGWLREDQCIDISYETIYKHIWSDKQNGGHLFQQLRRKGKAY
FT                   QSRSKDKQAGRGFIKNRISIDERPHVVDDKSRVGDWEIDLVIGKGHSGALVTIVERKTS
FT                   FTVSTRVDDKSAKTVTAATIALLAPFKGAVLTITADNGKEFAYHEKMTESLKCDVYFAD
FT                   PYCSWQRGLNENTNGLLRQYWPKSTDFKKVSQSEVQDVIANLNDRPRKKLNYKTPAKLM
FT                   AEHMVAIAA"
FT                   /protein_id="YP_002360224.1"
FT   misc_feature    7520..8365
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="Sbal223_4338"
FT   misc_feature    7919..8236
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal223_4338"
FT   gene            8517..10472
FT                   /db_xref="GeneID:7090214"
FT                   /locus_tag="Sbal223_4339"
FT   CDS_pept        8517..10472
FT                   /locus_tag="Sbal223_4339"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975555"
FT                   /db_xref="GeneID:7090214"
FT                   /translation="MVASAHASAIQLNSPRYPEIESGLNYYTSESANVLTKPLTSLDIY
FT                   NKETNEIERLSHDGFSINGITVATEGSSVIISNNTPRHFTEIAITDDINGFLIDEELKP
FT                   FTSLTFESNLASGELHFMDPNTQFRSSPSKFEGSATHPDIESYNLFLSHLKQFYSKPST
FT                   ETDFFDFFENRGESSSEILRKWNKTLSYDVPKTYRVNVSNSAGVASDSWLSINWPMAKF
FT                   NNDREYIYPYVVFSHENAHTQGFNHSSGLAYGWDDYVSAGIKELFESDDVIPGIVAEES
FT                   SEIYANYNLKNQSLVLFSNSVQNVDSISAIGDMDTLRFSGVSDNKYLIEMGRKSLSATT
FT                   FNITYDGDKKFTYIVDDVYGEKIQSERDPYYLKPDEKLSYHFETTGKIIYYIPEQDNVL
FT                   AHDTASQRSEAVWSGPATPTNITIRIKNTSDGKYYSLDLSAEKGGRHQMHQGAYSSILY
FT                   ISKQEGSYNQLPDGDYTSSFEVVAAGWHNQSYQKSFEVKVEFSKFETEVDRLWLDDWSD
FT                   NYSKETPSGNSSVYFYVPENDNVISSTGPRKASKAVWSGQAGVTSVVVNVTGEDGKTYP
FT                   VNLIGNKEFRGLAIKMEDGVQRGYGKLRFKIDTTSDTYNDLPEGMHYRANFNVVAKGWH
FT                   DTSFSESVLINVEFKK"
FT                   /protein_id="YP_002360225.1"
FT   repeat_region   10540..11174
FT                   /mobile_element="insertion sequence:ISSba5, truncated"
FT   gene            10614..11173
FT                   /db_xref="GeneID:7090215"
FT                   /locus_tag="Sbal223_4340"
FT                   /pseudo
FT   repeat_region   11252..12081
FT                   /mobile_element="insertion sequence:ISSba18"
FT   gene            11326..12018
FT                   /db_xref="GeneID:7090216"
FT                   /locus_tag="Sbal223_4341"
FT   CDS_pept        11326..12018
FT                   /locus_tag="Sbal223_4341"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG3316"
FT                   /codon_start="1"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shw:Sputw3181_1020 ISSod8, transposase"
FT                   /db_xref="GI:217975556"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:7090216"
FT                   /translation="MTINFSGRHYPPDIIMMALRYYLAYKLSYREIEEIFAERHIHFDH
FT                   STLNRWVIKYAPQLDAIFRNKKRRVSGSWRMDETYIKVKGRWVYYYRAVDKYGTIIDFY
FT                   LSETRDESAAQAFFNKAINQHGLPEKVVIDKSSANAAALDTVNLRLWLSGNMLFMIEVL
FT                   AIKYLNNIVEQSHRKVKGKMHQCLGWKSWLGAEATLAGIEVCDMIKKGQMMSAENMTPW
FT                   EQFYALAA"
FT                   /protein_id="YP_002360226.1"
FT   misc_feature    11338..11961
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal223_4341"
FT   gene            12180..13043
FT                   /db_xref="GeneID:7090217"
FT                   /locus_tag="Sbal223_4342"
FT   CDS_pept        12180..13043
FT                   /locus_tag="Sbal223_4342"
FT                   /gene_family="HOG000009686" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Swoo_4101"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: swd:Swoo_4101 hypothetical protein"
FT                   /db_xref="GI:217975557"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="GeneID:7090217"
FT                   /translation="MNKTRVLCATAMLFPLLVNAGMTQDASHSVSDKVIENQRTSLASN
FT                   TLGKGYGPQSPRDIDSIQGNNKRIFSEAPDYMEMNLCNIHFHKNAEHKGGEFTKYAGNG
FT                   DGHGYQTGYQYTGKLSKKELSPLKHEVGASQHGSLHPGDTIEVHYVHSTAKVSPGPTLG
FT                   ACLSKANSNPQLRVETQVFVLVNDAKAMSFMELTKLGIKNGFNQALNIPNNTGEPVEYE
FT                   GSTTGPGYNEIASPLQVSWSVRPKVMKVDINSVGQWLEGNVFDEDHAHGVRNLVINPDL
FT                   LSAESD"
FT                   /protein_id="YP_002360227.1"
FT   sig_peptide     12180..12242
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 21"
FT                   /locus_tag="Sbal223_4342"
FT   gene            13277..13885
FT                   /db_xref="GeneID:7090218"
FT                   /locus_tag="Sbal223_4343"
FT   CDS_pept        13277..13885
FT                   /locus_tag="Sbal223_4343"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; KEGG: vfi:VFB15
FT                   resolvease/recombinase"
FT                   /db_xref="GI:217975558"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="GeneID:7090218"
FT                   /translation="MRIYGYLRASTAEQDASRAKEQLSDFAKQMDLNIACWFEENESGA
FT                   SLKRPELFRLLDVAQPGDVLLVEQVDRISRLDSHDWETLKSLINQKRIKVVSIDLPTSY
FT                   QFMKNTDTFTERMMSALNSMMLDMLAAVARKDYEDRRRRQAQGVQRAKLAGKYKGRPED
FT                   KVLHQKIEGLLIDGKSYNYIVDLLGCSRHTISKVKKRLT"
FT                   /protein_id="YP_002360228.1"
FT   misc_feature    13277..13879
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="Sbal223_4343"
FT   misc_feature    13283..13693
FT                   /note="Serine recombinase (SR) family, Partitioning
FT                   (par)-Resolvase subfamily, catalytic domain; Serine
FT                   recombinases catalyze site-specific recombination of DNA
FT                   molecules by a concerted, four-strand cleavage and
FT                   rejoining mechanism which involves a transient...; Region:
FT                   SR_Res_par; cd03767"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4343"
FT   misc_feature    order(13298..13300,13304..13306,13487..13492,13499..13501)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4343"
FT   misc_feature    13304..13306
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4343"
FT   gene            13952..14251
FT                   /db_xref="GeneID:7090219"
FT                   /locus_tag="Sbal223_4344"
FT   CDS_pept        13952..14251
FT                   /locus_tag="Sbal223_4344"
FT                   /gene_family="HOG000000461" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975559"
FT                   /db_xref="GeneID:7090219"
FT                   /translation="MANEAPSLSIEDECVLASREHQRMFTSRHPCDGCDSQTPKRYAIS
FT                   GKCISCQAAGKRPSTDKRNYWNPGYHDLKMHNEIKHISLMLDILSERQRIKISS"
FT                   /protein_id="YP_002360229.1"
FT   repeat_region   complement(14405..15233)
FT                   /mobile_element="insertion sequence:ISSba18"
FT   gene            complement(14468..15160)
FT                   /db_xref="GeneID:7090220"
FT                   /locus_tag="Sbal223_4345"
FT   CDS_pept        complement(14468..15160)
FT                   /locus_tag="Sbal223_4345"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG3316"
FT                   /codon_start="1"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shw:Sputw3181_1020 ISSod8, transposase"
FT                   /db_xref="GI:217975560"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:7090220"
FT                   /translation="MTINFSGRHYPPDIIMMALRYYLAYKLSYREIEEIFAERHIHFDH
FT                   STLNRWVIKYAPQLDAIFRNKKRRVSGSWRMDETYIKVKGRWVYYYRAVDKYGTIIDFY
FT                   LSETRDESAAQAFFNKAINQHGLPEKVVIDKSSANAAALDTVNLRLWLSGNMLFMIEVL
FT                   AIKYLNNIVEQSHRKVKGKMHQCLGWKSWLGAEATLAGIEVCDMIKKGQMMSAENMTPW
FT                   EQFYALAA"
FT                   /protein_id="YP_002360230.1"
FT   misc_feature    complement(14525..15148)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal223_4345"
FT   gene            15444..15611
FT                   /db_xref="GeneID:7090221"
FT                   /locus_tag="Sbal223_4346"
FT   CDS_pept        15444..15611
FT                   /locus_tag="Sbal223_4346"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975561"
FT                   /db_xref="GeneID:7090221"
FT                   /translation="MTYFLRNKALENFSQMFTLTGESFEYAGTLWGKSALARSQRKIAV
FT                   FSRVNQTRQV"
FT                   /protein_id="YP_002360231.1"
FT   gene            complement(15638..15784)
FT                   /db_xref="GeneID:7090222"
FT                   /locus_tag="Sbal223_4347"
FT   CDS_pept        complement(15638..15784)
FT                   /locus_tag="Sbal223_4347"
FT                   /gene_family="HOG000027781" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975562"
FT                   /db_xref="GeneID:7090222"
FT                   /translation="MSQIQYNEIGKIRLIDIPQLPAGLLIKWLATRPIWMQERVIKQLT
FT                   LIH"
FT                   /protein_id="YP_002360232.1"
FT   gene            complement(15910..16269)
FT                   /db_xref="GeneID:7090223"
FT                   /locus_tag="Sbal223_4348"
FT   CDS_pept        complement(15910..16269)
FT                   /locus_tag="Sbal223_4348"
FT                   /gene_family="HOG000027782" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0062"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0062 hypothetical protein"
FT                   /db_xref="GI:217975563"
FT                   /db_xref="GeneID:7090223"
FT                   /translation="MDNPRTKIVIDESDDDISLFKVLAATSSKAQPLTERQLKEVEAQS
FT                   ETLGFTRREKRKRSPYVIQKNIKIRVGMDELLSELGEAVGSKSDQETFDIAITKLVESI
FT                   GSVRLSSMLNEISKR"
FT                   /protein_id="YP_002360233.1"
FT   misc_feature    complement(<16006..>16182)
FT                   /note="UvrD/REP helicase; Region: UvrD-helicase; cl14126"
FT                   /db_xref="CDD:175496"
FT                   /locus_tag="Sbal223_4348"
FT   gene            complement(16262..16948)
FT                   /db_xref="GeneID:7090224"
FT                   /locus_tag="Sbal223_4349"
FT   CDS_pept        complement(16262..16948)
FT                   /locus_tag="Sbal223_4349"
FT                   /gene_family="HOG000226571" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0061"
FT                   /codon_start="1"
FT                   /product="ParA protein, putative"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0061 ParA protein, putative"
FT                   /db_xref="GI:217975564"
FT                   /db_xref="GeneID:7090224"
FT                   /translation="MTVIAFAQSKGGAGKTTACVTLAGELCRQASESGIKITLIDTDPN
FT                   QHSAGWAKKNGCPSNLVLIEKSTEDTVLDDIETASSQTQFVLVDLEGTANFAVTQAISR
FT                   ADLVIVPCQGSEDDASEAARTIGLIRKQGRLLGRKIPCCILLTRTSAAIQTRLLKLIKQ
FT                   DFIESGVHILNSSLIDREAFRAVRSYGGTVNNLDPALVSGTDKAAINAKAYANDVKRML
FT                   LEVNNG"
FT                   /protein_id="YP_002360234.1"
FT   misc_feature    complement(16268..16948)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Sbal223_4349"
FT   misc_feature    complement(16508..16942)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4349"
FT   misc_feature    complement(16901..16921)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4349"
FT   misc_feature    complement(order(16682..16684,16901..16903))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4349"
FT   gene            17335..17504
FT                   /db_xref="GeneID:7090225"
FT                   /locus_tag="Sbal223_4350"
FT                   /pseudo
FT   gene            complement(18333..20990)
FT                   /db_xref="GeneID:7090138"
FT                   /locus_tag="Sbal223_4351"
FT   CDS_pept        complement(18333..20990)
FT                   /locus_tag="Sbal223_4351"
FT                   /gene_family="HOG000272937" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ECH74115_B0001"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ecf:ECH74115_B0001 hypothetical protein"
FT                   /db_xref="GI:217975565"
FT                   /db_xref="GeneID:7090138"
FT                   /translation="MKRNYISCLIAASIAATALSVSAKQISPLIFNSSAPQNDLVGSLS
FT                   ARVQFAQSQIIPASPKEGERQPTLTSLRKSLLLVQPLQADGVTPMVVEARDASGKLLGT
FT                   LTLSPPSALPETVYHLAGVPEGGVSFVPESGPTAVISSSADLAKLSDKSGAFLKDRLTG
FT                   RALVEIQTADGRWVRDIYLPVSPELEGKMVRLRSSAGYNSTIFYGERQVTVARGQTLQF
FT                   KFAKGQWFREGELENNRITYAPDTWSGELPAGWIQPGLNLSVRQGNFSGELRDIKVGAP
FT                   GELLLHTIDIGMLITPRDRFAFANDKEAHREYFQTIPASRMIVNQYAALYLPEVMLPNG
FT                   TLLTDFDPSEGGWHSGTMRQRIGKELISHGIDNANYGINSSAGEGEGSHPFVVAQLAAH
FT                   NSRGKYANGVQVHGGSGGGGIVTLDASLGNEFSHEVGHNYGLGHYVDGFSGSVHRSAEQ
FT                   LNSSWGWDSDKRRFIPNFSPTRTNEDACLDGQCQPPFDGRKFGFDAMAGGSPLSGANRF
FT                   TLYTPNSAAIIQRFFESKAVFDANSATGFSKWSSATARMEPYQHTIEGIEKIDAPMDAL
FT                   SEAGLSALLADYGLVRVAMWDGRWTRDIRVPVASADNRGRSLTIDHGAGYNSRLFINGK
FT                   EIVVNRGFKKSFTSDGQSWVEVSPIDTKVARKPEQFGVPVTTLVGYYDPQGSLPSYIYP
FT                   ALHGAYGFTYPDDSNTLSGNDCQLQVETRDGLQRFTLANHRAASTVMNKFHINIPTDLK
FT                   PSQAAVVCNNRTIAEKTLSSAPTDISFSVYGKALPAKANEGCIVSNTTGAQYCLPVGSR
FT                   SGYSLPNWIIGQEVHVDAGLNAKVLLSDWDNLSYNRIGEFVGSVGTNEMKKVKAWNGQY
FT                   LDFSRPRSMRVVSN"
FT                   /protein_id="YP_002360235.1"
FT   sig_peptide     complement(20919..20990)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 24"
FT                   /locus_tag="Sbal223_4351"
FT   misc_feature    complement(19380..20285)
FT                   /note="Peptidase M66; Region: Peptidase_M66; pfam10462"
FT                   /db_xref="CDD:151034"
FT                   /locus_tag="Sbal223_4351"
FT   gene            21272..21832
FT                   /db_xref="GeneID:7090139"
FT                   /locus_tag="Sbal223_4352"
FT   CDS_pept        21272..21832
FT                   /locus_tag="Sbal223_4352"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: rme:Rmet_4599 resolvase-like protein"
FT                   /db_xref="GI:217975566"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:7090139"
FT                   /translation="MQGQRIGYIRVSSFDQNPERQLEHIQVDKVFTDKASGKDTQRPQL
FT                   EALLSFVREGDTVVVHSMDRLARNLDDLRRLVQGLTQRSVCIEFVKEHLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKSLSDPEIAEVRRRVVAGEK
FT                   KATLAREFGISRETLYQYLRVPE"
FT                   /protein_id="YP_002360236.1"
FT   misc_feature    21284..21658
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    21287..21820
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:184041"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21299..21301,21305..21307,21461..21466,21473..21475)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    21305..21307
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21458..21460,21599..21604,21608..21613,21623..21625)
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21476..21478,21491..21496,21587..21589,21596..21601,
FT                   21608..21613,21620..21622,21629..21631)
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21545..21553,21587..21592,21599..21604,21611..21613,
FT                   21623..21625,21632..21634,21644..21646)
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21545..21547,21602..21604,21611..21613,21623..21625,
FT                   21632..21634,21644..21646)
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21626..21628,21644..21649)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    21692..21817
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Sbal223_4352"
FT   misc_feature    order(21695..21703,21797..21802,21806..21814)
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Sbal223_4352"
FT   gene            21836..24868
FT                   /db_xref="GeneID:7090140"
FT                   /locus_tag="Sbal223_4353"
FT   CDS_pept        21836..24868
FT                   /locus_tag="Sbal223_4353"
FT                   /gene_family="HOG000156427" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   pap:PSPA7_5340 transposase"
FT                   /db_xref="GI:217975567"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:7090140"
FT                   /translation="MAIARSERLTVLSDAEQEALYGLPDFDDAQRLEYLALTENELALA
FT                   SSRPSIHAQLYCILQIGYFKAKNDFFRFHWRDVEDDCAFVLSRYFQGEAFEAKQISKHE
FT                   HYSQRGKIAALFGYQPWASSYLPSLEQQASLIVRRDVTPSFVAAELIVWLNEHKIIRPG
FT                   YTTLQALVSEVLSVERRRLGALLAQVLDEPAKTALSQLLVRDDTLSQLAALKQDAKDFG
FT                   WRQMAREREKRALLAPLHEIAKGLLPKLGISQQNLLYYASLANFYTVHDLRNLKAEQTQ
FT                   LYLLCYAWVRYRQLSDNLVDAMAFHMDQLDHENRAGARDTFAEEQVKRHQETPQVGRLL
FT                   SLYVDDSVADPTPFGEVRQRAYKIMAKDVLQNTAQRMSVKPLNKLTLHWQAVDGQAKRI
FT                   RRHLRPLFVALQFAATDPDSQWLAALTWAKSVFAKQQRLSQRPLAECPVATLPKRLRPY
FT                   LLTFDADGEPTGLHADRYEFWLYHQVKKRFQSGELYLDDSLQHRHFSDELVSMEEHAQE
FT                   LAQMDIPFLRQPIETQLDVLATELHRQWQAFNRELKQGKLTHLEYDKDAQKLTWRKPKR
FT                   ENQKAREHTFYEQLPYCDVADVFRFVNNQCQFLSALTPLQPRYAKKVADTDSLIAVIIA
FT                   QAMNHGNLVMARTSDIPYHILESAYQQYLRQASLHEANDFISNAIAALPIFPYYSFDLD
FT                   VLYGAVDGQKFSVERPTVKARYSRKYFGRGKGVVAYTLLCNHIPLNGYLIGAHDYEAHH
FT                   VFDIWYRNTSDIVPEVITGDMHSINKANFAILHWFGRRFEPRYTDLNHQLQALYCVGDP
FT                   ARYEKCLIQPVGQIDRQLIVSEKANIDRIIATLGLKEMTQGTLIRKLCTYTAPNPTRRA
FT                   IFEFDKLVRSIYTLRYLRDPQLERNVHRSQNRIESYHQLRSSIAQVGGKKELTGRTDIE
FT                   IEISNQCARLIANAVIYYNSAILSRLLTKCEAAGNAKAISALTQISPAAWRHILLNGHY
FT                   TFQSDGKVIDLDTLVAGVELV"
FT                   /protein_id="YP_002360237.1"
FT   misc_feature    21869..24802
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Sbal223_4353"
FT   misc_feature    23765..24712
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Sbal223_4353"
FT   gene            complement(24902..25078)
FT                   /db_xref="GeneID:7090141"
FT                   /locus_tag="Sbal223_4354"
FT                   /pseudo
FT   gene            25321..25923
FT                   /db_xref="GeneID:7090142"
FT                   /locus_tag="Sbal223_4355"
FT   CDS_pept        25321..25923
FT                   /locus_tag="Sbal223_4355"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; KEGG: son:SO_A0026 resolvase
FT                   family site-specific recombinase"
FT                   /db_xref="GI:217975568"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="GeneID:7090142"
FT                   /translation="MFIRAYLRASTDEQDANRARNELVQFSDSKNVRIASFYTETQSGA
FT                   KIERPELGRLIMDSHPGDVLLIEKVDRLSRLPFEQWKVLKSKLVKANIHIVVVDQPMTH
FT                   GILSGTEEHTMIAKVLTEFMIDLAAAMARDDYETRRKRQAQGIEKAKTLGKYLGRQPDH
FT                   GLRQNIRLLLDEGKSWSQVQSLLKCSRSTISKAAKLG"
FT                   /protein_id="YP_002360238.1"
FT   misc_feature    25327..25914
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:184041"
FT                   /locus_tag="Sbal223_4355"
FT   misc_feature    25327..25758
FT                   /note="Serine recombinase (SR) family, Partitioning
FT                   (par)-Resolvase subfamily, catalytic domain; Serine
FT                   recombinases catalyze site-specific recombination of DNA
FT                   molecules by a concerted, four-strand cleavage and
FT                   rejoining mechanism which involves a transient...; Region:
FT                   SR_Res_par; cd03767"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4355"
FT   misc_feature    order(25342..25344,25348..25350,25531..25536,25543..25545)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4355"
FT   misc_feature    25348..25350
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4355"
FT   gene            26272..26979
FT                   /db_xref="GeneID:7090143"
FT                   /locus_tag="Sbal223_4356"
FT   CDS_pept        26272..26979
FT                   /locus_tag="Sbal223_4356"
FT                   /gene_family="HOG000070400" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PMI1582"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pmr:PMI1582 hypothetical protein"
FT                   /db_xref="GI:217975569"
FT                   /db_xref="GeneID:7090143"
FT                   /translation="MATEKRTNGDSIHEQLNQLEMQGRVPSDMSKKSTQQMRWQWDEYP
FT                   SGVHYGAPMDPEPLGRYNDPTGRTGICYAADNAAAAIAESLGRVYQRDPDNFTLGLSDL
FT                   HKAQMYTLETTRDTRTINMTKLQAMLHITADQTMSNRQDITQAITDWAANTPGLQYDGV
FT                   SYSSRHYGVGMCTAFWKREGETGPLADVTHSSVHSHVDSNPDNFPQNWQEKDIDGFEIV
FT                   VETLRFDVSADNS"
FT                   /protein_id="YP_002360239.1"
FT   gene            complement(27003..27632)
FT                   /db_xref="GeneID:7090144"
FT                   /locus_tag="Sbal223_4357"
FT   CDS_pept        complement(27003..27632)
FT                   /locus_tag="Sbal223_4357"
FT                   /gene_family="HOG000070401" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PMI1583"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pmr:PMI1583 hypothetical protein"
FT                   /db_xref="GI:217975570"
FT                   /db_xref="GeneID:7090144"
FT                   /translation="MNSTIQKECRKPQSASQMAVFDRLSNLTVELVAKLAEKKQLTIAR
FT                   NMTDNELAKLFFETQLDRSSEMSPREKRKMDHLNESAVKFAERLKRLGGTCRASKAADI
FT                   LGVKRQTINNRLKAKKLLAVQVGGESKFPTFQFDGNLMVDGLEEVLLLLGDFSPVTKTS
FT                   FLTAMYFFDDEENLNIIDALKKYGTAGEHMKEIRKQAALFGHQASH"
FT                   /protein_id="YP_002360240.1"
FT   gene            complement(28212..28886)
FT                   /db_xref="GeneID:7090145"
FT                   /locus_tag="Sbal223_4358"
FT   CDS_pept        complement(28212..28886)
FT                   /locus_tag="Sbal223_4358"
FT                   /gene_family="HOG000288218" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Shewana3_0879"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shn:Shewana3_0879 hypothetical protein"
FT                   /db_xref="GI:217975571"
FT                   /db_xref="GeneID:7090145"
FT                   /translation="MQQLKFGKIKNYKDDRGFGFIFSECKFIHHAIMGSKEVFFHIKQA
FT                   KKFESTLKSATPQEDLCFWLTTETTRKGGAVKQMWIKLSDIPQDIREGNAEFIKQVAEN
FT                   IKIYEAAKAEKRAREAEERIQQEALRKVRDSELNALIVAARSQGFSTSGQLSAWIRANK
FT                   LWTKYPTLTGDLTMHDGEVSWNFGAAIDPQYYRQVCQALGLHNAGSNARAGAFRSYASM
FT                   ER"
FT                   /protein_id="YP_002360241.1"
FT   misc_feature    complement(<28758..28868)
FT                   /note="S1_like: Ribosomal protein S1-like RNA-binding
FT                   domain. Found in a wide variety of RNA-associated proteins.
FT                   Originally identified in S1 ribosomal protein. This
FT                   superfamily also contains the Cold Shock Domain (CSD),
FT                   which is a homolog of the S1 domain...; Region: S1_like;
FT                   cl09927"
FT                   /db_xref="CDD:186872"
FT                   /locus_tag="Sbal223_4358"
FT   misc_feature    complement(order(28764..28766,28770..28772,28827..28829,
FT                   28857..28859))
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88416"
FT                   /locus_tag="Sbal223_4358"
FT   gene            complement(29061..29834)
FT                   /db_xref="GeneID:7090146"
FT                   /locus_tag="Sbal223_4359"
FT   CDS_pept        complement(29061..29834)
FT                   /locus_tag="Sbal223_4359"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpd:RPD_2297 hypothetical protein"
FT                   /db_xref="GI:217975572"
FT                   /db_xref="GeneID:7090146"
FT                   /translation="MTKDKYQISTKAQYINLLLLKDDLEYFDRVLSGVISGPENWLAKL
FT                   RATRSVFLTLNNVKDAVDRIQLRGEDEFIAKTRKLRKDLIFANHFRNRGIGHLNDTLLK
FT                   RAVQWSPQIFYESSKDNLVFQVIEAQRAIIESCINSFIDKDGVQKVFGTEIDLMYPPNA
FT                   KEFFSYLSEMVNSAIDWLSEGTSILLDSIDPHSDEEIQELAAIAGQTNFDLNADSDLEF
FT                   SVEEMRKKFSYAMEALEQQGAKPEILEFLRDRIQI"
FT                   /protein_id="YP_002360242.1"
FT   gene            complement(30450..31013)
FT                   /db_xref="GeneID:7090147"
FT                   /locus_tag="Sbal223_4360"
FT   CDS_pept        complement(30450..31013)
FT                   /locus_tag="Sbal223_4360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975573"
FT                   /db_xref="GeneID:7090147"
FT                   /translation="MDITGLSEEEKGKLAYFYRLVMSYSDFKHAHRCAMYSLEQHEQLE
FT                   KKGGDDLILRALYCSMVVSYSRPFNSYGKSNIGEIPPLKNEIESAFTEQELKAHKYLRW
FT                   CRNKYLAHSDAKEIALTPFVTSDLSNKLVMPSKVDALAPFTREYTELVLELLEKTYRWC
FT                   VEERHRIEPEIVAWLPIEQWGAEG"
FT                   /protein_id="YP_002360243.1"
FT   misc_feature    complement(30468..>30830)
FT                   /note="DNA topoisomerase VI, subunit B [DNA replication,
FT                   recombination, and repair]; Region: COG1389"
FT                   /db_xref="CDD:31579"
FT                   /locus_tag="Sbal223_4360"
FT   misc_feature    complement(30705..>30830)
FT                   /note="MutL_Trans: transducer domain, having a ribosomal S5
FT                   domain 2-like fold, conserved in the C-terminal domain of
FT                   type II DNA topoisomerases (Topo II) and DNA mismatch
FT                   repair (MutL/MLH1/PMS2) proteins. This transducer domain is
FT                   homologous to the second...; Region: TopoII_MutL_Trans;
FT                   cl02783"
FT                   /db_xref="CDD:155101"
FT                   /locus_tag="Sbal223_4360"
FT   misc_feature    complement(30792..30794)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73195"
FT                   /locus_tag="Sbal223_4360"
FT   gene            complement(31091..31801)
FT                   /db_xref="GeneID:7090148"
FT                   /locus_tag="Sbal223_4361"
FT   CDS_pept        complement(31091..31801)
FT                   /locus_tag="Sbal223_4361"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: amt:Amet_2245 hypothetical protein"
FT                   /db_xref="GI:217975574"
FT                   /db_xref="GeneID:7090148"
FT                   /translation="MQKGLIYMNSLEYFSSLKDEESLALRADDLEKVYGILRAGKTSTG
FT                   YTTLSLKVQDEEIDMGPEAVLTAYFPRAKNTMLFCMGALADGEDGLIQGEVDNKIYFDK
FT                   RFLEFGSHILLIIKPLDFSKRINKAIKKASGAFSSKLLHDGYGLVDYKSLENYSGPIGL
FT                   YIKDSKYSWQMEFRISFGVEDYFLNQNGAFELEIGDISDISNIIPVQALIDEPFCFKRR
FT                   TFIKAGDGYEQVNG"
FT                   /protein_id="YP_002360244.1"
FT   gene            complement(32053..32889)
FT                   /db_xref="GeneID:7090149"
FT                   /locus_tag="Sbal223_4362"
FT   CDS_pept        complement(32053..32889)
FT                   /locus_tag="Sbal223_4362"
FT                   /gene_family="HOG000071461" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Smal_1975"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: smt:Smal_1975 hypothetical protein"
FT                   /db_xref="GI:217975575"
FT                   /db_xref="GeneID:7090149"
FT                   /translation="MKNELVGYNMADFHVALSAFDKAVCEACAVSTFTGSRYVVPYKGY
FT                   SSHIFTRMCLHSQALISALPKTRWAKRDYECWEFSIIAPHVRALMEGYILFFYLSEAPI
FT                   SEDEWYVKLNIMHLNDCTRRVRLHQNIRSVEDEAGCREQQIELKERLKGSEFFKKLPSK
FT                   LQKQLLTGKALMIPSRDELLEKLDIDIGEFNAFYDIISNYTHILPISYYRSEANGRGTG
FT                   VQNQTDLSYISLSLIKATHWLNVTTERMVELFPDADTVRKGKKSKFTLGPKENTKN"
FT                   /protein_id="YP_002360245.1"
FT   gene            complement(33028..33261)
FT                   /db_xref="GeneID:7090150"
FT                   /locus_tag="Sbal223_4363"
FT   CDS_pept        complement(33028..33261)
FT                   /locus_tag="Sbal223_4363"
FT                   /gene_family="HOG000086250" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCVd0138 hypothetical protein"
FT                   /db_xref="GI:217975576"
FT                   /db_xref="GeneID:7090150"
FT                   /translation="MSKHYIHGDQSEDESSHFYCSACDAFFPEIHFFNQNEKCCNHWSR
FT                   YDDAIRMLGNSLKKNEESGRSINAINVFTHKS"
FT                   /protein_id="YP_002360246.1"
FT   gene            complement(33406..33780)
FT                   /db_xref="GeneID:7090151"
FT                   /locus_tag="Sbal223_4364"
FT   CDS_pept        complement(33406..33780)
FT                   /locus_tag="Sbal223_4364"
FT                   /gene_family="HOG000086252" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:NGO1002"
FT                   /codon_start="1"
FT                   /product="putative phage associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ngo:NGO1002 putative phage associated protein"
FT                   /db_xref="GI:217975577"
FT                   /db_xref="GeneID:7090151"
FT                   /translation="MSNYWVVGASWGGVEHQDKKFIEQGIWMLGWEEDDQPAQYKKASE
FT                   MKAGDRIAIKRMKGGGQIGIKIFHLGIIKGVILEANKIICTVDWVAKDLNRNIEESRGC
FT                   FKSIHGPFEHDDWVEKVFCL"
FT                   /protein_id="YP_002360247.1"
FT   misc_feature    complement(33442..>33672)
FT                   /note="Tic22-like family; Region: Tic22; cl04468"
FT                   /db_xref="CDD:164058"
FT                   /locus_tag="Sbal223_4364"
FT   gene            complement(34230..35327)
FT                   /db_xref="GeneID:7090152"
FT                   /locus_tag="Sbal223_4365"
FT   CDS_pept        complement(34230..35327)
FT                   /locus_tag="Sbal223_4365"
FT                   /gene_family="HOG000266876" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08775"
FT                   /codon_start="1"
FT                   /product="ParB family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ParB family protein; KEGG: son:SO_A0096
FT                   plasmid partition protein ParB"
FT                   /db_xref="GI:217975578"
FT                   /db_xref="InterPro:IPR014884"
FT                   /db_xref="GeneID:7090152"
FT                   /translation="MAKKRGVMSPLGNAVGAEEAQINAAKANIESLKRQITTEIEKVSE
FT                   DVTLSLQNLFGLESVGKSFLWQLASGATATFTEATLSYEQVRDSTYVTFDVNGRDQALL
FT                   NADSLQDLDSLAFQQFYPAVAREVNGKLDVLDGSRRRAWFLLQNGEVDIFRILVTKDDI
FT                   SLSDAKALAKQLQTAKEHNLREIGQQCLSLEKANPKITQAEVAAQLGMSQAGVSKALKA
FT                   AKVDERLVKLFPVANDLSHTDYALLNKVMEVYEFEDELLSFINDLTKKVVIIQAEYSRE
FT                   ERKSAITKAIKTELQIAKDMKNKALVSVTNLATFDSSGIYARKRIKGRNFAYEFGRLSL
FT                   DIQQQLDVAIADVLKKNKFNTTSDF"
FT                   /protein_id="YP_002360248.1"
FT   misc_feature    complement(<34854..35117)
FT                   /note="plasmid-partitioning protein; Provisional; Region:
FT                   PRK13698"
FT                   /db_xref="CDD:184254"
FT                   /locus_tag="Sbal223_4365"
FT   misc_feature    complement(34260..34631)
FT                   /note="ParB family; Region: ParB; pfam08775"
FT                   /db_xref="CDD:149741"
FT                   /locus_tag="Sbal223_4365"
FT   gene            complement(35327..36526)
FT                   /db_xref="GeneID:7090153"
FT                   /locus_tag="Sbal223_4366"
FT   CDS_pept        complement(35327..36526)
FT                   /locus_tag="Sbal223_4366"
FT                   /gene_family="HOG000000489" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   son:SO_A0095 plasmid partition protein ParA"
FT                   /db_xref="GI:217975579"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7090153"
FT                   /translation="MDSMQTTETFQVLKMGADAYIKRRNQRLLSNHRKELRKFTRAEAF
FT                   TYLDIDAKTLDKYVSTADFDPRRHEDSQWLINIEEMYQLRDLLPENLRKASKFKRSDNQ
FT                   RMQVIVIQNQKGGVGKTVSAATIASGLATEFHQEYRVGLIDMDGQATLSMYYAPEADLE
FT                   GCLSVGDLMMNNFDLDEGETLEQVVSNAFLPTTIPNLRILPASQSDRAIEGWFHEQVFG
FT                   QKLKSPYSLLHTIINAVQDEFDIIIIDTPPSLGYATYNAYFAATSVVFPLSITENDIDA
FT                   TCSYFSYIPQVWALLANANHHGYDFMKILITNHRDSATTTDLMNSLYDHFAPYMYSNEF
FT                   KHSEAIRQSSSLLSTVFDMSKSEYPKSKATFQSAQQNCYEVTSQVLRDIVNVWREQEQA
FT                   "
FT                   /protein_id="YP_002360249.1"
FT   misc_feature    complement(35348..36436)
FT                   /note="plasmid partitioning protein RepA; Region:
FT                   partition_RepA; TIGR03453"
FT                   /db_xref="CDD:163271"
FT                   /locus_tag="Sbal223_4366"
FT   misc_feature    complement(<36080..36205)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4366"
FT   misc_feature    complement(36164..36184)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4366"
FT   misc_feature    complement(36164..36166)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4366"
FT   misc_feature    complement(35591..>35800)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4366"
FT   misc_feature    complement(35780..35782)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4366"
FT   gene            36695..36922
FT                   /db_xref="GeneID:7090154"
FT                   /locus_tag="Sbal223_4367"
FT   CDS_pept        36695..36922
FT                   /locus_tag="Sbal223_4367"
FT                   /gene_family="HOG000000488" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0094 hypothetical protein"
FT                   /db_xref="GI:217975580"
FT                   /db_xref="GeneID:7090154"
FT                   /translation="MDKNTANDDGQDHHWPVPQPRIKVTKLMSQFQYNQIEKARLIDLP
FT                   MIPSGLLIQWLVTKPDWLQQRVFKQLTLQQ"
FT                   /protein_id="YP_002360250.1"
FT   gene            complement(37583..38314)
FT                   /db_xref="GeneID:7090155"
FT                   /locus_tag="Sbal223_4368"
FT   CDS_pept        complement(37583..38314)
FT                   /locus_tag="Sbal223_4368"
FT                   /gene_family="HOG000245283" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0058"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0058 hypothetical protein"
FT                   /db_xref="GI:217975581"
FT                   /db_xref="GeneID:7090155"
FT                   /translation="MQKSNADKARQKRQRLRNEKRAAALHVKNNKHDVGSNAYKASLDG
FT                   FKLKGSRLPRYFNVVINNARRLIYSRKLDVDNGGVSRTMSERTKRKLFEISVTLITTCD
FT                   LMSGQVGKAKNIGFDPTSHDALMLAHAKRWGEAIPSSTWYRFIDMLKLAGVYLVQEVKK
FT                   ADEEGTIRSRAAYKWLSPQFLQSIGVYSDDIRAQIKFSYQKALDNGLSFTWRCFKRQLP
FT                   LRQRFTADMFFSSNVNPPSTH"
FT                   /protein_id="YP_002360251.1"
FT   gene            complement(38761..38862)
FT                   /db_xref="GeneID:7090156"
FT                   /locus_tag="Sbal223_4369"
FT   CDS_pept        complement(38761..38862)
FT                   /locus_tag="Sbal223_4369"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975582"
FT                   /db_xref="GeneID:7090156"
FT                   /translation="MDQAVKDGKYQTITALTVEAVKDKLQFDPDSDA"
FT                   /protein_id="YP_002360252.1"
FT   gene            39063..39320
FT                   /db_xref="GeneID:7090157"
FT                   /locus_tag="Sbal223_4370"
FT   CDS_pept        39063..39320
FT                   /locus_tag="Sbal223_4370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975583"
FT                   /db_xref="GeneID:7090157"
FT                   /translation="MPLNKSEITIFRELFPTLTQRQLEVMKDFSLGMTPSQLQAKADCS
FT                   RTAIERHLADLRAEFGCTSSNEIRTIFLNKLLIQVLRNSI"
FT                   /protein_id="YP_002360253.1"
FT   gene            39422..39610
FT                   /db_xref="GeneID:7090158"
FT                   /locus_tag="Sbal223_4371"
FT   CDS_pept        39422..39610
FT                   /locus_tag="Sbal223_4371"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975584"
FT                   /db_xref="GeneID:7090158"
FT                   /translation="MSDGKINKNHSRITIILTGEYHNKLVNSCERSARSKRAEIQLRIE
FT                   HSLLSFVDAPPKPIKQQ"
FT                   /protein_id="YP_002360254.1"
FT   gene            39674..40048
FT                   /db_xref="GeneID:7090159"
FT                   /locus_tag="Sbal223_4372"
FT   CDS_pept        39674..40048
FT                   /locus_tag="Sbal223_4372"
FT                   /gene_family="HOG000000487" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vvy:VVP04 putative conjugative transfer
FT                   protein TraA"
FT                   /db_xref="GI:217975585"
FT                   /db_xref="GeneID:7090159"
FT                   /translation="MTTLTQKQPNAQQTEVNEEILRLAKHIPSDSTIFIMRCTFLFIIC
FT                   IVATLLLSWDVHAIDIFAPAKNEIVDTVGTGSTAQFAILVAGLCVGALTGFLTRDWGKA
FT                   IGGFIVGIIFINVGLKVVGL"
FT                   /protein_id="YP_002360255.1"
FT   misc_feature    39812..40045
FT                   /note="TraA; Region: TraA; cl11503"
FT                   /db_xref="CDD:187079"
FT                   /locus_tag="Sbal223_4372"
FT   gene            40052..40354
FT                   /db_xref="GeneID:7090160"
FT                   /locus_tag="Sbal223_4373"
FT   CDS_pept        40052..40354
FT                   /locus_tag="Sbal223_4373"
FT                   /gene_family="HOG000000486" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02762"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraL"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraL; PFAM: TraL family protein; KEGG: vvy:VVP05 putative
FT                   conjugative transfer protein TraL"
FT                   /db_xref="GI:217975586"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR014130"
FT                   /db_xref="GeneID:7090160"
FT                   /translation="MDNPTQFFSIPKHLNNTPTLLGFAMDEIVPALMFFAVLFMMDHAL
FT                   IGMVLASSWFLGMRRMKSQYGMSVLRLTAYWYAPAEFSASFLKRTPAACRRYWLR"
FT                   /protein_id="YP_002360256.1"
FT   misc_feature    40067..40351
FT                   /note="TraL protein; Region: TraL; cl06278"
FT                   /db_xref="CDD:186680"
FT                   /locus_tag="Sbal223_4373"
FT   gene            40395..40961
FT                   /db_xref="GeneID:7090161"
FT                   /locus_tag="Sbal223_4374"
FT   CDS_pept        40395..40961
FT                   /locus_tag="Sbal223_4374"
FT                   /gene_family="HOG000000485" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02761"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraE"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraE; PFAM: TraE family protein; KEGG: vvy:VVP06 putative
FT                   conjugative transfer protein TraE"
FT                   /db_xref="GI:217975587"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="GeneID:7090161"
FT                   /translation="MLQKNKIDFIRIAKSLNTLLLIGFTIAMISNTVLASIVWKAYFNK
FT                   SRTVVPPTISAAFTVSDTSIDEPYLQQMAEYFAFLKLNVTPASVDHQYKQLATYIDEAD
FT                   WHQMQPLLVEDAAMIKKQNISSHFTINETQIALDDRLVKITGTLNKYVGKRALEPETIS
FT                   YIIAMNYDHGQLSLKAIKKVQKDVK"
FT                   /protein_id="YP_002360257.1"
FT   misc_feature    40395..40952
FT                   /note="TraE protein; Region: TraE; cl05060"
FT                   /db_xref="CDD:186644"
FT                   /locus_tag="Sbal223_4374"
FT   sig_peptide     40395..40502
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 36"
FT                   /locus_tag="Sbal223_4374"
FT   gene            40961..41779
FT                   /db_xref="GeneID:7090162"
FT                   /locus_tag="Sbal223_4375"
FT   CDS_pept        40961..41779
FT                   /locus_tag="Sbal223_4375"
FT                   /gene_family="HOG000000484" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02756"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system secretin TraK"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system secretin
FT                   TraK; KEGG: ppr:PBPRC0005 hypothetical protein"
FT                   /db_xref="GI:217975588"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="GeneID:7090162"
FT                   /translation="MKIANPLVFAACALFPMSVLAANTPPKHYGFNDSETVPIELSSVD
FT                   INRLVVEGDKITSIDCPEGFCVVTGTKSDKSGAARVNLNLAMPFTAYVSTEKGRHFGLF
FT                   ISPKAIPAVTSIFTAEHYREEQPSVFDKKTPYPTMMTEFTAQMIRYLATGKPIDGYRVH
FT                   VVNDDLERTTVDSEPRGTETSIDDAMFTRLNEQQMPKPAGLTTEPAFVFTGKHFNGIIY
FT                   RVTNHAALPVTLTTAQFYSPTTRAAALSTYELAPQQTGHLFVVSGGESMQ"
FT                   /protein_id="YP_002360258.1"
FT   sig_peptide     40961..41026
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT                   /locus_tag="Sbal223_4375"
FT   misc_feature    40970..41752
FT                   /note="TraK protein; Region: TraK; pfam06586"
FT                   /db_xref="CDD:148287"
FT                   /locus_tag="Sbal223_4375"
FT   misc_feature    41009..41758
FT                   /note="conjugal transfer protein TraK; Provisional; Region:
FT                   PRK13736; cl05878"
FT                   /db_xref="CDD:186671"
FT                   /locus_tag="Sbal223_4375"
FT   gene            41776..43302
FT                   /db_xref="GeneID:7090163"
FT                   /locus_tag="Sbal223_4376"
FT   CDS_pept        41776..43302
FT                   /locus_tag="Sbal223_4376"
FT                   /gene_family="HOG000000483" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06447"
FT                   /codon_start="1"
FT                   /product="TraB pilus assembly family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraB pilus assembly family protein; KEGG:
FT                   ppr:PBPRC0006 putative sex pilus assembly and synthesis
FT                   protein TraB"
FT                   /db_xref="GI:217975589"
FT                   /db_xref="InterPro:IPR010501"
FT                   /db_xref="GeneID:7090163"
FT                   /translation="MKQLLDYFKKDPEADFEQGSALNEANKKRNWVIAGVGATVLGALY
FT                   LAGDAYMSAPKRAPETAAGNPIDFGAVIDKDFTEKDNQSALTAQQIALDKQQKAIDKIL
FT                   SSMQAIERNNEANRLDLKRNLETFQLTITERIDDKINAANANAMQHSNVTDEFSTEGID
FT                   ASAYPVRQSTRYLGEQTLPPRPSVGDGQSGYAAPYQGGAIPPPATQNGIDSFALNWETP
FT                   EENLPKKRTPENYVPAGTFVTAVVTGGADANAGVNGQGDTVPMVFQTTNQGVLPNGKPS
FT                   KLNNCTVLGAAYGEISSSRGIVRTTRLSCIFEDEIIDIPVEATVFNYGRNGIRGTAIMK
FT                   NGKIVQMAGISGILTGIGETGKALSQTTSNSALGSTSSVNGADALLNLAGSASSSVGSK
FT                   LADYYIKLAEQYHPIIELNPGNTVNIVFLKGFPLDPVGIQEYEEALAQQAQNPVSATAQ
FT                   ILNTISNPLLEQMPGNIKPQAQGANTPTPQQQYNQQGQRPPVNSAFGRAN"
FT                   /protein_id="YP_002360259.1"
FT   misc_feature    41839..43074
FT                   /note="conjugal transfer pilus assembly protein TraB;
FT                   Provisional; Region: PRK13729"
FT                   /db_xref="CDD:184281"
FT                   /locus_tag="Sbal223_4376"
FT   misc_feature    42475..43074
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="Sbal223_4376"
FT   gene            43323..43778
FT                   /db_xref="GeneID:7090164"
FT                   /locus_tag="Sbal223_4377"
FT   CDS_pept        43323..43778
FT                   /locus_tag="Sbal223_4377"
FT                   /gene_family="HOG000000482" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02747"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraV"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraV; PFAM: Type IV conjugative transfer system protein
FT                   TraV; KEGG: ppr:PBPRC0007 hypothetical protein"
FT                   /db_xref="GI:217975590"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="GeneID:7090164"
FT                   /translation="MNPIMCKNALRNTGIIALASWLVSGCAAGLDGDYSCDKVGGINGC
FT                   TNMMEVRQLTDSGVFNQPQAQSPAVTTLSGQSTTALPKLASQQQDFIPLPRRDRHGVPL
FT                   RTSESVQKVTIFPYLNEQGDYVDTSDVYIVVDKSRWTGRPAKYIKQD"
FT                   /protein_id="YP_002360260.1"
FT   sig_peptide     43323..43412
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.699 at
FT                   residue 30"
FT                   /locus_tag="Sbal223_4377"
FT   misc_feature    43371..43742
FT                   /note="Type IV conjugative transfer system lipoprotein
FT                   (TraV); Region: TraV; cl11514"
FT                   /db_xref="CDD:187086"
FT                   /locus_tag="Sbal223_4377"
FT   gene            43782..46370
FT                   /db_xref="GeneID:7090165"
FT                   /locus_tag="Sbal223_4378"
FT   CDS_pept        43782..46370
FT                   /locus_tag="Sbal223_4378"
FT                   /gene_family="HOG000000481" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02746"
FT                   /codon_start="1"
FT                   /product="type-IV secretion system protein TraC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-IV secretion system protein TraC;
FT                   KEGG: ppr:PBPRC0008 putative sex pilus assembly and
FT                   synthesis protein TraC"
FT                   /db_xref="GI:217975591"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="GeneID:7090165"
FT                   /translation="MKQRIKDDLGALYASSKQQHNHLHHELPYRIYDDAEQVFENANTL
FT                   GFGFAISLFGGANDDLIKTMNALVCTLPEGDKWHYQFVMVGNNQVGELIEQNQALLKGR
FT                   NAICDKFANNEAIYAKHSSTKGFGTKLSSAYHYDLKNTKGFFFVSTTEDMPALLDMRLG
FT                   VESELAQTGMHIRRLGADDLIEHCREHLNFSHQQDRVTPAKYNEYQPLNTQILSPDSEF
FT                   IINRDSVNIRHTPMQSDNSVDTTLINLGLKGLPNDFRLYAFPNCIASLSYTMNSVQCPY
FT                   RVSVSFYINKTGEQTTRNDSKIGSLTKTVNSPMRLLIPSAADELAERKEIQKGLSSHAF
FT                   KITTMTLNVTLYTTEEKHRHDTSKAIATFRTAGIDLIRNNKLQGMCTLSTLPFSMSEGF
FT                   MKDSQKAGLCFMMKTSNLVNFLPIVADYKRLSAGLLLPTMRHQISYFDPFNCGSDNYNM
FT                   AITGGSGAGKSFFMQALVKSIFAKGGKAWILDKGQSYKKLTQTLGGVYLDSSQIFLNPF
FT                   THLGKVLSVRDAGTFGPILDDEGQAIDPITEVLGNITALIATMASPDEKLTGFQTALLG
FT                   DAILLAWQKCGNDTLIDDVQKALYDIAAQKNDDTRISDIAAQLNKFCSSGIHGAIFNKP
FT                   SMLDPNIDITTLELDGFKGELQRPVIFALMVTISQQMYLSGQRSIPKICVIEEAWSLMS
FT                   GANAQSKDFINEGYRTVRKFGGSFATVTQGMNDFFANAEAEAALNSSDIHITLRQGDGF
FT                   GDFLNKHPDHFSPFEQHMIKSFPRANDAGHSCVMLKAGGLVSFHRIFADPWSRAMLSTE
FT                   PKEFEHCENLIKGGMPLLDAIELTAQHFYPDDMARFDAILSAAATHKEAA"
FT                   /protein_id="YP_002360261.1"
FT   misc_feature    43857..46301
FT                   /note="type-IV secretion system protein TraC; Region:
FT                   TraC-F-type; TIGR02746"
FT                   /db_xref="CDD:162997"
FT                   /locus_tag="Sbal223_4378"
FT   misc_feature    45123..>45332
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4378"
FT   misc_feature    order(45165..45170,45180..45188)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4378"
FT   misc_feature    order(45168..45170,45180..45188,45243..45245,45249..45254)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4378"
FT   gene            46372..46743
FT                   /db_xref="GeneID:7090166"
FT                   /locus_tag="Sbal223_4379"
FT   CDS_pept        46372..46743
FT                   /locus_tag="Sbal223_4379"
FT                   /gene_family="HOG000000480" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PSLT089"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbI"
FT                   /transl_table="11"
FT                   /note="KEGG: stm:PSLT089 conjugal transfer protein TrbI"
FT                   /db_xref="GI:217975592"
FT                   /db_xref="GeneID:7090166"
FT                   /translation="MEKKLIQAFLWLVTLSVMITLWVTREPSIVEYDINETVASFHQSI
FT                   GQSELSDEQREKEITRFTQTLDDVVREYALDNHVVVLVSPAVVSGAVNVTQEIQQSLLQ
FT                   TLHAQNKANRAQSSEVTPK"
FT                   /protein_id="YP_002360262.1"
FT   misc_feature    46381..46692
FT                   /note="Type-F conjugative transfer system protein
FT                   (TrbI_Ftype); Region: TrbI_Ftype; cl11515"
FT                   /db_xref="CDD:187087"
FT                   /locus_tag="Sbal223_4379"
FT   gene            46740..47444
FT                   /db_xref="GeneID:7090167"
FT                   /locus_tag="Sbal223_4380"
FT   CDS_pept        46740..47444
FT                   /locus_tag="Sbal223_4380"
FT                   /gene_family="HOG000222133" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02743"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system protein TraW"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system protein
FT                   TraW; KEGG: ppr:PBPRC0010 sex pilus assembly and synthesis
FT                   protein TraW"
FT                   /db_xref="GI:217975593"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="GeneID:7090167"
FT                   /translation="MNKFALLMLALCPLLPLKAASIGTVGQVFPIAEIDMLQWIENRLQ
FT                   TLEKTGELDSMREQFQENVKAGVKRPRPVGLITTKTPEVFLVDPTLTLAKDINDANGNL
FT                   IYPKGTRVNPFDTKTWPALQKANVGKFEFSKTLVFFDGDDVQQVLWAKEFATTHDKPHT
FT                   IKWILTGGEPETLHGQLDARVYFDQQGNLSRALTLKRVPSVVKQAGVMWQVREMDVSNF
FT                   PVFMEETNNAAH"
FT                   /protein_id="YP_002360263.1"
FT   sig_peptide     46740..46799
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.830 at
FT                   residue 20"
FT                   /locus_tag="Sbal223_4380"
FT   misc_feature    46800..47387
FT                   /note="Sex factor F TraW protein N terminal; Region:
FT                   TraW_N; cl10149"
FT                   /db_xref="CDD:186917"
FT                   /locus_tag="Sbal223_4380"
FT   gene            47431..48444
FT                   /db_xref="GeneID:7090168"
FT                   /locus_tag="Sbal223_4381"
FT   CDS_pept        47431..48444
FT                   /locus_tag="Sbal223_4381"
FT                   /gene_family="HOG000222151" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06834"
FT                   /codon_start="1"
FT                   /product="TraU family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraU family protein; KEGG: ppr:PBPRC0011
FT                   putative sex pilus assembly and synthesis protein TraU"
FT                   /db_xref="GI:217975594"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="GeneID:7090168"
FT                   /translation="MRHIKLAWLVALSLLMGLIPSQANAQAACTGTFVNPMTDICWSCI
FT                   FPMTIGSVPIIPGSLPDTRNPVSPISFCPKPPPIFMQIGLNIGYWEPDTLVDVTRVPYC
FT                   MVNMGMKLDMSNSPQIGGRVTSRDNDASDGAFYHGHWYKYPVIYWLQIMQSAACMATDN
FT                   FDIAYLTEIDPLWDDDELSFILNPEAILFGNLVSQLACATEAVATSTNSILPFDFLFWC
FT                   MGSQGSAYPLTGTTNYRDTPIQAGTLILERLNYKLHRQGIVWESHGEDGAICYQTPMPL
FT                   MPKSRYRYQMTNTIPDALWGHPYTTTTVIWESGHDNPVSGDNFGFINFKKRNCVFL"
FT                   /protein_id="YP_002360264.1"
FT   sig_peptide     47431..47508
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 26"
FT                   /locus_tag="Sbal223_4381"
FT   misc_feature    47515..48441
FT                   /note="TraU protein; Region: TraU; cl06067"
FT                   /db_xref="CDD:186673"
FT                   /locus_tag="Sbal223_4381"
FT   gene            48467..49207
FT                   /db_xref="GeneID:7090169"
FT                   /locus_tag="Sbal223_4382"
FT   CDS_pept        48467..49207
FT                   /locus_tag="Sbal223_4382"
FT                   /gene_family="HOG000000478" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02742"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TrbC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TrbC; PFAM: Type-F conjugative transfer
FT                   system pilin assembly protein TrbC; KEGG: ppr:PBPRC0012
FT                   conjugative transfer protein TrbC"
FT                   /db_xref="GI:217975595"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="GeneID:7090169"
FT                   /translation="MKKFETKLPTTYTALCTKIVDNSLFSHSFKGLALLVSLWCLGSIS
FT                   QVFAQTDYSIDELKALSMRERHTLPPLNVDQAALFDKARQFEAQSKGQLDNALSPLLDA
FT                   KPNPSADANGVMVFVSLGMPATSLQQLLMQSADLQVPLIVRGVLPQGFTATVKQMNHLI
FT                   DNKGKTIQSGFAINPQWFTQFGITQVPAFVAVRPNKCHAKQPCSTDDFDVIYGNVSLYD
FT                   ALNLLAQHGSIPDVAAKTLAKGAK"
FT                   /protein_id="YP_002360265.1"
FT   sig_peptide     48467..48616
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 50"
FT                   /locus_tag="Sbal223_4382"
FT   misc_feature    48809..49204
FT                   /note="Type-F conjugative transfer system pilin assembly
FT                   protein; Region: TrbC_Ftype; cl09883"
FT                   /db_xref="CDD:186869"
FT                   /locus_tag="Sbal223_4382"
FT   gene            49204..51006
FT                   /db_xref="GeneID:7090170"
FT                   /locus_tag="Sbal223_4383"
FT   CDS_pept        49204..51006
FT                   /locus_tag="Sbal223_4383"
FT                   /gene_family="HOG000000477" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02750"
FT                   /codon_start="1"
FT                   /product="conjugal transfer mating pair stabilization
FT                   protein TraN"
FT                   /transl_table="11"
FT                   /note="TraN; TrhN; involved in stabilizing mating pairs
FT                   during plasmid conjugation; F plasmid TraN appears to
FT                   recognize OmpA in the recipient cell"
FT                   /db_xref="GI:217975596"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="GeneID:7090170"
FT                   /translation="MTQLNNALILSAILTLSAALPVVAANSEKDYRNNVQWAKDSIKQN
FT                   QNKAGYTGFDVNSLCKDATCQQEVANPSESRYYNNPSAMDSAKMQGMSTDGQAQAVTSG
FT                   FNKGRPTIDENDPAYHTAVGYQNDAYNISHGISSKYHDCEKGLVCEVDSQPRSCTLPTN
FT                   NPVQCYLTPFVKHSSMTTKEYDFQLLYASLPYTFALEEPVALSSVRISGRFSISQFTTV
FT                   IRFYIDDTLLGEVPVIPEKCSMTTCSVQINSQFTYPVASESSSYVFKMKYMFLGDVGYD
FT                   VGLVDKAQVTLVTNKTSVEVGYNNSCGAVLPECQQVQSQCIEGKETRMINGISVTLDCW
FT                   KEQTTYQCAFPNTCDAIADCSIQSTSCDTQLGGVCIKDKQQRLCDKQQCRDTGLICGAD
FT                   SFALSGDYYDPAATRSTDFNHAAAGLAAVSDAAGDVKDKANINEDSAIIFKGNIMECSD
FT                   KALGISNCCQDSGWGNGIGLTSCSEEEKALGTAKEDKLTVSLGQYCAEKVLGVCIRKKK
FT                   AYCAFDSKLARIVQVEGRAQLGKNFGSAKHPDCSAFSPNELQRIDMSSMDFSDFYEDMY
FT                   DAIELPSTDEIQKRLQQSVGGTKP"
FT                   /protein_id="YP_002360266.1"
FT   sig_peptide     49204..49278
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT                   /locus_tag="Sbal223_4383"
FT   misc_feature    49267..50988
FT                   /note="conjugal transfer mating pair stabilization protein
FT                   TraN; Reviewed; Region: PRK12355"
FT                   /db_xref="CDD:183467"
FT                   /locus_tag="Sbal223_4383"
FT   misc_feature    <50116..>50607
FT                   /note="Mating pair stabilisation protein TraN; Region:
FT                   TraN; cl06164"
FT                   /db_xref="CDD:186676"
FT                   /locus_tag="Sbal223_4383"
FT   misc_feature    <50644..50964
FT                   /note="Mating pair stabilisation protein TraN; Region:
FT                   TraN; cl06164"
FT                   /db_xref="CDD:186676"
FT                   /locus_tag="Sbal223_4383"
FT   gene            51003..51878
FT                   /db_xref="GeneID:7090171"
FT                   /locus_tag="Sbal223_4384"
FT   CDS_pept        51003..51878
FT                   /locus_tag="Sbal223_4384"
FT                   /gene_family="HOG000000476" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02739"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TraF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TraF; KEGG: ppr:PBPRC0014 sex pilus
FT                   assembly and synthesis protein TraF"
FT                   /db_xref="GI:217975597"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="GeneID:7090171"
FT                   /translation="MRTLLNNRLQHAAAVPFFRWSSRAPLAWLSTKKGDAVVNKRSALV
FT                   LLILTTFCHGANATDAQGWRWYNEPTAPKKQAPKKAETPSVTLTRTQTLTPTEQMDWFH
FT                   SYYQDTLNDAAINSQDSEKVERAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPT
FT                   EQAARSTYLSLERNKKMRAVRTLADAGWGLFFVYKGSEEIDIALAPSVQQFATQHGIEL
FT                   LGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFL
FT                   NVATDFAPDF"
FT                   /protein_id="YP_002360267.1"
FT   sig_peptide     51003..51179
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.946 at
FT                   residue 59"
FT                   /locus_tag="Sbal223_4384"
FT   misc_feature    51132..51875
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Sbal223_4384"
FT   gene            51892..52329
FT                   /db_xref="GeneID:7090172"
FT                   /locus_tag="Sbal223_4385"
FT   CDS_pept        51892..52329
FT                   /locus_tag="Sbal223_4385"
FT                   /gene_family="HOG000000474" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02738"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   thiol-disulfide isomerase TrbB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly thiol-disulfide isomerase TrbB; KEGG:
FT                   ppr:PBPRC0015 putative thiol-disulfide isomerase"
FT                   /db_xref="GI:217975598"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="GeneID:7090172"
FT                   /translation="MKRIITVMLMTLLFSFNAKATPMGAAVAANPNDYALVFFFRSDCP
FT                   FCHKFAPKLKQLAAQTGTYTYAFSLDNQGIAGFEVPIPSTPDIAATFFENPRSVTVPAT
FT                   FLINVNTRKFVRLTVGDVTPSQLQQSYLQSLNDPQVIASMR"
FT                   /protein_id="YP_002360268.1"
FT   sig_peptide     51892..51954
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 21"
FT                   /locus_tag="Sbal223_4385"
FT   misc_feature    <51943..52263
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Sbal223_4385"
FT   gene            52341..52505
FT                   /db_xref="GeneID:7090173"
FT                   /locus_tag="Sbal223_4386"
FT   CDS_pept        52341..52505
FT                   /locus_tag="Sbal223_4386"
FT                   /gene_family="HOG000086253" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975599"
FT                   /db_xref="GeneID:7090173"
FT                   /translation="MDTMLIINILLALAIYKFVLVPVHALLSAVCLRALRALHPRLNGN
FT                   ISGNTGGKS"
FT                   /protein_id="YP_002360269.1"
FT   gene            52502..53890
FT                   /db_xref="GeneID:7090174"
FT                   /locus_tag="Sbal223_4387"
FT   CDS_pept        52502..53890
FT                   /locus_tag="Sbal223_4387"
FT                   /gene_family="HOG000000473" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06122"
FT                   /codon_start="1"
FT                   /product="TraH family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraH family protein; KEGG: vvu:VV2_0648
FT                   hypothetical protein"
FT                   /db_xref="GI:217975600"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="GeneID:7090174"
FT                   /translation="MKRLALTRTLLGVTISCLLTTHAHSAGVSGSLNDFFNGLGYGTNV
FT                   TNPGSFKGQSANYYSGGNLFVRSPIRDAQLVSVQMPSIAAGCGGIDMFMGGFSHINSDA
FT                   LVQQGKAIIANAAPFAVDLALQTWAPQIKQIKDTLTAIADKYLNQSINSCESAQAGVSA
FT                   LAGFAGVGSQKYICATMGTQNNAFADWVSGQQECGAGGQANKQLDNAKKDPALKDMVRK
FT                   NTNIVWAAILKNTFLASDPTLAEFLMSISGTYIYDATGDARGYGSLLTDNNNLINSLLE
FT                   GGKAETYQCTNKAIDQCLAPTQQTITIQSNHGLQYRVDTLLRGIASKMQNDQPLTDNDK
FT                   SLLEYTTLPIMTFLRTELEAGLTPQTNTYAKIISVQFITLYLQNMLSIVKSSITATNND
FT                   PKDIDRIERDIINANRFLEGLTAKAQNEAVSQHQLIMQNQQIKQQITGAMSAKAKANLN
FT                   FGER"
FT                   /protein_id="YP_002360270.1"
FT   sig_peptide     52502..52579
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.823 at
FT                   residue 26"
FT                   /locus_tag="Sbal223_4387"
FT   misc_feature    52595..53656
FT                   /note="Conjugative relaxosome accessory transposon protein;
FT                   Region: TraH; cl05580"
FT                   /db_xref="CDD:186660"
FT                   /locus_tag="Sbal223_4387"
FT   gene            53893..56706
FT                   /db_xref="GeneID:7090175"
FT                   /locus_tag="Sbal223_4388"
FT   CDS_pept        53893..56706
FT                   /locus_tag="Sbal223_4388"
FT                   /gene_family="HOG000000472" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07916"
FT                   /codon_start="1"
FT                   /product="TraG domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraG domain protein; KEGG: ppr:PBPRC0016
FT                   putative sex pilus assembly and mating pair TraG"
FT                   /db_xref="GI:217975601"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="GeneID:7090175"
FT                   /translation="MAVEIFTYSNGDVAKQVMNAIAVLFKSDSFASMISICALFAVVAT
FT                   ALHFFIKRDHNAIMKWCAVYFAVPLLAMNTTATVQITDLTNPTGNYRVDNVPAIVAYPA
FT                   SWASHYMYATTQTVEDIFHVPDDQQYSKTGMMFGSELYKLSRQSEIENTQLKGYWQHYI
FT                   SSCIRGDMLLNNKYTWRDLASAPDIWDFLATHNPSPLRAIQMGPNDYPTCKEALPRLKQ
FT                   LFQADSAKSIKLLGSWIYGEKATSQQSFLNTSISGGYQKYANISQSASQITLQNMTINA
FT                   LRNGLADDAAVSNNTAAAFNYAYTQNKMQTTSMWAGMALQAREFLPMLQSILFLLFSSV
FT                   AFLVVAIAMIPSLTFQVLGNYFKGFIYLGTWPVMFALINFIMTTRLSLNATEITNIYGG
FT                   ITLSNVDPLQEMHSRYAAMTGFLMMSVPTLIVPLIMKGGASVMSSMSHQFAGMMSSVNA
FT                   RTSASAASGDINLGNAQVDNYSYNNTNGNKIDTTGVERIHGNTKQDATGYETTTFDDGK
FT                   QVISGQNALSRSLPVNISGNDVLSNSLSQSATDSINASKVSGEQVSTSIASVNNAALSQ
FT                   MSGVNTSNSYGSNSATGDSGSHNKGFSDMSSTVKSYAKDFNVSEEQALSDLTTMYIAAE
FT                   AGVKVGTPGSGIFGSGAHVSANAGTKGSTDESNSSRMSESERASRQESYLDQFSTNVNT
FT                   VKSYSSGEQASETNSKNAGETQSFLQGINEATTQAKNYQSQLTEAQSYTDAANSVKSGS
FT                   ISVGRDFNQDFVNFVGKAREQEGDFMDVIKGETPQAIETRNQLVEEFANSPEVKAMAEQ
FT                   YKNHEFPQNRDDIVQAQERYASDIDVNKQQSPHYAPAPLNESLYQSGEFERIQGHAAQG
FT                   NAEIRQDVWKEERDHTPSNVQSIDMEQARADAKAAHALIPQDNRSDDEKMAETVRQSSP
FT                   FNTGPKM"
FT                   /protein_id="YP_002360271.1"
FT   misc_feature    53902..56586
FT                   /note="conjugal transfer mating pair stabilization protein
FT                   TraG; Provisional; Region: PRK13735"
FT                   /db_xref="CDD:184287"
FT                   /locus_tag="Sbal223_4388"
FT   misc_feature    53902..55269
FT                   /note="TraG-like protein, N-terminal region; Region:
FT                   TraG_N; pfam07916"
FT                   /db_xref="CDD:149152"
FT                   /locus_tag="Sbal223_4388"
FT   gene            56744..57277
FT                   /db_xref="GeneID:7090176"
FT                   /locus_tag="Sbal223_4389"
FT   CDS_pept        56744..57277
FT                   /locus_tag="Sbal223_4389"
FT                   /gene_family="HOG000000471" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975602"
FT                   /db_xref="GeneID:7090176"
FT                   /translation="MNIIKTGALLLCLLSPLAQAETTLFGLTLGKSTLQEVEQSYTLQD
FT                   KNTASGQSDRRNYYVVDGKQFNEPQLKDAALYFDDAQTLGTILFTFPSSLEKYKALEEQ
FT                   LSRQYPRIKMAPFVSEPLRLDKAEFQNDTTHIRLEYNVYSTFLSFTDLKYRAANQKRLA
FT                   EKKALEGNKPKKEP"
FT                   /protein_id="YP_002360272.1"
FT   sig_peptide     56744..56806
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT                   /locus_tag="Sbal223_4389"
FT   gene            57280..59406
FT                   /db_xref="GeneID:7090177"
FT                   /locus_tag="Sbal223_4390"
FT   CDS_pept        57280..59406
FT                   /locus_tag="Sbal223_4390"
FT                   /gene_family="HOG000266197" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02759"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system coupling
FT                   protein TraD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system
FT                   coupling protein TraD; PFAM: Type IV conjugative transfer
FT                   system coupling protein TraD; KEGG: ppr:PBPRC0019
FT                   conjugative transfer protein TraD"
FT                   /db_xref="GI:217975603"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="GeneID:7090177"
FT                   /translation="MTLNPKRTKGSNYTRGGQILFHNLRMFLQINAVLIRWTCYGVLIL
FT                   TALLCFLFIDKDTLTGAYYYWINQTVSMFRPESHVMQTEWQGTVYTSTLGSQLQNPILI
FT                   AANSRFWLWSQIYFLISCVIGFVFLSVAMWFFKKKGDEQTEEHFIRGMQKATPKELAKQ
FT                   LKKDKRQSDFKLDGIGIFKERFEVQHLLLDGTTGAGKSVALRKFLTWIRERGDKAIIYD
FT                   KGCTFVSKFYNPATDVLLNPFDERCAYWDVWCDAHEPSDFENMASALIPQHGEGDPFWV
FT                   QSARTIFSSTAFKMQDEPKMNQTTERLLELMLTSELESLSEYLKGTESASLVSDKIQKT
FT                   AISIKSVLAAYIKSLRFLAGLDEKDGQGKLLRRKFSIREWVKNDAENGFLFLSSNAQQH
FT                   ASLRPLISMWLSIASTAILEQDEDPDRRIWVLMDEAPSLHKLPELAETIAEVRKFGGCY
FT                   VIGIQSFAQLKKVYGENAALEMFDLLNTRLFFRSPSNEMAKISSHDLGEQEVDVSKEQY
FT                   SYGANEIRDGVSLGHQTITRPVVTPSEIMQLEDLQFWLRTPGNYPVVRVDLEFNQMRSL
FT                   CAPFIKRNYTPSENIKQIEWSLNYHQFSAVQHVDKADKTKLQSIHDTMYEGDENNDERS
FT                   AEAQRMTKLAEKTDAVAQSLIDAKKAKPTELALKDAQKKKAAEKQKTNDQHIEDAQRLE
FT                   EQQIASVHEEISLD"
FT                   /protein_id="YP_002360273.1"
FT   misc_feature    57316..59034
FT                   /note="type IV conjugative transfer system coupling protein
FT                   TraD; Region: TraD_Ftype; TIGR02759"
FT                   /db_xref="CDD:131806"
FT                   /locus_tag="Sbal223_4390"
FT   misc_feature    57385..57672
FT                   /note="F sex factor protein N terminal; Region: TraD_N;
FT                   pfam12615"
FT                   /db_xref="CDD:153049"
FT                   /locus_tag="Sbal223_4390"
FT   misc_feature    57718..58977
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4390"
FT   misc_feature    order(57859..57864,57874..57882)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4390"
FT   misc_feature    order(57862..57864,57874..57882,57937..57939,57943..57948,
FT                   58576..58581)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4390"
FT   misc_feature    58564..58578
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4390"
FT   gene            59420..59599
FT                   /db_xref="GeneID:7090178"
FT                   /locus_tag="Sbal223_4391"
FT   CDS_pept        59420..59599
FT                   /locus_tag="Sbal223_4391"
FT                   /gene_family="HOG000086255" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975604"
FT                   /db_xref="GeneID:7090178"
FT                   /translation="MTSFNATTRVPELSAKKPSRKASKNDNERMNVMRRIEAIKELKAL
FT                   GFTSDEIKAQLDSE"
FT                   /protein_id="YP_002360274.1"
FT   gene            59658..65618
FT                   /db_xref="GeneID:7090179"
FT                   /locus_tag="Sbal223_4392"
FT   CDS_pept        59658..65618
FT                   /locus_tag="Sbal223_4392"
FT                   /gene_family="HOG000000470" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02760"
FT                   /codon_start="1"
FT                   /product="conjugative transfer relaxase protein TraI"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: conjugative relaxase domain protein;
FT                   conjugative transfer relaxase protein TraI; PFAM: TrwC
FT                   relaxase; KEGG: ppr:PBPRC0022 DNA helicase TraI"
FT                   /db_xref="GI:217975605"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="GeneID:7090179"
FT                   /translation="MLSISPIASSAGGAASYYLSEEKNLNLPDVSLEKAADAKEGETNY
FT                   YLKEQSAEPNTQWFGKLAEQEGMLGKPVEEHQLKEVLAGSLNDQTLKTQNSNARNGFDF
FT                   TFSAPKSVSLLALVGGDKRLMTAHDDAVKFALSHIEKDAAQARQTNPDTKATSFENTGN
FT                   LLFAMVRHKTSREEDPQLHTHSLTANMTKDSEGTLRALASSFKQKGGIINGTGERVYNH
FT                   QKYYTSLYQSALARSVEQAGYQTRSLGNNLFEVEGVPQSLLDTFSTRSQQINEQTQSLG
FT                   LDSQAARDVAAKDTRKSKAYTSEATLFEQWKNKANNSGFNLTSFVTDSMSRETSLNALA
FT                   LKPAAIDAVSRAIEHASNTQNRFNYAKLVESATLEFTLGQKLDALDIKLALDKHIEDGA
FT                   LIPLDKESATFTSAAHIKAETNLLESIKPKTANMRQVVDTNTLQGKGLNADNQKKVSEL
FT                   FASTKQVNLVNVFGSSEQLATALLNVGEANGKRIHIITPDMKSKLHTSERVQRDSSTIG
FT                   KWIMNHFKPDHTHTLSSFTKTANNTNRDILVVENANKLGLNDFNALLAQAKAGNSKVIL
FT                   LNHVNAKQGMKAGNAIEVLKKGNVNESNWVATKQSNTAMRLHESKDSDRVNLIAKTYAQ
FT                   LSEKQHTQVIAGTHKDVKQLNSAIRAELQNQGDVSRLGLNIPTLNPVFLSAQQREVVGQ
FT                   YTKGMVLTQWQKVGGRNQQQQLTVDSVNRDNNTLTLIDKNGKASEINPSSKAFKAAEYA
FT                   IAKPDNLHIANGDKLIMATNHQDSGLSKQIYTINALSKEWVTLKDESGKQHSVKASALH
FT                   HAPLNHGYATTPSNASPNASHHIVNIKAYSASKEWLHDTLTQGIKHIDIFTDKAQQFDD
FT                   RLEKSEVKPSSISRIMQAADMPEKFVNRQTTALLTQDVTAALNAIGAQHQDKGLIHNAV
FT                   DFAIQHISEKEAGYSQKELIVNAIKYAFEEKGTSITQHEIINTLQHMATNSTDKGAPSL
FT                   LSAEYHDGTRWTTQAAIDTEVRILDRLQAGKDQLAPLTSVEHAAQVLSQNQNLTDGQKD
FT                   ATLLITTTKDRFVGVQGLAGTGKSTMLETGIDLVKQSESILNTQPNKTPTQFIGLAPTH
FT                   AAVNELKDKNVESQTVQSLLSNFLSQDAKPDQYANTVFLLDESSMTSNAQMDKFTHLIE
FT                   TTGARAVFLGDTKQLTSQEAGKPFELALNKGAINSVTMKDIVRQQNSTLLSAVHNIVDR
FT                   QGESAIDKIQQQLPFDQYTAPTANDAVTPEKQATANINQSLNIISTLQPLTDNPKKNQQ
FT                   LATEALPATVALEYLARTPKARENTLIIAYTNKERDDITHEIRQGLQQQKSLSTEQFTV
FT                   PRLRGVHASKAELATMLPYQQGLILTTGKDSYFEIMKVDKLNNMLTLADMKTGEEKHFF
FT                   PKNHGHKFTNLWAKSEQPLAEGDSIMLRKNDIDREMQGNKTYTVSSIDDKQMQLKSTDN
FT                   HTLTLSTKDLKDAHWDYAYTRTADMAQGATYENVITAIKGQGALTNVRRAYIDITRASK
FT                   HVKIITDNPQKMMLSWVNNDPNKVSALETRDKYYPEHTPLFNDKPLPQENPKYLDVNGY
FT                   VDLKLMATELNAKLPAYSESLATQLLGEPNHDKSDKDNLTFGKEGSLTLTTTGQYRGYF
FT                   KDWKTGDKGTLINLIMVAEKCSYKDALYKADKMMNEPDKYNLVKNPQHDELTHAIPVKQ
FT                   SQLEARAKQYFNEAKPIENSLAQTYLAKQGIEVTKHENLRFHDAVYSSEKRGTFPALIA
FT                   NITNDKSETKAVEITYLDKSSGDIAALKINKRILGSKSGNSTTINKGNNSDYSIVAVGV
FT                   ENALKINADNKNGADVIALNNNNDTKTFNTNELRENVIVVLDTNNSQDTAKLANDLTEK
FT                   FSKENIHAVIIEPSLIPDGLNKVETTKQLVNEAVYSITTKDNTLSKAIQSLSHDIADTN
FT                   NITIKDDSTNVATNKIKHDEHYQNLAMDSHRSTTKEYSPNIDNPKLDIGEKTM"
FT                   /protein_id="YP_002360275.1"
FT   misc_feature    59760..60623
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="Sbal223_4392"
FT   misc_feature    59781..65600
FT                   /note="conjugative transfer relaxase protein TraI; Region:
FT                   TraI_TIGR; TIGR02760"
FT                   /db_xref="CDD:163003"
FT                   /locus_tag="Sbal223_4392"
FT   gene            complement(65639..65998)
FT                   /db_xref="GeneID:7090180"
FT                   /locus_tag="Sbal223_4393"
FT   CDS_pept        complement(65639..65998)
FT                   /locus_tag="Sbal223_4393"
FT                   /gene_family="HOG000000469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0051 hypothetical protein"
FT                   /db_xref="GI:217975606"
FT                   /db_xref="GeneID:7090180"
FT                   /translation="MARSKVVQVPCDADLYAKIVAYREEKGLEKDAAAARDLILFALRI
FT                   LEHKDDAEGLSTRELLEVILTYTVKAQHTSSLVYYQTYNADPVDIQNAGIKHKDTMRKA
FT                   EEKVEQILAGENKED"
FT                   /protein_id="YP_002360276.1"
FT   gene            complement(67489..68313)
FT                   /db_xref="GeneID:7090181"
FT                   /locus_tag="Sbal223_4394"
FT   CDS_pept        complement(67489..68313)
FT                   /locus_tag="Sbal223_4394"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975607"
FT                   /db_xref="GeneID:7090181"
FT                   /translation="MKCIECKFDNLTTGKFCSNCGQPLAILDGSTSTKIPPTYVGYLNA
FT                   RGELCDSSGHNPLIPFSSISNLNGAIVEKNTDVLFEVVDGCAVGLRSIPSFTTAKLNFD
FT                   SFEVKGGDYPTGEYSIIGEYASLMSANSPRKFIFIAGAKVEKITEERALDKLKSVMYGS
FT                   VAAIATLGVGVAVGLMHAAKKYYLLEITLPNGKFLIVQCRPAGYEKIILTAKKKSLIDG
FT                   DIDEVFDIENAIEPQKFKNLNTSKCDEIITPKIKETIGYTIILIFILIYFFW"
FT                   /protein_id="YP_002360277.1"
FT   gene            68723..71845
FT                   /db_xref="GeneID:7090182"
FT                   /locus_tag="Sbal223_4395"
FT                   /pseudo
FT   repeat_region   complement(69025..70241)
FT                   /mobile_element="insertion sequence:ISSba2"
FT   gene            complement(69045..70154)
FT                   /db_xref="GeneID:7090183"
FT                   /locus_tag="Sbal223_4396"
FT   CDS_pept        complement(69045..70154)
FT                   /locus_tag="Sbal223_4396"
FT                   /gene_family="HOG000042098" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="GI:217975608"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="GeneID:7090183"
FT                   /translation="MSLFDHLSLVEDTRSHINQRHNLVDVLFLILSAVASGQDGWAEIQ
FT                   QFGELKLEWLRKFRPFANGIPRRHTIARILKAVGPENLQLCLFSWINDIRTASAKPIIA
FT                   IDGKTLRGASKLGCNTLHSVGAFDINNGLALYQEMASGKGKEIETVQSLITMLNINKAL
FT                   ITMDALHAQRATLEAIVARKGDYVVQVKSNQRTLFQAVKAQYDVAFQDDSQLAQFACSE
FT                   KGHGRTEQRITFQIPSKLSPKLQEKWPSVKTLIAVERHRKIGNKTSIETSFYLSSHDID
FT                   PEYIATAVRGHWRIENSLHWVLDVVYREDACRVHEQRTAESLAIVRRMALNLAKLEITQ
FT                   KRSMKSKLHRSLLSDEYRELMIFADVKSI"
FT                   /protein_id="YP_002360278.1"
FT   misc_feature    complement(69156..69863)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Sbal223_4396"
FT   misc_feature    complement(69153..>69335)
FT                   /note="Transposase [DNA replication, recombination, and
FT                   repair]; Region: COG5433"
FT                   /db_xref="CDD:34992"
FT                   /locus_tag="Sbal223_4396"
FT   gene            71845..72816
FT                   /db_xref="GeneID:7090184"
FT                   /locus_tag="Sbal223_4397"
FT   CDS_pept        71845..72816
FT                   /locus_tag="Sbal223_4397"
FT                   /gene_family="HOG000071242" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07674"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1603"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1603; KEGG:
FT                   sdn:Sden_3270 hypothetical protein"
FT                   /db_xref="GI:217975609"
FT                   /db_xref="InterPro:IPR011634"
FT                   /db_xref="GeneID:7090184"
FT                   /translation="MVELQELFNIEYGNSLDLNKLVQKSDGVNFVSRTAKNNGVSAKVK
FT                   ELAGIRKMSKGSITVSLGGSVLEAFLQCDEYYTGYHIYCLTPKDGIAMSDEVKLYYCAC
FT                   IRANKYRYSYGRQANRTLKNLLVPNLDQIPEWVSGVDLAIYKGIDKPKKETKEANLPDL
FT                   SKTIRIEEIFDIKNGIAASGLKEKDKAFKNSIMYVRPAATQARTLRSYIAKSSVPEDKI
FT                   FPKGSLFVSTNGEGSHSYSYVSTDEFVPNSDVSVLTPKREMSTEEKLFYAKCITANRYL
FT                   FSYGRKPKGNKLKSIKIPKLEGKDIDKVISYINSLPYSSNIE"
FT                   /protein_id="YP_002360279.1"
FT   misc_feature    71845..72228
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal223_4397"
FT   misc_feature    72325..72741
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal223_4397"
FT   gene            complement(73022..74377)
FT                   /db_xref="GeneID:7090185"
FT                   /locus_tag="Sbal223_4398"
FT   CDS_pept        complement(73022..74377)
FT                   /locus_tag="Sbal223_4398"
FT                   /gene_family="HOG000245118" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: son:SO_A0045
FT                   phage integrase family site specific recombinase"
FT                   /db_xref="GI:217975610"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:7090185"
FT                   /translation="MKTVKLTQVFIRSLARQTRAYIIQDSLCHGLGVKVMPDKPMQYVI
FT                   SRLIDNRTRTRILAPVSALTVKAAREKATGQLQAWREEHTQPSMSASPRFDVFVEQTWK
FT                   PMIFEHWKPSTKRSVLPALNRRLLAHFGRYPLHMINHKMVQAWFDEISKTRKGAANRNL
FT                   DTLQSVFKLALRQGHCLTNPCIGIRQNKRRVLNRFLSVAEMQRLSVALDECEKVGGSIA
FT                   QCADILRLLLLTGCRLSEITFLKGEYVRGNELHLPDSKTGAKVLYIGQAAVDILSRYHC
FT                   KANTELFPMKQGASTSLVQSLWLRLRKQIGIEDVRLHDLRHTFASYAVMDGCSIPMVAS
FT                   LLGHKKVTMTLRYTHVGDDSVEQAAEIIGAVFKGIFTQSEPLKPLIPQTNEAPTLAVKV
FT                   KQKRLPERKPTAKPKPKAVKKVKQVKPLQTPASLTKEESRAIQRFRDRELFL"
FT                   /protein_id="YP_002360280.1"
FT   misc_feature    complement(73283..74140)
FT                   /note="Integrase [DNA replication, recombination, and
FT                   repair]; Region: XerC; COG0582"
FT                   /db_xref="CDD:30927"
FT                   /locus_tag="Sbal223_4398"
FT   misc_feature    complement(73310..73996)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Sbal223_4398"
FT   misc_feature    complement(order(73319..73321,73424..73432,73595..73597,
FT                   73664..73669))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Sbal223_4398"
FT   misc_feature    complement(order(73319..73321,73346..73348,73415..73417,
FT                   73424..73426,73595..73597,73667..73669))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Sbal223_4398"
FT   misc_feature    complement(order(73319..73321,73346..73348,73415..73417,
FT                   73424..73426,73667..73669))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Sbal223_4398"
FT   gene            complement(74374..75504)
FT                   /db_xref="GeneID:7090186"
FT                   /locus_tag="Sbal223_4399"
FT   CDS_pept        complement(74374..75504)
FT                   /locus_tag="Sbal223_4399"
FT                   /gene_family="HOG000289180" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: son:SO_A0044
FT                   phage integrase family site specific recombinase"
FT                   /db_xref="GI:217975611"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:7090186"
FT                   /translation="MPSIKLQQSMIDNLPTPQKITVFYDKYFPAFFMRAYPSGIRCYYV
FT                   RFQYQGLRQLHVIGNANDITLDDARLEARKHIDALRYGVVREPAPSLTLCAFAEEFFPR
FT                   YARHWKPSTLLNSQRGFTRHIAPVLGDVPLAALTRQHIEQWFDGMHASKGMANRLLPLL
FT                   SVMMQQAEVYEYRPAQSNPCKGFKRYKSTHSERYLSEEELKRLWLALDSHEKASPVAVM
FT                   VLRLLILTGCRCNEVCSVKWADYRQGHWYLPDSKTGAKTVFLSSFARELLSDWPQVSEH
FT                   LFWHQSPSQPFTPVCLDRFWRPFRETIHLNDVRIHDLRHTYASIAVKHNINILTIGRLL
FT                   GHALPETTLKYTHLAKRDVQQAANVVSQLIAGEMQR"
FT                   /protein_id="YP_002360281.1"
FT   misc_feature    complement(74434..75411)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:185831"
FT                   /locus_tag="Sbal223_4399"
FT   misc_feature    complement(74431..74919)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Sbal223_4399"
FT   misc_feature    complement(order(74461..74463,74557..74565,74731..74733,
FT                   74803..74808))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Sbal223_4399"
FT   misc_feature    complement(order(74461..74463,74479..74481,74548..74550,
FT                   74557..74559,74731..74733,74806..74808))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Sbal223_4399"
FT   misc_feature    complement(order(74461..74463,74479..74481,74548..74550,
FT                   74557..74559,74806..74808))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Sbal223_4399"
FT   gene            complement(75859..76158)
FT                   /db_xref="GeneID:7090187"
FT                   /locus_tag="Sbal223_4400"
FT   CDS_pept        complement(75859..76158)
FT                   /locus_tag="Sbal223_4400"
FT                   /gene_family="HOG000254286" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:VIBHAR_p08169"
FT                   /codon_start="1"
FT                   /product="type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: vha:VIBHAR_p08169 type I
FT                   restriction-modification system methyltransferase subunit"
FT                   /db_xref="GI:217975612"
FT                   /db_xref="GeneID:7090187"
FT                   /translation="MSDKTIEDKLKWLGALYTSKGINELVKNGHGNGLALASLFYRHAI
FT                   GDWGDLENEDYQLNNEMLIKGGRILSAYQFEGVEIWIITEADRARTTALLPSEY"
FT                   /protein_id="YP_002360282.1"
FT   misc_feature    complement(75934..>76158)
FT                   /note="polyketide-type polyunsaturated fatty acid synthase
FT                   PfaA; Region: omega_3_PfaA; TIGR02813"
FT                   /db_xref="CDD:163029"
FT                   /locus_tag="Sbal223_4400"
FT   gene            complement(76207..77205)
FT                   /db_xref="GeneID:7090188"
FT                   /locus_tag="Sbal223_4401"
FT   CDS_pept        complement(76207..77205)
FT                   /locus_tag="Sbal223_4401"
FT                   /gene_family="HOG000141063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /codon_start="1"
FT                   /product="domain of unknown function DUF1738"
FT                   /transl_table="11"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   sew:SeSA_B0128 antirestriction protein"
FT                   /db_xref="GI:217975613"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="GeneID:7090188"
FT                   /translation="MTHSITTPASHTKPFNEQASLQATSRLSKDDISKSKTKSKSAKAF
FT                   KKVDMYQVVTDQIIAALDKGVKPWVCPWQRNSIGAGLPINFDTKKAYSGINVLLLWAAA
FT                   FDAGFSSNQFLTYNQANNLGGQVRKGEKGTSIIFYKSLEKENEQGEKEVIPMLKSFTVF
FT                   NVEQIDGLNVEEVKGFNVNNSFDAIDHVESFINKTGANIVEQGDKAFFRPSTDNIVLPT
FT                   RERFSNSLDFYCTALHELTHWTGAKSRLDRIKGSRFGSDDYAFEELIAELGASFLMAEL
FT                   NVSGDVQHESYIASWLTQLKNDKRYIFKAASAASKAHQYLMQVTCEQLKAA"
FT                   /protein_id="YP_002360283.1"
FT   misc_feature    complement(76210..77064)
FT                   /note="Antirestriction protein [DNA replication,
FT                   recombination, and repair]; Region: COG4227"
FT                   /db_xref="CDD:33952"
FT                   /locus_tag="Sbal223_4401"
FT   misc_feature    complement(76717..77064)
FT                   /note="Domain of unknown function (DUF1738); Region:
FT                   DUF1738; pfam08401"
FT                   /db_xref="CDD:149455"
FT                   /locus_tag="Sbal223_4401"
FT   gene            complement(77780..78007)
FT                   /db_xref="GeneID:7090189"
FT                   /locus_tag="Sbal223_4402"
FT   CDS_pept        complement(77780..78007)
FT                   /locus_tag="Sbal223_4402"
FT                   /gene_family="HOG000011008" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0036"
FT                   /codon_start="1"
FT                   /product="HicB-related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0036 HicB-related protein"
FT                   /db_xref="GI:217975614"
FT                   /db_xref="GeneID:7090189"
FT                   /translation="MMQNAMTFKGYHGSVEISPEDNILFGQVLFISPLINYEAETAKEL
FT                   EQAFQEAINAYLADCVQQDIPPEKALEGIA"
FT                   /protein_id="YP_002360284.1"
FT   misc_feature    complement(<77789..77998)
FT                   /note="Predicted nuclease of the RNAse H fold, HicB family
FT                   [General    function prediction only]; Region: HicB;
FT                   COG4226"
FT                   /db_xref="CDD:33951"
FT                   /locus_tag="Sbal223_4402"
FT   gene            complement(78120..78629)
FT                   /db_xref="GeneID:7090190"
FT                   /locus_tag="Sbal223_4403"
FT   CDS_pept        complement(78120..78629)
FT                   /locus_tag="Sbal223_4403"
FT                   /gene_family="HOG000118593" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   plu:plu0958 hypothetical protein"
FT                   /db_xref="GI:217975615"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:7090190"
FT                   /translation="MKITQFDKNEHDRKSFDCGNTELNNYLKCISGQHEKKDISRTYVL
FT                   TSELNPSHIKGYYSIAVAQVSLCELPTEIAKKYPSEITCSLIGRMAVNHTCQRQGLGSI
FT                   LLIDAIKRIIQASSAIPIPMIIVQAKNEDARRFYSEFGFVSFPDNYLKLMMTLAHAKAM
FT                   LKEAEH"
FT                   /protein_id="YP_002360285.1"
FT   misc_feature    complement(78198..>78371)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:185998"
FT                   /locus_tag="Sbal223_4403"
FT   gene            complement(78610..78903)
FT                   /db_xref="GeneID:7090191"
FT                   /locus_tag="Sbal223_4404"
FT   CDS_pept        complement(78610..78903)
FT                   /locus_tag="Sbal223_4404"
FT                   /gene_family="HOG000118706" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08681"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF1778"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF1778; KEGG:
FT                   plu:plu0959 hypothetical protein"
FT                   /db_xref="GI:217975616"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="GeneID:7090191"
FT                   /translation="MKSMTNERITTRVSIESKELLEKAAALAGYASINSFIANTMISEA
FT                   KRLITQEHFLVLSKNDALAFVNALDAPVKSNSRFLNAARKHKETVNNENYPI"
FT                   /protein_id="YP_002360286.1"
FT   misc_feature    complement(78640..78882)
FT                   /note="Protein of unknown function (DUF1778); Region:
FT                   DUF1778; cl01845"
FT                   /db_xref="CDD:154623"
FT                   /locus_tag="Sbal223_4404"
FT   gene            complement(79273..79674)
FT                   /db_xref="GeneID:7090192"
FT                   /locus_tag="Sbal223_4405"
FT   CDS_pept        complement(79273..79674)
FT                   /locus_tag="Sbal223_4405"
FT                   /gene_family="HOG000237292" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975617"
FT                   /db_xref="GeneID:7090192"
FT                   /translation="MCKPSVTFEEMNTYLQGQYKHERLYGRTPATGWPADYATSVVSSH
FT                   MADLNANGIGYIGHHESATGQAIRYTVDEVKYSPRFFIVGYDSENDIAQKQCYFIDSAI
FT                   NIERARAKCLESANRYPIVRIKDLQGQFV"
FT                   /protein_id="YP_002360287.1"
FT   gene            complement(79676..80299)
FT                   /db_xref="GeneID:7090193"
FT                   /locus_tag="Sbal223_4406"
FT   CDS_pept        complement(79676..80299)
FT                   /locus_tag="Sbal223_4406"
FT                   /gene_family="HOG000000466" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: see:SNSL254_p_0132 hypothetical protein"
FT                   /db_xref="GI:217975618"
FT                   /db_xref="GeneID:7090193"
FT                   /translation="MTHSITTPASHTKPFSEQASLQATSRLSKDDIQQQKRGELTIIVL
FT                   TEMNFFHFCGLGLEGVANEAWYPYSQGLLFEAVERFLVAAKVAQNVVSIDQPRRNGASI
FT                   DYRVRFNVFSTDKKRVSVRFPVVIKNFGNDTQCLSVDELTRALSLNYRNKHVSIMWSLP
FT                   SGIISTVYVSVAADGEISDCYTHHALWFVMEGGCIELATNTGAI"
FT                   /protein_id="YP_002360288.1"
FT   gene            complement(80975..81196)
FT                   /db_xref="GeneID:7090194"
FT                   /locus_tag="Sbal223_4407"
FT   CDS_pept        complement(80975..81196)
FT                   /locus_tag="Sbal223_4407"
FT                   /gene_family="HOG000000465" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0034"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0034 hypothetical protein"
FT                   /db_xref="GI:217975619"
FT                   /db_xref="GeneID:7090194"
FT                   /translation="MSQRAIEIVKISDLKSVKQGEVFEWCIDYEEFQWRKGDSFLRSRT
FT                   GVDSPWEIWPLTDNTKTAANRKVFELIK"
FT                   /protein_id="YP_002360289.1"
FT   gene            complement(81227..81715)
FT                   /db_xref="GeneID:7090195"
FT                   /locus_tag="Sbal223_4408"
FT   CDS_pept        complement(81227..81715)
FT                   /locus_tag="Sbal223_4408"
FT                   /gene_family="HOG000000330" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0033"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0033 hypothetical protein"
FT                   /db_xref="GI:217975620"
FT                   /db_xref="GeneID:7090195"
FT                   /translation="MGKVTGIPFSEVKAQLMDNPEVVAAYEQAVQADEPIHIIPVQHSE
FT                   GVIMPINNIVSCTREGHHVYFSFVNLFGGHHYPVTMIFMPSGAVNVVVGGARYRCQANQ
FT                   VQRVIDESGLGHEGLACLKYLIEAGELNFHIPADVHEQLKEHPEFQKYRLIEWEDEEM"
FT                   /protein_id="YP_002360290.1"
FT   gene            complement(81717..82172)
FT                   /db_xref="GeneID:7090196"
FT                   /locus_tag="Sbal223_4409"
FT   CDS_pept        complement(81717..82172)
FT                   /locus_tag="Sbal223_4409"
FT                   /gene_family="HOG000130864" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0032"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0032 hypothetical protein"
FT                   /db_xref="GI:217975621"
FT                   /db_xref="GeneID:7090196"
FT                   /translation="MLFMVGIESPADEMQAFGIVIPVFEKLGYGCFSAADSQEEILFKA
FT                   KEAILLMAEEVINDGHLVDSLNEGYRDYQALHPKFDQWLALEVPIEALKAKQKRLNITL
FT                   SESQIVRIDSFVAFHREFKDRSDFLAKAADKLMNSADSVRSCSKVGD"
FT                   /protein_id="YP_002360291.1"
FT   gene            complement(82297..84177)
FT                   /db_xref="GeneID:7090197"
FT                   /locus_tag="Sbal223_4410"
FT   CDS_pept        complement(82297..84177)
FT                   /locus_tag="Sbal223_4410"
FT                   /gene_family="HOG000000464" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="ParB domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   son:SO_A0031 ParB family partitioning protein"
FT                   /db_xref="GI:217975622"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:7090197"
FT                   /translation="MTNSIQAQATHTKASISPASHETQAGSHKPDIAQKSATAANSVVA
FT                   LASTAKPVLLQLQINQLVLSEKNVRKENASKADDEQLYASILAHGILQNLIVEPMNVEG
FT                   LYPVLGGGRRLRQLIKAVKNNKLKPKTLVPVKLLTAEEVANYATELSMTENFTRAKMHP
FT                   VDEFHAFADMVNQGASIADVAARFGVTAKFVQQRMKLSMVAPVVLDAYKAGNVSLDVVM
FT                   IFTIASVEKQVEVWELAGDRHYNEHQFRNMLKAAAVSADHYLAKFVGQDEYEKAGGVVT
FT                   SDLFSDEVYLDDKALLESLATAKLEIEAAKLIARGWKWTQIKLVSEYDELAGFGLLDLK
FT                   EGEYDPAEMALAGCMLVLKSFGEPVSIYIGLVHKDDKKALAQLKASVQSDPLNVNVGDV
FT                   KKIEDKDTSGYSAALNDDLRAQRLIITKHALMSAPSVALDTLHFSVCVSAFTDSHYGSR
FT                   PLHISVNDTTCHPKTGALTDNKAVQLIEGVKASLNLAWVGLPTVAERFNAFCALDVKEK
FT                   EKQVAYATASMFEASIDNSHKAVEAVISTLDVKWSNYWRPTAETFFKRVSLSCLIDMAQ
FT                   PVMGEQWALQAAALKKKDLANQVDSLVNGERKGLDDAQKAYFDALMPAGF"
FT                   /protein_id="YP_002360292.1"
FT   misc_feature    complement(<83815..83985)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Sbal223_4410"
FT   misc_feature    complement(<83401..83955)
FT                   /note="PRTRC system ParB family protein; Region:
FT                   PRTRC_parB; TIGR03734"
FT                   /db_xref="CDD:163446"
FT                   /locus_tag="Sbal223_4410"
FT   gene            complement(84568..84801)
FT                   /db_xref="GeneID:7090198"
FT                   /locus_tag="Sbal223_4411"
FT   CDS_pept        complement(84568..84801)
FT                   /locus_tag="Sbal223_4411"
FT                   /gene_family="HOG000000463" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975623"
FT                   /db_xref="GeneID:7090198"
FT                   /translation="MNYIDNNTLSELDLLWLRKFKASKNLDTLLIQVTGAERKIDQDSA
FT                   LTYREKFDHLASINTAFCLRETEVKQLTGDWS"
FT                   /protein_id="YP_002360293.1"
FT   gene            complement(84816..85007)
FT                   /db_xref="GeneID:7090199"
FT                   /locus_tag="Sbal223_4412"
FT                   /pseudo
FT   repeat_region   complement(85009..86243)
FT                   /mobile_element="insertion sequence:ISSba3"
FT   gene            complement(85017..86176)
FT                   /note="ribosomal slippage"
FT                   /db_xref="GeneID:7090200"
FT                   /locus_tag="Sbal223_4413"
FT   CDS_pept        complement(join(85017..85922,85922..86176))
FT                   /locus_tag="Sbal223_4413"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /codon_start="1"
FT                   /ribosomal_slippage
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   son:SO_4581 ISSod1, transposase OrfA"
FT                   /db_xref="GI:217975624"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:7090200"
FT                   /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLYN
FT                   WKEKHEALKQGITLEESERDELKRLRKENKELRMEKEILKKGKRLLCERNEVRFRFIKQ
FT                   QSNLFPITLLCRVMSVSKSGYYDWHKRPANVISVETLKLYRLVRQLFKQSRGSLGNREM
FT                   VKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNPVSA
FT                   NEVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALIKAYNLRQPA
FT                   RGLVFHSDRGSQYTSKQFGRLLSSYGIRASMGDVGACWDNAVVERFFGSLKHDWIFKVA
FT                   QPTREFMKQDVTAYMKYYNLERLHSANDDLSPVEFENSQVKVSSLG"
FT                   /protein_id="YP_002360294.1"
FT   misc_feature    complement(85949..86167)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:186341"
FT                   /locus_tag="Sbal223_4413"
FT   misc_feature    complement(85047..85826)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:177368"
FT                   /locus_tag="Sbal223_4413"
FT   misc_feature    complement(85173..85511)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal223_4413"
FT   gene            complement(86246..86458)
FT                   /db_xref="GeneID:7090201"
FT                   /locus_tag="Sbal223_4414"
FT                   /pseudo
FT   gene            86871..87050
FT                   /db_xref="GeneID:7090202"
FT                   /locus_tag="Sbal223_4415"
FT   CDS_pept        86871..87050
FT                   /locus_tag="Sbal223_4415"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975625"
FT                   /db_xref="GeneID:7090202"
FT                   /translation="MSFLDKSLLDFLLKSISFGLKFLWGDAVNTCGFESIKSYLYFLFT
FT                   KLFPNFTHSFHVAV"
FT                   /protein_id="YP_002360295.1"
FT   gene            complement(87009..87926)
FT                   /db_xref="GeneID:7090203"
FT                   /locus_tag="Sbal223_4416"
FT   CDS_pept        complement(87009..87926)
FT                   /locus_tag="Sbal223_4416"
FT                   /gene_family="HOG000000557" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:DP2995"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dps:DP2995 hypothetical protein"
FT                   /db_xref="GI:217975626"
FT                   /db_xref="GeneID:7090203"
FT                   /translation="MSKIYKYFSNNVIELVFQKKGFCGIKCSLPQDYNDPYELFLGMDL
FT                   NTPADQLAFYNDIISGIPQSPTTCFSKSPIVSPMWAHYANNHTGFVLEFDLDKLQEHFI
FT                   GNPIWDVTYRNAPSEHLQPILQRAAVLKKPRHSYALQEYVFVESYFAKYDDWKYEQECR
FT                   FVDMKKVSEKVAGNDILYIPSDLVTSIIIGSKYPKENINLTKEIAKKNELTWYELVIGK
FT                   SHPKPYMKNESGNVFTFSQSDILIAPNTCNSCLEPLVAESDLCPWCSITEAHKDEAARS
FT                   NPFRMLSSMGQLDSYMKAMSKIGK"
FT                   /protein_id="YP_002360296.1"
FT   misc_feature    complement(87435..87692)
FT                   /note="Protein of unknown function (DUF2971); Region:
FT                   DUF2971; pfam11185"
FT                   /db_xref="CDD:151627"
FT                   /locus_tag="Sbal223_4416"
SQ   Sequence 88311 BP; 25746 A; 20359 C; 18818 G; 23388 T; 0 other;
     GCTCCGCGCT CAATAAGTTT TCTGATTTCA TCTTAAAAAG ACAAAGTGAA AATTTAGCTT        60
     TTGTGGCGCA ATTTAACATT ATGGTTATTG TGCGCATCGC GTTATGACCA CTCAATCAAT       120
     ATCACTATCT AACGCCTCAA AACCACAGGT TTACAGCCCC TAAAATCACG AAAAATAAGA       180
     ACTCAATAAT TGGTCAATTT CACCATTTTG GTCATTCAGC TAAAAATAGC CCTCAAAGGC       240
     TCAAAATGGT AAAATGGTAA AATGGCTCAC CATCTCTTAC TTTGATATGC ACAGCGTGAA       300
     CTCTAGCTAT GATTTTTGTG ACGTGCTCGA TAACGCACTC TTACACCTCT ATTTAAGCGT       360
     GGCTGAAACA GAACGCTTTA CCCCTAAAGC AAAGCGTAAT GACATTTTGA TCCGCTACCT       420
     AAAACCAATG ATAAAAGATA AGCACTATCA GCAAGCAAAA AAGGAGATAA GAAGCCTGAT       480
     ATCTCTAGGG CGTATTGCCT CGTATGATTT GGAATCTAAA ATTGTTGGGC TTTATGAGCT       540
     GTCGCAACGT TATGACCAGC AAGCGACGAA AGCAAAGCAG TTGTTTGACT TGTTGACGTT       600
     CATTGAAGCT GAGTTAACGC TACCCACCAG ATTCTTAAAT GTAAGGGGTA ACGAGCGAAA       660
     ATTACCGAAC ACCATTTACA TGTTGCAAGA GCACATAGAA AACGGATTTA CAGTTTCAGG       720
     TGAGCAGGTT GCACCAGTGT CACTGTTTTT AGAGTCAGAT AAGGTAATAG ACGTAGTTGA       780
     TTTAGTGAAT GCCAAAGGCT TGTTCTTGGC TGAAATACAG CAGCATAATG TTGACGAAAA       840
     ACAAGGTCAT CTTATGCTGC ACCCTAAAAA GTAGGCATGT GTGTAATGGC TCACAATCAG       900
     CGACTTAGCT GAGTTATTTT CTGTGTCGAG ACCAACGGTC TATCGAATGC TTTTACGAGG       960
     AAAAAAATGA TCGATCTAAC TGCAGAGCAA AGACACTTGG CAAAAATAGT TCATGATTAT      1020
     GCTTGTCGGT TTCCTCTGAC AGAGGAGGGT GACGCTCAGT TATTGAAAAG CTGTTATGAC      1080
     TATATGGACG CCTTTAAGCG GGTGATGGAC TGCGCATCAA AAGTCCAGAT GGACTACATT      1140
     TGTCTGCAAT ATCCGGGGTA TTTTCGCTTT GCGAAATGGA TGGAGCGTTT AGCACAAGGT      1200
     ATTGCTGTTG GTGTCATTGA TATTCCCAAA GATCACTAAA AATAAGTCAC AAAATTTTGG      1260
     CGGCTTCGCC GCCCTTTTCC GTTTATGGGG TTTTACGCCC ATCCCCTCGA AATTAGTATT      1320
     AAAAACATGA TCTTGTCAAA TTAGGGTCAA AGAGCACTGG ACCCGTCCTA CCTTGGTTAA      1380
     TTGAAAAGCG AATTAACCAG GGGAGATCCC ACCCAACCGA TCACCAGATT TTTAAACGAC      1440
     AAAAAACTGC AAACACAAAA AATTGAAATG GGGCGATTAT ATCCTCTGGA TAGCATTCTT      1500
     TATTGTCTTT AGTGCTCTGT ATTTACTATA ATGTACTTAC AAATGTAACT ACACCGTGAG      1560
     GCAGTATGGG CACTATTAAT ATTCGCATCG ATGACGAGCT TAAGGAGCGT TCTTTTGCTG      1620
     TGTTGGAAAA ATTAGGCGTT AGTCCCTCTG AGGCATTGCG GCAAATGCTT GAGTATGTCG      1680
     CCACAAGCGG CGCTATGCCA TTTAAACCCG TACTGCTAAC AGCAGAGGAT GAAGCCTTGA      1740
     TCTCCTTGGT TAAAGAGCGT TTAGCGAGCC CTCGAAAGGG GATCGAGGTT TCGCTCGATG      1800
     ATCTATAAGT TAGTATTTGA TCCCCGCGCA TTAAAGGAAT GGAACAAGCT TGGAGATCCC      1860
     ATCAGGCAGC AGTTAAAAAA GAAACTGGCC GAGATACTGC AACATCCTCA TATCGGGGCT      1920
     AACAAACTTA GAGATCTCCC TGACTGTTAC AAAATCAAGT TGCGTACATC AGGTTATCGC      1980
     TTGGTATATC AAGTACAAGA TGAACGCATT ACCGTGTTTG TCGTGGCCGT AGGCAAGCGT      2040
     GAACGATTAG CGGTGTATTC AACAGCAGAA AAGCGCCTTT AAATGAGGTA TGAATCAGTT      2100
     CTCTAGAGAT TTGATTCATT TTAGGACAAA AAAAAGCCCC GTTGGAAGGA AGAAACGGGG      2160
     CGAAATGGGT CTGTTTTAAG GTCAGCGTGA ATCAGTCAGG GGCTTTGTTT CCTAAATAGG      2220
     TTGAACTAAA ACCGTAGCCG CAGATCTGAT CGGCATCGCC TATTAACTTA CCCATCAACC      2280
     GTGTCAAAAC CTCGCTATAA AACAACCAAC TGGAAGCAAT ACAACCAAGC CTTAATCAAC      2340
     CGCGGTTCAC TTACCTTCTG GATTGATGAG GATGCAATTG CTAAGTGGAA AGCCAAGGTC      2400
     GAGCAGCCCA AGAAAGGTCG CCCTCAAGTG TTTAGCGACT TAGCCATTAC CACTGCGTTG      2460
     ATGGTTAAGC GTATTTTCTC TATGCCACTG CGAGCCTTAC AAGGCTTCAT CAATTCGGTG      2520
     TTTAAACTGG GTGACATCCC ATTATCTTGC CCGCATTACA CCTGCATCAG TAAACGCGCG      2580
     AAAACGGTCA ATATTGCTTT TAAAACCAAG ACTCGCGGCG CCATTGAGCA CTTAGCTATC      2640
     GACTCGACAG GCTTGAAGGT CTATGGCGAA GGTGAGTGGA AAGTGAAGAA ACATGGTACA      2700
     GATGGAAAGC GCCGAGTGTG GCGTAAACTG CATATTGCCG TAGATACGCA TAGCCATGAA      2760
     ATTATTGCCG CAGAACTCAG TTTATCAGGT GTCACAGACG CTGAAGTGAT GCCCAATTTA      2820
     CTTAAGCAAA CCCATCGAAA AATCCGCAAT ATCTCGGGTG ATGGTGCTTA CGACACGAAA      2880
     GCCTGTCACG AAGCCGTTCG TCGAAAACGC GCTTTAGTGC TCATTCCACC TAGGGAAGGT      2940
     GCTGCGCTAT GGGAACAAGG GCATCCACGA AACTTAGCCG TCAGTTGGCA ACAGCTTCAT      3000
     GGCTCAAATA AGCAGTGGAA AAAACGGTAT GGTTACCATC GACGTTCAAT CTCAGAAACC      3060
     GCCATGTACA GGATAAAACA ACTGTTAGGA GGCACATTGA GCATGCGTAA TTATAACGCT      3120
     CAGGTGGGAG AAACTTACGC TATGATTAGG GCTTTGAACA AGCTTACTGG GCTAGGTATG      3180
     CCTGAAACCC ACTATGTAGC TTGATATTTG AACAATGATG AGAGTTTTGT TCGCTGACTC      3240
     GATTTAGGAA ACAAAGCCGC TCCAAGTTGT AATATTTCAT GTAAGCCGTC ACATCTTGCT      3300
     TCATAAACTC CCTTGTTGGT TGTAGTGATG TGATGGACGC CTCAGCACCT AAGCTTGCAG      3360
     TATTATGCCA AGCTTGAAGC TGACAAATAG TTCTGGAGGT TTCCATCATG GATATTAAAG      3420
     TTATTGGTAT CGATTTAGCC AAAAATGTTT TTCAAGTTTG TGTTTGTCTT ATGGATAACT      3480
     CAGTCATGAC TAACAAAAAG GTTAACAGAA ACAAACTGCT CGATAAAATT AGACAATTCC      3540
     CCGAAGGTAG TCTTATTGCT ATGGAGGCCT GTGGTACGGC GCATTACTGG GGAAGACAAT      3600
     TTCAAGCTCT TGGTTATCAA GTGCAATTGA TCCCTGCTCA ACATGTTAAG CCATTTGTTG      3660
     CAAACCAAAA GAATGATGCC AACGATGCCC TCGCTATATG CGAAGCGGTT TTCAGACCTA      3720
     ATATCCACAT GGTTCCAGTT AAAACTGTTG AGCAACAAGA CATTAAAGCA TTACGTTGTG      3780
     TACGTAGTCG TCTCGTTCAA AATCGAACCG CCATGGTCAA TCAAATTCGA AGCCTAGCGA      3840
     GCGAGTCTGG TGTGATCTTC TCTGTCGGCA GGTTGCAATT ACAAGCGTCA CTTAGCCGTA      3900
     TTTTAGCAAA TAATGAGCAT GAACTGTCTC ATACGCTTCA TTACCTGTTA AAACTTTTAT      3960
     ATGAAGATTT ATGTGTTTTA AATGAGAGAA TTAATCAAAT CGAGCGCGAC ATTAAAGCGC      4020
     TATGTCAAAT CCAACCTCGC TACAATGCAT TGCTGTCGAT CCCTGGCTTT GGACCATTAG      4080
     TCACAGCAAG CTTTATGAGT GAATTAGGTT CGGGTCATCA ATTTAAAAAT GGCCGGCAAT      4140
     TATCTGCATG GTGTGGCTTA GTGCCATCGC AATCGAGTTC TGGTGGAAAA GTTCGACTAG      4200
     GATCGATCAC GAAAAATGGC AGCTCAGAAC TACGTGTTTT ACTCATCCAT GGCGCCAGAG      4260
     CCGTTGGCCG ATTTGCGAGC AAACGTGATG ATAGACTTGG GCGATGGTTT AATGCACTTG      4320
     CGTTAAGGCA AGGTCGACAC AAAGCCGTTG TCGCATTGGC CAATAAAATA GCGCGTATAG      4380
     GATGGCGGAT CCTCACGAGT AACGATAATT TCGACGTTAA TAAAGCGTTT GCGTAAGACG      4440
     TTAAGCATCA CGTAAAAGTT TACATGCACT GATGAATAAA CGGTCAACCG TACCTATTAG      4500
     AGCCTGACTT GACCAAGGCA TTAAATGCCG ATGTAGTGAT AAGGTAATAG GTTTCGGATT      4560
     TACATCATGG CGCGGGTAAA AAGCCTATTT AGACGCCGAA TATATGGTAG TGAACCAATC      4620
     ATTCAAAAGT GTTGTAAAAG CTGAGGCGTC CATATATGGT CAAGTAAAAT TGGCCACGGT      4680
     TTTAGAGTCA TTCCAATATA AACGTTCTGA CTCATTTGGC GTTAACCCAC CATTATATTG      4740
     ATGGGGTCTG GTCTCACTGT AATATCCAGT GATGTAATTT GTGATCTCTT TATCTGCTTC      4800
     TGTAAAATTC CCATAACCAC TGGCGGGTAT CCACTCAGAT TTCAAACTTC TAAAGAAACG      4860
     CTCCATTGGT GCGTTATCCC AACAATTCCC GCGGCGACTC ATACTTTGCT CAATCTGAAG      4920
     ACGCCATATT AATTGTCTGA ATTTCAAGCT TGTGTAATGC GAACCTTGAT CGCTGTGATA      4980
     TATCACATTC TCAGGCTTAC CCCTTAACTC AAATGCCATT TTCAAAGCTT TACAGGTCAG      5040
     CTCACTATCT GGTGATAATG ACAAAGCCCA TCCAACAGGT TTGCGGGAAA ATAAGTCTAA      5100
     AACAACGGCT AGATAGGCCC AACGATTACC GACCCAAACA TACGTCACGT CGCCACACCA      5160
     CACTTGATCT GGTTGAGTTA CTGCAAACTG TCGATTAAGC GTATTGGGGA TTGCAACATG      5220
     CTCTTGTGTC GCTTTCCGAT AAGAATGCTT AGGCTGCTGA CAGCTTAATA ACCCAAGCTT      5280
     TTTCATTAGA TTACGGGCTC GATAACGACT GAGGCCAATC CCTTTGTTAG TCACTAATTG      5340
     CGCTATCGTT CGAGCACCGG CAGAGCCATG ACTAATACGA TGTGCGGCCT TCACTTCACT      5400
     GCATAAAATA GTAAAGTCTG CATCAATATT TTCTTTTCTT TTTAGCCAAT ACTTATAGCT      5460
     ACTTCGATGC ACTTTGAATG CATTACAAAT TGTGAGAATA GAGTGGCTCT GCTTGAGTGC      5520
     GCTGATTAGC GTAAATTGTT CATCGAGTCT GACATCAAGA GAGCGGTAGC CTTTTTTAGG      5580
     ATAAGATTGT GCTCCTCAAG ACGAGCTATT TGCTTCTTCA GCTCACGGAT TTCAATTTGT      5640
     TCAGGGGTAA TCGGAGATGC TTTTGGTGTG CCACCCTGGC GTTCTAGTTT TAACTGTCTC      5700
     ACCCATTTAT CCATAGTGGA TTTACCTACG TTCATCGCCT TTGCAGCTTC GATGATGCTA      5760
     TGGTTTTTAT CAAGGACTAA TTGGGCTGCT TCAAGTTTGA ATTCAGCACT AAATGTTTTT      5820
     CTGGTTGTCG ATCTCATGTG TTCACCTAAA GTCATCTACG AGGTAATAAT ATCACCTCTA      5880
     TTTAGGTGGC CAAAATTAGT GTGCCACTAC AGGTTGAGCA ACTTTAAAAA TCCAATCGTG      5940
     TTTCAAGCTA CCAAAGAATC GCTCAACAAC GGCATTATCC CAACACGCAC CCACATCACC      6000
     CATGCTGGCT CGGATACCAT AGCTCGATAG CAACCTGCCG AACTGCTTAC TGGTATATTG      6060
     CGAGCCTCGG TCACTGTGAA ATACCAACCC TCTGGCCGGT TGGCGCAGGT TGTAGGCTTT      6120
     TATTAATGCC TTAGATATCA AATCTGTGGT CATGCGTTTG TCTATGTGCC ATCCCACAAT      6180
     CCGGCGTGAA TATAAATCCA TCACCACTGC CAAATACATC CAACCTTCAC CTGTCTTTAA      6240
     ATAGGTCACG TCACCCGCCC AAACCTCATT AGCCGATACG GGGTTAAAGT TCATGTTTAG      6300
     CAGGTTATCA GCCACAGCAT CTGAGTGTTT TCGCTGCGTA GTCACCTTGT AAGCGCGTCG      6360
     CTGGGTTGCT TTGAGTCGAA GGCGGTGCAT AATTTTACGA ACGAGATAGC GACCAACCTG      6420
     GTAGCCTTCC TTGCGCAATT TCTTCACCAT TTCACGATTC CCTAAGCTGC CTCGACTTTG      6480
     CTTAAATAGC TGTCGAACAA GGCGATAAAG CTTCAGTGTT TCAACGCTTA TCACGTTTGC      6540
     AGGGCGTTTA TGCCAATCGT AATAGCCTGA CTTACTGACA CTCATTACTC GGCATAACAG      6600
     TGTTATAGGA AACAGGTTAG ATTGCTGTTT GATGAAACGA AATCTTACTT CATTTCTCTC      6660
     GCAAAGAAGG CGCTTGCCTT TTTTAGAATT TCTTTCTCCA TGCGTAATTC TTTGTTTTCT      6720
     TTACGTAATC TCTTTAGCTC ATCACGCTCA GACTCTTCTA AGGTGATACC TTGTTTCAGG      6780
     GCTTCGTGTT TTTCCTTCCA GTTGTAAAGC AGGCTCGTGC TAACTCCAAG AGACTTTGCC      6840
     GCATCGGCAA CGCTATAACC TTGTTCTAGC ACCATCAAGA CGGCTTCATC TTTAAATGCC      6900
     TGCGGATAAC TCTTATGTGA TTTCTTCAGA CTCATATAGA CCTCTTAATT TATTGACCAT      6960
     ACTGTCTCAA AATTAAGTGT CCGATGGAAT TAGACCAGAA CAGTTTACCA CTGGCACTAA      7020
     ACCTATCACG GTAGACATTT TAGAAGCCAC CCTATCCAAG CGTATCGATG ATATTGAGCC      7080
     ACGGCTCATT CGGCACGGGT ACTCAGATAA AGTGTTGGTA GAACAGTTCA ATTACAAGCT      7140
     TGCAGAGGTT CGCCGATTTT TCAAAGGCGA ATTGGATGCC AATAGAGCGA AAGACATTAC      7200
     CCAGGATTTA AGAGAAGCAG GCCTACCGAT ATAAGGCAGA TGTTGCATCA ATGATAGAAG      7260
     ATGTTCATCG AAGCACATAT CAACCAAAGT ACTGAAGCCT GTGGCTTGAA ACCACGGCAA      7320
     GGCTGTTTGA GCAGAATACG ATGACTTGGG ATGTCCTAGC CCAGCTCAAG GTTTTTATTG      7380
     GCAATTAATG TGAGTCCGGC AAGATGAATG CAAGCCCGTT GTTAGTTAAT CTGAGTCGGC      7440
     GGTCCCGCTT ATTATCAATT AATGTGAGTC CATTTGAGCG GATGTAATCG CGCCGAAGGG      7500
     ATTATGTGTG CAAGCCGCTA CAATTAGCAG GGAGTTTTCC CGCAATACGG GTAAACGTGG      7560
     CTATCGCTTT AAACAAGCTC AAACATCAAC AATTAGACGC CGATTAGCCG CTTGTAAAGC      7620
     CATTAAAATG ACAACAACGA CCGTTGAGTT AATTGAATCA AAAATCAACG CGAAATGGAG      7680
     TCCAGAGCAG GTGTCGGGGT GGCTTAGGGA AGACCAGTGC ATTGATATTA GTTATGAAAC      7740
     CATTTATAAG CACATTTGGT CAGACAAGCA AAATGGTGGC CATTTATTCC AACAATTACG      7800
     CAGAAAAGGT AAGGCTTATC AATCACGTAG TAAGGATAAG CAAGCCGGCA GAGGGTTTAT      7860
     TAAGAACCGT ATAAGTATTG ATGAGCGCCC ACATGTTGTT GATGATAAAA GTAGGGTGGG      7920
     TGATTGGGAA ATTGACTTGG TTATAGGCAA AGGGCACAGT GGCGCACTGG TCACGATTGT      7980
     AGAGCGGAAA ACGAGCTTTA CCGTTTCAAC ACGTGTAGAT GACAAATCAG CAAAAACAGT      8040
     AACAGCAGCC ACCATCGCTT TGTTAGCGCC GTTTAAAGGC GCGGTGCTCA CTATAACGGC      8100
     GGATAATGGT AAAGAATTTG CGTACCATGA AAAGATGACA GAAAGTTTGA AATGTGATGT      8160
     CTATTTTGCC GATCCTTATT GTTCATGGCA ACGAGGATTG AATGAAAACA CCAATGGCCT      8220
     ATTACGACAA TATTGGCCGA AATCAACAGA CTTTAAAAAG GTATCGCAAT CAGAGGTTCA      8280
     GGATGTAATA GCCAATCTCA ATGATAGGCC AAGAAAGAAA CTAAATTATA AAACACCAGC      8340
     CAAATTAATG GCTGAACACA TGGTGGCTAT AGCCGCTTAG AGGTTATGCA CTTCAAAGTT      8400
     GAATCTGCCA GTTACTATAA GTATAATGTT ACGCCAATAG GTTTTTTCAT TAGAGCCAAA      8460
     CTTAAATATT AAAAAAGGAA TTTCTTATCA AAAAACATAT TTACTTTCCT GTAATAATGG      8520
     TCGCCAGTGC CCATGCAAGC GCTATTCAAC TCAATTCACC AAGATATCCA GAAATAGAAT      8580
     CTGGTTTAAA TTACTACACA AGTGAATCAG CCAATGTTCT AACCAAGCCT TTAACAAGTC      8640
     TCGACATCTA CAACAAAGAA ACAAATGAAA TAGAACGACT ATCACATGAT GGTTTCAGTA      8700
     TTAACGGTAT AACAGTAGCG ACTGAGGGTA GCTCAGTTAT AATCAGTAAT AACACTCCTC      8760
     GTCACTTTAC AGAAATAGCG ATTACTGACG ATATAAATGG ATTTTTAATA GACGAAGAGT      8820
     TAAAACCATT TACATCACTT ACTTTTGAAT CAAATTTGGC TTCTGGTGAA TTACACTTTA      8880
     TGGACCCAAA TACGCAGTTC AGATCATCTC CGTCGAAATT TGAAGGCAGC GCTACCCATC      8940
     CAGATATAGA AAGCTACAAT CTATTTCTTA GTCACCTAAA ACAGTTTTAC TCTAAACCAT      9000
     CTACCGAAAC AGATTTCTTC GATTTTTTTG AAAATAGAGG TGAATCATCA TCTGAAATCC      9060
     TGAGGAAATG GAACAAAACG CTATCTTACG ATGTACCAAA AACTTACAGA GTTAATGTAT      9120
     CAAACAGTGC TGGCGTAGCG AGTGACAGCT GGTTATCTAT AAATTGGCCT ATGGCTAAGT      9180
     TCAATAATGA TCGTGAATAT ATATATCCTT ACGTGGTCTT CTCACATGAA AACGCGCATA      9240
     CACAGGGTTT TAACCATAGC AGTGGACTCG CTTATGGGTG GGATGATTAC GTATCGGCTG      9300
     GCATTAAAGA ATTATTTGAA TCAGACGATG TAATACCAGG CATTGTTGCA GAGGAAAGCT      9360
     CTGAAATTTA TGCCAACTAC AATCTAAAAA ATCAATCTCT AGTACTATTT TCAAATTCGG      9420
     TACAAAATGT TGATAGTATT AGCGCTATTG GTGATATGGA TACACTTAGA TTTTCAGGTG      9480
     TTAGCGACAA TAAATATCTC ATTGAAATGG GAAGAAAGTC ACTTTCTGCA ACCACATTTA      9540
     ACATTACTTA TGATGGAGAT AAAAAATTCA CATACATCGT TGATGATGTT TATGGTGAAA      9600
     AAATCCAAAG CGAGCGTGAC CCGTATTATC TAAAACCTGA TGAGAAGCTA TCGTACCATT      9660
     TCGAAACAAC AGGCAAAATA ATCTATTACA TACCCGAGCA AGATAATGTA TTAGCACATG      9720
     ATACTGCCAG TCAGCGTAGT GAGGCGGTTT GGAGTGGCCC CGCTACCCCA ACCAACATCA      9780
     CTATACGCAT CAAGAATACA AGTGACGGTA AGTATTACTC GCTAGATTTG TCTGCTGAGA      9840
     AAGGCGGTCG CCATCAAATG CATCAAGGCG CTTACAGCAG TATACTGTAT ATATCTAAGC      9900
     AAGAGGGTAG CTACAATCAG CTACCCGACG GTGATTACAC TAGTTCATTT GAGGTTGTAG      9960
     CTGCAGGTTG GCACAATCAA AGTTACCAAA AATCATTTGA AGTTAAAGTT GAATTCAGCA     10020
     AGTTCGAAAC GGAAGTTGAT AGACTTTGGC TAGATGATTG GTCAGATAAT TACAGCAAGG     10080
     AGACACCATC AGGTAACTCA TCTGTATACT TTTATGTGCC AGAAAATGAC AACGTCATTT     10140
     CTTCAACAGG TCCAAGAAAA GCATCAAAAG CAGTATGGTC TGGTCAAGCT GGCGTAACTA     10200
     GTGTTGTAGT TAATGTTACA GGCGAAGATG GAAAAACTTA CCCTGTAAAC TTAATAGGGA     10260
     ACAAAGAATT TCGCGGTCTA GCGATTAAAA TGGAAGATGG TGTTCAGCGT GGTTATGGGA     10320
     AGTTAAGATT TAAAATAGAT ACTACATCTG ACACCTATAA TGATTTGCCT GAAGGCATGC     10380
     ATTATAGAGC CAATTTTAAC GTTGTAGCTA AGGGGTGGCA TGATACTAGC TTCTCTGAAT     10440
     CCGTCCTGAT TAATGTCGAA TTTAAAAAGT AATATTTGAT TAAACAAAAG CCTCCACGTT     10500
     GGAGGTTTAG TTAGATAACT AATTTAGCGT GTGCAGTTGT GTAGTGGCAC ACTAATTTTG     10560
     GCCACCTAAA TAGAGGTGAT ATTATTACCT CGTAGATGAC TTTAGGTGAA CACATGAGAT     10620
     CGACAACCAG AAAAACATTT AGTGCTGAAT TCAAACTTGA AGCTGCCCAA TTAGTCCTCG     10680
     ATAAAAACCA TAGCATCATC GAAGCTGCAA AGGCGATGAA CGTAGGTAAG TCCACTATGG     10740
     ATAAATGGGT GAGACAGTTA AAACTAGAAC GCCAGGGTGG CACACCAAAA GCATCTCCGA     10800
     TTACCCCTGA ACAAATTGAA ATCCGTGAGC TGAAGAAGCA AATAGCTCGT CTTGAGGAGC     10860
     ACAATCTTAT CCTAAAAAAG GCTACCGCTC TCTTGATGTC AGACTCGATG AACAATTTAC     10920
     GCTAATCAGC GCACTCAAGC AGAGCCACTC TATTCTCACA ATTTGTAATG CATTCAAAGT     10980
     ACATCGAAGT AGCTATAAGT ATTGGCTAAA AAGAAAAGAA CATATTGATG CAGACTTTAC     11040
     TATTTTATGC AGTGAAGTGA AGGCTGCACA TCGTATTAGT CATGGCTCTG CCGGTGCTCG     11100
     AACGATAGCG CAATTAGTGA CTAACAAAGG GATTGGTCTC AGTCGTTATC GAGCCCGTAA     11160
     TCTAATGAAA AAGCCAGAAT TCAGATAATA ACTGCGACAC TCTAATCGAG GTGTAGAAGA     11220
     AGCCAACTGC TGAAAAGTGG TACGCTTTAT CTGGTTTTGT CGCAAAGTTG ACGATGTAAA     11280
     TCATAATGTT AATACTATTC CGATATTTCT CCGAGTCTCA ATAGCATGAC AATCAACTTT     11340
     TCAGGACGAC ATTATCCACC AGATATCATC ATGATGGCGT TGCGTTATTA CCTGGCTTAT     11400
     AAACTCAGTT ATCGTGAAAT AGAAGAAATA TTCGCTGAGC GTCATATTCA TTTTGACCAC     11460
     TCAACCTTGA ACCGGTGGGT GATTAAATAC GCACCGCAAC TCGATGCTAT ATTCAGGAAT     11520
     AAAAAACGTC GAGTCTCTGG CTCCTGGCGA ATGGATGAAA CCTACATCAA AGTAAAAGGT     11580
     CGCTGGGTTT ACTATTATCG AGCTGTCGAT AAGTATGGTA CTATTATTGA CTTTTATTTG     11640
     AGTGAAACCC GCGACGAGTC AGCTGCTCAG GCATTTTTCA ACAAAGCCAT CAACCAACAT     11700
     GGGTTGCCAG AAAAGGTTGT TATTGATAAA AGCAGTGCTA ATGCTGCTGC ATTAGATACG     11760
     GTCAACCTTC GCCTTTGGTT ATCTGGGAAT ATGCTGTTTA TGATTGAAGT ATTGGCAATC     11820
     AAATATCTGA ATAATATTGT CGAGCAAAGC CATCGAAAAG TGAAGGGAAA AATGCATCAA     11880
     TGTCTAGGAT GGAAATCTTG GCTTGGTGCA GAGGCAACAT TAGCGGGTAT TGAAGTGTGC     11940
     GACATGATTA AAAAAGGTCA GATGATGAGC GCTGAAAATA TGACACCATG GGAGCAGTTT     12000
     TATGCTTTGG CGGCATAGTT GTATCTGAGA GGGCTTGCGC CCTCAAATTA TAGCCGCAAG     12060
     ATATCAGTTT GCGACAGAAC CCCGTTTGCC ATACACCTGT TGTAAATCAT AAAATAAACA     12120
     TTAATATACG CTTTCGGGCC ATTGGACTTC CTCTCTCCTT TAAAAGGAAA AATCATATCA     12180
     TGAACAAAAC ACGAGTATTA TGCGCTACAG CTATGCTTTT CCCACTTTTG GTTAATGCAG     12240
     GGATGACACA AGATGCAAGT CATAGCGTTT CAGATAAAGT AATAGAAAAT CAAAGAACTT     12300
     CATTGGCTTC TAATACTTTA GGTAAAGGTT ATGGTCCTCA GTCACCAAGA GATATAGATA     12360
     GTATTCAAGG CAATAACAAG CGCATATTTT CTGAAGCTCC TGACTACATG GAAATGAACT     12420
     TATGCAATAT ACATTTCCAT AAGAATGCCG AGCATAAAGG CGGGGAGTTC ACCAAATATG     12480
     CCGGCAATGG TGATGGCCAC GGCTACCAGA CCGGTTATCA ATATACTGGT AAGTTATCTA     12540
     AAAAAGAGTT AAGCCCCCTT AAACATGAAG TCGGTGCGAG TCAACACGGT AGCCTGCATC     12600
     CAGGGGATAC CATTGAAGTG CATTATGTCC ATTCAACCGC TAAAGTGAGC CCAGGTCCGA     12660
     CTCTGGGAGC TTGTCTCAGT AAAGCGAATA GCAACCCTCA GCTCCGAGTA GAAACTCAGG     12720
     TATTTGTGCT AGTAAATGAC GCTAAAGCAA TGAGTTTTAT GGAACTGACA AAGTTAGGCA     12780
     TTAAAAACGG ATTTAACCAG GCCCTAAATA TTCCAAACAA TACTGGCGAG CCAGTGGAGT     12840
     ATGAAGGTTC AACCACCGGT CCAGGTTATA ACGAGATCGC TTCACCACTA CAGGTGAGCT     12900
     GGAGCGTACG TCCAAAAGTC ATGAAGGTAG ACATTAACAG CGTAGGTCAA TGGTTAGAGG     12960
     GCAATGTCTT CGATGAAGAT CATGCCCACG GAGTTAGAAA CCTAGTAATT AATCCAGATC     13020
     TACTCTCTGC TGAAAGTGAC TAGTCTGGAC AAGCATGCCA GAAGCGTAAC TGATAAGGGG     13080
     TCGATCAATT CAGCCCCTTT GTTTAGCTCT GTCGTAAAGT TGACGAAAAA ATAACTATCT     13140
     CCCCCCGACA ACTTCTCTTG ACGTTTTGAG TACACCTAAA GTGCACCTCC CAATCAAAGT     13200
     GCACTATTTT GCATTTTTAT ATGTATAATG CACCCACATA TAAACACCTA TGTAAAGTGC     13260
     ACTCATTGAG GTGGTCATGC GGATCTACGG ATATTTAAGA GCATCAACAG CTGAACAAGA     13320
     CGCCAGTCGA GCTAAAGAGC AATTATCTGA CTTTGCCAAA CAAATGGATT TAAACATTGC     13380
     ATGTTGGTTC GAAGAGAATG AATCGGGCGC CAGCTTAAAG CGACCAGAGT TATTTCGGCT     13440
     GCTTGATGTT GCGCAACCAG GGGACGTTCT TCTGGTTGAA CAAGTAGACC GCATAAGTCG     13500
     ATTGGATAGC CATGACTGGG AAACGCTTAA AAGCCTCATT AATCAAAAAC GCATAAAAGT     13560
     CGTATCGATT GATTTGCCAA CGAGCTATCA GTTTATGAAA AACACCGATA CATTTACCGA     13620
     GCGGATGATG TCGGCCCTCA ACAGTATGAT GTTAGATATG CTAGCCGCAG TCGCACGTAA     13680
     AGATTACGAA GATAGACGCA GACGACAAGC CCAAGGCGTT CAGCGGGCAA AGCTAGCCGG     13740
     TAAGTATAAA GGCAGACCTG AAGATAAAGT GCTGCATCAA AAGATTGAAG GGTTGCTCAT     13800
     CGATGGTAAA AGTTACAACT ACATTGTGGA TCTATTAGGC TGTTCTAGGC ATACCATTTC     13860
     AAAAGTAAAA AAACGATTAA CTTAGAAAGA TATGCAACGA TAAACAGAAA ATGACGTCAA     13920
     AGTTGAATAT ATAAGACTTG AGTGAATGAA TATGGCTAAT GAAGCCCCTT CCCTATCAAT     13980
     AGAAGATGAA TGCGTTTTAG CCTCTCGTGA GCATCAACGT ATGTTTACCT CTCGTCACCC     14040
     GTGTGACGGA TGCGATAGTC AAACCCCTAA ACGGTATGCC ATTAGTGGGA AATGCATATC     14100
     TTGCCAAGCA GCAGGAAAAA GACCAAGTAC AGATAAGCGT AACTATTGGA ACCCTGGATA     14160
     TCATGACTTA AAGATGCACA ATGAAATTAA ACACATCAGT TTAATGCTAG ATATTTTGTC     14220
     AGAGCGTCAA CGGATTAAAA TCAGTTCGTA GTAGCCCCAA TATTGCGTCA GTAAACGCAG     14280
     TGCGCACAAT AACCATAATG TTAAATTGCG CCACAAAAGC TAAATTTTCA CTTTGTCTTT     14340
     TTAAGATGAA ATCAGAAAAC TTATTGAGCG CGGAGCGCAA ACTTACGACC ACCGCAAATG     14400
     TTAAGGTTCT GTCGCAAACT GATATCTTGC GGCTATAATT TGAGGGCGCA AGCCCTCTCA     14460
     GATACAACTA TGCCGCCAAA GCATAAAACT GCTCCCATGG TGTCATATTT TCAGCGCTCA     14520
     TCATCTGACC TTTTTTAATC ATGTCGCACA CTTCAATACC CGCTAATGTT GCCTCTGCAC     14580
     CAAGCCAAGA TTTCCATCCT AGACATTGAT GCATTTTTCC CTTCACTTTT CGATGGCTTT     14640
     GCTCGACAAT ATTATTCAGA TATTTGATTG CCAATACTTC AATCATAAAC AGCATATTCC     14700
     CAGATAACCA AAGGCGAAGG TTGACCGTAT CTAATGCAGC AGCATTAGCA CTGCTTTTAT     14760
     CAATAACAAC CTTTTCTGGC AACCCATGTT GGTTGATGGC TTTGTTGAAA AATGCCTGAG     14820
     CAGCTGACTC GTCGCGGGTT TCACTCAAAT AAAAGTCAAT AATAGTACCA TACTTATCGA     14880
     CAGCTCGATA ATAGTAAACC CAGCGACCTT TTACTTTGAT GTAGGTTTCA TCCATTCGCC     14940
     AGGAGCCAGA GACTCGACGT TTTTTATTCC TGAATATAGC ATCGAGTTGC GGTGCGTATT     15000
     TAATCACCCA CCGGTTCAAG GTTGAGTGGT CAAAATGAAT ATGACGCTCA GCGAATATTT     15060
     CTTCTATTTC ACGATAACTG AGTTTATAAG CCAGGTAATA ACGCAACGCC ATCATGATGA     15120
     TATCTGGTGG ATAATGTCGT CCTGAAAAGT TGATTGTCAT GCTATTGAGA CTCGGAGAAA     15180
     TATCGGAATA GTATTAACAT TATGATTTAC ATCGTCAACT TTGCGACAAA ACCCATTTAT     15240
     CTCCCATCGT TATTCTTATA AAAGTTGATT TAAAGGCTGT ATTCCCTTTA TCTCTTGCTA     15300
     AGATACTTAA CTCTTAAAAA TCATTGTCTT ACTAATCATA CAAGCGTTTC TATTTAAACA     15360
     CTTATTATAA TATGCATCAG CGTGTTATCC ACCTTTAGCA GTAGTTAGCA GAGGAACGTA     15420
     GCCGAATTAA AACACGAGAT CTAATGACAT ACTTTTTACG AAATAAAGCA TTAGAAAATT     15480
     TTAGTCAAAT GTTCACTTTG ACTGGTGAGA GTTTCGAATA TGCTGGCACA CTTTGGGGCA     15540
     AAAGCGCGTT AGCCCGAAGC CAGCGTAAAA TAGCTGTGTT TTCGCGTGTG AACCAGACTA     15600
     GGCAAGTCTG ATTCACCATG GATAATCCTT ACCGTAATTA ATGAATCAAT GTGAGCTGTT     15660
     TAATCACGCG CTCTTGCATC CAAATAGGTC TGGTTGCCAA CCACTTAATG AGTAGCCCAG     15720
     CTGGCAACTG AGGTATGTCA ATTAGACGGA TTTTACCAAT TTCGTTATAC TGTATTTGTG     15780
     ACATAAATTT AGATTCCTTA TTTCCTAGGT TTTGGCACAG GCCAGTGATG ATCTGATCCA     15840
     TCATCATTGG CCAATCTATA GGTTGCGCGT AAACATATTG AGGTAGCTAT ACAAAAAAAA     15900
     GATAGCTAGC TATCTTTTTG AAATTTCATT CAACATACTT GAAAGTCGTA CAGACCCAAT     15960
     ACTCTCAACC AGTTTAGTAA TGGCAATATC AAAAGTTTCC TGGTCACTCT TAGAACCAAC     16020
     AGCCTCACCT AATTCGCTTA AAAGTTCATC CATACCAACG CGAATTTTGA TATTTTTTTG     16080
     AATGACATAA GGCGAACGTT TACGTTTTTC GCGGCGCGTA AAGCCTAGAG TCTCACTTTG     16140
     GGCCTCAACT TCTTTCAACT GCCGCTCGGT CAATGGCTGA GCCTTAGAGC TTGTAGCCGC     16200
     TAACACTTTA AAAAGTGAAA TATCATCATC ACTTTCATCA ATTACTATTT TAGTGCGTGG     16260
     GTTATCCATT ATTAACCTCC AACAGCATAC GTTTAACATC ATTAGCATAC GCTTTAGCAT     16320
     TGATAGCCGC TTTGTCTGTA CCAGATACCA ACGCAGGATC TAAATTGTTT ACCGTCCCAC     16380
     CATAGCTGCG AACAGCTCTA AATGCTTCAC GGTCAATCAA ACTTGAATTA AGGATATGAA     16440
     CACCACTCTC AATAAAATCT TGTTTAATCA GTTTTAATAA TCTGGTTTGT ATCGCGGCAC     16500
     TTGTGCGAGT CAGTAAGATA CAACAAGGGA TCTTCCGTCC CAGTAAACGG CCTTGCTTGC     16560
     GGATCAAACC GATGGTTCTT GCTGCTTCGC TGGCATCGTC CTCTGATCCC TGACAGGGAA     16620
     CGATAACCAA ATCAGCCCGA CTAATAGCCT GTGTCACTGC AAAGTTAGCT GTTCCTTCAA     16680
     GATCTACCAA CACAAATTGA GTCTGAGAAC TTGCAGTTTC AATATCATCA AGAACAGTAT     16740
     CTTCCGTTGA TTTTTCAATC AAAACCAGAT TTGACGGACA ACCGTTTTTC TTAGCCCATC     16800
     CCGCGCTATG CTGGTTGGGG TCGGTATCAA TCAGGGTAAT TTTTATACCA CTTTCTGATG     16860
     CTTGTCGGCA TAGTTCGCCG GCTAATGTAA CGCAAGCCGT GGTCTTTCCC GCCCCACCTT     16920
     TACTTTGTGC AAATGCAATA ACAGTCATTA TTAGTTCTCC ATATAGCAAA AGATAGCTAG     16980
     CTATCAAACA GTATACTAGC TATACAAAAA CAATCTAGCT AGCTACATTA AAACATGATA     17040
     GCTAGCTAGA TTCAATAGTA GATAGCTAGC TATCTTTACT ATATCTAGCT ATATTATTAC     17100
     TTTGTTTCGA AGATTGCTAA ATTTGCCCAA CGCGCCAAAA ATGTAAAATT ATGGAATTCG     17160
     GCGTAGAACC CTACAGAGCA CTGGAGTTAC TGTGTCAATG AACATGATAA GCCACTACTC     17220
     GTTCACCCTT GCAGAACAGG TGCTAAATGG AAGCAGCAAG TGGAGCTTGA TGAATGGCCT     17280
     TAGCGTACGT TTTCGTTCCG CAGGACTTCA AACCCCGATC ATGAAGGGGT CTGACGCTCA     17340
     GTGGAACGAA AACTCACGTT AACGGGTTAT GAACGGCACC AGAACGTCAT ATATTACCGG     17400
     CAGGTAAAAA ACTTAGCATC CGCGAAACGG CAGATGCAAC GGGCTACCGT GCTTCGCAGA     17460
     TTTACCGCAT TCAGGCTCTT TATAAAGATG CGGTGTCTGA TTAACAAATA ATCATAACGT     17520
     ACAATAATTT TCGATATCTA AACTGACCCC TACAAGCCAA AAATTTTAGA AAAGCTACAA     17580
     TTAACGCAAA TTTTCCCATT ATCTTTTAAT AAATTTATCT TTATATTTTA GCTAGTTAAT     17640
     ACCATTGTAT TGTATCATCA CATGCACAAT ACAATGGTTA AACCATTTTA TTCATCTTTG     17700
     GCTTTATCTA TGGTGTTAAA TCAGCTTTTA AAACAGGTTT TTGATTTGAT TTTTATCTAA     17760
     TGCTAAAACC TATTCGAATC TTGGCATTAC GCTTGCAAAA TCCCTTCTGC TAGACGCTTT     17820
     TTTCTTTAGC AACTGACTTG CAGCACGTTT GAAGTTTAAC GGTCGGAGAC AAAATCAACT     17880
     TACAGCGCTG CTTTTAATCT CTTGTAGAAG CGACTGATTT ATCAGTCATC ATTTTTAAGT     17940
     CTTTTGCTAT AGATCTTTTT ATCTTTCATT TTCTAAAGCT AAAAGGGGTT CTAAGCCGGA     18000
     ACCGCCGAAA TTTCCGTCTG GGTGCAATTG GCTGACGGGC AACGGTGTCC GTTCAACGAT     18060
     TTTCTAGGGT ATGCCATAGC CGCAGAACGT AGATGGGAGC AGATCACGAA ACGGAAAGAA     18120
     TCGCTAAGCA TTATGCTCGA AAAAACCTAA TATTTCAACG AGCTATGTTA TATGTCAGAA     18180
     TGGGCCGATA AGAATACGCC ACGTACGGGG GGACTTCTTC AAGGGACAAA TCTCCTGGCA     18240
     TCTCAGAACA AAATGTAGGC AAGTAACTGC CTCAAATTTG ATAGAAAAGA AGGTGCAATA     18300
     TATTTATCGC ACCGTCCTGA TGTTTATAGT GATTAATTAC TCACAACTCT CATCGATCGA     18360
     GGTCGGCTAA AATCGAGGTA CTGGCCATTC CATGCTTTTA CTTTTTTCAT CTCGTTAGTC     18420
     CCTACACTGC CGACAAACTC ACCAATCCTG TTATATGAAA GGTTATCCCA ATCAGACAAA     18480
     AGTACTTTTG CGTTAAGGCC TGCATCGACA TGAACCTCTT GGCCAATAAT CCAATTAGGC     18540
     AAAGAATATC CAGACCTAGA ACCAACTGGG AGGCAATACT GTGCCCCTGT AGTGTTAGAT     18600
     ACGATACACC CTTCATTTGC TTTTGCAGGA AGAGCTTTAC CATACACAGA GAATGAAATA     18660
     TCTGTTGGTG CTGATGATAA TGTTTTTTCA GCAATCGTCC TATTATTGCA TACCACTGCT     18720
     GCTTGGCTGG GTTTCAGGTC TGTCGGTATG TTGATGTGAA ATTTGTTCAT CACTGTACTG     18780
     GCTGCCCTGT GGTTGGCCAA TGTGAAGCGC TGCAGACCAT CGCGGGTCTC CACCTGCAAC     18840
     TGGCAGTCAT TACCGGACAA GGTGTTGCTG TCATCCGGAT AGGTGAAGCC GTAGGCGCCG     18900
     TGCAGAGCCG GATAGATGTA ACTGGGCAGA CTCCCCTGCG GGTCGTAATA GCCCACCAGG     18960
     GTGGTCACCG GCACTCCGAA CTGCTCGGGC TTGCGCGCAA CCTTGGTATC GATGGGGGAG     19020
     ACCTCCACCC AGCTCTGGCC ATCCGAGGTG AAGCTCTTCT TGAAGCCCCG GTTCACCACA     19080
     ATTTCCTTGC CGTTGATAAA GAGGCGACTG TTGTAACCGG CCCCGTGATC GATGGTCAGA     19140
     CTGCGCCCAC GGTTGTCCGC TGAGGCAACC GGCACCCGGA TATCACGAGT CCAGCGTCCA     19200
     TCCCACATGG CAACCCTGAC CAAGCCGTAA TCCGCCAGCA GGGCACTCAG TCCGGCCTCG     19260
     CTCAGGGCAT CCATGGGGGC ATCGATCTTC TCGATCCCCT CGATTGTGTG CTGATAGGGC     19320
     TCCATCCTGG CCGTCGCACT GCTCCACTTG CTAAAGCCGG TGGCCGAGTT GGCATCGAAC     19380
     ACGGCCTTGC TCTCGAAGAA ACGCTGAATG ATGGCAGCCG AGTTGGGAGT GTAGAGGGTG     19440
     AATCGGTTAG CACCGGATAG AGGGCTGCCG CCCGCCATCG CATCGAAGCC AAACTTGCGG     19500
     CCATCGAACG GGGGCTGGCA CTGGCCATCC AGACAGGCAT CCTCATTGGT TCGGGTCGGC     19560
     GAGAAGTTGG GGATGAAGCG ACGCTTGTCA CTGTCCCAGC CCCAGCTGGA GTTGAGCTGC     19620
     TCAGCACTGC GATGGACCGA ACCACTAAAA CCATCTACAT AGTGGCCAAG CCCGTAGTTG     19680
     TGACCTACCT CGTGGCTAAA CTCGTTGCCG AGCGAAGCGT CCAGAGTGAC TATACCTCCC     19740
     CCGCCTGAGC CACCATGCAC CTGCACCCCA TTGGCATACT TACCACGACT GTTGTGTGCA     19800
     GCTAGCTGAG CCACCACAAA CGGATGGCTC CCCTCCCCTT CGCCTGCACT GCTGTTGATA     19860
     CCATAGTTGG CATTGTCGAT ACCGTGAGAG ATAAGTTCCT TGCCGATACG CTGGCGCATA     19920
     GTGCCGCTAT GCCAGCCCCC TTCGCTTGGA TCGAAATCGG TCAGCAGAGT ACCGTTGGGT     19980
     AGCATAACTT CCGGCAGATA GAGTGCCGCA TACTGGTTGA CGATCATCCG GCTAGCAGGA     20040
     ATGGTCTGGA AGTATTCTCG GTGAGCCTCC TTGTCGTTGG CAAAGGCGAA GCGATCCCGT     20100
     GGCGTGATGA GCATGCCGAT GTCGATGGTG TGCAGCAGCA GCTCGCCGGG GGCACCGACC     20160
     TTGATGTCAC GCAGTTCACC ACTGAAATTG CCCTGACGAA CGGAGAGGTT CAGTCCAGGC     20220
     TGGATCCACC CGGCAGGCAG CTCGCCGCTC CAGGTATCCG GGGCATAGGT GATGCGGTTG     20280
     TTCTCCAGCT CCCCCTCACG GAACCACTGC CCCTTGGCAA ACTTGAACTG CAGGGTCTGG     20340
     CCACGGGCGA CGGTCACCTG CCGCTCGCCA TAGAAGATCG TCGAGTTGTA GCCTGCGCTG     20400
     GAGCGCAAGC GCACCATCTT GCCCTCCAGC TCCGGGCTCA CGGGCAGGTA GATATCCCGA     20460
     ACCCAGCGGC CGTCAGCGGT CTGAATCTCC ACCAGTGCAC GACCCGTCAG CCGATCCTTG     20520
     AGGAAGGCGC CGCTCTTGTC GCTCAGTTTG GCCAAATCAG CACTGCTGCT GATCACCGCG     20580
     GTGGGGCCGC TCTCTGGGAC GAAACTCACC CCGCCTTCGG GAACACCTGC GAGGTGGTAG     20640
     ACAGTCTCAG GCAGCGCCGA CGGGGGCGAC AAGGTCAGAG TGCCAAGCAG CTTGCCGCTG     20700
     GCGTCGCGGG CCTCCACCAC CATGGGGGTC ACCCCATCGG CCTGTAGCGG TTGCACCAGC     20760
     AGCAAACTCT TGCGCAGGCT GGTCAAGGTG GGCTGGCGCT CCCCCTCCTT GGGGGAGGCT     20820
     GGGATAATCT GGCTCTGGGC AAACTGCACT CTGGCTGATA GTGAGCCGAC CAGGTCATTT     20880
     TGTGGGGCAG ACGAGTTGAA TATGAGAGGA GAGATTTGCT TAGCAGATAC AGACAATGCT     20940
     GTAGCTGCAA TCGAGGCTGC GATCAAACAG GAAATATAGT TGCGCTTCAT TTTTTAATTA     21000
     CCATTGATTA AATATTAATT CATCATGTTT TTTACAGTGA AAAAGTCAAA TATTTTCAGA     21060
     AGGAAAGTCA TGTCCAGAAA CTAAATAGGA AATGTCAAGA ATAAAGAATG TGCTTTGTTG     21120
     TCACCTTGAA TCGTCCAACT AGGGTATACC CTATCCTGAT GTCAGGTCGT TCAGTTAAAA     21180
     GTGTCAAAAT AAAGTATTGA ATTTAATTAA TTGACACATT CAAGGCAAGA TCTTAGATTT     21240
     CTTCCTGACA CTTTTAAGTT CAGGAGGTCT CTTGCAGGGA CAACGCATCG GTTACATCCG     21300
     CGTCAGCAGC TTCGATCAAA ACCCAGAACG GCAACTGGAA CATATTCAGG TGGACAAAGT     21360
     TTTCACCGAC AAAGCCTCGG GGAAAGACAC TCAGCGCCCG CAGCTCGAAG CCTTGCTCTC     21420
     CTTTGTTCGC GAAGGTGACA CGGTCGTGGT ACACAGCATG GATCGCCTTG CTCGCAACTT     21480
     GGATGATCTG CGTCGACTTG TGCAGGGACT TACCCAGCGC AGTGTCTGCA TTGAATTCGT     21540
     CAAGGAGCAT CTGACTTTCA CTGGCGAAGA TTCGCCGATG GCAAACCTTA TGCTGTCAGT     21600
     CATGGGGGCA TTCGCCGAGT TCGAGCGAGC GTTGATCCGG GAACGTCAAC GGGAAGGTAT     21660
     TGCCTTGGCA AAACAGCGTG GAGCTTATCG GGGTCGCAAG AAATCACTGT CTGACCCAGA     21720
     GATAGCGGAA GTGCGGCGGC GAGTCGTTGC TGGCGAAAAG AAGGCGACAC TTGCCCGTGA     21780
     ATTTGGCATC AGCAGGGAGA CTCTGTACCA ATACTTGCGG GTGCCGGAGT AACTTATGGC     21840
     GATTGCTAGA AGCGAGCGAC TAACAGTTCT GTCGGATGCC GAGCAGGAGG CGCTATATGG     21900
     CTTGCCGGAC TTTGACGATG CGCAGCGGCT GGAATACCTG GCCTTGACCG AAAATGAGCT     21960
     GGCGCTCGCC AGCAGCCGAC CAAGCATCCA TGCTCAGCTC TATTGCATCC TGCAGATTGG     22020
     TTACTTCAAA GCCAAGAACG ATTTCTTCCG TTTCCACTGG CGTGACGTCG AGGATGATTG     22080
     CGCTTTCGTG CTCAGCCGAT ATTTTCAAGG TGAGGCATTC GAGGCCAAGC AGATCTCCAA     22140
     ACACGAGCAC TACAGCCAGC GAGGTAAAAT TGCCGCGCTA TTTGGCTACC AGCCGTGGGC     22200
     CTCCAGCTAC CTGCCATCAC TTGAGCAACA GGCCTCACTG ATCGTGCGGC GCGACGTGAC     22260
     GCCCAGCTTT GTGGCCGCTG AGCTGATCGT CTGGCTCAAC GAACACAAGA TCATTCGTCC     22320
     CGGCTATACC ACCCTGCAAG CGTTGGTCAG CGAAGTCCTG TCAGTCGAAC GTCGACGACT     22380
     GGGAGCCCTG CTAGCACAGG TGTTGGATGA ACCGGCCAAG ACTGCGCTGA GCCAGCTCCT     22440
     GGTGCGCGAC GATACGTTGT CACAACTGGC GGCACTCAAG CAAGACGCCA AGGATTTCGG     22500
     GTGGCGTCAG ATGGCCAGAG AGCGTGAGAA ACGTGCCCTG CTGGCGCCGT TGCACGAGAT     22560
     TGCCAAGGGG TTGCTGCCCA AACTGGGGAT CTCTCAACAG AACCTGTTGT ATTACGCGAG     22620
     TCTGGCTAAC TTCTATACCG TCCATGATTT GCGCAACTTG AAGGCAGAAC AGACCCAGCT     22680
     CTACCTGTTG TGCTATGCCT GGGTACGCTA TCGGCAGCTC AGCGATAACC TGGTCGATGC     22740
     GATGGCGTTC CACATGGATC AACTTGATCA CGAAAACCGA GCAGGAGCCA GGGACACTTT     22800
     CGCAGAGGAA CAGGTCAAAC GGCATCAGGA AACGCCCCAG GTTGGTCGCT TGCTGTCCCT     22860
     GTACGTGGAC GACAGTGTTG CGGATCCGAC GCCATTCGGC GAGGTACGCC AACGAGCCTA     22920
     CAAGATCATG GCCAAAGACG TGCTGCAAAA CACGGCGCAG CGCATGAGCG TCAAGCCACT     22980
     GAATAAACTG ACATTGCACT GGCAGGCGGT GGATGGCCAA GCCAAACGTA TCCGTCGTCA     23040
     TCTCAGACCT TTGTTTGTTG CGCTGCAGTT CGCCGCCACC GATCCGGACA GCCAGTGGCT     23100
     GGCGGCACTG ACCTGGGCCA AAAGCGTGTT TGCCAAGCAG CAGCGCCTGT CACAACGACC     23160
     ACTCGCTGAA TGCCCGGTAG CCACACTCCC CAAACGCTTG CGGCCCTACC TGCTGACCTT     23220
     TGATGCGGAT GGTGAGCCGA CAGGGCTACA TGCTGACCGC TACGAGTTCT GGTTGTACCA     23280
     CCAAGTCAAA AAACGCTTCC AGTCTGGCGA GCTCTATCTC GATGACAGTT TGCAGCACCG     23340
     GCATTTCTCT GATGAGTTGG TGTCTATGGA AGAGCACGCC CAGGAGCTGG CACAGATGGA     23400
     CATCCCGTTT CTGCGCCAAC CGATTGAAAC ACAGCTCGAT GTCTTGGCCA CCGAGCTGCA     23460
     CAGGCAATGG CAGGCATTCA ACCGTGAACT GAAACAGGGC AAGCTGACAC ACCTCGAATA     23520
     CGACAAAGAT GCGCAAAAAC TGACCTGGCG CAAGCCCAAG AGGGAAAACC AAAAGGCGCG     23580
     GGAACATACG TTTTACGAGC AATTACCGTA CTGCGATGTC GCCGATGTGT TCCGCTTCGT     23640
     CAACAACCAG TGTCAGTTCC TATCGGCACT GACTCCGCTG CAACCACGTT ACGCCAAGAA     23700
     GGTGGCTGAT ACCGACAGCC TGATTGCGGT CATCATCGCC CAGGCCATGA ACCACGGTAA     23760
     CCTGGTCATG GCGCGTACCA GCGATATTCC ATACCACATC CTGGAGAGCG CATATCAGCA     23820
     GTACCTGCGG CAAGCATCGC TACACGAGGC CAATGACTTC ATCAGCAATG CCATTGCTGC     23880
     GCTGCCTATC TTCCCGTATT ACTCGTTCGA CCTCGATGTG CTGTACGGCG CTGTCGATGG     23940
     GCAGAAATTC AGCGTTGAGC GGCCAACCGT GAAGGCGCGC TACTCGCGCA AGTACTTCGG     24000
     GCGCGGCAAG GGTGTGGTGG CCTATACGCT CTTGTGTAAC CACATCCCGT TGAACGGCTA     24060
     CCTGATTGGT GCCCATGATT ACGAGGCCCA CCATGTGTTC GACATCTGGT ATCGCAATAC     24120
     CTCTGACATT GTGCCAGAGG TCATTACTGG CGACATGCAC AGTATTAACA AGGCCAATTT     24180
     CGCTATTCTG CACTGGTTCG GGCGGCGTTT CGAACCACGC TATACCGACC TCAACCACCA     24240
     GTTGCAGGCG TTGTATTGTG TGGGCGACCC GGCGCGATAC GAGAAGTGCC TGATCCAGCC     24300
     AGTTGGCCAA ATAGATAGGC AGTTGATTGT CAGCGAAAAG GCGAACATTG ATCGGATCAT     24360
     CGCCACACTG GGTTTGAAGG AGATGACGCA GGGAACGTTG ATCCGCAAAC TGTGCACCTA     24420
     CACCGCGCCA AACCCAACGC GGCGGGCCAT CTTCGAGTTT GATAAGCTCG TGCGCAGCAT     24480
     CTACACGCTA CGCTACCTGC GCGACCCCCA ATTGGAACGT AACGTACATC GCTCACAAAA     24540
     CCGGATTGAG TCATACCATC AGCTACGTTC AAGTATTGCG CAGGTGGGGG GCAAGAAAGA     24600
     ATTGACTGGG CGGACCGACA TTGAGATCGA GATCAGCAAC CAGTGCGCCA GGCTGATCGC     24660
     CAACGCAGTC ATCTACTACA ACTCGGCAAT CCTGTCGCGG TTGCTAACGA AGTGCGAAGC     24720
     GGCAGGTAAC GCCAAGGCCA TCTCGGCGCT CACCCAAATA TCGCCGGCAG CCTGGCGGCA     24780
     CATTTTGCTG AACGGGCATT ATACCTTTCA GAGTGACGGT AAGGTGATTG ACCTGGACAC     24840
     GCTTGTGGCT GGGGTTGAAC TGGTATGACG GAAATTTCGG CGGTTCCGGC TTACAACCCC     24900
     TTTCAAATTG GTAGTCCCAT ACAGTCGATG TACCACATTC ATCCACGACT TCTAAAACCC     24960
     AACGCCCAGA CGAGTCACCT TCGTAAATAA AAATACTCAG TAGCTCACCA TCAACAACCA     25020
     GCTCCTTATT TAAAGGAGAA TACTTTATTT TAATATCATC AATCTCAATC GAACTCATTG     25080
     TAATCTGTCC TATTGGGTAA AAGTGTTCTT ATACAGTTTA TGTAATGACT TAGGTAGCAA     25140
     CAAAGATCTC TTTCTGACAT TTAGCCAACG CTATACGGGG GTGAAATCCA ACGGTGCGAA     25200
     AACGTATACC CCAAGCAAAC TAACCACATC ACATTGCCAA TTGGTTCGCT ATATATTGAT     25260
     TTAAAACCCT ACTCGCACTA GCATCGTAAA CCACATCCTA AAAACACCAA ATGAGGCAAA     25320
     ATGTTTATTC GGGCCTACCT ACGCGCATCG ACAGATGAAC AAGATGCCAA TCGAGCCAGA     25380
     AATGAGTTGG TTCAGTTTTC AGACAGTAAA AATGTTCGCA TAGCCAGTTT TTATACCGAG     25440
     ACACAATCTG GGGCGAAAAT TGAACGGCCC GAGCTTGGGC GCTTGATCAT GGACTCACAC     25500
     CCTGGTGATG TTTTACTCAT AGAAAAAGTC GATAGATTGT CTCGCCTCCC CTTCGAGCAA     25560
     TGGAAGGTCC TAAAAAGTAA ATTGGTAAAA GCCAATATTC ATATTGTGGT CGTTGACCAG     25620
     CCAATGACAC ATGGGATCTT AAGTGGCACA GAAGAACATA CCATGATCGC AAAGGTACTG     25680
     ACTGAGTTCA TGATTGATTT AGCCGCGGCA ATGGCCAGAG ATGATTACGA GACAAGAAGA     25740
     AAGCGACAAG CGCAAGGCAT CGAAAAGGCC AAAACCTTAG GCAAATACCT TGGACGTCAG     25800
     CCTGACCATG GATTAAGGCA AAATATTCGG TTACTACTCG ATGAAGGGAA AAGCTGGTCA     25860
     CAAGTGCAGA GTCTGCTTAA ATGCAGTCGT TCTACCATTT CCAAAGCAGC TAAGTTGGGG     25920
     TGAGTTTGGA GATCGGAAAT TATTGTACGT TAAGCCTGAT TTTTGAACAG GCTTACCTAT     25980
     AGCAATAGGG CGTACTCCCG CGCTATATGC CGTTTTCCAT GCAATATGTT AAATAGGCCC     26040
     CGATTTCTCA CAATATAGCT GCTCTCTCTA CCCTTTCTCT CTCTGTCAAT TCTTTTAATT     26100
     AGAAGTTATA TAAATCATAT CGTTGAAACT ACGTTCCACA AAACCTAAGA TGCGTATGCC     26160
     CCTAAAAAGG TAAGTGGCTT ACGGGCAAGC ACGTAGGCCA ATCAATCCCC TATATTCCAG     26220
     TAATGGTGAA TGTATGGCTC TAATAATTTT TGAAAGAAAC AGAGGTGTTC CGTGGCAACA     26280
     GAAAAGAGAA CGAATGGAGA TTCCATCCAT GAGCAGTTAA ACCAGTTAGA AATGCAGGGG     26340
     CGTGTTCCGA GTGACATGAG TAAGAAAAGC ACTCAACAAA TGCGCTGGCA ATGGGACGAA     26400
     TATCCTTCAG GTGTGCATTA TGGTGCACCG ATGGACCCCG AACCGTTAGG TCGCTACAAC     26460
     GATCCTACGG GCCGCACAGG TATCTGCTAC GCCGCAGATA ACGCCGCAGC TGCAATAGCT     26520
     GAATCGTTGG GAAGAGTCTA CCAACGTGAC CCAGATAATT TTACTCTCGG TTTGAGTGAT     26580
     TTACACAAGG CTCAGATGTA TACGCTAGAG ACGACTCGTG ATACGAGAAC CATCAATATG     26640
     ACGAAGTTGC AGGCTATGTT GCATATTACT GCTGATCAGA CGATGAGCAA TCGACAGGAC     26700
     ATTACACAAG CCATTACCGA TTGGGCTGCG AACACACCTG GGCTACAGTA TGACGGTGTT     26760
     TCGTACAGTT CAAGGCATTA CGGTGTGGGG ATGTGTACTG CCTTCTGGAA ACGCGAGGGG     26820
     GAGACAGGCC CCTTAGCTGA TGTTACGCAT AGTTCCGTTC ATTCACATGT TGATTCGAAC     26880
     CCAGATAATT TCCCTCAAAA CTGGCAGGAA AAAGACATTG ATGGATTTGA AATTGTGGTG     26940
     GAAACGCTAC GGTTTGATGT GAGTGCAGAT AACTCGTAAA TAAAAGGCCC TAAGGGGCCT     27000
     TTTTAGTGGG ATGCCTGATG ACCGAAGAGA GCGGCTTGTT TGCGGATCTC TTTCATGTGT     27060
     TCACCTGCTG TGCCGTATTT TTTCAGTGCA TCGATGATAT TTAAATTTTC TTCATCATCG     27120
     AAAAAATACA TTGCAGTCAA GAACGAGGTT TTAGTGACTG GGCTAAAATC TCCCAGCAAC     27180
     AATAAAACTT CTTCCAGACC ATCAACCATA AGGTTTCCAT CAAACTGGAA TGTCGGGAAT     27240
     TTGCTCTCGC CCCCAACCTG CACTGCCAGC AATTTTTTTG CTTTTAGTCG ATTGTTAATT     27300
     GTCTGTCTTT TTACTCCGAG GATGTCAGCT GCTTTACTTG CCCGACATGT TCCGCCGAGT     27360
     CTCTTCAAAC GTTCTGCAAA TTTGACCGCG CTTTCATTTA GATGATCCAT TTTGCGTTTT     27420
     TCACGCGGTG ACATCTCAGA AGACCGGTCT AGTTGAGTTT CAAAAAAGAG TTTAGCCAGC     27480
     TCGTTATCTG TCATGTTGCG AGCGATGGTT AGCTGTTTTT TTTCAGCTAA TTTTGCCACT     27540
     AACTCGACTG TCAAATTTGA TAAGCGGTCA AACACGGCCA TTTGCGATGC GGACTGTGGT     27600
     TTGCGGCATT CTTTTTGAAT TGTGCTATTC ATATTTACCC CCTCTATTTG ACACTTATAA     27660
     TAGATACTTA AGGGTAAAGT GTCAAATTAA AACGACGTGG AAATATACAG ATTGAACATG     27720
     TGATGTTGTC GCAATAGCGT GTACTCCCGC TCTATACGCC GTTTTCCGTG GATTTTGTTT     27780
     AATCGGATAA CCTAAATGCG ATACCGCTAA GGCGATAATT TAAAAGCGAT AGCCACTGGT     27840
     ACTAAATCAA TCCCTTACAG GCTCTTGTGG TTAAATAATG CGCTAAACGT ACAATAGTGT     27900
     CCGATCTCCA AACTGACCCC TACCATTGCC AAAGCAGCTA AGTTGAATGA GCTATAAACC     27960
     GATGAATCAA TTCTCTAAAG ATTTGATTCA TTCTAAGGCA AAAAAATGCC CCATTTGAAG     28020
     GAAGACACGG GGCGAAATGG GTCTGTTTTA AGGCTCGCGT GAATCAGTCT GGGGTAGAGT     28080
     GATTCACTGG ATCATTTTTG GACAAAAGCG TGTTACCTAT TTTGCTAATT TAGCTTACGG     28140
     CGAATTATCA GAAGTATGGC AAAACCTCCA GTCCAGTGAC CATTATTTGT TAACCACTAC     28200
     ACATCCTTAC ATTAACGCTC CATACTTGCA TACGAACGGA AAGCTCCAGC TCTTGCGTTA     28260
     GAACCCGCGT TATGTAGACC TAAAGCTTGG CAAACCTGCC TGTAGTACTG AGGGTCAATA     28320
     GCTGCCCCAA AGTTCCATGA CACCTCGCCA TCGTGCATAG TCAAGTCGCC TGTTAGTGTC     28380
     GGATATTTAG TCCACAGCTT ATTAGCCCGA ATCCATGCTG ACAATTGTCC ACTAGTTGAG     28440
     AACCCTTGGC TACGTGCAGC TACAATCAGG GCATTGAGTT CAGAATCACG TACTTTACGA     28500
     AGAGCCTCTT GCTGAATACG CTCCTCAGCT TCACGAGCAC GTTTCTCTGC TTTAGCTGCT     28560
     TCATAGATCT TAATATTCTC CGCTACTTGT TTAATGAACT CGGCGTTACC TTCGCGAATA     28620
     TCTTGAGGGA TGTCGGATAG CTTGATCCAC ATCTGCTTAA CTGCCCCGCC TTTACGAGTA     28680
     GTTTCTGTAG TGAGCCAGAA GCATAAGTCT TCTTGAGGTG TAGCTGATTT CAGTGTGGAT     28740
     TCAAACTTCT TAGCCTGTTT GATGTGAAAG AACACTTCTT TAGAACCCAT GATTGCATGG     28800
     TGAATGAATT TACATTCCGA GAAGATGAAA CCGAAGCCCC GATCGTCTTT GTAGTTTTTG     28860
     ATCTTACCGA ATTTAAGTTG TTGCATAATA ACGACCCTTT CAATTGACGG GCCCCGCTAG     28920
     TAAGGTTCTG GACATAACCT TATTAGATTG TTAGCTGAAA TGAGTGAGTT TTGGATTAAA     28980
     ATTTCTATGG GTAACACCCA CATAAACGGC CAAGCAATAG CGAAGTGCAG CGACTGCAGG     29040
     GAGCGAATTT GATGTGATTG TTATATTTGT ATTCTGTCAC GCAGAAACTC CAAAATTTCA     29100
     GGTTTAGCCC CTTGTTGTTC AAGTGCTTCC ATAGCATATG AAAACTTCTT TCTCATTTCC     29160
     TCTACAGAGA ATTCCAGATC AGAATCCGCA TTCAAATCAA AATTTGTTTG ACCAGCTATT     29220
     GCTGCTAACT CTTGGATTTC CTCATCAGAA TGAGGATCAA TACTGTCGAG TAGAATCGAT     29280
     GTACCTTCTG AGAGCCAGTC AATCGCACTG TTCACCATTT CAGATAAATA GCTGAAAAAC     29340
     TCCTTAGCAT TTGGCGGATA CATCAGGTCT ATTTCGGTAC CAAATACCTT TTGCACACCA     29400
     TCTTTATCAA TAAATGAATT GATGCACGAC TCAATTATTG CTCTCTGTGC CTCAATGACT     29460
     TGAAATACTA AATTATCCTT CGAGGACTCA TAAAATATTT GGGGGCTCCA TTGAACAGCC     29520
     CGTTTGAGCA AGGTGTCGTT TAAGTGCCCT ATACCTCGAT TTCGAAAGTG GTTTGCAAAA     29580
     ATAAGATCTT TTCTAAGTTT TCTTGTTTTT GCGATAAATT CGTCTTCACC TCTTAACTGA     29640
     ATGCGGTCTA CAGCATCTTT CACGTTATTT AGCGTTAGAA AAACGCTTCT TGTTGCACGC     29700
     AGCTTTGCCA GCCAATTTTC GGGGCCCGAA ATTACACCAG ACAGTACTCT ATCAAAATAC     29760
     TCTAGATCAT CTTTGAGCAG GAGCAAATTA ATGTACTGTG CTTTGGTCGA TATTTGATAC     29820
     TTATCTTTAG TCAAGGCCTA TCCTCATAGC TATCGGACCA ATTCACATAA CGCCCAATTA     29880
     AGGTGTGAAG CACGCTACCA CGACACTGAA TTTGAGCACC GTAATCACTA AACTAGACCC     29940
     AAAATGCCAC GCGTGCTGAA TCACTCTTAA ATTGTTTGTG TACGCCCAGC ATGGGCATGA     30000
     ACTAATGAGG TGAAAGTCCT CTGTAGGAAG GTCACCGTTC AATAACATGC TGTTATTAAA     30060
     CGTTAACTAC TAGCGAATGG CAAGGGCTTA TCCGCGAGGA TTGGTCTGAA GGAAGCCGCT     30120
     AGCAAATTTG CGAGCTGATG AACAAGAACA TCATATGAGG CGTAGGCTAG AGGTGAGTTG     30180
     GCACAAGACG ACGAAACCAT GTGATCTAAT GGCCACCGTA AATGATGCTG CTGTGCAAAG     30240
     AAAGTTCATG TTCTTATCTG GGGAGATCTG CTTAACACGC GATCGGCCTT TAACCAGTCA     30300
     GGCTCTGGAC ATTTCCGAGT TAGAATTTAG CTCGGTTTAG TGAGTCTCGA ATTAAATTTT     30360
     CTATAGGTAA CATTTGCTTA AGGAGCCGGC TTTAGCCCTT CTCAGTGAGC AAAGCGAGCG     30420
     ATTTGGACCT GTGGTTAGGT GACGACAACT CAACCCTCTG CTCCCCACTG CTCGATAGGT     30480
     AGCCAAGCTA CTATTTCTGG TTCAATACGA TGCCTTTCTT CCACACACCA CCGATACGTT     30540
     TTTTCTAGAA GCTCGAGGAC AAGTTCCGTG TACTCTCGAG TGAAAGGTGC CAATGCATCA     30600
     ACTTTACTTG GCATCACAAG TTTGTTTGAT AAATCTGACG TAACAAATGG AGTTAGGGCG     30660
     ATTTCTTTTG CATCTGAGTG GGCCAGATAC TTGTTTCGGC ACCATCGTAA ATATTTATGA     30720
     GCCTTGAGTT CTTGTTCTGT AAATGCGCTC TCTATTTCGT TTTTTAGCGG TGGTATTTCT     30780
     CCTATATTGG ATTTCCCATA GGAGTTAAAT GGGCGTGAGT AAGATACGAC CATGGAGCAA     30840
     TATAGTGCTC TCAGTATAAG GTCGTCGCCT CCCTTTTTCT CAAGCTGTTC ATGTTGTTCC     30900
     AGAGAGTACA TTGCGCATCG ATGTGCATGT TTGAAGTCGC TATAAGACAT TACGAGACGG     30960
     TAGAAGTAAG CAAGCTTCCC TTTTTCTTCT TCTGAGAGCC CAGTGATATC CATTCTAGTT     31020
     ACCTAAAGCA AAGCACAAGG GCGACGAGCC GTGCAGCGGG TTGGCCAAAG GCCGCGAGTG     31080
     ATGCGCCTTG TTAACCATTG ACTTGTTCAT AACCATCACC AGCTTTTATG AATGTTCGCC     31140
     TTTTGAAACA AAACGGCTCA TCAATGAGTG CTTGAACCGG AATGATATTA CTTATGTCAG     31200
     AAATATCACC AATTTCTAAC TCAAACGCAC CATTTTGGTT TAGGAAATAG TCTTCGACAC     31260
     CAAAAGAAAT TCTAAACTCC ATTTGCCAGG AATATTTGGA GTCTTTTATA TATAAGCCAA     31320
     TTGGGCCAGA ATAATTCTCT AGTGATTTAT AATCAACCAG CCCATAGCCA TCATGCAAAA     31380
     GCTTAGAGCT AAAGGCTCCA GATGCTTTTT TTATTGCCTT GTTTATTCTT TTTGAAAAAT     31440
     CCAAAGGCTT AATTATAAGG AGAATATGTG AACCAAACTC TAAAAATCGT TTATCAAAAT     31500
     ATATCTTATT GTCCACCTCC CCCTGTATTA AGCCGTCTTC ACCGTCAGCA AGAGCTCCCA     31560
     TGCAAAATAG CATCGTATTC TTAGCTCTTG GAAAATAAGC TGTAAGAACC GCTTCGGGAC     31620
     CCATATCAAT TTCTTCATCC TGAACTTTCA AAGATAACGT GGTATAACCC GTTGAGGTTT     31680
     TGCCAGCTCG AAGTATTCCA TAAACTTTCT CAAGATCATC AGCTCGTAAA GCTAGACTCT     31740
     CCTCATCTTT TAAACTTGAA AAGTACTCGA GACTATTCAT GTAGATAAGC CCTTTCTGCA     31800
     TTTGCACTAA CCTGTCATAT GAAGCAACTT TAAAAAGTAG CCAAAAATCT GTTCTAGGTT     31860
     TGCTTGCAAT AAAGCTTCTT GATGTATTTT CAGTTGCCAT ACAAATCACT GTTCACTGGG     31920
     ACTGGCTAAT GCCCGGTTAG GGGCTAACAA TGCAAAACAC TGAACTTAAA ATAACAACCG     31980
     TAATCACAAA TGCTGATTTG AACAAAAACC GCCACACGTT GGCAGTCTCT CTTGAACCGT     32040
     TTGTGTTTAT TTTCAGTTCT TCGTATTTTC CTTTGGACCC AAAGTAAACT TAGATTTCTT     32100
     ACCTTTTCTA ACCGTATCAG CATCAGGAAA CAACTCAACC ATTCTTTCCG TAGTAACGTT     32160
     CAGCCAATGA GTAGCCTTGA TTAAAGAGAG AGATATATAA GATAAATCCG TTTGATTTTG     32220
     GACGCCTGTA CCTCGTCCAT TAGCTTCACT TCGGTAGTAA GAAATCGGCA ATATATGAGT     32280
     GTAGTTTGAA ATTATGTCAT AAAACGCATT AAACTCGCCA ATATCAATGT CTAATTTTTC     32340
     GAGTAGCTCA TCTCGTGATG GGATCATAAG AGCCTTTCCA GTTAACAGCT GCTTTTGAAG     32400
     CTTAGACGGG AGTTTTTTAA AGAACTCAGA ACCTTTTAAG CGTTCTTTCA ACTCTATTTG     32460
     CTGCTCACGG CAACCCGCCT CGTCTTCAAC ACTTCTTATA TTTTGATGAA GCCTAACTCT     32520
     GCGAGTACAG TCATTAAGGT GCATTATATT AAGTTTTACA TACCATTCAT CTTCACTAAT     32580
     AGGTGCTTCT GACAAATAAA AGAACAAAAT ATAGCCTTCC ATTAATGCTC GGACATGAGG     32640
     AGCTATAATG CTAAATTCCC AGCACTCGTA ATCTCGTTTC GCCCATCGAG TTTTCGGTAA     32700
     TGCGGAAATA AGAGCCTGTG AATGTAAACA CATTCTGGTA AAAATGTGAG AAGAGTATCC     32760
     TTTATAGGGA ACAACATAAC GGCTTCCTGT GAAAGTACTT ACAGCACACG CTTCACAAAC     32820
     CGCTTTATCA AATGCGCTTA AAGCAACATG AAAGTCGGCC ATATTGTAGC CAACTAATTC     32880
     ATTTTTCACA GAATTTCCTC ATAAACACAT AACGCCTTGC TCACCGACGA GTAAGTTGGT     32940
     GCTGTTTTTG CTGCTTTTTT TAGCGACAAC TGTACCGAGT CCGAGTGCAG CAACTTGTTA     33000
     TAAGGCTTTT AGCCATAACT GTGAACTCTA ACTTTTATGT GTAAATACAT TTATTGCATT     33060
     TATAGAACGT CCGGATTCTT CGTTTTTTTT AAGTGAATTA CCTAGCATTC TTATAGCGTC     33120
     ATCGTATCTA CTCCAATGAT TACAACATTT CTCATTTTGA TTAAAAAAAT GAATTTCAGG     33180
     AAAAAAAGCG TCACATGCTG AACAGTAGAA ATGTGACGAT TCATCTTCAG ATTGATCACC     33240
     GTGGATATAA TGCTTGCTCA TAATTATCTC CTAGCCTTAT GACGCTCGCC TAAGGGGCTG     33300
     GTAACGCACA AACCAACAAA TTAACCGCAC ACCAAAAATG CCGCATGTTG ACAGTCCCGC     33360
     TTGAGGCGTT TGTATGGCAG TTACGTTTAC TGGCAATTGT TCAACCTACA GGCAAAATAC     33420
     TTTTTCAACC CAGTCGTCAT GCTCGAATGG CCCGTGTATT GATTTAAAGC ATCCGCGGCT     33480
     TTCTTCGATA TTACGATTTA AGTCCTTTGC CACCCAGTCG ACAGTGCAGA TAATTTTATT     33540
     TGCTTCTAAA ATTACTCCTT TAATAATTCC CAGGTGAAAA ATTTTAATTC CTATTTGACC     33600
     GCCACCTTTC ATTCGTTTGA TGGCGATTCT GTCGCCTGCT TTCATTTCCG AAGCTTTCTT     33660
     GTATTGAGCT GGTTGATCGT CTTCTTCCCA GCCCAGCATC CAAATACCTT GTTCTATGAA     33720
     TTTTTTATCC TGATGCTCCA CCCCGCCCCA AGACGCACCA ACAACCCAGT AATTTGACAT     33780
     TAAATACACC TTTTGCGAGT TATGAAATCG CCTAACATTT GTATAATGCG CATGCGCGTT     33840
     TATCTCGTTA GACTAGTGAA AGCGTGCATA GTTAACTATT TGTATGCAAA GAATTTATCA     33900
     GCTTTCAGCC AAATACACCA TCTGGAAAAA CGCGCATGTG CGTTTTTCCA AACCTATTAA     33960
     CTAAAGCCGG TCAATATAGT CTATTGATTT TATATAGCTT TATTTATTCC CGATTGGATA     34020
     AAAAGATGAG AATTTGTAGG GCAACTCATT CATCCGTCTA CGATTGACCA AAGGTGTTAT     34080
     GACGAGCTTT GGGGCATAAA CGTGCCAGAA CTGATCGGCC TGACACGAGT TTGAACAAAA     34140
     GCGAGTTACA ACCAGTATGA TACTTTAATA CTCTCCAACA AGAAGGTTAG CGTACGTTTT     34200
     CATTCCATTG GGATTCAAAC CCCTAAAATT TAAAAATCAG ATGTTGTGTT AAATTTATTT     34260
     TTTTTCAAAA CATCAGCAAT AGCAACATCT AACTGCTGTT GAATATCTAA AGACAATCGT     34320
     CCAAATTCAT AAGCGAAGTT TCGCCCTTTA ATACGTTTTC TTGCATAAAT GCCAGAACTA     34380
     TCAAATGTTG CAAGATTAGT AACACTAACT AGTGCTTTAT TCTTCATATC CTTAGCTATT     34440
     TGAAGTTCTG TTTTTATCGC TTTGGTAATA GCTGATTTAC GTTCTTCCCT TGAATATTCA     34500
     GCCTGAATAA TGACAACTTT TTTAGTCAAA TCATTGATGA AAGATAGTAA TTCATCTTCA     34560
     AATTCATACA CTTCCATAAC TTTATTCAGT AAAGCATAGT CAGTGTGTGA CAAGTCATTA     34620
     GCCACAGGAA AAAGCTTCAC CAAACGTTCA TCAACCTTAG CGGCTTTTAA AGCTTTACTC     34680
     ACACCAGCCT GACTCATTCC AAGTTGAGCT GCTACTTCAG CCTGTGTAAT CTTAGGATTC     34740
     GCCTTTTCCA AAGATAAGCA TTGTTGGCCA ATTTCACGTA GGTTATGTTC TTTTGCGGTT     34800
     TGGAGCTGTT TAGCTAGAGC TTTTGCATCT GAAAGTGAAA TATCATCTTT AGTTACCAAT     34860
     ATGCGAAATA TATCAACTTC ACCATTTTGC AGTAAAAACC AAGCTCTGCG TCGAGAACCA     34920
     TCTAGCACAT CGAGTTTACC ATTCACTTCT CTCGCGACGG CTGGGTAAAA TTGCTGGAAG     34980
     GCTAATGAAT CGAGATCTTG TAGAGAATCT GCATTTAATA ATGCCTGGTC ACGCCCGTTA     35040
     ACATCAAAAG TCACATAGGT ACTATCGCGA ACTTGTTCAT ATGATAACGT TGCTTCGGTA     35100
     AATGTAGCAG TAGCACCCGA AGCTAATTGC CATAAGAAGC TTTTACCTAC AGATTCAAGA     35160
     CCAAATAGAT TTTGAAGAGA TAACGTTACG TCTTCACTTA CTTTTTCTAT TTCAGTTGTA     35220
     ATTTGGCGTT TTAAAGACTC AATATTAGCT TTGGCTGCAT TTATTTGTGC TTCTTCGGCA     35280
     CCAACAGCAT TGCCTAGAGG GCTCATTACC CCACGTTTTT TAGCCATTAT GCTTGCTCCT     35340
     GTTCACGCCA GACGTTCACA ATATCTCTTA GGACTTGGCT GGTTACTTCA TAACAATTTT     35400
     GCTGTGCACT TTGGAACGTC GCTTTACTCT TAGGGTATTC ACTCTTAGAC ATATCAAACA     35460
     CGGTAGAAAG CAACGAAGAT GACTGACGAA TAGCTTCACT ATGTTTAAAT TCATTTGAGT     35520
     ACATATAAGG CGCAAAATGA TCGTATAAAC TATTCATTAG ATCGGTTGTT GTAGCGCTAT     35580
     CACGATGATT TGTAATTAAA ATCTTCATAA AATCATAACC ATGATGATTA GCATTCGCCA     35640
     ATAAAGCCCA CACTTGAGGG ATATAACTAA AATAGGAACA AGTAGCATCA ATGTCGTTTT     35700
     CTGTGATGGA CAACGGGAAA ACTACACTGG TAGCGGCAAA ATATGCATTA TAAGTTGCAT     35760
     ACCCTAATGA GGGAGGGGTA TCGATAATGA TGATATCAAA TTCATCTTGA ACAGCATTAA     35820
     TGATCGTGTG CAAAAGAGAG TAAGGAGACT TTAACTTTTG ACCAAATACT TGTTCATGAA     35880
     ACCAACCTTC AATAGCTCTA TCACTTTGTG ATGCCGGCAA AATACGGAGA TTAGGTATAG     35940
     TTGTAGGTAA GAATGCGTTT GAAACGACTT GTTCAAGAGT CTCACCTTCA TCTAGATCAA     36000
     AATTATTCAT CATGAGATCG CCAACAGATA AACAACCTTC TAGATCCGCT TCTGGTGCGT     36060
     AATACATGGA CAAAGTAGCT TGACCATCCA TATCGATAAG GCCTACCCGA TACTCTTGAT     36120
     GAAACTCTGT AGCCAAGCCT GAAGCGATTG TTGCAGCAGA AACAGTTTTA CCAACACCAC     36180
     CTTTTTGATT TTGTATAACA ATAACCTGCA TTCTTTGGTT ATCACTGCGC TTAAATTTAG     36240
     ATGCTTTACG CAAATTTTCT GGCAGCAAAT CTCGTAACTG ATACATTTCT TCTATGTTGA     36300
     TTAGCCATTG AGAATCTTCA TGCCGCCTTG GATCAAAATC CGCTGTAGAG ACATATTTAT     36360
     CAAGTGTTTT TGCGTCAATA TCCAAATAGG TAAAGGCTTC TGCACGCGTA AATTTTCGCA     36420
     ACTCTTTGCG GTGATTAGAC AATAAGCGTT GGTTACGTCG CTTAATATAG GCATCAGCCC     36480
     CCATTTTAAG CACTTGAAAA GTCTCTGTAG TCTGCATGCT ATCCATGAAA TCCTCCTTAA     36540
     ATAATTAAAT ATAAGTGTAT ACCTTAATAT TTAAGGTGTA TACTTATATT CGATGGAATT     36600
     ACTACTTTAA AGGTAAAAGT ACCCGAATTT GGTCAGACTG TTAATGTGGC CAAACAACGA     36660
     AATACGGAAG TTGAGGGTAT TGAAATGAGA AATGATGGAT AAAAATACGG CCAATGATGA     36720
     TGGTCAAGAT CATCACTGGC CTGTGCCACA ACCTAGGATA AAGGTAACTA AACTTATGTC     36780
     ACAATTTCAG TATAACCAAA TTGAAAAAGC GCGTCTAATC GACTTACCAA TGATCCCATC     36840
     GGGATTGTTG ATTCAATGGT TAGTAACGAA ACCTGATTGG TTACAACAGC GAGTATTTAA     36900
     ACAACTAACA CTTCAACAAT AAACCATAGA GAGCAGGGAT TAAGTTCCTG CTCTTTAATG     36960
     CCAGGTCTAA ACACCTTTAT CAATTTTTAA CCTTTCTTAC TTAGAGCTCG TTCTCAAGTG     37020
     ATCTTGCAAT AGAATGGTTC AACCATTCTA TATAATTCAA CTTCTCTTAT TTTAATTATT     37080
     TCTGTTTTAC TCCGTTTCTT CGCCACTTTG GCACTTAGCT TGCAATTCCC TTCTGCTAGA     37140
     CGCTTTTTTC TTTAGCTACT GACTATACAG CGCGTTTGAA TTTTAACGGT CGTAGACAAA     37200
     ATTAACTTAC AGCACTGCTT TTAGATATCG CCCCTAGCGT TAGCTAGGAA TTGGCGAGGC     37260
     ATTATGCACT TAGTGGATTT ATCCACTGCT TTTGATTCCT TTTAATAAGT TATCTTTTAC     37320
     TAATAAGTAA GCTCTTAAAA GAAAAAAGCT TTTGGACTCC CGAATTTTAC TCCTTTTTCT     37380
     TACTCCCAAT TTAATAAGGA TATACATACC TTATCCACAA GAGCTACGAA CCTATGAGAA     37440
     AAACATACGA GTTAACGTCA ATCGCTATCA AAGAGAGATG AAAATTTAGT GAAATGTAAG     37500
     CCTTTAACTA GCAAAATTAG CTGTTATTTA TCGTTGGGGT AGGGAAGGGC GCCGCCATAT     37560
     GACGGTAAGC TTAAAATAGC GATTAATGCG TACTGGGGGG ATTAACGTTA GAGGAGAAAA     37620
     ACATATCCGC TGTAAATCGT TGCCTCAATG GCAGCTGACG CTTGAAGCAG CGCCACGTAA     37680
     ACGATAAACC ATTATCAAGA GCTTTCTGAT ACGAAAACTT AATTTGCGCT CTTATATCAT     37740
     CGGAATAAAC ACCAATCGAT TGCAAAAATT GAGGTGATAG CCACTTATAA GCTGCACGAG     37800
     AACGAATAGT ACCTTCTTCG TCGGCTTTTT TAACTTCTTG AACCAGGTAG ACGCCTGCAA     37860
     GTTTAAGCAT ATCGATAAAG CGATACCAAG TTGAGCTTGG TATCGCTTCA CCCCAGCGCT     37920
     TAGCGTGAGC AAGCATGAGT GCATCATGGC TGGTAGGATC GAACCCTATG TTTTTAGCTT     37980
     TACCCACTTG GCCGCTCATA AGATCGCATG TGGTTATCAA CGTAACTGAT ATCTCAAATA     38040
     GCTTTCTCTT AGTACGTTCA GACATTGTTC GTGATACGCC ACCATTATCA ACGTCTAACT     38100
     TTCGGCTATA AATCAGCCGG CGCGCATTGT TGATCACCAC ATTAAAATAT CGAGGTAAAC     38160
     GGCTACCTTT AAGCTTAAAA CCGTCAAGAC TAGCTTTATA GGCATTAGAG CCCACATCAT     38220
     GCTTATTATT TTTTACATGA AGAGCAGCTG CGCGTTTTTC GTTGCGTAGT CTCTGACGCT     38280
     TCTGACGTGC TTTATCTGCG TTAGATTTTT GCATGAGACA CTACCACAAT GCACTCACGA     38340
     AAAGATGATC TCAAGATCAA CTGACGCTGG CATATGGGGT TTAAGTGTCT TAAATTTTGG     38400
     TGCTGCAAAG GTACGCAGCC ATTGAAATAA TTAGGCATTA TATTGATTCC ACATGTTTTA     38460
     GGGCTGTTTG AATGGTTAGT TCAAACATTG CTGATCACTA TAATCTTATC GATCGCAAAG     38520
     ATCAACGATC TTTCAATAGC TTGAATTTTA GGCACAAAAA AGCCGACCCA TGTGGTAAGT     38580
     CGGCTTCGTT GTCGAATGCT TCACGTTAGG GAACCACCCC CAACACACTC TAATTTTGAA     38640
     AAATACACTA CATAGAAAAC TATGTAGTAG CGTGCTATGT AATGCACTTT TGCTTCAAAA     38700
     TCTACTTCGT ATTTTAATAG CTCATCAAAA AAATTGCAAG GCCAATGCAA AACAGATCAA     38760
     CTATGCATCT GAATCGGGGT CGAATTGCAA TTTATCCTTA ACAGCCTCAA CAGTTAAAGC     38820
     TGTAATTGTT TGATATTTAC CATCTTTTAC AGCTTGGTCC ATCAATTCCT TAAGCTTCTT     38880
     TGGGCACCGA AACGTCACAA GCTCAGTTTT AGACGAAGTA GGAGGGTTAT AATTTTTTTT     38940
     CATAATAATT CATTTTGTAT TGACCACCTT ACTGTAATAC AGTAAGTTTA CTGTAATACA     39000
     GTAATCTTGT AATTTTATTC ATGATAGAAC ATATCGATTT TTCAATAAAG AAGTAAAAAA     39060
     ATATGCCTCT AAATAAAAGC GAGATCACTA TTTTCCGTGA GTTGTTCCCA ACTCTTACGC     39120
     AACGGCAGCT AGAAGTAATG AAGGATTTTT CACTAGGAAT GACACCATCT CAATTACAAG     39180
     CCAAAGCAGA CTGCTCACGC ACGGCAATTG AAAGGCACCT TGCCGATCTC AGAGCAGAAT     39240
     TTGGATGCAC GTCATCTAAT GAAATTAGAA CTATCTTTTT AAATAAACTA TTAATACAAG     39300
     TATTACGTAA CTCAATTTAA GTTTCATTTC AAGTTAGGAA TTTCCTAACT AATAACGGTA     39360
     TCTGTTTTCA CTTATTATCT TCGCCGCGAT AGTCGCACAA CCAGATATAA ATGAGGATTA     39420
     CATGTCCGAT GGAAAAATTA ACAAAAATCA CTCAAGAATA ACAATTATTC TAACAGGTGA     39480
     ATATCACAAT AAATTAGTTA ATTCATGTGA ACGTTCAGCA CGTAGCAAAC GAGCCGAAAT     39540
     ACAGCTTCGA ATTGAACATA GTTTATTAAG TTTTGTTGAT GCTCCGCCAA AACCAATTAA     39600
     ACAACAATGA TCAAACAAGT GATTATAATT AATTACATAA GCCTCACCTA AATATATACA     39660
     AAGGAAGTGT TATATGACAA CTCTGACTCA AAAACAACCT AACGCACAAC AAACTGAAGT     39720
     AAACGAAGAA ATTCTAAGAC TCGCAAAACA TATACCCAGT GATAGCACCA TATTCATAAT     39780
     GCGTTGCACT TTCCTATTCA TCATTTGTAT CGTCGCTACT TTGCTGTTGT CTTGGGATGT     39840
     ACATGCCATA GACATATTCG CCCCCGCTAA AAATGAGATT GTTGATACCG TTGGCACAGG     39900
     TTCAACAGCG CAATTTGCCA TTCTGGTGGC GGGCTTATGT GTAGGGGCTC TCACGGGATT     39960
     TTTAACCAGA GACTGGGGAA AAGCCATAGG GGGTTTTATC GTTGGCATCA TTTTCATCAA     40020
     CGTTGGGTTA AAGGTCGTAG GTCTATAGGC CGTGGATAAT CCCACTCAGT TTTTTAGCAT     40080
     CCCTAAACAC CTTAATAACA CCCCTACGCT ATTAGGGTTC GCTATGGATG AAATAGTCCC     40140
     TGCCTTAATG TTTTTTGCCG TGTTATTCAT GATGGATCAC GCGCTCATTG GCATGGTACT     40200
     AGCCTCTTCA TGGTTTTTAG GGATGCGCAG AATGAAATCG CAATACGGCA TGAGCGTATT     40260
     ACGCCTCACC GCTTATTGGT ACGCCCCTGC AGAATTTAGC GCTTCATTTT TAAAACGAAC     40320
     ACCTGCGGCA TGTCGCCGCT ACTGGTTACG TTAAATGATG TGAATTAGGG GGCCAATCCC     40380
     CCTAAGGATG CCCCATGTTA CAAAAGAACA AGATCGACTT TATTCGCATT GCCAAATCCC     40440
     TCAACACACT TCTGTTAATC GGCTTTACCA TAGCCATGAT CAGTAACACG GTCCTAGCAA     40500
     GTATTGTATG GAAGGCCTAC TTCAATAAAA GCCGCACCGT TGTGCCACCG ACCATCAGCG     40560
     CAGCCTTTAC CGTATCAGAC ACCTCTATAG ACGAACCGTA TTTACAGCAA ATGGCCGAAT     40620
     ACTTTGCCTT TCTAAAACTC AATGTCACGC CCGCTTCGGT AGACCATCAG TACAAACAGC     40680
     TCGCAACGTA TATCGATGAA GCTGATTGGC ATCAGATGCA ACCTTTACTG GTTGAAGATG     40740
     CAGCCATGAT TAAAAAACAA AACATCAGCA GTCACTTCAC CATCAATGAA ACCCAAATAG     40800
     CCCTTGATGA TCGTCTCGTC AAAATAACGG GCACGTTAAA CAAATATGTG GGCAAACGCG     40860
     CGCTAGAACC CGAAACCATT AGCTACATCA TTGCCATGAA TTATGACCAT GGCCAACTGT     40920
     CGCTCAAAGC CATTAAGAAA GTGCAAAAGG ACGTTAAATA ATGAAGATTG CTAACCCACT     40980
     TGTTTTCGCA GCCTGCGCGC TTTTTCCTAT GAGCGTGTTA GCGGCAAATA CGCCCCCAAA     41040
     ACACTACGGA TTCAATGACA GTGAAACGGT TCCTATTGAG CTGTCGAGTG TTGATATCAA     41100
     CCGCTTAGTC GTTGAAGGTG ACAAAATCAC CTCGATTGAT TGTCCAGAAG GATTTTGCGT     41160
     TGTCACTGGC ACGAAATCGG ATAAATCCGG TGCAGCGCGC GTTAACCTCA ATTTGGCCAT     41220
     GCCATTCACA GCCTATGTAT CAACAGAAAA GGGCAGACAT TTCGGCTTAT TCATCAGCCC     41280
     TAAAGCCATT CCTGCCGTGA CCTCTATCTT CACTGCAGAA CATTATCGCG AAGAACAACC     41340
     CTCCGTTTTC GATAAGAAAA CCCCTTATCC AACCATGATG ACCGAGTTCA CCGCGCAAAT     41400
     GATCCGCTAC CTCGCCACAG GCAAACCGAT TGACGGTTAT CGTGTGCATG TCGTCAATGA     41460
     TGACCTTGAA CGCACCACGG TAGACAGTGA GCCGAGAGGC ACGGAAACAT CTATCGATGA     41520
     CGCGATGTTT ACTCGCTTAA ATGAGCAACA AATGCCTAAA CCAGCAGGAC TAACAACAGA     41580
     ACCTGCTTTC GTGTTCACTG GTAAGCATTT CAACGGCATC ATTTATCGCG TAACAAACCA     41640
     CGCAGCACTC CCAGTCACCC TCACCACAGC GCAGTTCTAC TCACCAACGA CGCGAGCCGC     41700
     AGCCTTATCA ACCTATGAAT TAGCACCACA ACAAACAGGC CACCTGTTTG TTGTCTCGGG     41760
     CGGGGAGAGC ATGCAATGAA GCAACTCCTA GACTACTTCA AAAAGGACCC CGAAGCCGAC     41820
     TTTGAGCAAG GCAGTGCGTT AAATGAAGCC AATAAAAAAC GCAATTGGGT GATTGCAGGT     41880
     GTGGGGGCAA CGGTACTCGG TGCCCTCTAT TTAGCGGGCG ACGCCTATAT GTCTGCCCCT     41940
     AAACGTGCCC CCGAAACCGC AGCGGGCAAT CCTATCGATT TTGGTGCCGT GATTGATAAA     42000
     GATTTCACCG AGAAAGACAA TCAGTCTGCG CTCACCGCAC AACAAATTGC CTTAGATAAG     42060
     CAGCAGAAAG CGATTGATAA AATACTGAGC AGCATGCAAG CCATTGAGCG CAACAATGAA     42120
     GCTAATCGCC TTGATTTAAA ACGTAATTTA GAGACATTCC AACTAACCAT CACTGAAAGA     42180
     ATTGATGATA AGATTAATGC AGCAAACGCA AATGCAATGC AGCATAGCAA TGTCACCGAT     42240
     GAATTTTCGA CAGAGGGCAT CGATGCATCT GCCTATCCCG TTAGGCAAAG CACACGCTAC     42300
     TTAGGTGAAC AAACGCTGCC GCCACGCCCG AGCGTGGGTG ACGGACAAAG CGGGTATGCT     42360
     GCCCCCTATC AAGGCGGCGC TATCCCGCCA CCTGCAACCC AAAATGGCAT CGATTCCTTT     42420
     GCATTAAATT GGGAAACGCC AGAAGAAAAC CTGCCAAAAA AACGCACCCC TGAGAACTAT     42480
     GTTCCTGCAG GTACGTTTGT CACGGCTGTC GTTACGGGCG GCGCAGATGC CAATGCGGGT     42540
     GTGAATGGCC AAGGCGATAC GGTGCCGATG GTATTCCAAA CCACTAACCA AGGTGTACTC     42600
     CCTAACGGCA AGCCCTCAAA GCTCAATAAC TGCACGGTTC TCGGTGCAGC TTACGGGGAA     42660
     ATCTCATCGA GTCGCGGCAT TGTGCGCACC ACTCGCCTCA GCTGTATTTT TGAAGATGAA     42720
     ATCATCGACA TTCCAGTCGA GGCGACCGTA TTTAACTATG GCCGCAATGG CATTCGCGGT     42780
     ACAGCCATTA TGAAGAACGG CAAAATCGTT CAGATGGCAG GGATTAGCGG CATTTTGACG     42840
     GGCATTGGTG AGACAGGTAA AGCACTGAGC CAAACCACAT CGAACTCAGC GCTAGGGTCA     42900
     ACTTCAAGCG TCAATGGGGC CGATGCACTG CTCAACTTAG CCGGCAGTGC CAGTTCAAGC     42960
     GTGGGTAGCA AGCTTGCTGA TTATTACATC AAATTAGCTG AGCAATACCA CCCGATTATT     43020
     GAGCTCAATC CGGGCAATAC CGTCAACATC GTGTTTTTGA AAGGCTTCCC ACTCGATCCG     43080
     GTTGGCATTC AAGAATACGA AGAAGCGCTA GCGCAACAAG CCCAAAATCC TGTCAGTGCC     43140
     ACAGCGCAAA TCCTCAACAC TATCAGCAAC CCACTTTTAG AACAGATGCC AGGGAATATT     43200
     AAGCCGCAGG CCCAAGGCGC AAACACGCCT ACACCACAGC AGCAATATAA CCAACAAGGC     43260
     CAACGCCCCC CTGTTAACTC AGCCTTTGGC CGTGCGAATT AATTCATTTA AGGAGTGACA     43320
     TTTTGAACCC AATCATGTGC AAAAATGCAT TACGTAACAC CGGTATTATC GCACTGGCTT     43380
     CATGGCTAGT GAGTGGCTGT GCAGCAGGGC TGGATGGTGA CTATTCCTGC GATAAGGTGG     43440
     GCGGCATCAA TGGCTGTACC AATATGATGG AAGTGAGGCA ACTCACCGAC AGTGGTGTGT     43500
     TCAATCAGCC ACAAGCACAA AGCCCTGCGG TGACGACCTT AAGCGGCCAA AGCACAACTG     43560
     CACTTCCCAA GCTCGCGAGC CAACAACAAG ACTTTATCCC TTTGCCACGC CGCGACCGCC     43620
     ACGGTGTACC GCTGCGCACC TCTGAGTCAG TCCAAAAAGT AACCATCTTC CCGTATCTCA     43680
     ATGAGCAAGG TGATTACGTT GATACCAGCG ATGTCTACAT CGTGGTCGAT AAGAGCCGTT     43740
     GGACGGGTAG ACCTGCCAAA TACATCAAGC AGGATTAAGC CATGAAACAA CGTATTAAAG     43800
     ACGATCTCGG CGCACTCTAT GCCAGCAGCA AACAGCAGCA CAACCATCTG CATCATGAAT     43860
     TGCCCTATCG CATTTATGAT GATGCCGAAC AAGTATTTGA AAATGCCAAT ACGCTTGGTT     43920
     TTGGCTTTGC CATTTCGCTG TTTGGCGGGG CTAATGACGA CTTGATCAAA ACCATGAACG     43980
     CCTTGGTGTG CACACTGCCA GAGGGCGACA AATGGCACTA TCAATTCGTC ATGGTGGGTA     44040
     ACAACCAAGT CGGTGAACTC ATCGAGCAAA ATCAAGCGCT GCTTAAGGGC CGCAATGCCA     44100
     TTTGCGATAA ATTTGCTAAT AATGAAGCTA TCTATGCCAA ACACAGTTCG ACCAAAGGCT     44160
     TTGGCACCAA GCTCAGCAGC GCATACCACT ACGATTTAAA GAACACCAAA GGGTTTTTCT     44220
     TTGTTTCAAC CACCGAGGAC ATGCCTGCAC TGCTGGATAT GCGTCTTGGC GTTGAGTCAG     44280
     AACTGGCGCA AACAGGCATG CACATTCGCC GCTTAGGCGC TGACGATCTG ATTGAGCATT     44340
     GCCGCGAACA CTTAAATTTT TCGCATCAAC AAGATCGCGT CACGCCCGCT AAATATAACG     44400
     AGTATCAACC TCTCAACACC CAAATTCTCA GCCCTGACAG TGAGTTCATC ATTAATCGTG     44460
     ATTCGGTCAA TATCCGTCAC ACACCGATGC AATCAGACAA CAGTGTCGAT ACCACCCTAA     44520
     TCAATCTAGG GCTTAAAGGG CTGCCGAACG ACTTTAGGCT ATATGCGTTT CCCAACTGTA     44580
     TTGCATCACT CAGTTACACC ATGAACAGTG TTCAATGCCC TTACCGTGTC AGCGTGTCTT     44640
     TTTATATTAA TAAAACGGGT GAGCAAACAA CCCGTAACGA CAGCAAAATT GGATCTTTGA     44700
     CCAAAACGGT CAACTCCCCT ATGCGGTTGT TGATCCCCAG TGCTGCGGAT GAACTGGCTG     44760
     AACGCAAGGA GATACAAAAA GGACTCAGCT CACACGCCTT TAAAATCACC ACCATGACAT     44820
     TGAATGTCAC CCTGTATACG ACAGAAGAGA AGCACCGCCA CGACACCTCA AAAGCGATAG     44880
     CGACATTCCG CACGGCAGGC ATTGATTTAA TCCGAAACAA TAAACTGCAA GGCATGTGTA     44940
     CTCTGTCCAC ACTCCCGTTC TCAATGAGCG AAGGCTTTAT GAAAGACAGC CAAAAAGCGG     45000
     GCCTGTGTTT CATGATGAAA ACCTCAAACT TGGTGAACTT TTTACCGATT GTTGCAGACT     45060
     ACAAACGCTT ATCCGCAGGG TTACTCTTGC CAACAATGCG TCATCAAATT AGCTATTTCG     45120
     ATCCGTTTAA CTGCGGCAGT GATAACTACA ACATGGCCAT CACGGGCGGC TCAGGGGCAG     45180
     GGAAGTCATT CTTCATGCAA GCCTTGGTAA AATCGATTTT TGCCAAAGGG GGCAAGGCAT     45240
     GGATTCTTGA CAAGGGTCAG AGTTACAAAA AACTCACTCA AACATTAGGC GGCGTCTATC     45300
     TCGATAGTTC GCAGATTTTC CTAAACCCGT TTACCCACTT AGGCAAAGTT TTAAGCGTGC     45360
     GGGATGCGGG TACTTTTGGC CCAATACTCG ATGATGAAGG TCAAGCCATT GATCCCATCA     45420
     CCGAAGTGTT GGGAAACATC ACCGCGCTTA TCGCCACCAT GGCATCTCCT GATGAAAAGC     45480
     TCACCGGATT TCAGACGGCA TTACTCGGCG ATGCTATTTT GCTGGCATGG CAAAAATGCG     45540
     GTAACGACAC GCTGATTGAC GATGTGCAAA AGGCACTCTA TGACATTGCC GCGCAAAAAA     45600
     ATGACGATAC CCGTATCAGT GATATCGCTG CGCAATTAAA CAAGTTCTGT TCAAGCGGTA     45660
     TTCATGGCGC GATTTTCAAT AAGCCCTCGA TGCTCGATCC CAATATCGAT ATCACCACTC     45720
     TTGAACTCGA TGGATTTAAA GGCGAGCTGC AACGTCCGGT GATTTTCGCG TTAATGGTGA     45780
     CGATTAGCCA ACAAATGTAC TTATCGGGCC AACGTTCTAT TCCGAAAATC TGTGTGATTG     45840
     AAGAAGCGTG GTCGCTCATG AGCGGCGCGA ATGCGCAAAG TAAGGATTTC ATCAACGAAG     45900
     GTTATCGCAC AGTGCGTAAG TTCGGCGGTA GCTTTGCCAC AGTAACGCAA GGCATGAACG     45960
     ACTTCTTTGC CAACGCCGAG GCCGAAGCGG CACTGAACAG TTCAGATATT CATATCACCT     46020
     TGCGACAAGG TGATGGCTTT GGGGATTTCT TGAACAAGCA TCCTGACCAC TTCTCGCCCT     46080
     TCGAGCAACA CATGATCAAG TCATTCCCCC GCGCCAATGA TGCGGGTCAT TCCTGCGTCA     46140
     TGCTCAAAGC GGGCGGGCTA GTGTCCTTTC ACCGAATTTT TGCCGATCCA TGGTCGCGCG     46200
     CCATGCTCTC AACCGAGCCT AAAGAATTTG AGCATTGTGA GAACCTTATT AAAGGCGGCA     46260
     TGCCGTTACT CGATGCCATT GAACTGACAG CCCAACATTT CTATCCCGAT GATATGGCCC     46320
     GTTTTGATGC CATTTTGTCC GCAGCAGCAA CCCACAAAGA GGCCGCATAA AATGGAAAAA     46380
     AAACTTATTC AAGCCTTTTT ATGGCTGGTG ACGCTGAGCG TCATGATAAC CCTCTGGGTA     46440
     ACGCGCGAAC CCAGTATTGT CGAGTATGAC ATTAACGAAA CCGTGGCCAG CTTTCACCAA     46500
     TCTATCGGTC AAAGCGAGCT ATCCGACGAA CAACGCGAAA AAGAAATCAC TCGATTTACC     46560
     CAAACACTCG ATGATGTGGT TCGTGAATAC GCTCTGGATA ATCATGTCGT GGTGTTAGTC     46620
     AGCCCTGCCG TCGTCAGTGG CGCGGTGAAT GTCACCCAAG AAATTCAGCA ATCACTACTG     46680
     CAAACCCTTC ATGCGCAAAA CAAGGCGAAC CGTGCCCAAT CTAGCGAGGT CACGCCTAAA     46740
     TGAATAAATT CGCGCTTCTG ATGTTGGCGT TATGCCCACT ATTACCGCTC AAGGCTGCGT     46800
     CTATCGGCAC CGTGGGGCAA GTGTTCCCGA TTGCTGAAAT TGACATGCTG CAGTGGATTG     46860
     AAAACCGTCT GCAAACCTTA GAGAAAACGG GTGAGCTAGA CAGTATGCGC GAGCAATTCC     46920
     AAGAGAATGT CAAAGCCGGT GTTAAGCGCC CTCGTCCGGT GGGGCTCATT ACCACTAAAA     46980
     CCCCTGAGGT GTTTTTGGTC GATCCCACCT TAACGCTGGC CAAAGATATC AATGATGCGA     47040
     ATGGCAACCT GATTTATCCC AAAGGGACGC GCGTAAACCC ATTTGACACC AAGACATGGC     47100
     CAGCATTGCA AAAGGCCAAC GTCGGCAAGT TTGAGTTCAG TAAAACGCTG GTGTTTTTTG     47160
     ATGGGGATGA TGTGCAGCAA GTGTTATGGG CCAAAGAGTT TGCAACAACC CATGACAAGC     47220
     CACACACCAT CAAATGGATT TTAACGGGCG GCGAACCCGA AACACTGCAT GGCCAATTAG     47280
     ATGCGCGCGT TTACTTTGAC CAGCAAGGAA ACCTCAGCCG CGCCTTAACA CTTAAGCGCG     47340
     TTCCAAGTGT CGTGAAGCAA GCGGGCGTGA TGTGGCAAGT GCGCGAAATG GATGTGTCCA     47400
     ATTTCCCCGT ATTCATGGAG GAAACAAACA ATGCGGCACA TTAAACTCGC GTGGCTTGTA     47460
     GCCTTATCTT TATTGATGGG TCTAATTCCT TCACAAGCCA ACGCACAGGC CGCCTGTACG     47520
     GGCACATTCG TTAACCCGAT GACCGACATT TGTTGGTCGT GTATCTTCCC GATGACCATT     47580
     GGCAGTGTGC CTATTATTCC TGGGAGCCTA CCCGATACGC GCAACCCCGT ATCACCCATT     47640
     TCATTTTGTC CCAAACCGCC GCCTATTTTT ATGCAAATTG GCTTGAATAT CGGCTACTGG     47700
     GAACCTGATA CCTTAGTGGA CGTGACGCGC GTCCCTTACT GCATGGTTAA CATGGGCATG     47760
     AAACTCGACA TGAGTAATTC CCCCCAAATC GGCGGTCGCG TCACAAGTCG CGATAACGAT     47820
     GCCAGTGATG GCGCGTTTTA TCATGGCCAT TGGTACAAAT ACCCTGTGAT CTATTGGCTG     47880
     CAGATTATGC AAAGCGCAGC TTGTATGGCC ACGGACAATT TCGACATTGC CTATTTAACA     47940
     GAGATAGATC CACTGTGGGA TGATGACGAG TTGTCATTTA TCCTCAATCC CGAAGCCATT     48000
     TTATTTGGCA ATTTAGTGTC ACAACTCGCC TGTGCAACCG AAGCCGTGGC CACCTCAACT     48060
     AACAGCATAT TGCCTTTTGA TTTTCTGTTT TGGTGTATGG GCTCACAAGG CAGTGCCTAC     48120
     CCCCTGACTG GCACCACCAA TTACCGCGAC ACGCCCATTC AGGCGGGTAC GTTGATTTTA     48180
     GAGCGCCTGA ACTACAAATT GCATCGCCAA GGCATCGTTT GGGAATCCCA CGGTGAAGAT     48240
     GGCGCGATTT GTTATCAAAC GCCGATGCCC CTCATGCCCA AATCCCGCTA TCGCTATCAA     48300
     ATGACCAACA CCATACCCGA TGCGCTTTGG GGACACCCGT ACACCACCAC AACGGTGATC     48360
     TGGGAAAGTG GCCACGACAA CCCTGTGTCG GGTGACAACT TTGGTTTTAT CAACTTCAAA     48420
     AAACGCAATT GCGTGTTTTT GTGACAAATA AGGAGAGGGA TTTTCGATGA AAAAGTTTGA     48480
     GACCAAATTA CCAACAACAT ATACCGCTTT ATGCACAAAA ATTGTGGATA ACAGCCTATT     48540
     TTCACATTCA TTTAAAGGCT TAGCCCTGCT CGTGAGTTTA TGGTGCCTTG GATCAATTTC     48600
     ACAGGTGTTC GCCCAAACGG ATTACAGTAT TGACGAATTA AAAGCGCTGT CGATGCGAGA     48660
     ACGCCACACA TTACCCCCAC TGAACGTAGA CCAAGCCGCA CTGTTTGATA AAGCTCGTCA     48720
     GTTCGAAGCG CAAAGCAAAG GCCAATTAGA CAACGCGCTA TCACCATTGC TCGATGCAAA     48780
     GCCCAACCCC AGTGCCGATG CTAATGGTGT GATGGTATTT GTGTCATTGG GTATGCCTGC     48840
     CACCAGTTTG CAGCAATTGC TCATGCAAAG CGCAGACTTA CAAGTGCCAC TCATTGTGCG     48900
     CGGTGTACTG CCTCAAGGCT TTACCGCCAC CGTTAAACAG ATGAACCACC TTATCGATAA     48960
     CAAGGGTAAA ACCATTCAGA GCGGGTTTGC CATCAATCCC CAGTGGTTTA CGCAATTCGG     49020
     CATTACCCAA GTACCCGCCT TTGTTGCTGT AAGACCCAAC AAATGTCATG CAAAACAGCC     49080
     CTGCAGTACC GATGATTTTG ACGTGATTTA CGGCAACGTT TCGTTGTATG ACGCGCTGAA     49140
     CTTACTTGCA CAACACGGCA GCATTCCCGA TGTGGCAGCG AAGACATTAG CAAAGGGGGC     49200
     GAAATGACTC AGTTGAATAA TGCCTTAATC CTCAGTGCCA TCCTCACATT GAGCGCCGCC     49260
     TTGCCTGTTG TGGCGGCAAA CAGCGAAAAA GACTATCGCA ACAATGTGCA GTGGGCCAAA     49320
     GACAGTATCA AGCAGAATCA GAACAAAGCG GGTTACACCG GTTTTGACGT TAACAGCCTA     49380
     TGCAAAGATG CGACATGCCA GCAAGAAGTC GCCAATCCGA GCGAAAGCCG TTACTACAAC     49440
     AACCCGAGCG CCATGGACAG CGCCAAAATG CAAGGCATGA GCACGGATGG TCAAGCCCAA     49500
     GCAGTGACGA GCGGCTTTAA CAAGGGACGC CCGACGATCG ATGAAAACGA TCCGGCATAC     49560
     CATACCGCCG TCGGCTATCA AAATGATGCT TACAATATCA GTCACGGCAT TTCATCTAAA     49620
     TATCATGACT GTGAAAAAGG GCTCGTTTGT GAGGTCGATT CTCAGCCACG CTCGTGTACT     49680
     TTGCCCACCA ACAATCCGGT GCAATGCTAC CTGACGCCCT TTGTTAAACA CTCGTCGATG     49740
     ACGACTAAAG AGTATGACTT CCAACTGTTA TATGCGTCAC TACCTTACAC CTTCGCACTT     49800
     GAAGAGCCTG TAGCGCTCAG TAGTGTTCGT ATTTCAGGCC GCTTCAGCAT TTCGCAATTT     49860
     ACAACAGTCA TACGCTTTTA TATCGACGAT ACCCTGCTTG GAGAAGTACC CGTTATACCG     49920
     GAAAAATGTT CGATGACGAC ATGTAGCGTA CAGATTAATA GTCAATTTAC TTACCCAGTC     49980
     GCCAGTGAAA GTAGTTCATA CGTTTTTAAG ATGAAGTACA TGTTCTTAGG GGACGTCGGG     50040
     TATGACGTTG GTTTAGTAGA CAAAGCGCAG GTGACATTAG TCACAAATAA AACCTCCGTA     50100
     GAAGTAGGCT ACAACAACAG TTGCGGCGCA GTCCTCCCCG AGTGCCAACA AGTTCAATCT     50160
     CAATGTATTG AGGGTAAAGA AACGCGCATG ATTAATGGGA TCAGCGTGAC ATTGGATTGC     50220
     TGGAAAGAAC AAACCACCTA TCAATGTGCC TTTCCCAATA CCTGCGACGC CATCGCTGAT     50280
     TGCAGCATTC AATCGACCAG TTGTGACACC CAACTTGGCG GCGTTTGCAT TAAAGATAAA     50340
     CAACAACGCC TATGTGATAA ACAGCAATGC CGAGATACGG GCCTTATCTG CGGTGCAGAC     50400
     AGCTTTGCGC TCAGTGGTGA CTATTACGAT CCTGCGGCCA CTCGTAGCAC TGACTTTAAC     50460
     CATGCTGCGG CAGGACTGGC CGCCGTCAGT GACGCAGCCG GTGATGTGAA AGACAAGGCC     50520
     AACATCAACG AAGACAGCGC CATCATTTTC AAAGGCAACA TCATGGAGTG CAGCGATAAA     50580
     GCGCTGGGGA TCAGCAATTG TTGTCAGGAC AGCGGTTGGG GTAACGGCAT CGGCTTAACG     50640
     TCCTGCAGTG AAGAAGAAAA AGCGCTGGGT ACCGCAAAAG AGGACAAGCT CACCGTATCA     50700
     CTTGGCCAAT ATTGTGCTGA GAAAGTGCTT GGCGTGTGTA TCCGCAAGAA AAAAGCCTAT     50760
     TGCGCGTTTG ATAGCAAACT CGCGCGCATT GTGCAGGTTG AGGGTCGCGC GCAATTGGGC     50820
     AAAAACTTCG GCAGCGCCAA ACATCCTGAT TGCAGCGCCT TTTCACCTAA CGAACTGCAA     50880
     CGCATTGATA TGTCGTCAAT GGACTTTTCT GATTTTTATG AAGACATGTA CGACGCCATC     50940
     GAACTGCCCA GCACAGACGA AATTCAAAAA CGCTTACAAC AGTCGGTTGG AGGAACCAAA     51000
     CCATGAGGAC GTTGTTAAAT AACCGCTTGC AACATGCCGC CGCAGTGCCT TTTTTTCGGT     51060
     GGTCAAGCCG CGCGCCGTTG GCGTGGTTGT CCACAAAAAA AGGGGATGCG GTGGTCAACA     51120
     AGCGCAGCGC GTTAGTGCTC CTTATACTGA CAACGTTTTG CCACGGCGCA AACGCCACGG     51180
     ATGCACAAGG CTGGCGCTGG TATAACGAAC CGACTGCCCC CAAGAAGCAA GCGCCTAAAA     51240
     AGGCCGAAAC GCCAAGCGTC ACACTCACGC GCACCCAAAC CCTGACGCCC ACCGAGCAGA     51300
     TGGATTGGTT TCACAGCTAC TACCAAGACA CGCTCAATGA CGCGGCGATA AACAGCCAAG     51360
     ACAGCGAGAA AGTGGAAAGG GCCATGCTGC TTAATCAGTA CGTCAGCAAT AAATCCTCAG     51420
     AGTTTGGCAT GACCTTCAAA AAGGTCCTGC TGGATAACCC TGAGCTGTCT TACACCAAAG     51480
     ACAGACCGAC GGAACAAGCG GCAAGAAGTA CGTATTTATC ATTAGAGCGC AACAAGAAGA     51540
     TGCGCGCAGT ACGCACCCTT GCAGATGCGG GATGGGGCCT GTTCTTTGTC TACAAAGGCA     51600
     GTGAAGAAAT TGATATTGCG CTGGCGCCCA GCGTGCAGCA GTTCGCAACG CAACATGGCA     51660
     TTGAGCTACT TGGCGTCACG CTGGATGGTG TAGCACTGCC AGCCATCGTA CAGAACCGCC     51720
     AAAACGACCA GCACATAAAC GTCCCGTTTA GTCCCGCACT CGTGTTAGTT AATCCTGGCA     51780
     CGGGGGAAAT GAAACCGCTC GCTTATGGCT TTATCTCTCA AGACGATTTA CTTGGCCGCT     51840
     TCCTGAACGT GGCCACCGAT TTCGCCCCTG ACTTTTAAAC GGAAAATACC CATGAAACGC     51900
     ATCATCACTG TAATGTTAAT GACTCTTCTA TTCTCTTTCA ACGCGAAGGC GACTCCCATG     51960
     GGGGCGGCTG TCGCAGCCAA TCCGAATGAT TACGCGTTAG TGTTTTTCTT TCGCTCTGAT     52020
     TGCCCGTTTT GCCACAAGTT CGCCCCGAAA CTGAAACAGC TTGCGGCGCA AACTGGCACC     52080
     TATACCTATG CCTTTTCGCT CGACAACCAA GGGATAGCAG GCTTTGAAGT GCCTATTCCT     52140
     TCCACGCCTG ACATTGCCGC CACCTTCTTT GAGAACCCGC GCAGCGTGAC AGTGCCCGCC     52200
     ACATTTTTAA TCAACGTCAA TACCCGTAAG TTTGTCCGTT TAACCGTCGG TGATGTGACG     52260
     CCCTCGCAGC TTCAACAAAG TTACCTTCAA TCCCTCAATG ACCCACAAGT CATTGCAAGC     52320
     ATGCGTTAGG AGCAACCGTC ATGGACACGA TGTTAATCAT CAATATTTTA CTGGCCCTAG     52380
     CCATTTATAA ATTCGTACTC GTCCCCGTGC ATGCATTGTT AAGTGCTGTT TGCTTGCGGG     52440
     CGCTACGCGC ACTACACCCG CGCCTTAATG GCAACATAAG CGGCAATACA GGGGGTAAAT     52500
     CATGAAACGC TTAGCACTGA CACGCACACT ACTTGGCGTC ACTATTTCAT GTTTGCTGAC     52560
     AACCCACGCG CATAGTGCGG GGGTTTCAGG TTCGCTAAAC GATTTCTTCA ATGGTTTGGG     52620
     CTATGGCACG AACGTGACCA ATCCGGGCTC ATTCAAAGGC CAAAGCGCCA ACTACTACAG     52680
     CGGCGGCAAT CTCTTTGTGC GCAGCCCCAT TCGCGACGCG CAGCTCGTGA GCGTGCAAAT     52740
     GCCCAGCATT GCCGCTGGCT GTGGTGGTAT TGATATGTTT ATGGGGGGAT TTAGTCACAT     52800
     TAACTCTGAC GCCCTTGTTC AACAAGGCAA GGCCATCATC GCCAACGCCG CGCCGTTTGC     52860
     CGTCGATTTA GCCCTGCAAA CGTGGGCGCC GCAAATCAAA CAGATTAAGG ACACGCTAAC     52920
     GGCCATTGCT GATAAGTACC TCAATCAGTC GATCAATTCT TGCGAGAGTG CCCAAGCGGG     52980
     CGTGTCGGCA CTGGCGGGGT TTGCGGGTGT AGGCAGTCAA AAATACATTT GTGCCACCAT     53040
     GGGCACACAA AATAATGCTT TTGCAGATTG GGTCTCTGGC CAGCAAGAAT GCGGCGCGGG     53100
     CGGCCAAGCT AATAAGCAGC TCGATAACGC CAAGAAAGAT CCCGCACTAA AAGACATGGT     53160
     GCGCAAAAAC ACCAACATCG TCTGGGCCGC CATTTTAAAA AACACCTTCC TTGCCAGCGA     53220
     TCCCACCTTG GCAGAATTTC TCATGTCGAT TTCAGGCACG TATATTTATG ACGCGACTGG     53280
     CGATGCGCGC GGCTATGGCT CACTGCTGAC CGACAACAAT AACCTGATTA ATAGTCTGTT     53340
     AGAGGGCGGC AAAGCCGAAA CTTATCAGTG CACCAATAAA GCGATTGATC AATGTCTTGC     53400
     ACCGACACAA CAAACGATCA CCATCCAAAG TAACCACGGC CTGCAATACC GTGTAGATAC     53460
     CTTGCTCAGA GGCATCGCCA GTAAGATGCA AAACGACCAG CCACTAACAG ATAACGACAA     53520
     GTCGTTGCTG GAATACACGA CACTGCCCAT CATGACTTTT TTACGCACTG AACTAGAAGC     53580
     AGGACTCACG CCACAAACCA ATACTTACGC CAAAATCATC AGCGTACAGT TTATTACCCT     53640
     CTATCTGCAA AACATGCTGT CGATTGTAAA GTCCTCTATC ACTGCGACGA ACAATGATCC     53700
     CAAAGACATT GATCGTATCG AGCGAGACAT TATCAACGCC AACCGCTTTT TAGAAGGACT     53760
     CACCGCTAAA GCTCAAAATG AGGCCGTATC GCAGCACCAG CTCATTATGC AAAACCAGCA     53820
     AATCAAACAG CAAATAACCG GCGCCATGAG CGCTAAAGCC AAGGCCAACT TGAATTTTGG     53880
     GGAGCGATAA CCATGGCTGT TGAGATTTTC ACATACAGCA ACGGTGACGT GGCCAAGCAA     53940
     GTGATGAATG CCATTGCCGT GCTGTTCAAG TCCGATTCAT TTGCCAGCAT GATAAGCATC     54000
     TGCGCACTGT TTGCCGTTGT GGCCACCGCG CTGCACTTTT TCATCAAGCG TGACCATAAC     54060
     GCGATTATGA AATGGTGCGC GGTTTACTTT GCCGTGCCAT TGCTTGCCAT GAACACCACC     54120
     GCCACAGTGC AAATTACCGA TCTAACCAAT CCGACGGGGA ACTATCGCGT GGACAATGTG     54180
     CCGGCGATTG TGGCGTATCC AGCCTCATGG GCATCGCACT ATATGTATGC CACCACCCAA     54240
     ACGGTGGAAG ATATTTTTCA CGTACCGGAT GATCAACAAT ACAGTAAAAC GGGCATGATG     54300
     TTTGGCTCAG AGCTGTACAA GTTATCCAGA CAAAGCGAGA TAGAAAACAC CCAACTTAAA     54360
     GGCTATTGGC AGCACTACAT CAGCAGTTGT ATTCGCGGAG ATATGCTACT CAATAATAAA     54420
     TACACATGGC GAGATTTAGC CAGTGCGCCG GATATTTGGG ACTTTCTAGC GACTCACAAC     54480
     CCTTCGCCGC TACGGGCTAT TCAAATGGGT CCTAATGACT ATCCTACCTG CAAAGAAGCC     54540
     CTTCCGCGCC TCAAGCAACT ATTCCAAGCA GACAGCGCAA AAAGCATCAA GTTACTGGGC     54600
     AGTTGGATTT ATGGTGAAAA GGCTACAAGC CAACAAAGCT TTTTGAATAC CAGCATCAGT     54660
     GGTGGTTATC AAAAGTACGC CAATATCAGT CAAAGCGCGT CGCAAATCAC GCTGCAAAAC     54720
     ATGACGATTA ACGCCTTGCG AAATGGCCTC GCGGATGATG CAGCGGTGAG CAACAACACC     54780
     GCCGCCGCAT TCAACTACGC CTATACACAA AACAAAATGC AAACCACATC GATGTGGGCG     54840
     GGAATGGCCC TGCAGGCGCG CGAATTTTTG CCCATGCTGC AATCAATTTT GTTTTTGCTG     54900
     TTTAGCTCTG TCGCCTTTTT AGTGGTGGCG ATTGCCATGA TCCCCTCACT CACGTTTCAA     54960
     GTGCTCGGCA ACTATTTCAA AGGCTTTATC TACCTTGGCA CATGGCCGGT GATGTTTGCC     55020
     CTCATTAACT TCATCATGAC CACGCGCTTA TCCCTTAACG CCACCGAAAT CACAAACATT     55080
     TACGGCGGTA TCACGTTAAG CAACGTTGAT CCCTTACAAG AAATGCACTC CCGCTATGCG     55140
     GCCATGACCG GCTTTTTAAT GATGAGCGTA CCGACATTAA TTGTCCCGCT CATTATGAAA     55200
     GGCGGCGCGT CGGTAATGAG CAGTATGTCG CATCAGTTCG CGGGCATGAT GAGCAGCGTT     55260
     AACGCGCGCA CCTCTGCAAG TGCGGCAAGT GGTGATATCA ATTTGGGTAA CGCTCAGGTG     55320
     GATAACTACA GCTACAACAA CACCAACGGC AATAAAATCG ACACCACTGG CGTTGAACGT     55380
     ATTCACGGCA ACACCAAGCA AGATGCAACC GGTTATGAAA CCACGACCTT TGATGATGGC     55440
     AAACAAGTCA TTAGTGGCCA AAATGCCCTA AGCCGTAGCT TGCCGGTGAA CATCAGCGGT     55500
     AATGATGTGT TATCAAACTC ATTATCTCAA TCAGCCACTG ATAGCATCAA TGCCAGCAAG     55560
     GTTTCAGGTG AACAAGTCAG TACAAGCATT GCAAGCGTCA ACAATGCCGC GTTAAGTCAA     55620
     ATGAGCGGAG TTAATACATC GAACAGTTAT GGCAGCAATA GCGCCACCGG CGACAGTGGT     55680
     TCCCATAACA AAGGCTTCTC AGATATGAGT AGCACAGTGA AGTCTTATGC CAAAGATTTT     55740
     AACGTGTCAG AAGAACAAGC CTTAAGCGAT TTAACCACTA TGTATATAGC CGCAGAAGCA     55800
     GGGGTAAAAG TTGGCACACC TGGGAGTGGA ATATTTGGTT CTGGCGCACA TGTTTCCGCC     55860
     AATGCAGGCA CCAAAGGGTC AACCGATGAG TCTAACAGCT CGCGCATGAG TGAAAGCGAA     55920
     CGCGCAAGTC GCCAAGAAAG CTACCTTGAC CAGTTCAGCA CTAACGTTAA CACCGTGAAG     55980
     TCATATAGTA GCGGCGAACA AGCGAGCGAA ACTAACAGTA AAAATGCAGG TGAAACGCAA     56040
     AGCTTCCTAC AGGGAATTAA CGAAGCAACA ACCCAAGCTA AAAACTACCA ATCTCAGCTC     56100
     ACCGAAGCAC AAAGTTACAC TGATGCAGCC AATAGCGTGA AGAGTGGCTC AATTAGTGTT     56160
     GGTCGCGATT TCAATCAGGA TTTTGTTAAT TTCGTCGGAA AGGCAAGAGA GCAGGAAGGG     56220
     GATTTCATGG ATGTTATCAA GGGCGAAACC CCTCAAGCGA TAGAGACGAG AAACCAGCTA     56280
     GTCGAAGAAT TTGCAAACAG CCCTGAAGTC AAAGCGATGG CTGAGCAATA TAAAAATCAT     56340
     GAATTTCCGC AAAACAGAGA TGACATTGTG CAAGCTCAGG AGCGTTACGC TTCAGACATT     56400
     GATGTCAATA AACAGCAATC ACCACATTAT GCTCCTGCGC CGCTTAATGA AAGCCTCTAT     56460
     CAATCAGGCG AATTTGAGCG CATCCAAGGC CATGCTGCGC AAGGTAACGC TGAAATTAGA     56520
     CAAGATGTTT GGAAGGAAGA GCGCGACCAT ACTCCTTCAA ATGTTCAGAG CATTGATATG     56580
     GAACAAGCCC GTGCAGACGC AAAAGCTGCG CACGCGCTAA TACCGCAAGA CAATCGAAGT     56640
     GACGATGAAA AAATGGCAGA AACAGTACGT CAATCAAGTC CCTTTAATAC AGGACCAAAA     56700
     ATGTGATAAT AGCCATGACT TTCAATCACA AAGAGATAAT CTCATGAACA TCATTAAAAC     56760
     AGGCGCACTG TTGCTGTGCT TATTAAGCCC CTTGGCTCAG GCTGAAACCA CCCTGTTCGG     56820
     CCTCACCTTG GGCAAATCCA CACTGCAAGA AGTTGAGCAA TCCTACACGC TCCAAGACAA     56880
     AAACACTGCA TCAGGACAGT CTGATAGACG GAATTATTAT GTCGTTGATG GCAAGCAGTT     56940
     TAATGAGCCA CAGCTTAAAG ACGCCGCGCT GTATTTTGAT GACGCTCAAA CATTAGGAAC     57000
     CATCCTGTTT ACCTTCCCGA GCTCCTTAGA AAAGTATAAG GCGCTAGAAG AACAACTTAG     57060
     CCGCCAATAC CCACGCATAA AAATGGCCCC CTTCGTATCG GAGCCATTAC GCCTCGATAA     57120
     AGCCGAGTTT CAAAATGACA CCACCCATAT CCGACTGGAG TACAACGTTT ACAGCACTTT     57180
     CTTGTCCTTT ACTGACCTAA AGTATCGCGC TGCCAACCAA AAACGCCTCG CTGAAAAGAA     57240
     AGCCCTCGAA GGCAATAAAC CGAAAAAGGA ACCCTAGACG TGACCTTAAA CCCCAAACGT     57300
     ACTAAAGGCA GTAACTACAC CCGTGGTGGC CAGATTTTAT TTCACAATTT GCGGATGTTT     57360
     CTGCAGATTA ACGCCGTGCT TATCCGCTGG ACGTGTTATG GCGTGCTCAT CTTAACAGCG     57420
     CTGCTATGCT TCCTATTCAT TGATAAAGAT ACCTTAACAG GCGCTTATTA TTACTGGATA     57480
     AACCAAACGG TTAGCATGTT TAGACCAGAA AGCCATGTCA TGCAGACTGA ATGGCAAGGC     57540
     ACTGTCTATA CCAGTACGTT AGGGTCTCAA TTGCAAAACC CAATACTGAT TGCGGCCAAC     57600
     AGCCGCTTTT GGTTGTGGTC ACAAATCTAC TTCCTTATAA GCTGTGTGAT TGGCTTCGTA     57660
     TTTCTCTCCG TGGCCATGTG GTTTTTCAAG AAAAAAGGGG ACGAGCAAAC CGAGGAACAC     57720
     TTTATTCGGG GGATGCAAAA AGCCACGCCG AAGGAATTAG CAAAACAGCT TAAAAAGGAC     57780
     AAGCGCCAGT CCGATTTCAA GCTCGATGGC ATCGGTATTT TCAAAGAACG CTTTGAAGTA     57840
     CAGCACTTGT TACTTGATGG CACCACGGGC GCGGGAAAGT CCGTGGCGCT GCGTAAGTTT     57900
     TTAACGTGGA TACGTGAACG GGGCGACAAA GCCATTATCT ATGACAAAGG CTGTACCTTT     57960
     GTCAGCAAGT TCTATAATCC GGCAACGGAC GTACTACTAA ACCCGTTTGA TGAACGCTGT     58020
     GCTTACTGGG ATGTGTGGTG TGATGCGCAT GAGCCCTCAG ATTTTGAGAA CATGGCGAGC     58080
     GCGCTCATTC CCCAGCATGG TGAGGGCGAT CCATTCTGGG TGCAATCTGC TCGCACCATT     58140
     TTTTCATCTA CTGCATTTAA GATGCAAGAT GAACCTAAAA TGAACCAAAC CACTGAACGA     58200
     CTGCTTGAAC TCATGCTGAC CAGCGAACTT GAGTCCTTAA GTGAATACTT AAAAGGGACC     58260
     GAATCGGCCT CACTGGTATC AGATAAAATC CAAAAAACGG CGATATCCAT TAAGTCGGTC     58320
     CTCGCGGCCT ACATCAAATC ATTACGATTC CTTGCCGGAC TGGATGAAAA GGACGGACAG     58380
     GGAAAACTCC TTCGCCGCAA ATTTTCAATT CGTGAGTGGG TGAAAAACGA TGCCGAAAAT     58440
     GGCTTTCTAT TTCTATCCAG CAACGCACAG CAACATGCAT CATTGCGCCC CTTGATCTCA     58500
     ATGTGGCTAT CCATTGCCTC GACCGCCATT TTGGAACAAG ACGAAGATCC GGACCGCAGA     58560
     ATTTGGGTGT TGATGGATGA AGCACCAAGC TTGCACAAGT TACCTGAACT TGCCGAAACA     58620
     ATCGCAGAAG TGCGTAAGTT TGGCGGCTGT TATGTCATAG GCATTCAGTC ATTCGCACAG     58680
     CTTAAAAAAG TCTATGGCGA AAATGCGGCA CTTGAAATGT TCGACTTGCT CAACACTCGC     58740
     TTATTTTTCC GCTCACCCTC TAACGAAATG GCCAAAATCT CGTCTCACGA TTTAGGCGAG     58800
     CAAGAAGTCG ATGTATCTAA AGAGCAATAC AGCTACGGCG CTAATGAAAT CAGGGATGGC     58860
     GTATCACTGG GCCATCAAAC CATTACCCGC CCTGTGGTCA CGCCCTCTGA AATCATGCAG     58920
     CTTGAAGATT TACAATTTTG GCTGCGCACG CCTGGCAATT ATCCCGTGGT AAGAGTGGAT     58980
     TTAGAGTTTA ACCAAATGCG CTCACTGTGC GCCCCGTTTA TCAAACGTAA CTACACCCCG     59040
     TCTGAAAACA TAAAGCAGAT TGAATGGAGT CTGAACTATC ACCAGTTCAG TGCGGTTCAA     59100
     CACGTCGATA AAGCGGATAA AACCAAGCTC CAAAGCATTC ATGACACCAT GTATGAAGGG     59160
     GATGAAAACA ATGATGAACG CAGCGCGGAA GCGCAGCGCA TGACCAAACT TGCTGAAAAA     59220
     ACCGATGCGG TCGCCCAAAG CCTCATCGAT GCGAAAAAGG CCAAACCGAC TGAGTTAGCG     59280
     CTCAAGGATG CGCAGAAGAA AAAAGCCGCT GAAAAACAAA AGACCAATGA CCAGCACATT     59340
     GAGGATGCAC AGCGACTTGA AGAGCAACAA ATAGCCTCAG TACACGAAGA AATATCGCTC     59400
     GACTAAAGGA GCTAAAACGA TGACCTCATT CAACGCCACG ACACGAGTGC CCGAATTGTC     59460
     GGCGAAAAAG CCCTCACGTA AAGCCTCTAA AAATGACAAT GAACGGATGA ACGTCATGCG     59520
     TCGAATTGAA GCCATCAAGG AACTCAAAGC GCTGGGCTTC ACGTCTGACG AAATCAAAGC     59580
     CCAACTCGAC TCAGAATAAA CCTACCGGAT TAGTTCACCT CGCGCCCCGC GCGAGGTCCC     59640
     TCTAAAGGAA TATCATTATG CTTTCCATCA GTCCCATTGC GTCGAGCGCT GGCGGCGCGG     59700
     CCAGCTACTA CCTCAGTGAA GAAAAGAACC TCAATTTGCC TGACGTGTCG TTAGAAAAAG     59760
     CAGCGGACGC CAAAGAAGGG GAAACCAACT ATTACTTGAA AGAGCAGAGC GCCGAGCCCA     59820
     ATACCCAATG GTTTGGCAAA CTGGCAGAGC AAGAGGGAAT GTTAGGTAAG CCCGTTGAAG     59880
     AACATCAACT CAAAGAGGTG TTAGCCGGTA GCCTGAACGA CCAAACGCTT AAAACCCAAA     59940
     ACAGCAACGC CCGCAACGGT TTTGACTTTA CCTTTTCGGC GCCTAAATCC GTCAGTTTAC     60000
     TTGCACTCGT GGGCGGCGAT AAACGCTTAA TGACAGCGCA CGATGACGCG GTAAAATTCG     60060
     CGTTATCGCA TATCGAGAAA GATGCGGCGC AGGCCAGACA AACCAACCCT GATACCAAAG     60120
     CGACCTCTTT TGAAAACACG GGCAATTTGC TGTTTGCAAT GGTGCGTCAC AAAACCAGCC     60180
     GTGAAGAAGA TCCGCAGCTG CACACCCACT CACTCACCGC CAACATGACC AAGGACAGCG     60240
     AGGGCACATT GCGCGCGCTG GCAAGCAGCT TTAAACAAAA AGGCGGCATC ATCAATGGCA     60300
     CGGGTGAGCG GGTTTATAAC CATCAAAAAT ACTATACCTC GCTCTATCAA AGCGCCTTAG     60360
     CCCGCAGTGT TGAACAAGCG GGTTATCAAA CTCGTTCACT GGGTAATAAT TTGTTTGAAG     60420
     TCGAAGGTGT CCCGCAGTCC TTACTCGATA CCTTTTCAAC CCGTAGCCAG CAAATCAACG     60480
     AACAAACCCA AAGCTTAGGT TTAGACTCCC AAGCGGCGCG GGATGTGGCC GCAAAGGACA     60540
     CCCGCAAGAG TAAAGCCTAT ACCAGCGAAG CCACCTTGTT TGAGCAATGG AAAAACAAAG     60600
     CCAATAACAG CGGCTTTAAC CTGACAAGCT TCGTGACGGA CAGCATGTCA CGAGAAACAT     60660
     CACTCAATGC GTTAGCGCTC AAACCCGCCG CTATCGATGC GGTGAGTCGC GCGATTGAGC     60720
     ACGCCAGTAA CACCCAAAAC CGTTTTAATT ACGCGAAATT AGTGGAATCA GCCACGCTTG     60780
     AATTTACACT AGGCCAGAAG CTCGATGCGC TCGATATTAA ATTGGCACTC GATAAGCACA     60840
     TTGAAGATGG CGCACTCATT CCGCTTGATA AAGAGTCTGC GACCTTTACC AGCGCCGCCC     60900
     ACATCAAAGC CGAAACTAAC CTGCTAGAGA GCATCAAGCC AAAAACGGCC AACATGCGCC     60960
     AAGTGGTCGA TACCAACACG CTTCAAGGCA AAGGCTTAAA TGCGGACAAC CAAAAGAAAG     61020
     TCTCTGAACT GTTCGCCAGT ACCAAACAAG TTAACCTAGT GAACGTCTTT GGTAGCAGTG     61080
     AACAGCTCGC GACCGCCCTG CTCAATGTCG GTGAGGCCAA CGGTAAACGT ATTCACATCA     61140
     TTACCCCTGA CATGAAAAGC AAACTGCACA CCAGTGAACG AGTGCAACGC GATTCATCGA     61200
     CTATTGGCAA GTGGATAATG AACCACTTCA AACCTGACCA CACACACACA CTCAGCAGCT     61260
     TTACTAAAAC GGCCAACAAC ACTAACCGCG ATATTTTAGT GGTTGAGAAC GCCAATAAAC     61320
     TCGGCCTTAA CGACTTTAAT GCCCTGCTCG CGCAAGCCAA AGCGGGTAAC AGTAAAGTGA     61380
     TTTTGCTCAA TCACGTCAAT GCCAAGCAAG GCATGAAAGC CGGTAACGCT ATCGAGGTAC     61440
     TTAAAAAAGG TAACGTAAAC GAAAGCAACT GGGTCGCCAC CAAACAAAGC AACACAGCCA     61500
     TGCGACTGCA TGAAAGCAAA GACAGTGACA GGGTTAACCT GATTGCAAAA ACTTACGCGC     61560
     AACTGTCCGA GAAGCAACAC ACCCAAGTCA TTGCGGGCAC CCATAAAGAC GTGAAGCAGC     61620
     TTAACAGCGC GATCCGCGCA GAACTGCAAA ATCAAGGTGA TGTATCGCGC CTTGGGCTCA     61680
     ACATCCCTAC CCTTAATCCC GTGTTCTTAT CCGCGCAGCA ACGGGAAGTC GTCGGCCAGT     61740
     ACACCAAGGG CATGGTACTC ACCCAATGGC AAAAAGTCGG CGGCCGCAAT CAACAGCAGC     61800
     AATTGACGGT GGACAGCGTT AACCGTGATA ACAACACTCT CACGCTGATA GACAAAAACG     61860
     GTAAAGCCTC CGAGATTAAC CCCAGCAGCA AAGCCTTTAA AGCCGCAGAG TACGCGATCG     61920
     CTAAACCGGA CAATTTACAT ATCGCCAACG GCGACAAACT CATCATGGCC ACAAACCATC     61980
     AAGACAGTGG TTTGAGCAAA CAAATTTATA CGATCAACGC CCTGTCCAAA GAATGGGTCA     62040
     CGCTCAAAGA CGAAAGCGGC AAACAGCACA GCGTTAAAGC CAGTGCATTG CACCATGCGC     62100
     CGCTCAATCA TGGTTACGCC ACCACGCCAA GCAATGCCAG CCCTAATGCA AGTCACCACA     62160
     TCGTCAATAT TAAAGCCTAT AGCGCCTCAA AAGAGTGGTT ACATGACACG CTGACACAAG     62220
     GCATCAAACA CATTGATATA TTCACCGACA AGGCACAACA ATTTGATGAC CGATTAGAAA     62280
     AAAGTGAGGT GAAACCATCC AGTATTTCGC GCATCATGCA AGCCGCTGAT ATGCCAGAAA     62340
     AGTTCGTGAA TCGCCAAACC ACGGCCCTGC TCACCCAAGA TGTGACCGCA GCACTGAATG     62400
     CCATTGGTGC CCAGCATCAA GACAAAGGGC TTATTCACAA TGCCGTAGAT TTTGCCATCC     62460
     AGCACATTAG CGAGAAAGAA GCCGGTTACT CACAAAAAGA GCTGATTGTT AATGCGATCA     62520
     AGTACGCCTT TGAGGAAAAA GGCACCAGCA TTACCCAACA TGAAATCATC AACACCCTGC     62580
     AACACATGGC CACGAACAGC ACGGATAAAG GCGCGCCCTC ACTCCTGAGC GCCGAATATC     62640
     ACGACGGCAC CCGCTGGACC ACCCAAGCCG CCATCGATAC CGAAGTACGT ATTTTAGACA     62700
     GACTACAAGC GGGCAAAGAT CAACTTGCGC CCCTTACCAG CGTTGAACAC GCCGCGCAGG     62760
     TACTCAGTCA AAATCAAAAC CTGACCGATG GCCAAAAAGA CGCGACCTTG CTTATCACCA     62820
     CCACCAAAGA CCGATTTGTG GGTGTTCAAG GGTTAGCGGG TACGGGTAAA TCGACCATGC     62880
     TTGAAACGGG TATCGATCTT GTTAAACAAA GCGAATCCAT TCTCAACACA CAACCCAATA     62940
     AGACACCGAC ACAATTCATC GGTCTAGCGC CGACACACGC CGCCGTTAAC GAACTCAAAG     63000
     ACAAGAACGT CGAAAGCCAA ACGGTGCAAT CACTCCTAAG CAACTTTTTA AGCCAAGATG     63060
     CGAAACCTGA CCAATACGCC AACACCGTGT TCTTGCTCGA TGAATCCTCG ATGACCAGTA     63120
     ACGCCCAAAT GGATAAATTT ACCCATTTGA TTGAGACAAC AGGCGCGCGC GCCGTGTTCT     63180
     TGGGTGACAC TAAACAGTTA ACGTCCCAAG AAGCGGGTAA ACCTTTTGAA CTCGCGTTAA     63240
     ACAAAGGCGC AATCAATAGC GTCACCATGA AAGACATTGT GCGCCAACAG AACAGCACGC     63300
     TACTGAGTGC AGTACACAAT ATTGTCGATC GCCAAGGCGA AAGCGCTATT GATAAAATTC     63360
     AGCAACAATT ACCCTTTGAC CAATACACCG CGCCCACCGC GAACGACGCG GTAACGCCCG     63420
     AAAAGCAGGC TACCGCTAAC ATCAATCAAA GCTTGAATAT CATTTCAACT TTGCAGCCGC     63480
     TAACTGATAA CCCAAAGAAA AACCAGCAAC TTGCGACCGA AGCCCTGCCC GCCACTGTGG     63540
     CACTGGAATA CTTGGCCAGA ACACCTAAAG CGCGTGAAAA TACCCTTATC ATTGCGTACA     63600
     CCAACAAAGA ACGCGACGAC ATTACCCACG AAATTCGCCA AGGGTTACAG CAACAAAAAA     63660
     GCCTCAGTAC CGAGCAATTC ACCGTGCCGC GATTACGCGG AGTTCATGCC AGTAAGGCGG     63720
     AACTGGCGAC CATGTTGCCC TATCAGCAGG GGTTAATCCT GACGACCGGT AAAGACAGTT     63780
     ATTTTGAAAT TATGAAGGTT GATAAGCTCA ATAACATGCT CACCCTCGCG GATATGAAAA     63840
     CCGGCGAGGA AAAGCATTTC TTCCCCAAAA ATCATGGTCA CAAATTCACG AACCTTTGGG     63900
     CTAAGAGTGA GCAACCTCTC GCAGAAGGCG ACAGTATCAT GCTCCGCAAA AACGATATTG     63960
     ACCGTGAAAT GCAGGGCAAC AAAACCTATA CCGTTAGCAG CATTGACGAT AAACAAATGC     64020
     AGCTCAAATC CACGGATAAC CACACATTAA CGCTCTCAAC CAAAGATTTG AAAGATGCTC     64080
     ATTGGGATTA CGCATACACC CGCACCGCCG ATATGGCGCA AGGGGCAACC TATGAGAATG     64140
     TCATTACCGC GATTAAGGGC CAAGGTGCAT TAACTAACGT AAGGCGCGCG TATATCGATA     64200
     TCACCCGTGC CAGTAAGCAC GTAAAAATCA TCACCGATAA CCCGCAAAAA ATGATGCTCT     64260
     CATGGGTCAA TAACGATCCC AATAAAGTCT CTGCACTTGA GACAAGAGAT AAGTATTACC     64320
     CTGAACATAC CCCGCTATTT AATGACAAAC CCTTGCCGCA GGAAAACCCA AAGTACCTCG     64380
     ATGTAAATGG ATATGTGGAT CTAAAACTGA TGGCCACCGA GCTAAATGCC AAGCTTCCGG     64440
     CCTACAGTGA ATCACTGGCA ACGCAGCTTT TAGGTGAGCC GAACCACGAT AAATCAGACA     64500
     AAGATAACCT GACATTTGGC AAAGAGGGGA GCCTAACATT GACCACAACG GGCCAATATC     64560
     GTGGCTATTT TAAAGACTGG AAAACCGGCG ATAAAGGCAC CTTAATTAAC CTGATTATGG     64620
     TCGCTGAAAA ATGCAGTTAT AAAGATGCAC TTTATAAAGC CGATAAAATG ATGAACGAAC     64680
     CCGATAAATA TAATCTGGTA AAAAACCCAC AGCATGATGA ATTAACACAT GCCATTCCGG     64740
     TTAAGCAAAG CCAATTAGAA GCGCGCGCGA AGCAATACTT TAACGAAGCT AAACCTATAG     64800
     AAAACTCACT CGCACAAACC TATTTAGCCA AGCAAGGAAT CGAGGTTACG AAGCATGAAA     64860
     ACTTACGGTT TCACGATGCC GTTTATTCGT CAGAAAAACG TGGAACCTTC CCCGCATTAA     64920
     TCGCGAATAT CACCAATGAC AAGAGTGAAA CCAAGGCAGT AGAAATCACT TACCTTGATA     64980
     AATCCAGCGG TGACATTGCA GCGCTAAAAA TAAATAAGCG CATACTCGGC TCTAAATCGG     65040
     GGAACAGCAC GACGATCAAC AAAGGCAATA ATTCAGACTA TAGTATTGTC GCTGTCGGTG     65100
     TAGAGAATGC GCTTAAGATA AATGCTGACA ATAAAAACGG GGCTGACGTT ATTGCGCTAA     65160
     ACAATAATAA TGACACTAAA ACATTTAATA CAAATGAATT GCGCGAAAAC GTGATAGTGG     65220
     TACTTGATAC TAATAATTCA CAAGACACTG CAAAACTGGC TAATGACCTT ACGGAAAAAT     65280
     TCAGTAAGGA AAATATACAT GCGGTTATTA TTGAACCCAG TCTGATACCT GACGGCTTAA     65340
     ACAAAGTCGA AACGACAAAG CAATTAGTCA ATGAAGCGGT CTATAGCATA ACGACAAAAG     65400
     ACAATACCCT ATCTAAAGCC ATTCAATCAT TGAGTCATGA TATTGCAGAC ACCAACAATA     65460
     TAACGATTAA AGATGACAGC ACTAACGTAG CAACGAATAA AATAAAGCAC GATGAACACT     65520
     ATCAAAATTT AGCAATGGAT AGCCACCGTT CAACGACGAA AGAATACTCC CCCAACATCG     65580
     ACAATCCTAA ATTGGATATT GGGGAAAAGA CCATGTAATG AATATATAAA GAGGACACTT     65640
     AGTCCTCTTT ATTTTCGCCC GCTAAAATCT GCTCAACTTT TTCCTCTGCC TTTCTCATAG     65700
     TGTCCTTATG CTTAATACCT GCATTCTGTA TATCTACAGG ATCCGCATTG TATGTCTGGT     65760
     AATAGACCAA ACTGCTAGTG TGTTGTGCCT TAACTGTATA GGTCAAAATA ACCTCTAACA     65820
     GTTCGCGAGT AGATAACCCC TCGGCATCAT CTTTATGCTC AAGAATACGC AGAGCAAACA     65880
     AGATCAAATC TCGCGCGGCG GCAGCATCTT TTTCTAAACC CTTCTCTTCT CGATAAGCAA     65940
     CAATCTTGGC ATAGAGATCT GCATCGCAGG GGACTTGCAC AACTTTACTT CTGGCCATAG     66000
     TGACATTATC CAATGTATTA AAAGTGTATT AACAACGTAT AGATTTGCAT TATAACTGTA     66060
     TTAACCAGTG TATTAAAGTT TAATACACTC ACAAATTAAG TTAATGATTA ATTCCTTTAT     66120
     AAACATCACT TTAATACTAA ATAATACACA CGGTATTAAT ACTGTATTAA TCCGCCTGAA     66180
     ACCATTGGTA CAAGGGCTTT TAATACGATT GTATTATTTT ATTAATACAC CTTTAATACG     66240
     ATTTAGTGTA AAAACGAAAT GAATTTTCAA AAAAAAATAT TTATTCTATT TTGATATTTA     66300
     AACTCTTAAT TTCAATAACT TAAACCACAA ACAACCATAA GAATTGATTT ATCAATTCTT     66360
     GCGTGGGGTG TGGAGAATAT AGGACGTGCA AAGGTGGCAT TTTTGCATTA ATTTTACGTG     66420
     TTTAATTATT TCCGCTCAGG GCAAGTATAT CAGCAACTTA GAACCCTTTG AAGGGGCTGG     66480
     GACTGTGTAA AAAAGTAGCC CCACGCAACC AATTTTCGGG CAAAAAACCT CTTTAAGGTG     66540
     GCATTTTTGT GTCATTTTCT GCAAAAAACG TAAGATCTTT GAGTGGCGTG AAGTGTGGAC     66600
     AATGCAAAAC GAGTTAAGGT GGCATTTTTG CATTAATTTT TTACAGGTAT ATATTTAAAA     66660
     CTAAACCAAT TACATCAAAC ACATATAACA TGCATAAATA ATAAAAGTTG TGCGAAAAAG     66720
     TAGTTTCCCG CAACAAAATT TACAGGCAAA ACTTCTCTTA AGGTGGCAAT TTTTCCTCAA     66780
     AAAATACTGG ATTTTTTAGC GGCGTGAAGT GTGGTGAATA TAGGACATGC CAAGGTGGCA     66840
     TTTCTGCGTT AATTTTTTAC AGATAAATAT TTAGAACTAA AACAATCATA TCAAACACAT     66900
     AAAACATGCA TAAATAATAA AAGCTGTGCA AAAAAGTAAT TTTCCGCAAC TAAATTTAAA     66960
     GACAAAAATC TCTTAAGGTG GCATTTTTGC GTTAAATTTA AGTATTCGAT TATTTCATCT     67020
     CAGAGCAAGT ATATCAATAA CTTAGCCTCC TTTTAATAGG CTCTGATTGT GTATATAAGT     67080
     AGCCTTACTT AACCAAAATC AACTCCTTTT TTTGACACGA AATTTTACTT CATGTTCTGC     67140
     AAAGCAATGG ACATTTTAGT AGATTAGAAT GTATTAGTTA GAACATATTT TTTAAGTTCA     67200
     ACAGGCTGAT TCAAATGTAG TGCAAAGTCA TATCTTAGAG GATCTACGTT TTTACTTGAA     67260
     ATTATGGGAA GGTGAACAAG AAAAAGAAGT TATGTTTTTT ATTGGGATAA ATGAAGTCAG     67320
     TATCACCAGA TTTTTTGTCG GTGAAAATGC TCATGATGAA AAATATAAAA AAGTTTTTTA     67380
     GATAATCTAA TTAACAAGTA AAAATGTTTT AAATTTTCTG TTAATGAAGA AAACTTTAAT     67440
     CTGGACTCGA ATCACTTTGT CTAGAGGATG CATTTATTAT AGCTTTAGTT ACCAAAAAAA     67500
     ATATATTAAA ATGAAAATTA AGATAATTGT ATAACCTATT GTTTCTTTGA TTTTTGGTGT     67560
     TATGATCTCA TCACATTTAC TAGTGTTTAA GTTTTTGAAC TTTTGAGGTT CAATTGCATT     67620
     TTCAATATCA AAAACCTCAT CAATATCACC ATCAATGAGT GATTTCTTTT TTGCAGTTAA     67680
     TATGATTTTT TCATAACCTG CTGGACGACA TTGCACTATT AAAAACTTAC CGTTCGGAAG     67740
     GGTTATCTCT AATAAGTAAT ATTTTTTAGC TGCATGCATA AGGCCTACAG CAACTCCCAC     67800
     TCCTAATGTG GCAATTGCAG CTACGCTACC ATACATAACA CTTTTCAATT TATCTAGGGC     67860
     TCTTTCTTCA GTTATCTTTT CAACTTTTGC ACCTGCTATG AAAATAAATT TTCTGGGGCT     67920
     GTTAGCACTC ATTAGAGATG CATATTCCCC TATTATTGAA TATTCACCTG TTGGGTAATC     67980
     ACCGCCTTTA ACTTCAAAAC TATCAAAATT TAGTTTGGCA GTTGTAAAGG AGGGGATTGA     68040
     TCTTAAACCT ACTGCGCATC CATCTACTAC TTCGAATAGC ACATCGGTAT TCTTTTCGAC     68100
     TATTGCACCA TTTAGATTTG AAATACTGCT GAATGGAATG AGTGGATTAT GTCCTGAACT     68160
     GTCGCAAAGC TCTCCACGAG CATTAAGATA GCCAACATAG GTGGGAGGGA TTTTTGTAGA     68220
     TGTAGAGCCA TCTAAAATGG CTAGTGGCTG TCCACAGTTA CTACAGAACT TCCCTGTTGT     68280
     GAGGTTGTCA AATTTGCACT CTATACATTT CATATATTAG CAGTCTGTTA ATTGTATGAT     68340
     TTTAACGTTA GGGTATGACT TAAGTAGCTA TTATTGCAAG TCTTTTATAG TATTTTTATA     68400
     ATGATTTTTG GGGCTAAATA GTCTAAATTT AATATTTCAA GGCTAAGAGC TTGTTGAAAT     68460
     TAGTGGGGTT TGATTAAACT TTATGAAACT CACTTTTGGA CAATTATCAG TTTCGGAAGG     68520
     TCGAACATTA GAATTTCATC AACAACTACA GGTATGGAAA ACCACTAATC TCCCCTTTGT     68580
     ATGCACCTCT TATCCTACGA CACTTCTCAT TTGCAGCAGG TTATGACATT TATTCGTCAC     68640
     TAAACCAAAA TCATTGACAA AGTAATGCAT AGAGTATTCA ACTAGATTGG GTATAATCCT     68700
     GTCCAAATTT TAAAGATTAA ACGTGGTTGG ATTACTTGTG GCAAATGAAA GAATTACCGA     68760
     AAACTATGTA AGAGAAAAGT TGAGAGAAAA CGGCTACTAT GAAGCTGACA ATGGCGTAGT     68820
     CATTGAAGAA CAAAAATCGC AAATCAAGCG AGTTCAAACC ATCTTAAAAT CTGCAAGTAA     68880
     AGCGAAAACA GGTAAAGGTG GCTATCCAGA GTTTATTATC ACTTGGGAGT CAGATCCTAA     68940
     CTTCCTAATC GTGGTTGAGT GTAAAGCTGA CACGAAGTAT CACGAAAGCC CAGATTTAGA     69000
     CAAACCAAAA GACTATGCGG TTGACAGGGC CGGAGCATAC TTTGTTAAAT TGATTTAACA     69060
     TCTGCAAAAA TCATCAATTC CCGATATTCA TCACTGAGTA AAGAACGATG TAACTTACTC     69120
     TTCATACTGC GTTTTTGTGT TATTTCGAGT TTTGCCAGAT TCAGGGCCAT TCGCCTCACT     69180
     ATCGCCAGTG ATTCGGCAGT TCTTTGCTCG TGAACCCGAC AAGCATCTTC TCGATAAACC     69240
     ACATCCAGGA CCCAGTGCAG ACTATTCTCA ATTCGCCAGT GCCCTCGGAC AGCAGTCGCA     69300
     ATATATTCGG GATCGATATC ATGGGATGAG AGATAGAAAC TGGTCTCTAT GCTGGTCTTA     69360
     TTGCCTATTT TTCTGTGTCG CTCAACGGCT ATTAATGTCT TAACTGAAGG CCACTTTTCT     69420
     TGCAATTTAG GACTCAGCTT CGATGGGATT TGAAATGTAA TCCGCTGCTC TGTTCTTCCA     69480
     TGCCCTTTTT CCGAACAGGC AAATTGGGCT AACTGACTGT CATCTTGGAA GGCCACATCA     69540
     TACTGCGCTT TAACTGCTTG AAATAAAGTC CGTTGATTAC TTTTCACCTG CACCACATAA     69600
     TCTCCTTTAC GAGCGACTAT CGCTTCCAGC GTCGCGCGTT GGGCATGCAA AGCATCCATG     69660
     GTTATCAATG CTTTATTTAT GTTAAGCATG GTAATAAGTG ATTGTACCGT TTCAATTTCC     69720
     TTGCCTTTTC CAGAGGCCAT TTCTTGATAA AGCGCCAAGC CATTATTAAT GTCGAACGCA     69780
     CCCACGGAAT GTAAGGTGTT GCACCCTAAC TTAGAGGCAC CTCTGAGTGT TTTACCATCG     69840
     ATAGCAATGA TGGGTTTAGC TGATGCGGTG CGGATGTCGT TAATCCAACT GAATAGGCAC     69900
     AACTGCAAAT TCTCCGGCCC TACGGCTTTT AGGATACGTG CTATGGTATG CCGACGGGGA     69960
     ATGCCATTAG CAAATGGACG AAACTTACGT AGCCACTCAA GTTTTAGCTC GCCGAACTGT     70020
     TGAATTTCTG CCCAACCATC TTGCCCACTG GCTACTGCCG ATAAGATTAA GAACAGTACG     70080
     TCGACAAGGT TGTGGCGTTG ATTAATGTGT GAGCGCGTGT CTTCGACTAA AGATAGGTGA     70140
     TCAAAAAGTG ACATGGAGAG TGGCCAAGTA ATTAATTTCT CATTCAGATC ATGGCATTGC     70200
     GGAATAGTTC AATTTTTTTA ACAAAGTGCG ATCTCGCCCT GATGCGGTTG ACGGTGTATT     70260
     GCACTATGCA AGGTATCTAT CAAAAGACTT CACTGTCCTT GCCTTAGCTG TTAGCGGCAC     70320
     GTCAGAGGAC TATACAAAAG TATCTAATTA CTTAATACCT TGTGGAAGTA AAGACCACAA     70380
     AGTCCTGACT AATGAAGATG GTATCGAAGT AAACGATATT CTTTCATTTG AAGACTATTA     70440
     CCGTTTAGCT TCTTTCGACC CACAGGTTGA AAGGAAACGT CATAGCGATC TATTAGCGTT     70500
     TGCAAAAGAC CTCCACGAGC TGATCTGGAC AGCAGCGAAA ATATCAGAAG AAGATAAGCC     70560
     TTTGTTAGTT AGTGGAACGT TGATTGCACT AATGAACCAA CCATTTTTAA ACTCATTTCA     70620
     ATATTACAGT CCAGAGGATA TGCCTCGAAA ATGGCTAGAA GCTATCAAAG ACGAACTTGA     70680
     TAAAGCTGAC ATTCCCAAGG CTAAAAAAGA CACAATGCGT CAACCTTATG CGGCTGTTGC     70740
     TGGACAGCCA AATTTAGGTA AACCTGATGC AAAAATTGCT AAAAAGTATC CGAAAGGTGT     70800
     TCTTTACGAG GTGATCAAAG AAATCAACGA TAATGTCTGG CCATTTATCA GCGTTTATCA     70860
     CAACTTTGAC GTTGTTGGTC ATTTTTACGG TGAGTTCTTA AAATACACAG CAGGGGATAA     70920
     GAAAGCCCTT GGCATTGTCT TGACTCCAAG ACACGTAACA GAACTATTTT GCGATATCGC     70980
     CAACGTTACT AAAAAAGACA CTGTTATAGA TATCTGTGCT GGAACTGGTG GCTTCTTGAT     71040
     TTCAGCAATG CACCGAATGC TGAAAACAGC GATGACGGAA GAAGAACGTT TAGACATTAA     71100
     AAAGAACCGT CTGATCGGTA TCGAGAACAG CCCTAAAATG TTTGCATTAG CTGCAAGCAA     71160
     TATGATTTTA CGAGGTGACG GCAAAGCAAA CTTACACCAA AGTAGTTGTT TCGAACCAAC     71220
     GTTAAAGAAA GCTATTACAG TTCCCGATCC TGCTTTGGGT GTCAAAAGAC CAAACGTTGG     71280
     TTTGTTGAAC CCTCCTTATG CTCAGTCAAA AAGCGATGCA GAGTTACACG AACTCTATTT     71340
     TGTGAAAGAA ATGCTAGACC TTCTTGAAAA AGGTGGCATT GGTGTCGCAA TTATTCCCGT     71400
     TAGTTGTGTA ATAAGTCCAA ACAAAGCAAA ACACGAGATA CTAGAAAAGC ATACTTTAAA     71460
     AGCCGTTATG TCGATGCCTA GCGAGCTTTT CTATCCAGTT GGAACCGTTA CATGTATTGT     71520
     CGTTTTTGAA GCACACAAGC CACATAACGA AACAAATAAG AAAACATGGT TTGGTTACTG     71580
     GCGAGACGAC GGCTATATCA AAACGAAACA TATGGGACGC ATTGATTTAA ACCACCAATG     71640
     GCAAGATATA AAATCTCGTT GGTTAGAGGC GTACAACAAT AACGAAGTTC ACGCTGGTGA     71700
     GTCTGTTACT GCTTATGTTG ACGGTGATAG TGAATGGATT GCAGAAGCCT ATATGGAAAC     71760
     CGATTACTCT ACAATTACAG AAGAAAGCTT TGCTGATCTA GTCAAGAACT ATGCAATGTT     71820
     TAAGATACTC AATGAGGACA AATAATGGTT GAATTACAAG AGTTATTTAA CATTGAGTAT     71880
     GGTAATAGCT TGGACTTGAA TAAGCTGGTT CAGAAGTCAG ATGGAGTAAA CTTCGTCTCT     71940
     AGAACAGCAA AAAACAACGG TGTTTCAGCA AAAGTTAAAG AATTAGCTGG TATTAGAAAA     72000
     ATGTCTAAAG GATCAATAAC AGTTTCTTTA GGCGGATCTG TATTGGAAGC CTTTCTTCAA     72060
     TGTGACGAGT ATTATACTGG CTATCATATT TATTGCTTAA CACCTAAAGA CGGTATAGCA     72120
     ATGAGTGACG AAGTGAAGCT TTACTATTGT GCTTGCATTC GAGCAAACAA ATATCGTTAT     72180
     AGCTACGGCC GTCAGGCTAA TAGGACTCTG AAAAACCTCT TAGTTCCTAA CTTAGATCAA     72240
     ATACCTGAAT GGGTTTCTGG CGTTGACTTA GCCATATACA AAGGCATTGA TAAACCGAAA     72300
     AAAGAAACAA AAGAAGCGAA CCTTCCAGAC CTTAGCAAGA CCATTCGGAT TGAGGAAATA     72360
     TTTGATATTA AGAATGGCAT AGCAGCTTCA GGATTAAAAG AGAAAGATAA GGCGTTTAAA     72420
     AATAGCATAA TGTATGTTCG CCCTGCTGCT ACACAAGCAA GAACATTACG TAGCTATATC     72480
     GCTAAATCTT CTGTGCCAGA AGATAAGATC TTTCCCAAAG GCTCACTTTT CGTGTCAACA     72540
     AATGGCGAGG GTAGCCATAG CTATTCATAC GTCTCAACTG ATGAATTTGT TCCAAATAGC     72600
     GATGTTTCAG TATTGACTCC GAAAAGAGAA ATGAGTACTG AAGAAAAGCT ATTTTATGCA     72660
     AAATGTATTA CTGCAAACAG ATACTTATTC TCTTATGGTA GAAAACCAAA AGGAAATAAA     72720
     TTGAAGTCTA TTAAAATTCC AAAGCTTGAA GGAAAAGATA TAGATAAAGT CATATCTTAT     72780
     ATTAATTCTC TGCCTTATAG CTCTAACATA GAATGAATGA AAAGGCCACT ATAATAAGTA     72840
     GCTTCATTTC GCACGCCTAT TACCATAAGT AATAAACTTT GGTTGTTCTG TTTGGTATAG     72900
     GTGCTGATTT GGATAAGCTT TAGTAAGTCA AACGCACGCT CCTAGATTTT GTAGAACATT     72960
     TAGTCTAAGT GATTTTGGGG CAAAAATATG TTTACTTTAT GCCCTCTTTC AACGTTTAAC     73020
     TTTACAAGAA TAGTTCACGA TCCCTAAATC GTTGTATCGC GCGGCTCTCC TCTTTCGTTA     73080
     AAGAGGCCGG TGTCTGTAAT GGTTTAACCT GCTTCACTTT CTTCACCGCT TTAGGCTTTG     73140
     GCTTCGCTGT TGGTTTTCTT TCTGGCAGAC GCTTTTGCTT TACTTTTACG GCTAGCGTTG     73200
     GAGCCTCATT AGTTTGAGGT ATTAAGGGTT TAAGGGGTTC AGACTGAGTA AAAATGCCTT     73260
     TGAAGACAGC CCCAATAATC TCAGCGGCTT GCTCTACGCT ATCATCCCCA ACATGGGTAT     73320
     ATCGTAACGT CATAGTGACT TTTTTATGCC CCAGTAAAGA GGCCACCATC GGAATACTGC     73380
     ATCCGTCCAT GACGGCATAA CTTGCAAAGG TATGCCTTAA ATCATGCAAT CTCACATCTT     73440
     CAATCCCTAT CTGTTTTCGC AACCTTAGCC ATAGCGACTG TACCAATGAA GTGGAAGCGC     73500
     CCTGTTTCAT CGGAAAAAGT TCTGTATTGG CCTTACAGTG ATAGCGACTT AATATGTCAA     73560
     CTGCGGCTTG ACCAATGTAA AGCACTTTTG CCCCCGTTTT ACTGTCGGGT AAATGCAATT     73620
     CATTGCCGCG AACGTACTCC CCTTTTAAAA AGGTGATTTC CGATAATCGG CAGCCTGTGA     73680
     GCAGTAAAAG CCGCAAAATA TCAGCACATT GAGCAATACT GCCGCCGACC TTTTCACATT     73740
     CATCAAGCGC CACAGATAAA CGCTGCATTT CAGCAACACT CAAAAAGCGA TTTAATACCC     73800
     GCCTTTTGTT TTGCCGAATA CCAATACAGG GATTCGTCAG GCAATGCCCC TGCCTCAATG     73860
     CTAACTTGAA GACGGATTGT AATGTATCAA GGTTACGGTT AGCGGCACCT TTGCGCGTTT     73920
     TACTTATCTC ATCAAACCAT GCTTGCACCA TCTTATGGTT AATCATGTGC AACGGGTAAC     73980
     GGCCAAAATG AGCTAACAAG CGTCTATTCA GCGCAGGCAA GACTGACCGT TTTGTACTGG     74040
     GTTTCCAGTG TTCAAAAATC ATCGGCTTCC ATGTTTGTTC AACAAACACG TCAAAACGAG     74100
     GTGAAGCACT CATGCTCGGT TGAGTGTGCT CCTCTCGCCA TGCTTGAAGT TGCCCTGTTG     74160
     CCTTCTCCCG TGCCGCTTTA ACCGTTAGCG CACTAACAGG CGCAAGAATG CGTGTGCGTG     74220
     TCCGATTATC AATAAGGCGG CTAATAACGT ACTGCATCGG TTTATCGGGC ATCACTTTAA     74280
     CGCCAAGGCC ATGACAGAGA CTGTCTTGAA TGATATAGGC GCGTGTTTGA CGGGCTAATG     74340
     ACCGAATAAA CACTTGTGTT AATTTCACTG TTTTCATCGT TGCATCTCCC CTGCAATGAG     74400
     TTGAGAAACG ACATTTGCCG CCTGTTGAAC ATCACGTTTA GCAAGGTGTG TGTACTTTAA     74460
     GGTTGTTTCA GGTAAGGCAT GCCCTAATAA GCGGCCAATC GTGAGGATGT TGATATTGTG     74520
     CTTTACTGCA ATACTGGCGT AGGTGTGGCG TAAGTCATGG ATGCGAACAT CATTAAGATG     74580
     AATTGTCTCG CGAAATGGCC GCCAAAATCG GTCTAAGCAA ACAGGGGTAA ACGGCTGTGA     74640
     AGGTGATTGA TGCCAAAAAA GATGCTCGCT TACTTGTGGC CAATCACTCA GCAACTCCCG     74700
     CGCAAAGGAA GATAGAAACA CTGTTTTAGC GCCTGTTTTA CTGTCGGGCA AATACCAATG     74760
     CCCTTGCCGA TAATCAGCCC ATTTGACGGA GCACACTTCG TTACAGCGAC AACCCGTTAA     74820
     GATTAGTAAC CGTAAGACCA TCACCGCAAC GGGTGACGCT TTTTCGTGGC TATCTAAAGC     74880
     CAACCATAGC CGCTTGAGTT CTTCCTCAGA TAAATAACGC TCACTGTGCG TAGACTTATA     74940
     GCGCTTAAAG CCTTTGCAAG GGTTACTTTG CGCTGGACGA TACTCATATA CTTCGGCTTG     75000
     CTGCATCATT ACCGACAACA ACGGCAACAA GCGATTAGCC ATACCTTTCG AGGCATGCAT     75060
     ACCATCAAAC CACTGTTCTA TGTGTTGTCG TGTCAACGCG GCAAGCGGAA CATCACCCAA     75120
     CACAGGGGCG ATATGCCGCG TAAAACCACG CTGGCTATTG AGTAATGTTG AGGGCTTCCA     75180
     ATGACGGGCA TATCTTGGAA AAAACTCTTC TGCGAACGCA CAGAGCGTAA GAGAGGGCGC     75240
     AGGTTCACGC ACCACCCCAT AACGTAACGC ATCTATGTGC TTTCTTGCCT CAAGTCGCGC     75300
     ATCATCAAGC GTGATATCAT TTGCATTGCC GATAACATGA AGTTGTCGCA AACCTTGATA     75360
     CTGGAAGCGA ACGTAATAAC ACCGAATACC AGAGGGATAG GCTCGCATAA AAAAAGCGGG     75420
     AAAATATTTA TCGTAAAACA CCGTTATTTT CTGTGGTGTG GGTAAATTAT CAATCATTGA     75480
     CTGTTGCAGT TTAATACTCG GCATAGGTTT TCCTCGTTCA GTAAGGTGGC ATTTATGAGG     75540
     TGTTTTCGAA CCATTTTCGG GCTAAAAACA CGTAAAAAAC GCATTAAATT TCACTGAGCG     75600
     AAAAACAATA AAACACATTT AAATCAATGC ACTAAACTCA ACAAACAACC ACCCCCTTGG     75660
     AGCGTGGGGT GTGGTTCTTT TTTTCAAGGT TCCAACTTCA CTATTTCGCC AGAATTTTGC     75720
     ACTTTTCATT TTTTGGGGAT TTTTTGGGAA TTTTCGATTT TTGCTAGGCT GCTGCCGTAT     75780
     GAAGCGGCAA AGGTATCGGG GGATTTTCAG GCCAAAAAAA ACGCACTCAA TGAGTGCGTT     75840
     TTCTGCAAGC GTGGCGGCTT AATATTCGCT TGGCAATAAT GCGGTGGTTC GTGCTCTGTC     75900
     TGCCTCGGTG ATGATCCATA TTTCTACACC TTCAAACTGA TAAGCTGAAA GGATACGACC     75960
     GCCCTTAATT AACATCTCAT TATTAAGCTG GTAATCTTCA TTCTCTAAAT CTCCCCAATC     76020
     TCCGATCGCG TGACGATAGA ACAAAGACGC TAACGCTAAA CCATTACCAT GGCCGTTTTT     76080
     GACCAATTCA TTTATCCCTT TAGATGTATA TAATGCACCA AGCCACTTCA ATTTATCTTC     76140
     TATTGTTTTA TCCGACATAT CTATTCCTAT CTAATAAAAG GCTTAGTGAA AACTAAGCCT     76200
     ATAAAATCAA GCGGCCTTTA ACTGTTCGCA TGTGACTTGC ATTAAATACT GATGAGCCTT     76260
     AGACGCGGCA CTGGCGGCTT TAAAAATATA GCGCTTATCA TTCTTTAACT GCGTTAACCA     76320
     ACTTGCGATA TAAGACTCAT GCTGAACGTC ACCGCTAACA TTTAACTCGG CCATTAAAAA     76380
     ACTTGCGCCT AATTCAGCGA TCAATTCTTC AAAGGCGTAA TCATCCGAAC CAAACCGAGA     76440
     TCCCTTTATT CTGTCTAATC GGCTTTTTGC GCCTGTCCAA TGCGTTAACT CATGCAATGC     76500
     CGTACAATAA AAATCAAGGC TATTTGAGAA ACGTTCGCGA GTGGGTAAAA CGATGTTATC     76560
     GGTAGAGGGT CTAAAAAATG CTTTATCTCC TTGCTCTACA ATATTCGCAC CTGTTTTATT     76620
     AATGAAGCTT TCAACATGAT CAATTGCATC AAATGAATTG TTAACGTTGA AACCTTTCAC     76680
     TTCCTCAACA TTTAACCCGT CGATTTGCTC AACGTTAAAG ACAGTGAAAC TTTTAAGCAT     76740
     GGGAATAACT TCTTTTTCAC CTTGTTCATT TTCTTTTTCC AAACTCTTAT AAAAAATAAT     76800
     TGAGGTGCCC TTCTCGCCTT TGCGAACTTG ACCGCCTAAA TTATTCGCTT GGTTATAGGT     76860
     TAAAAATTGA TTTGATGAAA ATCCCGCATC AAATGCCGCC GCCCATAACA ACAAAACATT     76920
     AATACCGCTA TAGGCTTTTT TAGTATCGAA ATTAATCGGC AAACCTGCAC CGATTGAATT     76980
     TCTCTGCCAC GGACACACCC AAGGCTTTAC GCCTTTATCT AATGCCGCAA TGATTTGATC     77040
     AGTGACGACC TGATACATAT CTACTTTTTT AAATGCTTTT GCACTTTTAC TTTTTGTTTT     77100
     GCTTTTTGAG ATATCGTCTT TGGAGAGCCT GCTTGTCGCT TGTAAGCTGG CTTGCTCATT     77160
     GAAAGGCTTA GTGTGGCTTG CTGGGGTAGT GATTGAGTGT GTCATGGGCT GCTTGCTCCG     77220
     TTTGGGGTCT ATCATCTTCG TTTTCGCCTG ACGTCCTGCT CGCTCGCCAT CGTTCTGATT     77280
     GACAAGGGCG CGCAGCGGCG AAGCGAACCC TTGGCAAGCG GGTTGTGGTG AGCGACAGAT     77340
     AAGACGGAAG CGTAAACGAA AGGGATAGCA CCAGGAGCGG CCATGATGCC GAATGAAACG     77400
     ACCAGCTTAG CCACACTTGC CGCGCAGTGA GTAGGACTGT GCTTGGCGGT TTGGTGGTTG     77460
     CGTTAGGGAT TGGCAAGCAG GAACGTAGAG CCACGGCAAG CTTGCTTGCC ATCAGTGGAT     77520
     CACGTTATCG CGGGGAGCGA AGCGAAAAGC CCGACCGGAG GGAACGCCCA AGTTCATCAG     77580
     TTGTCTTTAG ATGACATAGC GCAACAGCAG CCAATAGACA CTCAGAGTAA ATAGATTGAC     77640
     CGCCGAGGCA CACTTCAAAG CACACCAAGG GGTATTGTCA GATAAACGGA AAAGGGCGGC     77700
     GCAGCCGCCG CTTGTTTCGC GTTTTACGGG GAGCTAACAA GGGGCAGCCT GAGCTTAAAT     77760
     CACATGGCTC AAGCTGATAT TAAGCTATCC CTTCCAAGGC TTTCTCTGGC GGAATGTCCT     77820
     GTTGAACACA ATCAGCAAGA TAAGCGTTAA TCGCCTCTTG AAATGCTTGC TCTAACTCTT     77880
     TGGCGGTTTC GGCCTCATAG TTGATCAACG GTGAAATGAA TAACACCTGC CCAAACAGAA     77940
     TATTATCCTC TGGGCTGATT TCTACAGAGC CGTGATAACC CTTAAATGTC ATTGCATTTT     78000
     GCATCATCGT TCCCCCCTTC CCCATTATTT ATCAGACAAT TGGCAAGACA TTATCAACAA     78060
     TGAACCGCTC ATTTAAAGCG GTTTCATCAT CACTAAATTT AAATTATTTT ACTTATTTTT     78120
     TAATGTTCGG CTTCTTTCAA CATCGCTTTA GCATGGGCCA GTGTCATCAT GAGTTTCAAA     78180
     TAATTATCAG GAAAGGATAC AAAACCAAAC TCACTATAAA AACGTCTAGC ATCTTCGTTC     78240
     TTTGCTTGAA CAATAATCAT AGGGATGGGG ATAGCACTGG AAGCTTGGAT AATTCGTTTG     78300
     ATTGCGTCTA TAAGCAATAT TGAGCCAAGC CCTTGTCTTT GACAGGTATG GTTAACAGCC     78360
     ATTCGACCTA TCAAGCTACA CGTTATTTCA GATGGATATT TTTTAGCTAT TTCGGTTGGT     78420
     AACTCACAAA GTGATACCTG AGCTACCGCA ATAGAGTAAT AACCTTTTAT GTGTGAAGGA     78480
     TTTAACTCTG AAGTAAGAAC ATATGTTCTT GAAATATCTT TCTTTTCATG CTGACCTGAA     78540
     ATGCATTTCA GGTAATTGTT TAGCTCTGTA TTCCCACAAT CAAAACTCTT ACGGTCATGC     78600
     TCATTTTTAT CAAATTGGGT AATTTTCATT GTTTACCGTT TCCTTATGCT TACGCGCGGC     78660
     ATTAAGAAAC CGACTGTTAC TTTTAACGGG TGCATCTAAA GCGTTCACAA AAGCTAAAGC     78720
     ATCATTTTTT GATAACACCA GAAAATGCTC TTGTGTGATC AATCTTTTCG CTTCTGAAAT     78780
     CATTGTATTC GCAATAAAAC TGTTAATACT GGCATAACCA GCGAGCGCAG CCGCTTTCTC     78840
     TAATAGTTCT TTTGACTCAA TGCTTACCCG AGTGGTAATG CGTTCATTTG TCATACTTTT     78900
     CATCTGCTTA TTTCCTAATT TAGCATCAAT GGATGCGTTC ACTTTTAATA GCCACTATTC     78960
     AGACACGCTG TGCTGAACTA GCGGAACATA TTGCGGTGAA ATATGAGGCA TAGCCTCATT     79020
     TGGCATACTA CCCTTATAAT TAACAAAAAT CAATTAAGGT GACAAAATGG CACCTTGGTT     79080
     CAGGTTGATC CCAAAAGTGC CAACTCCAAT ACATCAAGCA TAAATGCGCT TTTTTCTATA     79140
     GTTCAAACAC TTGCAGTTAA CGGAGGAGTA GGCTTTATGA GTCAGCCCCC TTCCATCACA     79200
     AACCGAAGTG GGTCATGATG TGAATTAGCG AAAAAGGGGA ACGCATGTTC CCCTGTAAGA     79260
     CGTTCAGGCT GTTTACACAA ACTGCCCTTG TAGATCCTTA ATTCTCACTA TCGGATAGCG     79320
     ATTAGCACTC TCTAAGCATT TAGCGCGAGC CCTTTCGATA TTGATCGCTG AATCAATAAA     79380
     ATAGCATTGT TTTTGGGCAA TATCGTTTTC AGAGTCATAG CCAACAATAA AAAAGCGAGG     79440
     GGAATATTTA ACCTCGTCCA CGGTATAACG GATCGCCTGA CCTGTCGCGG ATTCGTGATG     79500
     GCCAATGTAC CCGATCCCGT TAGCATTCAA ATCAGCCATG TGGCTACTGA CAACCGATGT     79560
     TGCATAGTCC GCAGGCCAAC CCGTTGCAGG GGTGCGACCA TATAAACGTT CATGTTTATA     79620
     TTGCCCTTGT AAATAGGTGT TCATTTCTTC AAACGTCACT GAGGGTTTGC ACATATCATA     79680
     TCGCCCCCGT GTTAGTGGCC AACTCAATGC AGCCCCCTTC CATCACAAAC CAAAGGGCAT     79740
     GATGTGTATA GCAATCGCTT ATCTCCCCGT CAGCCGCCAC CGACACATAA ACCGTTGATA     79800
     TGATCCCCGA GGGTAAAGAC CACATGATTG AAACGTGCTT ATTTCGATAG TTCAGACTTA     79860
     ACGCCCTCGT TAGTTCATCG ACTGAGAGGC ATTGCGTATC GTTGCCAAAA TTCTTAATCA     79920
     CGACAGGAAA ACGAACCGAA ACCCGTTTTT TGTCAGTGCT AAACACATTG AAACGCACGC     79980
     GATAATCAAT ACTTGCGCCA TTGCGTCGAG GTTGATCGAT TGATACGACA TTTTGAGCCA     80040
     CTTTTGCCGC GACCAAGAAC CGTTCAACCG CTTCAAACAA CAACCCCTGT GAGTAGGGAT     80100
     ACCATGCTTC ATTTGCCACC CCTTCAAGTC CGAGGCCGCA GAAGTGGAAG AAGTTCATTT     80160
     CAGTTAAAAC AATGATCGTC AACTCGCCCC TTTTTTGCTG TTGAATATCG TCTTTGGAGA     80220
     GCCTGCTTGT CGCTTGTAAG CTGGCTTGCT CGCTGAAAGG CTTAGTGTGG CTTGCTGGGG     80280
     TAGTGATTGA GTGTGTCATG GCTGCTTGCT CCGTTTGGGG TCTATCATCT TCGTTTTCGC     80340
     CTGACGTCCT GCTCGCTCGC CATCGTTCTG ATTGACAAGG GCGCGCAGCG GCGAAGCGAA     80400
     CCCTTGGCAA GCGGGTTGTG GTGAGCGACA GATAAGACGG AAGCGTAAAC GAAAGGGATA     80460
     GAACCAGGAG CGGCCATGAT GCCGAATGAA ACGACCAGCT TAGCCACACT TGCCGCGCAG     80520
     TGAGTAGGAC TGTGCTTGGC GGTTTGGCGG TTGCGTTAGG GATTGGCAAG CAGGAACGTA     80580
     GAGCCACGGC AAGCTTGCTT GCCATCAGTG GATCACGTTA TCGCGGGGAG CGAAGCGAAA     80640
     AGCCCGACCG AAGGGAACGC CCAAGTTCAT CAGTTGTATT TAGATGACAT AGCGCCACAG     80700
     CAGCCAATAG ACACTCAGAG TAAATAGATT GACCGCCGAG GCACGTTTCA AAGCACACCA     80760
     AGGGGTATTG TCAGATAAAC GGAAAAGGGC GGCGCAGCCG CCGCTTGTTT CGCGTTTTGC     80820
     GGGGAACTAA CAGGGGATAC TAGAGCGACT ATCGGCGGCC AATGAAAACG AGCCTGAATG     80880
     CGGCTGCGCC GAAATAAAGG GCAGAAATGG CAATGAACAG CCAACAAATC ACCAATAGTA     80940
     AATTATTCAA TAAAGCCATC AACATGTCGC TCGCTTATTT TATCAATTCA AATACTTTAC     81000
     GGTTAGCAGC GGTTTTGGTG TTATCAGTCA ACGGCCAAAT TTCCCAAGGA GAATCGACGC     81060
     CCGTGCGACT TCTGAGAAAG CTATCTCCCT TGCGCCATTG AAACTCTTCG TAATCAATAC     81120
     ACCACTCAAA CACTTCACCC TGTTTGACGG ACTTGAGATC ACTTATCTTC ACAATCTCTA     81180
     TCGCACGTTG AGACATGCCT AACCCTCCTT GTCGTTATCG CAACACTCAC ATTTCTTCAT     81240
     CTTCCCACTC GATGAGGCGG TATTTTTGAA ACTCTGGATG CTCTTTAAGC TGCTCGTGAA     81300
     CATCAGCGGG AATATGAAAA TTCAACTCCC CCGCTTCAAT CAAATACTTC AAACACGCTA     81360
     AGCCCTCATG CCCAAGCCCA GACTCATCAA TCACGCGCTG CACTTGATTG GCTTGGCATC     81420
     GATACCGCGC CCCACCGACA ACGACATTCA CCGCGCCAGA GGGCATAAAA ATCATCGTCA     81480
     CTGGATAGTG ATGGCCGCCA AACAGATTCA CAAAGGAAAA ATAGACATGA TGACCTTCAC     81540
     GAGTACAACT CACGATATTG TTGATTGGCA TGATAACGCC CTCACTGTGT TGCACTGGAA     81600
     TAATATGGAT CGGCTCATCG GCTTGTACGG CTTGCTCATA GGCTGCGACA ACCTCGGGAT     81660
     TGTCCATAAG CTGCGCTTTC ACCTCTGAAA ATGGAATACC GGTTACTTTG CCCATATCAA     81720
     TCTCCCACTT TTGAACACGA TCTTACTGAG TCTGCGCTGT TCATTAACTT ATCAGCCGCC     81780
     TTGGCCAAGA AGTCCGAACG GTCTTTGAAC TCGCGATGAA ACGCCACAAA GCTATCGATA     81840
     CGTACAATCT GCGATTCTGA CAATGTGATA TTGAGGCGTT TTTGTTTGGC TTTAAGCGCC     81900
     TCTATTGGCA CCTCTAAAGC CAGCCATTGG TCGAACTTGG GATGCAATGC CTGATAGTCG     81960
     CGATAACCTT CATTCAAGCT ATCGACTAAA TGACCATCGT TGATCACTTC CTCGGCCATT     82020
     AATAAAATGG CTTCCTTAGC CTTAAACAAG ATTTCTTCTT GGCTATCCGC CGCCGAAAAA     82080
     CAGCCATAGC CTAATTTTTC AAACACGGGA ATAACGATAC CAAACGCCTG CATTTCATCA     82140
     GCAGGGCTTT CGATCCCGAC CATAAATAGC ATGGTAAAAC CTCTGCGTTA ACCGTTGAAC     82200
     TATTATACAC ACGCATACAC ACAACTCAAT TTATTTAGTT AATTTTTGCT CAGATTTACC     82260
     CTGAATTAAC AGGGTAAATC TGCATCAGTA TGCGGTTTAA AATCCAGCGG GCATCAACGC     82320
     ATCAAAGTAG GCTTTTTGTG CATCATCTAG CCCTTTTCGC TCCCCGTTCA CTAAGCTATC     82380
     AACCTGATTT GCTAAATCCT TTTTCTTGAG TGCGGCGGCT TGTAATGCCC ACTGCTCACC     82440
     CATGACAGGC TGAGCCATAT CAATTAAACA AGACAAGCTC ACGCGCTTAA AGAAGGTTTC     82500
     TGCCGTTGGT CGCCAGTAGT TAGACCATTT CACATCGAGC GTGGATATCA CGGCCTCAAC     82560
     AGCTTTATGA CTATTATCAA TTGACGCCTC GAACATGGAA GCCGTGGCGT AAGCCACCTG     82620
     CTTTTCTTTC TCTTTTACAT CGAGGGCGCA AAAAGCGTTA AAGCGTTCAG CGACCGTTGG     82680
     CAGACCAACC CACGCTAAAT TTAGGCTGGC TTTTACACCC TCGATTAACT GCACCGCTTT     82740
     GTTATCCGTG AGCGCTCCCG TTTTAGGATG GCAAGTGGTG TCGTTAACGC TGATATGCAG     82800
     TGGACGACTG CCATAATGTG AATCAGTGAA CGCGCTTACA CAGACAGAGA AATGCAACGT     82860
     ATCAAGCGCA ACGCTTGGCG CACTCATTAA CGCATGTTTC GTGATAATCA AACGCTGAGC     82920
     CCGTAAGTCG TCATTAAGCG CAGCGGAATA ACCGCTAGTA TCCTTATCTT CAATTTTTTT     82980
     CACGTCACCC ACGTTCACGT TGAGTGGGTC TGATTGCACA CTGGCTTTTA ATTGTGCCAG     83040
     TGCCTTTTTA TCGTCCTTAT GCACTAACCC AATATAGATA CTGACAGGCT CACCAAAACT     83100
     TTTTAACACG AGCATACACC CCGCTAGCGC CATTTCAGCG GGATCATACT CACCCTCTTT     83160
     TAAATCTAAA AGCCCAAACC CTGCAAGTTC ATCATACTCA GAAACTAACT TTATCTGTGT     83220
     CCACTTCCAG CCACGCGCGA TTAATTTTGC TGCTTCGATT TCCAATTTTG CGGTCGCTAA     83280
     TGATTCGAGC AGGGCTTTAT CATCAAGATA GACTTCATCA CTGAACAAGT CTGAGGTCAC     83340
     AACCCCGCCC GCTTTTTCGT ATTCGTCTTG ACCTACAAAC TTAGCGAGGT AGTGATCTGC     83400
     ACTCACCGCA GCGGCTTTGA GCATGTTGCG GAACTGATGC TCGTTGTAAT GTCTATCGCC     83460
     TGCCAGCTCC CACACTTCGA CTTGTTTTTC GACACTGGCA ATCGTGAATA TCATCACGAC     83520
     ATCAAGCGAC ACGTTCCCCG CTTTGTACGC ATCGAGCACA ACAGGGGCGA CCATGCTTAA     83580
     CTTCATGCGC TGCTGCACGA ATTTCGCTGT TACGCCAAAC CGCGCCGCAA CATCAGCAAT     83640
     GCTCGCGCCC TGATTCACCA TGTCAGCAAA AGCGTGAAAT TCATCGACTG GGTGCATCTT     83700
     GGCGCGCGTG AAGTTTTCAG TCATTGATAG CTCGGTGGCA TAGTTGGCCA CTTCTTCGGC     83760
     TGTCAGCAAC TTAACAGGCA CAAGCGTTTT CGGTTTCAGC TTATTATTTT TGACCGCTTT     83820
     AATGAGCTGT CTCAGTCTAC GGCCACCGCC CAACACAGGA TATAAGCCTT CCACGTTCAT     83880
     GGGCTCGACA ATCAGATTTT GTAAAATGCC ATGCGCCAAA ATGGAGGCAT ACAACTGTTC     83940
     ATCGTCAGCC TTGGACGCAT TTTCTTTACG CACGTTCTTC TCAGACAACA CCAACTGGTT     84000
     AATCTGCAAT TGCAGTAACA CTGGCTTTGC TGTTGAAGCC AATGCCACCA CAGAGTTAGC     84060
     CGCTGTTGCC GATTTTTGAG CGATATCGGG CTTGTGAGAG CCTGCTTGAG TCTCGTGGCT     84120
     GGCGGGTGAA ATGCTGGCTT TAGTGTGAGT TGCTTGCGCT TGAATTGAGT TTGTCATTGC     84180
     TTGTTTTCCT GTCGTTTAAA TATCGTTCTC GTCTTCGCCT AACTTCCTGA CTCATTTCAC     84240
     GTTCTGACAG ACAAGGGCGC GCAGCGGCGA AGCCTCCCTT GGCGGGCAGG TTGTGAAATG     84300
     AGACAGATAA GAAGTGACAG CGCAGACGTG AACGGTATTG ACAGGGAAAC GATGACAAGC     84360
     GATAGAGAAG CGCACGCTTA CTCACACTTT AGCCAGCAAT GAACCGGACA GTGCTTGTGA     84420
     CTTTGATGTT TGCTTTGGTT TGGGCTTGGT TGTTGCGTTA GGGATTGGCA AGCAGGAACG     84480
     TAGAGCCACG GCAAGCTTGC TTGCCATTAG TGGATCACGT TATCGCGGGG AGCGAAGCGA     84540
     AAAGCCCGAC CGAAGGGAAC GCCCGGTTTA AGACCAATCT CCGGTGAGCT GTTTTACTTC     84600
     GGTTTCACGA AGACAAAACG CCGTATTAAT CGACGCTAAA TGATCAAACT TCTCTCGATA     84660
     AGTGAGAGCT GAATCTTGAT CAATTTTACG CTCAGCGCCG GTTACTTGGA TTAGTAAAGT     84720
     ATCAAGATTT TTACTGGCTT TAAACTTACG CAGCCACAAC AAATCCAATT CGGACAATGT     84780
     GTTATTATCA ATGTAATTCA TAGCTTCTCG TATATTTACC AAATATTGGC TTGCTGACAG     84840
     CGAGTTTTGA CGATCTCATT ATCATTAAGC TGAATCGCGG CAATTTTTTT GGCCCGCTGG     84900
     CACTCCTGAA CATTCACCGG ATATTGCTTA TCCCACGCAC TCATAAGCTG CCGCTGTGGT     84960
     TTACTCATCG AATATTTAGG ATAACTTTGG TCCATATACA GATAAGACTG TACTGGTCAA     85020
     CCCAAACTGG ACACTTTTAC TTGAGAATTC TCAAACTCTA CAGGTGACAG ATCGTCATTA     85080
     GCAGAATGAA GTCGCTCCAA GTTGTAATAT TTCATGTAAG CCGTCACATC TTGCTTCATA     85140
     AACTCCCTTG TTGGTTGAGC AACTTTAAAA ATCCAATCGT GTTTCAAGCT ACCAAAGAAT     85200
     CGCTCAACAA CGGCATTATC CCAACACGCA CCCACATCAC CCATGCTGGC TCGGATACCA     85260
     TAGCTCGATA GCAACCTGCC GAACTGCTTA CTGGTATATT GCGAGCCTCG GTCACTGTGA     85320
     AATACCAACC CTCTGGCCGG TTGGCGCAGG TTGTAGGCTT TTATTAATGC CTTAGATATC     85380
     AAATCTGTGG TCATGCGTTT GTCTATGTGC CATCCCACAA TCCGGCGTGA ATATAAATCC     85440
     ATCACCACTG CCAAATACAT CCAACCTTCA CCTGTCTTTA AATAGGTCAC GTCACCCGCC     85500
     CAAACCTCAT TAGCCGATAC GGGGTTAAAG TTCATGTTTA GCAGGTTATC AGCCACAGCA     85560
     TCTGAGTGTT TTCGCTGCGT AGTCACCTTG TAAGCGCGTC GCTGGGTTGC TTTGAGTCGA     85620
     AGGCGGTGCA TAATTTTACG AACGAGATAG CGACCAACCT GGTAGCCTTC CTTGCGCAAT     85680
     TTCTTCACCA TTTCACGATT CCCTAAGCTG CCTCGACTTT GCTTAAATAG CTGTCGAACA     85740
     AGGCGATAAA GCTTCAGTGT TTCAACGCTT ATCACGTTTG CAGGGCGTTT ATGCCAATCG     85800
     TAATAGCCTG ACTTACTGAC ACTCATTACT CGGCATAACA GTGTTATAGG AAACAGGTTA     85860
     GATTGCTGTT TGATGAAACG AAATCTTACT TCATTTCTCT CGCAAAGAAG GCGCTTGCCT     85920
     TTTTTAGAAT TTCTTTCTCC ATGCGTAATT CTTTGTTTTC TTTACGTAAT CTCTTTAGCT     85980
     CATCACGCTC AGACTCTTCT AAGGTGATAC CTTGTTTCAG GGCTTCGTGT TTTTCCTTCC     86040
     AGTTGTAAAG CAGGCTCGTG CTAACTCCAA GAGACTTTGC CGCATCGGCA ACGCTATAAC     86100
     CTTGTTCTAG CACCATCAAG ACGGCTTCAT CTTTAAATGC CTGCGGATAA CTCTTATGTG     86160
     ATTTCTTCAG ACTCATATAG ACCTCTTAAT TTATTGACTA TACTGTCTCA AAATTAAGTG     86220
     TCCGATGGAA TTAGACCAGA ACAATGTTCC GGCGCGGTGC CGCTCTATCG ATAATTAAAA     86280
     TGTCGCCGTC GTATATACCG ACACCTTCCA TGCTTCGTCC AGCTGTGCGG CCGAACCACG     86340
     TAGAACTAGG GTGCTCAACA AGGAGTTGAT CGAGGCTAAG CGGTAATTCG AGGTAATCTG     86400
     CAGCAGGTGA AGGGAAGCCG CTTACCCCTG CACTTGCATT GCATGTAATC AATTTCACAA     86460
     GCCAAAACCA CTGTATAAAT AATCAGTAAT GATAGCAGTA AAAAAATAAA AATCTAAAAT     86520
     TTCGATCCTG CTGCCGGTTC CTGACTTTTT TCGGTGGGTA ATCGCCGCGC TCTTTGCGGT     86580
     GTTATCCACA AAAAATCAGG GTTCGGTGGC GAATGGCTTT TCGCTTGAAA TGGTCATGAG     86640
     CGATGGAAAA TCGGTAAATA ATTTCTGACA GCCGCTTTTG TTGCATAAAT CTGGTCAATA     86700
     CCCACAGATT ATTGACCACT TGTTGCAGAA TACTTGGTAA TCTCATGGCA ACTGTCTAGA     86760
     TCCACGGTGA ACAACTCCTA GACAGCCAGC CCCCGCAAGG GGGCGTTCTA TCTTTATAAA     86820
     CGCCAAGAGA CGACAAAGGA TACAAATGAC TATTAAGAGT GAGTATCTTC ATGTCATTTT     86880
     TGGACAAAAG CTTGTTAGAT TTTTTACTCA AATCCATTAG TTTCGGATTA AAATTTCTAT     86940
     GGGGTGATGC CGTCAACACG TGCGGCTTTG AGAGTATTAA AAGCTACTTG TATTTTTTGT     87000
     TTACGAAACT ATTTCCCAAT TTTACTCATA GCTTTCATGT AGCTGTCTAG TTGCCCCATT     87060
     GAACTTAACA TTCTAAATGG ATTACTTCTA GCTGCTTCAT CCTTATGGGC TTCGGTTATG     87120
     CTACACCAAG GACATAAATC GCTCTCTGCT ACTAGTGGTT CTAAGCAACT GTTACAAGTA     87180
     TTAGGCGCAA TTAATATATC GCTCTGAGAG AATGTAAAAA CATTACCAGA CTCATTTTTC     87240
     ATATATGGTT TCGGGTGGCT TTTACCAATA ACTAACTCAT ACCAAGTTAA TTCATTCTTT     87300
     TTAGCAATTT CTTTCGTCAA ATTGATGTTT TCTTTAGGGT ATTTTGAACC AATGATAATA     87360
     CTAGTTACCA AATCACTGGG AATGTATAAA ATATCGTTCC CAGCTACTTT CTCTGATACT     87420
     TTTTTCATAT CAACAAACCT GCATTCTTGC TCGTATTTCC AGTCATCATA TTTAGCAAAA     87480
     TATGATTCAA CAAAAACATA TTCTTGTAAG GCATAAGAGT GACGTGGTTT TTTTAAAACT     87540
     GCGGCTCTTT GAAGGATAGG TTGAAGGTGC TCACTTGGTG CATTTCTATA TGTAACATCC     87600
     CAAATTGGGT TACCTATAAA GTGCTCTTGC AACTTATCTA AATCAAACTC TAATACGAAT     87660
     CCTGTATGAT TATTTGCATA ATGTGCCCAC ATAGGAGAAA CAATCGGAGA TTTAGAAAAA     87720
     CATGTCGTTG GGCTTTGGGG AATACCAGAA ATAATATCAT TATAAAAAGC AAGTTGATCA     87780
     GCTGGAGTGT TCAAATCCAT GCCAAGGAAA AGCTCATAAG GATCATTGTA ATCCTGAGGT     87840
     AAAGAACATT TTATACCGCA AAATCCTTTT TTTTGGAAAA CTAGTTCAAT TACATTATTT     87900
     GAAAAGTATT TATATATTTT TGACATTTGA ATCGATCATC CATATACGAA AAACAAACGC     87960
     CCGCCTAAGG GCTGACAACT CTCATCCAAA CTCAAACTGT AGTGGCAAAG CCAAATTGGT     88020
     CATCAATACA TAATTACTTT GTTCCATTAC TAAATTTTGG TCAATAGTTA GTTGCCAAAT     88080
     ACAGTAGTGA GTTAGGCGGT TGACACGTTT TGGGGCAAAA GTGCGTTAGC CCGAGGTCAG     88140
     CGCAAAATGA CGAAATTTGG CGCGTGAACC AGACAAGGCA AGCCTGATTC AATCACACTA     88200
     GCACTCTGAT ATCGGTAATG GCCTTCATGT GGAAAAGCTG GGACATAAAA GCGCTGCCCT     88260
     CAGCTTTACC ACAATCAGCC AGATTAACAT TTGCGGTGGT CGTAAGTTTG C              88311
//

If you have problems or comments...

PBIL Back to PBIL home page