(data stored in ACNUC7421 zone)

HOGENOMDNA: SHEB2_3

ID   SHEB2_3; SV 1; empty ; DNA; empty ; PRO; 59223 BP.
XX
AC   NC_011665;
XX
PR   Project: 58775;
XX
DE   Shewanella baltica OS223 plasmid pS22303, complete sequence.
XX
OS   Shewanella baltica OS223
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-59223
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Meincke,L., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Brettar,I., Rodrigues,J., Konstantinidis,K. and
RA   Tiedje,J.;
RT   "Complete sequence of plasmid3 of Shewanella baltica OS223";
RL   Unpublished
XX
RN   [2]
RP   1-59223
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (15-DEC-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-59223
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Meincke,L., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Brettar,I., Rodrigues,J., Konstantinidis,K. and
RA   Tiedje,J.;
RT   "Direct Submission";
RL   Submitted (04-DEC-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001255.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003209
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..59223
FT                   /strain="OS223"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella baltica OS223"
FT                   /plasmid="pS22303"
FT                   /db_xref="taxon:407976"
FT   gene            complement(1094..1477)
FT                   /db_xref="GeneID:7090277"
FT                   /locus_tag="Sbal223_4481"
FT   CDS_pept        complement(1094..1477)
FT                   /locus_tag="Sbal223_4481"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRC0031 hypothetical protein"
FT                   /db_xref="GI:217975698"
FT                   /db_xref="GeneID:7090277"
FT                   /translation="MYICLKNPWCQFFIAFWPFISVASNTTNQSFNQAKKQLLSVYQDH
FT                   RETPSDTQREPDMIYMLQEHVENGFIASGEQVAPVSLFLESDKVISVVDLVNATGLFQT
FT                   EIQQHNVDEKQGHILLIPNSLVQ"
FT                   /protein_id="YP_002360297.1"
FT   gene            1556..2095
FT                   /db_xref="GeneID:7090227"
FT                   /locus_tag="Sbal223_4482"
FT   CDS_pept        1556..2095
FT                   /locus_tag="Sbal223_4482"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bth:BT_p548232 hypothetical protein"
FT                   /db_xref="GI:217975699"
FT                   /db_xref="GeneID:7090227"
FT                   /translation="MYYVDPSTVISPKTSVSAVRVLEDKQEGSFSIARIRYDNEDVIAC
FT                   RWNGSDSEPSGHPNSRGIPTWFIIPTEIENDILQGVIKRAETDRSFILQELVALKKELS
FT                   DFKHTGTGTHITIYQLKKIRSLTDANLLVELVRTDNDLKKLKVDVFDMDNKGTRTKDPI
FT                   SLLGEKLHLSLVRQID"
FT                   /protein_id="YP_002360298.1"
FT   repeat_region   2645..5038
FT                   /mobile_element="insertion sequence:ISSba20"
FT   gene            2738..4240
FT                   /db_xref="GeneID:7090228"
FT                   /locus_tag="Sbal223_4483"
FT   CDS_pept        2738..4240
FT                   /locus_tag="Sbal223_4483"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pden_0461"
FT                   /codon_start="1"
FT                   /product="integrase, catalytic region"
FT                   /transl_table="11"
FT                   /note="KEGG: pde:Pden_0461 integrase, catalytic region"
FT                   /db_xref="GI:217975700"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:7090228"
FT                   /translation="MPGRRITDQQIRLFMSKRKDHPQVTAAVKAGISERSARRIESGQR
FT                   QLGPSKPRNYRTRTDPLEPVWEPVVLPLLQRSDTITPVGVFDYLIEEYSDAFPAKLRRT
FT                   LERRIQKWRQINGRDKEVIFRQVKQLGQLGIMDFTWADFTVTIQGVALKHRLFNYRLPA
FT                   SGWSYAEVVYGGESFVAVATGLQNAFTQSNGVPQEVRTDSLSAAYKNHSNEIWFTERFS
FT                   ELSMHYSFKPSKNNTGIAHENGAIESANNHLKNQIRQALAIRDSSDFDCIDEYEVFIDE
FT                   VVQRRNRRIMPLLIEEQRQLQPLPKFDSANYEVHPVKVSSTSTFQLKRVTYSVPSRLVG
FT                   ATLRVHLFDKTLDIYCQGVHTSTLTRVHTSANHRGHQIDYRHLIGALMKKPRAFRGCQW
FT                   RDQLLPNEDYRQIWKGIDAQLSADEASLYMVRLLNIACKSEREEAVGRFVLDGLNNAQL
FT                   PSIFDCEDRFLKDEEWEYNPQVQQHSLASYQQLFDGENGYVS"
FT                   /protein_id="YP_002360299.1"
FT   misc_feature    3143..3508
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal223_4483"
FT   gene            4230..4976
FT                   /db_xref="GeneID:7090229"
FT                   /locus_tag="Sbal223_4484"
FT   CDS_pept        4230..4976
FT                   /locus_tag="Sbal223_4484"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: gvi:gll4066 putative transposase"
FT                   /db_xref="GI:217975701"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:7090229"
FT                   /translation="MSVETLPLLLKELRLASLLPHWEALAEKAREQHWPMERYLAELCQ
FT                   LELSSREQKRLQRGLKEATLPIGKYLDTYDFNEVEGLSKEQVWHLAEHAQWLKTGDNIL
FT                   LFGASGLGKTHIAAGLGYRLVEQGHRVKFMSASLLVQQLQKAKEELRLSEALVKLDKFA
FT                   VLILDDLGYVQKSTEETSVLFELIAHRYERHSLIITSNQSFEDWDKLFSDTVMTVAAID
FT                   RLIHHAKILQCKGESYRRKEAQNKLN"
FT                   /protein_id="YP_002360300.1"
FT   misc_feature    4293..4958
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Sbal223_4484"
FT   misc_feature    4515..4847
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal223_4484"
FT   misc_feature    4548..4571
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal223_4484"
FT   misc_feature    order(4551..4574,4731..4733,4830..4832)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal223_4484"
FT   misc_feature    4719..4736
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal223_4484"
FT   gene            5479..5766
FT                   /db_xref="GeneID:7090230"
FT                   /locus_tag="Sbal223_4485"
FT   CDS_pept        5479..5766
FT                   /locus_tag="Sbal223_4485"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: abo:ABO_2714 hypothetical protein"
FT                   /db_xref="GI:217975702"
FT                   /db_xref="GeneID:7090230"
FT                   /translation="MEVKYYHQKEGAYGNIMWDKKLGESEDTHPIESIKVDAQNHPLEK
FT                   FRKLGYFASCFPEGDGIAIQDETKKKTKGMVADDIITCFGWDVCIVVNGS"
FT                   /protein_id="YP_002360301.1"
FT   repeat_region   complement(5995..6032)
FT                   /note="tn3 end"
FT   repeat_region   complement(6220..6257)
FT                   /note="tn3 end"
FT   gene            6360..6929
FT                   /db_xref="GeneID:7090231"
FT                   /locus_tag="Sbal223_4486"
FT   CDS_pept        6360..6929
FT                   /locus_tag="Sbal223_4486"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG1192"
FT                   /codon_start="1"
FT                   /product="chromosome partitioning ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: vfi:VFB13 hypothetical protein"
FT                   /db_xref="GI:217975703"
FT                   /db_xref="GeneID:7090231"
FT                   /translation="MKVISVWNEKGGVGKSTISYNLAGAAVTKGLSVLLIDDDPQGSCA
FT                   WLSSDGFAPFEVVKHWPTNKPNVDLVIVDMTPSTTDTPNGVVILPYQPTRLAYGVVPKH
FT                   LPKLKQAGLRVVQVISMADMRKTEHREFAKTKMREDKTIQLVPNRAIYERTTGLGRTVF
FT                   DPELKGMYGLRDAQKDMNKLLDEVLK"
FT                   /protein_id="YP_002360302.1"
FT   misc_feature    6360..6926
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Sbal223_4486"
FT   misc_feature    6366..6689
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4486"
FT   misc_feature    6387..6407
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4486"
FT   misc_feature    order(6405..6407,6579..6581)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4486"
FT   gene            6926..7300
FT                   /db_xref="GeneID:7090232"
FT                   /locus_tag="Sbal223_4487"
FT   CDS_pept        6926..7300
FT                   /locus_tag="Sbal223_4487"
FT                   /gene_family="HOG000245284" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975704"
FT                   /db_xref="GeneID:7090232"
FT                   /translation="MSQGPAWLATAENNTQGNEVGTAAVIDNKTPRGKPGPKKSLVKRK
FT                   VIGLNFSDNQNKKLDELEMRLKLAGIDLPRGRSEAAELAINTLLFILTQSPSDSDRWIK
FT                   RLLENLVGEEEKQHETSQAN"
FT                   /protein_id="YP_002360303.1"
FT   gene            complement(8519..11176)
FT                   /db_xref="GeneID:7090233"
FT                   /locus_tag="Sbal223_4488"
FT   CDS_pept        complement(8519..11176)
FT                   /locus_tag="Sbal223_4488"
FT                   /gene_family="HOG000272937" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ECH74115_B0001"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ecf:ECH74115_B0001 hypothetical protein"
FT                   /db_xref="GI:217975705"
FT                   /db_xref="GeneID:7090233"
FT                   /translation="MKRNYISCLIAASIAATALSVSAKQISPLIFNSSAPQNDLVGSLS
FT                   ARVQFAQSQIIPASPKEGERQPTLTSLRKSLLLVQPLQADGVTPMVVEARDASGKLLGT
FT                   LTLSPPSALPETVYHLAGVPEGGVSFVPESGPTAVISSSADLAKLSDKSGAFLKDRLTG
FT                   RALVEIQTADGRWVRDIYLPVSPELEGKMVRLRSSAGYNSTIFYGERQVTVARGQTLQF
FT                   KFAKGQWFREGELENNRITYAPDTWSGELPAGWIQPGLNLSVRQGNFSGELRDIKVGAP
FT                   GELLLHTIDIGMLITPRDRFAFANDKEAHREYFQTIPASRMIVNQYAALYLPEVMLPNG
FT                   TLLTDFDPSEGGWHSGTMRQRIGKELISHGIDNANYGINSSAGEGEGSHPFVVAQLAAH
FT                   NSRGKYANGVQVHGGSGGGGIVTLDASLGNEFSHEVGHNYGLGHYVDGFSGSVHRSAEQ
FT                   LNSSWGWDSDKRRFIPNFSPTRTNEDACLDGQCQPPFDGRKFGFDAMAGGSPLSGANRF
FT                   TLYTPNSAAIIQRFFESKAVFDANSATGFSKWSSATARMEPYQHTIEGIEKIDAPMDAL
FT                   SEAGLSALLADYGLVRVAMWDGRWTRDIRVPVASADNRGRSLTIDHGAGYNSRLFINGK
FT                   EIVVNRGFKKSFTSDGQSWVEVSPIDTKVARKPEQFGVPVTTLVGYYDPQGSLPSYIYP
FT                   ALHGAYGFTYPDDSNTLSGNDCQLQVETRDGLQRFTLANHRAASTVMNKFHINIPTDLK
FT                   PSQAAVVCNNRTIAEKTLSSAPTDISFSVYGKALPAKANEGCIVSNTTGAQYCLPVGSR
FT                   SGYSLPNWIIGQEVHVDAGLNAKVLLSDWDNLSYNRIGEFVGSVGTNEMKKVKAWNGQY
FT                   LDFSRPRSMRVVSN"
FT                   /protein_id="YP_002360304.1"
FT   sig_peptide     complement(11105..11176)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 24"
FT                   /locus_tag="Sbal223_4488"
FT   misc_feature    complement(9566..10471)
FT                   /note="Peptidase M66; Region: Peptidase_M66; pfam10462"
FT                   /db_xref="CDD:151034"
FT                   /locus_tag="Sbal223_4488"
FT   gene            11458..12018
FT                   /db_xref="GeneID:7090234"
FT                   /locus_tag="Sbal223_4489"
FT   CDS_pept        11458..12018
FT                   /locus_tag="Sbal223_4489"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: rme:Rmet_4599 resolvase-like protein"
FT                   /db_xref="GI:217975706"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:7090234"
FT                   /translation="MQGQRIGYIRVSSFDQNPERQLEHIQVDKVFTDKASGKDTQRPQL
FT                   EALLSFVREGDTVVVHSMDRLARNLDDLRRLVQGLTQRSVCIEFVKEHLTFTGEDSPMA
FT                   NLMLSVMGAFAEFERALIRERQREGIALAKQRGAYRGRKKSLSDPEIAEVRRRVVAGEK
FT                   KATLAREFGISRETLYQYLRVPE"
FT                   /protein_id="YP_002360305.1"
FT   misc_feature    11470..11844
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    11473..12006
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:184041"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11485..11487,11491..11493,11647..11652,11659..11661)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    11491..11493
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11644..11646,11785..11790,11794..11799,11809..11811)
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11662..11664,11677..11682,11773..11775,11782..11787,
FT                   11794..11799,11806..11808,11815..11817)
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11731..11739,11773..11778,11785..11790,11797..11799,
FT                   11809..11811,11818..11820,11830..11832)
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11731..11733,11788..11790,11797..11799,11809..11811,
FT                   11818..11820,11830..11832)
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11812..11814,11830..11835)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    11878..12003
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Sbal223_4489"
FT   misc_feature    order(11881..11889,11983..11988,11992..12000)
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Sbal223_4489"
FT   gene            12022..15054
FT                   /db_xref="GeneID:7090235"
FT                   /locus_tag="Sbal223_4490"
FT   CDS_pept        12022..15054
FT                   /locus_tag="Sbal223_4490"
FT                   /gene_family="HOG000156427" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   rpi:Rpic_1851 transposase Tn3 family protein"
FT                   /db_xref="GI:217975707"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:7090235"
FT                   /translation="MAIARSERLTVLSDAEQEALYGLPDFDDAQRLEYLALTENELALA
FT                   SSRPSIHAQLYCILQIGYFKAKNDFFRFHWRDVEDDCAFVLSRYFQGEAFEAKQISKHE
FT                   HYSQRGKIAALFGYQPWASSYLPSLEQQASLIVRRDVTPSFVAAELIVWLNEHKIIRPG
FT                   YTTLQALVSEVLSVERRRLGALLAQVLDEPAKTALSQLLVRDDTLSQLAALKQDAKDFG
FT                   WRQMAREREKRALLAPLHEIAKGLLPKLGISQQNLLYYASLANFYTVHDLRNLKAEQTQ
FT                   LYLLCYAWVRYRQLSDNLVDAMAFHMDQLDHENRAGARDTFAEEQVKRHQETPQVGRLL
FT                   SLYVDDSVADPTPFGEVRQRAYKIMAKDVLQNTAQRMSVKPLNKLTLHWQAVDGQAKRI
FT                   RRHLRPLFVALQFAATDPDSQWLAALTWAKSVFAKQQRLSQRPLAECPVATLPKRLRPY
FT                   LLTFDADGEPTGLHADRYEFWLYHQVKKRFQSGELYLDDSLQHRHFSDELVSMEEHAQE
FT                   LAQMDIPFLRQPIETQLDVLATELHRQWQAFNRELKQGKLTHLEYDKDAQKLTWRKPKR
FT                   ENQKAREHTFYEQLPYCDVADVFRFVNNQCQFLSALTPLQPRYAKKVADTDSLIAVIIA
FT                   QAMNHGNLVMARTSDIPYHILESAYQQYLRQASLHEANDFISNAIAALPIFPYYSFDLD
FT                   VLYGAVDGQKFSVERPTVKARYSRKYFGRGKGVVAYTLLCNHIPLNGYLIGAHDYEAHH
FT                   VFDIWYRNTSDIVPEVITGDMHSINKANFAILHWFGRRFEPRYTDLNHQLQALYCVGDP
FT                   ARYEKCLIQPVGQIDRQLIVSEKANIDRIIATLGLKEMTQGTLIRKLCTYTAPNPTRRA
FT                   IFEFDKLVRSIYTLRYLRDPQLERNVHRSQNRIESYHQLRSSIAQVGGKKELTGRTDIE
FT                   IEISNQCARLIANAVIYYNSAILSRLLTKCEAAGNAKAISALTQISPAAWRHILLNGHY
FT                   TFQSDGKVIDLDTLVAGVELV"
FT                   /protein_id="YP_002360306.1"
FT   misc_feature    12055..14988
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Sbal223_4490"
FT   misc_feature    13951..14898
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Sbal223_4490"
FT   gene            complement(14890..15264)
FT                   /db_xref="GeneID:7090236"
FT                   /locus_tag="Sbal223_4491"
FT   CDS_pept        complement(14890..15264)
FT                   /locus_tag="Sbal223_4491"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pol:Bpro_5523 hypothetical protein"
FT                   /db_xref="GI:217975708"
FT                   /db_xref="GeneID:7090236"
FT                   /translation="MSSIEIDDIKIKYSPLNKELVVDGELLSIFIYEGDSSGRWVLEVV
FT                   DECGTSTVWDYQFERGCKPEPPKFPSYQFNPSHKRVQVNHLTVTLKGIMPVQQNVPPGC
FT                   RRYLGERRDGLGVTCRFALR"
FT                   /protein_id="YP_002360307.1"
FT   gene            complement(15599..15805)
FT                   /db_xref="GeneID:7090237"
FT                   /locus_tag="Sbal223_4492"
FT   CDS_pept        complement(15599..15805)
FT                   /locus_tag="Sbal223_4492"
FT                   /gene_family="HOG000086256" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01848"
FT                   /codon_start="1"
FT                   /product="Hok/gef cell toxic protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hok/gef cell toxic protein; KEGG: vvu:VV2_0662
FT                   hypothetical protein"
FT                   /db_xref="GI:217975709"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="GeneID:7090237"
FT                   /translation="MYPDNTNSSLFTFRRQDMPKRKTTTLSLAIVCFTLLAALALIRDD
FT                   LCKVEYRNGAMLLNVVLAYEVRG"
FT                   /protein_id="YP_002360308.1"
FT   sig_peptide     complement(15692..15805)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.555 at
FT                   residue 38"
FT                   /locus_tag="Sbal223_4492"
FT   misc_feature    complement(15605..15748)
FT                   /note="Hok/gef family; Region: HOK_GEF; cl11494"
FT                   /db_xref="CDD:187074"
FT                   /locus_tag="Sbal223_4492"
FT   gene            complement(16500..17234)
FT                   /db_xref="GeneID:7090238"
FT                   /locus_tag="Sbal223_4493"
FT   CDS_pept        complement(16500..17234)
FT                   /locus_tag="Sbal223_4493"
FT                   /gene_family="HOG000245283" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0058"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0058 hypothetical protein"
FT                   /db_xref="GI:217975710"
FT                   /db_xref="GeneID:7090238"
FT                   /translation="MQKSKADKARIKRQKLRSAKREAALHVKTHKTAVGANAYKASLEG
FT                   FKALKSRLPRYFSEVINNARKLIYSRKFEIDEGGISRQMSELTKRKLFEIIVTLITSCD
FT                   FMSGQIGKAKNIGMDTTSHDALMLAHAKRWGYAMPSSTWYRYIGMLKQAGVFVVEEVKI
FT                   AGETEKTIRSVAAYKWLSTHFLQAIGAYTDTIRAQIKQAYQKAVNNGLSFTWRVFKRQL
FT                   PVKQRFTADMFFSQSTNPPQTH"
FT                   /protein_id="YP_002360309.1"
FT   gene            complement(17658..18353)
FT                   /db_xref="GeneID:7090239"
FT                   /locus_tag="Sbal223_4494"
FT   CDS_pept        complement(17658..18353)
FT                   /locus_tag="Sbal223_4494"
FT                   /gene_family="HOG000127685" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="putative phage repressor"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase S24
FT                   and S26 domain protein; KEGG: vfi:VFB18 DNA-binding protein
FT                   RDGA"
FT                   /db_xref="GI:217975711"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="GeneID:7090239"
FT                   /translation="MNVISLIINTEINLWPFGMNCSFERNLKQLRIDLGFSQEEFGRRI
FT                   GVTKSTISQWEAGKSQARRKFIKKIIETFELEDNYFDIVDREEANVDSCKSNCESSFKR
FT                   IPFYSDVKVAAGSGYCNREEVYELILVKDLPALSNYKKLFCITVTGDSMEPALKDGSLI
FT                   VVDPTQTVVRDGKIYVFRQGDVLRVKAFSYEKQMVKAKSYNEFYKDELYRLDELELLGR
FT                   VVFSSTKMD"
FT                   /protein_id="YP_002360310.1"
FT   misc_feature    complement(18111..18281)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4494"
FT   misc_feature    complement(order(18183..18185,18258..18260,18270..18272))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4494"
FT   misc_feature    complement(17661..18269)
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2932"
FT                   /db_xref="CDD:32756"
FT                   /locus_tag="Sbal223_4494"
FT   misc_feature    complement(order(18186..18188,18261..18263))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4494"
FT   misc_feature    complement(order(18180..18185,18195..18197,18204..18206,
FT                   18237..18242))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4494"
FT   misc_feature    complement(17682..17924)
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Sbal223_4494"
FT   misc_feature    complement(order(17787..17789,17898..17900))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Sbal223_4494"
FT   gene            18469..18645
FT                   /db_xref="GeneID:7090240"
FT                   /locus_tag="Sbal223_4495"
FT   CDS_pept        18469..18645
FT                   /locus_tag="Sbal223_4495"
FT                   /gene_family="HOG000027778" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vha:VIBHAR_p08218 conjugative transfer protein
FT                   TraY"
FT                   /db_xref="GI:217975712"
FT                   /db_xref="GeneID:7090240"
FT                   /translation="MTKPTHVNVELDGKTNEMLEASAKRNNRSKRKEAQARLIDHLSRF
FT                   DEMGMGLKGKDKS"
FT                   /protein_id="YP_002360311.1"
FT   misc_feature    18487..>18603
FT                   /note="TraY family; Region: TraY; cl14193"
FT                   /db_xref="CDD:187259"
FT                   /locus_tag="Sbal223_4495"
FT   gene            18700..19086
FT                   /db_xref="GeneID:7090241"
FT                   /locus_tag="Sbal223_4496"
FT   CDS_pept        18700..19086
FT                   /locus_tag="Sbal223_4496"
FT                   /gene_family="HOG000000487" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRC0003 hypothetical protein"
FT                   /db_xref="GI:217975713"
FT                   /db_xref="GeneID:7090241"
FT                   /translation="MTTKTQQPNAQQPNAQQNEVNEEILRLAKHIPSDSTIFIMRWTFL
FT                   FIICVVATLLLSWDVHAADPFVKAKSEIVDTVGTGSTAQFAILVVGLCAAALTGFLTKN
FT                   WGAAIGAFVVGMIFVNVALKVVGL"
FT                   /protein_id="YP_002360312.1"
FT   misc_feature    18817..19083
FT                   /note="TraA; Region: TraA; cl11503"
FT                   /db_xref="CDD:187079"
FT                   /locus_tag="Sbal223_4496"
FT   gene            19090..19392
FT                   /db_xref="GeneID:7090242"
FT                   /locus_tag="Sbal223_4497"
FT   CDS_pept        19090..19392
FT                   /locus_tag="Sbal223_4497"
FT                   /gene_family="HOG000000486" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02762"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraL"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraL; PFAM: TraL family protein; KEGG: vvy:VVP05 putative
FT                   conjugative transfer protein TraL"
FT                   /db_xref="GI:217975714"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR014130"
FT                   /db_xref="GeneID:7090242"
FT                   /translation="MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMDHAL
FT                   IGMALASSWFLGMRRMKSQYGMSVLRLTAYWYAPAEFSASFLKRTPAACRRYWLR"
FT                   /protein_id="YP_002360313.1"
FT   misc_feature    19105..19389
FT                   /note="TraL protein; Region: TraL; cl06278"
FT                   /db_xref="CDD:186680"
FT                   /locus_tag="Sbal223_4497"
FT   gene            19433..19999
FT                   /db_xref="GeneID:7090243"
FT                   /locus_tag="Sbal223_4498"
FT   CDS_pept        19433..19999
FT                   /locus_tag="Sbal223_4498"
FT                   /gene_family="HOG000000485" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02761"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraE"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraE; PFAM: TraE family protein; KEGG: vvy:VVP06 putative
FT                   conjugative transfer protein TraE"
FT                   /db_xref="GI:217975715"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="GeneID:7090243"
FT                   /translation="MLQKNKIDFIRIAKSLNTLLLIGFTVAMISNTVLASIVWKAYFNK
FT                   SRTVVPPTISAAFTVSDTSIDEPYLQQMAEYFAFLKLNVTPTSVDHQYKQLASYIDEAD
FT                   WHQMQPLLVEDAAMIKKQNISSHFTINETQIALDDRLVKITGTLNKYVGKRALEPETIS
FT                   YIIAMNYDHGQLSLKAIKKVQKDVK"
FT                   /protein_id="YP_002360314.1"
FT   misc_feature    19433..19990
FT                   /note="TraE protein; Region: TraE; cl05060"
FT                   /db_xref="CDD:186644"
FT                   /locus_tag="Sbal223_4498"
FT   sig_peptide     19433..19540
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 36"
FT                   /locus_tag="Sbal223_4498"
FT   gene            19999..20814
FT                   /db_xref="GeneID:7090244"
FT                   /locus_tag="Sbal223_4499"
FT   CDS_pept        19999..20814
FT                   /locus_tag="Sbal223_4499"
FT                   /gene_family="HOG000000484" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02756"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system secretin TraK"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system secretin
FT                   TraK; KEGG: ppr:PBPRC0005 hypothetical protein"
FT                   /db_xref="GI:217975716"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="GeneID:7090244"
FT                   /translation="MKITNPLVFAACALFPMSVLAANTPPKHYGFNDSETVPIELSSVD
FT                   INRLVVEGDKITSIDCPEGFCVVTGTKSDKSGAARVNLNLAMPFTAYVSTEKGRHFGLF
FT                   ISPKAIPAVTSIFTAEHYREEQPSVFDKKTPYPTMMTEFTAQMIRYLATGKPIDGYRVH
FT                   VVNDDLERTTVDSEPRGTETSIDDAMFIRLNEQMPKPAGLTTEPAFVFTGKHFNGIIYR
FT                   VTNHAALPVTLTTAQFYSPTTRAAALSTYELAPQQTGHLFVVSGGESMQ"
FT                   /protein_id="YP_002360315.1"
FT   sig_peptide     19999..20064
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT                   /locus_tag="Sbal223_4499"
FT   misc_feature    20014..20787
FT                   /note="TraK protein; Region: TraK; pfam06586"
FT                   /db_xref="CDD:148287"
FT                   /locus_tag="Sbal223_4499"
FT   misc_feature    20047..20793
FT                   /note="conjugal transfer protein TraK; Provisional; Region:
FT                   PRK13736; cl05878"
FT                   /db_xref="CDD:186671"
FT                   /locus_tag="Sbal223_4499"
FT   gene            20811..22340
FT                   /db_xref="GeneID:7090245"
FT                   /locus_tag="Sbal223_4500"
FT   CDS_pept        20811..22340
FT                   /locus_tag="Sbal223_4500"
FT                   /gene_family="HOG000000483" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06447"
FT                   /codon_start="1"
FT                   /product="TraB pilus assembly family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraB pilus assembly family protein; KEGG:
FT                   ppr:PBPRC0006 putative sex pilus assembly and synthesis
FT                   protein TraB"
FT                   /db_xref="GI:217975717"
FT                   /db_xref="InterPro:IPR010501"
FT                   /db_xref="GeneID:7090245"
FT                   /translation="MKQLLDYFKKDPEADFEQGSALNEANKKRNWVIAGVGATVLGALY
FT                   LAGDAYMSAPKRAPETAAGNPIDFGAVIDKDFTEKDNQSALTAQQIALDKQQKAIDKML
FT                   KSMEAIERSNEANRLDLKRNLETFQLTVSEKIDDKINAATANAMQHSNNNVTDEFSTQG
FT                   IDASAYPVRQSTRYLGEQTLPPRPSVGDGQSYSAPYQGGAIPPPATQNGIDSFALNWET
FT                   PDQNLPKKRTPENYVPAGTFVTAVVTGGADANAGVNGQGDTVPMVFQTTNQGVLPNGKP
FT                   SKLNNCTVLGAAYGEISSSRGIVRTTRLSCIFEDEIIDIPVEATVFNYGRNGIRGTAIM
FT                   KNGKIVQMAGISGILTGIGETGKALSQTTSNSALGSTSSVNGADALLNLAGSASSSVGS
FT                   KLADYYIKLAEQYHPIIELNPGNTVNIVFLKGFPLDPVGIQEYEEALAQQAQNPVSATA
FT                   QILNTISNPLLEQMPGNIKPQAQGANTPTPQQQYNQQGQRPPVNSAFGRAN"
FT                   /protein_id="YP_002360316.1"
FT   misc_feature    20874..22112
FT                   /note="conjugal transfer pilus assembly protein TraB;
FT                   Provisional; Region: PRK13729"
FT                   /db_xref="CDD:184281"
FT                   /locus_tag="Sbal223_4500"
FT   misc_feature    21513..22112
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="Sbal223_4500"
FT   gene            22361..22816
FT                   /db_xref="GeneID:7090246"
FT                   /locus_tag="Sbal223_4501"
FT   CDS_pept        22361..22816
FT                   /locus_tag="Sbal223_4501"
FT                   /gene_family="HOG000000482" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02747"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraV"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraV; PFAM: Type IV conjugative transfer system protein
FT                   TraV; KEGG: ppr:PBPRC0007 hypothetical protein"
FT                   /db_xref="GI:217975718"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="GeneID:7090246"
FT                   /translation="MNPIMSKNALRNTGIIALASWLVSGCAAGLDGDYSCDKVGGINGC
FT                   TNMMEVRQLTDSGVFNQPQAQSPAVTALSGQSTTALPKLASQQQDFIPLPRRDRHGVPL
FT                   RTSESVQKVTIFPYLNEQGDYVDTSDVYIVVDKSRWTGRPAKYIKQD"
FT                   /protein_id="YP_002360317.1"
FT   sig_peptide     22361..22450
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.736 at
FT                   residue 30"
FT                   /locus_tag="Sbal223_4501"
FT   misc_feature    22409..22780
FT                   /note="Type IV conjugative transfer system lipoprotein
FT                   (TraV); Region: TraV; cl11514"
FT                   /db_xref="CDD:187086"
FT                   /locus_tag="Sbal223_4501"
FT   gene            22820..25408
FT                   /db_xref="GeneID:7090247"
FT                   /locus_tag="Sbal223_4502"
FT   CDS_pept        22820..25408
FT                   /locus_tag="Sbal223_4502"
FT                   /gene_family="HOG000000481" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02746"
FT                   /codon_start="1"
FT                   /product="type-IV secretion system protein TraC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-IV secretion system protein TraC;
FT                   KEGG: ppr:PBPRC0008 putative sex pilus assembly and
FT                   synthesis protein TraC"
FT                   /db_xref="GI:217975719"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="GeneID:7090247"
FT                   /translation="MKQRIKNDLGALYASSKQQHNHLHHELPYRIYDDAEQVFENANSL
FT                   GFGFAISLFGGANDDLIKTMNALVCTLPEGDKWHYQFVMVGNNQVGELIEQNQALLSGR
FT                   NAICDKFASNEAIYAKHSSIKGFGTKLSHAYHYDLKNTKGFFFVSTTEDMPALLDMRLG
FT                   IESELAQTGMHIRRLAADSLIEHCREHLNFSHQQDRVSPAKYNEYQPLNTQILSPDSEF
FT                   IINRDSVNIRHTPMQSDNSVDTTLINLGLKGLPNDFRLYAFPNCIASLSYTMNSVQCPY
FT                   RVSVSFYINKTGEQTTRNDSKIGSLTQTVGSPMRLLIPSAADELAERKEIQKGLGLHEF
FT                   KITTMTLNVTLYTTEAKQRHDTAKAIATFRTAGMDLIQNNKLQGMCTLSTLPFSMSEGF
FT                   MKDSQKAGLCFMMKTSNLVNFLPIVADYKRLSAGLLLPTMRHQISYFDPFNCGSDNYNM
FT                   AITGGSGAGKSFFMQALVKSIFAKGGKAWILDKGQSYKKLTQTLGGVYLDSSQIFLNPF
FT                   THLGKVQSVRDAGTFGIILDDEGQVVDPIAAVLGNITELIATMASPDEKISGFQKAILG
FT                   DAILLAWKKAGNDTLIDDVQTALYDIAAQKNDDTRISDIAAQLNKFCSQGIHGAIFNKP
FT                   SMLNPNIDITTLELDGFKGELQRPVIFALMVAISQQMYLSGQRSTPKICVIEEAWSLMS
FT                   GANAQSKDFIEEGYRTVRKFGGSFATVTQGMKDFFANAEAEAAYNSSDIHITLRQGEGF
FT                   GDFLNKHPDHFSPFEQSMIKSFPRADAAGHSCIMLKAGGLVSFHRIFADPWSRAMLSTE
FT                   PKEFEYCENLIKGGMPLLDAIELTAQHFYPDDMARFDAILSAAATHKEAE"
FT                   /protein_id="YP_002360318.1"
FT   misc_feature    22895..25339
FT                   /note="type-IV secretion system protein TraC; Region:
FT                   TraC-F-type; TIGR02746"
FT                   /db_xref="CDD:162997"
FT                   /locus_tag="Sbal223_4502"
FT   misc_feature    24161..>24370
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4502"
FT   misc_feature    order(24203..24208,24218..24226)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4502"
FT   misc_feature    order(24206..24208,24218..24226,24281..24283,24287..24292)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4502"
FT   gene            25410..25781
FT                   /db_xref="GeneID:7090248"
FT                   /locus_tag="Sbal223_4503"
FT   CDS_pept        25410..25781
FT                   /locus_tag="Sbal223_4503"
FT                   /gene_family="HOG000000480" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PSLT089"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbI"
FT                   /transl_table="11"
FT                   /note="KEGG: stm:PSLT089 conjugal transfer protein TrbI"
FT                   /db_xref="GI:217975720"
FT                   /db_xref="GeneID:7090248"
FT                   /translation="MEKTIIQSILWLVTLGVMITLWVTREPRVVEYDINETVASFHQSI
FT                   GQSELSDEQREKEITRFTQTLDDVVQQYALDNHVVVLVSPAVVSGAVNVTQEIQQSLLQ
FT                   TLQAQNKANRAQASEVTAK"
FT                   /protein_id="YP_002360319.1"
FT   misc_feature    25422..25730
FT                   /note="Type-F conjugative transfer system protein
FT                   (TrbI_Ftype); Region: TrbI_Ftype; cl11515"
FT                   /db_xref="CDD:187087"
FT                   /locus_tag="Sbal223_4503"
FT   gene            25778..26479
FT                   /db_xref="GeneID:7090249"
FT                   /locus_tag="Sbal223_4504"
FT   CDS_pept        25778..26479
FT                   /locus_tag="Sbal223_4504"
FT                   /gene_family="HOG000222133" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02743"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system protein TraW"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system protein
FT                   TraW; KEGG: ppr:PBPRC0010 sex pilus assembly and synthesis
FT                   protein TraW"
FT                   /db_xref="GI:217975721"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="GeneID:7090249"
FT                   /translation="MNKFALLMLALCPLLPLKAASIGTVGQVFPIAEIDMLQWIENRLQ
FT                   TLEKTGELDSMREQFQENVKAGVKRPRPVGLITTKTPEVFLVDPTLTLAKDINDANGNL
FT                   IYPKGTRVNPFDTKTWPALQKANVGKFEFSKTLVFFDGDDVQQVLWAKEFATTHEKQHI
FT                   KWILTGGEPETLHGQLDARVYFDQQGNLSRALTLKRVPSVVKQAGVMWQVREIDVSNFP
FT                   VFMEETNHATH"
FT                   /protein_id="YP_002360320.1"
FT   sig_peptide     25778..25837
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.830 at
FT                   residue 20"
FT                   /locus_tag="Sbal223_4504"
FT   misc_feature    25838..26425
FT                   /note="Sex factor F TraW protein N terminal; Region:
FT                   TraW_N; cl10149"
FT                   /db_xref="CDD:186917"
FT                   /locus_tag="Sbal223_4504"
FT   gene            26466..27473
FT                   /db_xref="GeneID:7090250"
FT                   /locus_tag="Sbal223_4505"
FT   CDS_pept        26466..27473
FT                   /locus_tag="Sbal223_4505"
FT                   /gene_family="HOG000222151" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06834"
FT                   /codon_start="1"
FT                   /product="TraU family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraU family protein; KEGG: ppr:PBPRC0011
FT                   putative sex pilus assembly and synthesis protein TraU"
FT                   /db_xref="GI:217975722"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="GeneID:7090250"
FT                   /translation="MRHIKPAWLVALLMGVIPAQVNAQAACTGTFVNPMTDICWSCIFP
FT                   MTIGSVPIIPGSLPDTRNPVSPISFCPKPPPIFMQIGLNIGYWEPDTLVDVTRVPYCMV
FT                   NMGMKLDMSNSPQIGGRVTSRDNDASDGAFYHGHWYKYPVVYWLQIMQSAACMATDNFD
FT                   IAYLTEIDPLWDDDELSFILNPEAILFGNIVSQLACATEAVATSTNSILPFDFLFWCMG
FT                   SQGSAYPLTGTTNYRDTPIQAGTLILERLNYKLHRQGIVWESHGEDGAICYQTPMPLIP
FT                   KSRYRYQMTNTIPDALWGHPYTTTTVIWESGHDNPVSGDNFGFINFKKRNCVFL"
FT                   /protein_id="YP_002360321.1"
FT   sig_peptide     26466..26537
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.918 at
FT                   residue 24"
FT                   /locus_tag="Sbal223_4505"
FT   misc_feature    26544..27470
FT                   /note="TraU protein; Region: TraU; cl06067"
FT                   /db_xref="CDD:186673"
FT                   /locus_tag="Sbal223_4505"
FT   gene            27496..28233
FT                   /db_xref="GeneID:7090251"
FT                   /locus_tag="Sbal223_4506"
FT   CDS_pept        27496..28233
FT                   /locus_tag="Sbal223_4506"
FT                   /gene_family="HOG000000478" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02742"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TrbC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TrbC; PFAM: Type-F conjugative transfer
FT                   system pilin assembly protein TrbC; KEGG: ppr:PBPRC0012
FT                   conjugative transfer protein TrbC"
FT                   /db_xref="GI:217975723"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="GeneID:7090251"
FT                   /translation="MKKFETKLPTIYTELCTKIVHNSLFPQSFKGLALLLSLYLGSISP
FT                   VFAQTDYSIDELTALSMRERHTLPPLNLDQTALFDKARQFEAQSKGQLDNALSPLLDAK
FT                   PNPSADANGVMVFVSLGMPATSLQQLLMQSADLQVPLIVRGVLPQGFTATVKQMNHLID
FT                   NKGKTIQSGFAINPQWFTQFGITQVPAFVAVRPNKCQAKQPCSSDDFDVIYGNVSLYDA
FT                   LNLLAQHGSIPDVAAKTLAKGAK"
FT                   /protein_id="YP_002360322.1"
FT   sig_peptide     27496..27642
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 49"
FT                   /locus_tag="Sbal223_4506"
FT   misc_feature    27835..28230
FT                   /note="Type-F conjugative transfer system pilin assembly
FT                   protein; Region: TrbC_Ftype; cl09883"
FT                   /db_xref="CDD:186869"
FT                   /locus_tag="Sbal223_4506"
FT   gene            28230..30044
FT                   /db_xref="GeneID:7090252"
FT                   /locus_tag="Sbal223_4507"
FT   CDS_pept        28230..30044
FT                   /locus_tag="Sbal223_4507"
FT                   /gene_family="HOG000000477" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02750"
FT                   /codon_start="1"
FT                   /product="conjugal transfer mating pair stabilization
FT                   protein TraN"
FT                   /transl_table="11"
FT                   /note="TraN; TrhN; involved in stabilizing mating pairs
FT                   during plasmid conjugation; F plasmid TraN appears to
FT                   recognize OmpA in the recipient cell"
FT                   /db_xref="GI:217975724"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="GeneID:7090252"
FT                   /translation="MTQLNNALILSAILTLSAALPVVAANSEKDYRDNVQWAKDSIKQN
FT                   QNKAGYTGFDVNSLCKDATCQQEVANPSESRYYNNPSAMDSAKMQGMSTDGQAQAVTSG
FT                   FNNGRPTIDENDPAYHTAVGYQNDAYNISHGISSKYHDCEKGLVCEVDSQPRSCTLPTN
FT                   NPVQCYLTPFVKSTSTQHKEHTFRLSGLPPFSVELPNPDAIITGLRFNGGFLSWGNPIS
FT                   VEISLNKVVIGTVPVKKEAGSCDQNGACPSSVNTSLNASHYQGGAAPMSVNVGTIFGSW
FT                   GWPFYLSVTNFPITFITTENNVEIGYNNSCGAVLPECQQVQSQCVEGKETRMINGIAVT
FT                   LDCWKEQTTYQCAFPNTCTTLADCSIQSTSCDTQLGGVCIKDKQQRLCDKQQCRDTGLI
FT                   CGADSFALSGDYYDPAATRSTDFNHAAAGLAAVSDAAGDVKDKANINENSAIIFKGNIM
FT                   ECSDKALGISNCCQDSGWGNGIGLTSCSEEEKALGTAKEDKLTVSLGQYCAEKVLGVCI
FT                   RKKKAYCAFDSKLARIVQVEGRAQLGKNFGSAKHPDCSAFSPNELQRIDMSSMDFSDFY
FT                   EDMYDAIELPSTDEIQKRLQQSVGGTKP"
FT                   /protein_id="YP_002360323.1"
FT   sig_peptide     28230..28304
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 25"
FT                   /locus_tag="Sbal223_4507"
FT   misc_feature    28293..30026
FT                   /note="conjugal transfer mating pair stabilization protein
FT                   TraN; Reviewed; Region: PRK12355"
FT                   /db_xref="CDD:183467"
FT                   /locus_tag="Sbal223_4507"
FT   misc_feature    <29682..30002
FT                   /note="Mating pair stabilisation protein TraN; Region:
FT                   TraN; cl06164"
FT                   /db_xref="CDD:186676"
FT                   /locus_tag="Sbal223_4507"
FT   gene            30041..30916
FT                   /db_xref="GeneID:7090253"
FT                   /locus_tag="Sbal223_4508"
FT   CDS_pept        30041..30916
FT                   /locus_tag="Sbal223_4508"
FT                   /gene_family="HOG000000476" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02739"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TraF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TraF; KEGG: ppr:PBPRC0014 sex pilus
FT                   assembly and synthesis protein TraF"
FT                   /db_xref="GI:217975725"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="GeneID:7090253"
FT                   /translation="MMTWLNDRLQHAAVSPFFRWSSRAPLAWLSTKKGDAVVNKRSALV
FT                   LLMLTTFCLGANATDAQGWRWYNEPTAPKKQAPKKAETPSVTLTRTQTLTPTEQMDWFH
FT                   SYYQDTLNDAAINSQDSKKVERAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPT
FT                   EQAARSTYLSLERNKKMRAVRSLADAGWGLFFVYKGQEEMDIALAPSVQQFATEHGIEL
FT                   LGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFL
FT                   NVATDFAPDF"
FT                   /protein_id="YP_002360324.1"
FT   sig_peptide     30041..30217
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.877 at
FT                   residue 59"
FT                   /locus_tag="Sbal223_4508"
FT   misc_feature    30170..30913
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Sbal223_4508"
FT   gene            30952..31689
FT                   /db_xref="GeneID:7090254"
FT                   /locus_tag="Sbal223_4509"
FT   CDS_pept        30952..31689
FT                   /locus_tag="Sbal223_4509"
FT                   /gene_family="HOG000000475" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975726"
FT                   /db_xref="GeneID:7090254"
FT                   /translation="MSLKNITDMMLKAIKRQKLPCLTLFTFTYCFVLSAVYDINGAPFL
FT                   TLCTVVFGALFILYPMILSPKNATILMPRHLFNQGSQTRPLGIMPLAFMSLLNTFPSLT
FT                   ATPAIVLMSIFSLIYCIASLFFATLTLEEQFSADHANKTSTRLAIEMLGFEFAPEAMQP
FT                   PSSPLQYYRALSTHHLIAYHALTSLITLIALLIFIGTFNTPWVGALLALAVIKASLELL
FT                   FLSLGQPPTAPISTANITTEVTQ"
FT                   /protein_id="YP_002360325.1"
FT   sig_peptide     30952..31056
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.861) with cleavage site probability 0.472 at
FT                   residue 35"
FT                   /locus_tag="Sbal223_4509"
FT   gene            31686..32129
FT                   /db_xref="GeneID:7090255"
FT                   /locus_tag="Sbal223_4510"
FT   CDS_pept        31686..32129
FT                   /locus_tag="Sbal223_4510"
FT                   /gene_family="HOG000000474" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02738"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   thiol-disulfide isomerase TrbB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly thiol-disulfide isomerase TrbB; KEGG:
FT                   ppr:PBPRC0015 putative thiol-disulfide isomerase"
FT                   /db_xref="GI:217975727"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="GeneID:7090255"
FT                   /translation="MKQLTTLIIGIFTLLLSSLGHTATMDTPVAANPNDYALVFFFRSD
FT                   CPFCHKFAPKLKQLAAQTGTYTYAFSLDNQGIAGFEVPIPSTPDIAATFFENPRSVTVP
FT                   ATFLINVNTRKFVRLTVGDVTSSQLQQSYLQSLNDPQVIASMR"
FT                   /protein_id="YP_002360326.1"
FT   sig_peptide     31686..31754
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.825 at
FT                   residue 23"
FT                   /locus_tag="Sbal223_4510"
FT   misc_feature    <31746..32060
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Sbal223_4510"
FT   gene            32141..32305
FT                   /db_xref="GeneID:7090256"
FT                   /locus_tag="Sbal223_4511"
FT   CDS_pept        32141..32305
FT                   /locus_tag="Sbal223_4511"
FT                   /gene_family="HOG000086253" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975728"
FT                   /db_xref="GeneID:7090256"
FT                   /translation="MDTMLIINILLALAIYKFVLVPVHALLSAVCLRALRALHPRHNGN
FT                   ISGNTGGKS"
FT                   /protein_id="YP_002360327.1"
FT   gene            32302..33690
FT                   /db_xref="GeneID:7090257"
FT                   /locus_tag="Sbal223_4512"
FT   CDS_pept        32302..33690
FT                   /locus_tag="Sbal223_4512"
FT                   /gene_family="HOG000000473" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06122"
FT                   /codon_start="1"
FT                   /product="TraH family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraH family protein; KEGG: vvu:VV2_0648
FT                   hypothetical protein"
FT                   /db_xref="GI:217975729"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="GeneID:7090257"
FT                   /translation="MKRLALTRTLLGVTISCLLTTHAYSAGVSGSLNDFFNGLGYGTNV
FT                   TNPGSFKGQSANYYSGGNLFVRSPIRDAQLVSVQMPSIAAGCGGIDMFMGGFSHINSDA
FT                   LVQQGKAIIANAAPFAVDLALQTWAPQIKQIKDTLTAIADKYLNQSINSCESAQAGVSA
FT                   LAGFAGVGSQKYICATMGTQNNAFADWVSGQQECGAGGQANNQLDNAKKDPALKDMVRK
FT                   NTNIVWAAILKNTFLASDPTLAEFLMSISGTYIYDATGNARGYGSLLTDNNNLINSLLE
FT                   GGKAETYQCTNQAIDQCLAPTQQTITIQSNHGLQYRVETLLRGIASKMQNDQPLTDNDK
FT                   SLLEYTTLPIMTFLRTELEAGLTPQTNTYAKIISVQFITLYLQNMLSIVKSSITATNND
FT                   PKDIDRIERDIINANRFLEGLTAKAQNEAVSQHQLIMQNQQIKQQITGAMSAKAKANLN
FT                   FGKR"
FT                   /protein_id="YP_002360328.1"
FT   sig_peptide     32302..32379
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.629 at
FT                   residue 26"
FT                   /locus_tag="Sbal223_4512"
FT   misc_feature    32395..33456
FT                   /note="Conjugative relaxosome accessory transposon protein;
FT                   Region: TraH; cl05580"
FT                   /db_xref="CDD:186660"
FT                   /locus_tag="Sbal223_4512"
FT   gene            33693..36521
FT                   /db_xref="GeneID:7090258"
FT                   /locus_tag="Sbal223_4513"
FT   CDS_pept        33693..36521
FT                   /locus_tag="Sbal223_4513"
FT                   /gene_family="HOG000000472" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07916"
FT                   /codon_start="1"
FT                   /product="TraG domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraG domain protein; KEGG: ppr:PBPRC0016
FT                   putative sex pilus assembly and mating pair TraG"
FT                   /db_xref="GI:217975730"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="GeneID:7090258"
FT                   /translation="MAVEIFTYSNGDVAKQVMNAIAVLFKSDSFASMISICALFAVVAT
FT                   ALHFFIKRDHNAIMKWCAVYFAVPLLAMNTTATVQITDLTNPTGNYRVDNVPAIVAYPA
FT                   SWASHYMYATTQTVEDIFHVPDDQQYSKTGMMFGSELYKLSRQSEIENTQLKGYWQHYI
FT                   SSCIRGDMLLNHKYTWRDLANAPDIWDFLATHNPSPLRAIQMGPNDYPTCKEALPRLKQ
FT                   LFQADSAKSIKLLGSWIYGEKAKSQQSFLNTSISSGYQKYANISQSASQITLQNMTINA
FT                   LRNGLADDAAVSNNTAAAFNYAYTQNKMQTTSMWAGMALQAREFLPMLQSILFLLFSCV
FT                   AFLVVAIAMIPSLTFQVLGNYFKGFIYLGTWPVMFALINFIMTTRLSLNATEITNIYGG
FT                   ITLSNVDPLQEMHSRYAAMTGFLMMSVPTLIVPLIMKGGASVMSSMSHQFAGMMSSVNA
FT                   RTSASAASGDINLGNAQVDNYSYNNTNGNKIDTTGVERIHGNTKQDATGYETTTFDDGR
FT                   QVISGQNALSRSLPVNISGSDMVTNSASQSASNAISASKIEGKQASESIATSTNTALSQ
FT                   MSGVNTSNSYGSNSATGDSGTHNKGFADMRSTVKSFAKDFNLTEDQATSTLLSMYVGAE
FT                   AGVKLGTPGSGFLGSSAHVSGSTGTKGSTDDVSTDRTSESERDSLQQSYLDQFSANVNT
FT                   VKSYNSGEQASTTNSKNEGETQTFLQGLNEAITHTKNAQSQLTEAQSYTDLANNVKSGS
FT                   ISIGRDFNQDFVEFVQNSRKNGDFMDVIKGQTPEMQQERNQLAAEFANTPKVKAMVEQY
FT                   KNHELPQNRDDIVQAQERYAADIDFNKQQSPQYAPAPLNDSLYQTGEFERIQGHAAQGN
FT                   AEIRQDVLHEEQTHNASSVPSIDIEQARADAKAAHALIPSDNLIPPDNRSDDEKMAETV
FT                   RQSSPFNTGPKM"
FT                   /protein_id="YP_002360329.1"
FT   misc_feature    33702..35069
FT                   /note="TraG-like protein, N-terminal region; Region:
FT                   TraG_N; pfam07916"
FT                   /db_xref="CDD:149152"
FT                   /locus_tag="Sbal223_4513"
FT   gene            36559..37092
FT                   /db_xref="GeneID:7090259"
FT                   /locus_tag="Sbal223_4514"
FT   CDS_pept        36559..37092
FT                   /locus_tag="Sbal223_4514"
FT                   /gene_family="HOG000000471" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975731"
FT                   /db_xref="GeneID:7090259"
FT                   /translation="MNIIKTFALLLCLLSPLAQAETTLFGLTLGKSTRQEAEQTYPPQY
FT                   KNTASGLPNSWNYYRVDGKQFNEPLLKYATLFFDDAQTLGSILFTFPISLEKYKALEEQ
FT                   LSRQYPRLNTAPFVSEPLRLDKAEFQNDTTYIRLDYSDYGTYLSFTDLKYRAAAQKRLA
FT                   EKKALEANKPKKEP"
FT                   /protein_id="YP_002360330.1"
FT   sig_peptide     36559..36621
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT                   /locus_tag="Sbal223_4514"
FT   gene            37095..39221
FT                   /db_xref="GeneID:7090260"
FT                   /locus_tag="Sbal223_4515"
FT   CDS_pept        37095..39221
FT                   /locus_tag="Sbal223_4515"
FT                   /gene_family="HOG000266197" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02759"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system coupling
FT                   protein TraD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system
FT                   coupling protein TraD; PFAM: Type IV conjugative transfer
FT                   system coupling protein TraD; KEGG: ppr:PBPRC0019
FT                   conjugative transfer protein TraD"
FT                   /db_xref="GI:217975732"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="GeneID:7090260"
FT                   /translation="MTLNPKRTKGSNYTRGGQILFHNLRMFLQINAVLIRWTCYGVLIL
FT                   TALLCYLFLDKDTLTGAYYYWINQTVSVFRPESHVMQTEWQGTVYTSTLGSQLENPILI
FT                   AANSRFWLWTQIYLLISCVIGIVFLSVAMWYFKKKGDEQTEEHFIRGMQKATPKELAKQ
FT                   LKKDRRQSDFKLDGIGIFKERFEVQHLLLDGTTGAGKSVALRKFLTWIRERGDKAIIYD
FT                   KGCTFVSKFYNPATDVLLNPFDERCAYWDVWCDAHEPSDFENMASALIPQHGEGDPFWV
FT                   QSARTIFSSTAFKMQDEPKKNQTTERLLELMLTSELESLSEYLKGTESASLVSDKIQKT
FT                   AISIKSVLAAYIKSLRFLAGLDEKDEQGKLLRRKFSIREWVKNDAENGFLFLSSNAQQH
FT                   ASLRPLISMWLSIASTAILEQDENPDRRIWVLMDEAPSLHKLPELAETIAEVRKFGGCY
FT                   VIGIQSFAQLKKVYGENAALEMFDLLNTRLFFRSPSNEMAKISSHDLGEQEVDVSKEQY
FT                   SYGANEIRDGVSLGHQTITRPVVTPSEIMQLEDLQFWLRTPGNYPVVRVDLVFNQMRSL
FT                   CAPFIKRNYTPSENIKQIEWSLNYHQFSAVQHVDKADKTKLQSIHDTMYEGDENNDERS
FT                   AEAQRMTKLAEKTDAVAQSLIDAKKAKPTELALKDAQKKKAAEKQKANDQHIEDAQRLE
FT                   EQQIASVHEEISLD"
FT                   /protein_id="YP_002360331.1"
FT   misc_feature    37131..38849
FT                   /note="type IV conjugative transfer system coupling protein
FT                   TraD; Region: TraD_Ftype; TIGR02759"
FT                   /db_xref="CDD:131806"
FT                   /locus_tag="Sbal223_4515"
FT   misc_feature    37200..37487
FT                   /note="F sex factor protein N terminal; Region: TraD_N;
FT                   pfam12615"
FT                   /db_xref="CDD:153049"
FT                   /locus_tag="Sbal223_4515"
FT   misc_feature    37533..38792
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4515"
FT   misc_feature    order(37674..37679,37689..37697)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4515"
FT   misc_feature    order(37677..37679,37689..37697,37752..37754,37758..37763,
FT                   38391..38396)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4515"
FT   misc_feature    38379..38393
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4515"
FT   gene            39235..39414
FT                   /db_xref="GeneID:7090261"
FT                   /locus_tag="Sbal223_4516"
FT   CDS_pept        39235..39414
FT                   /locus_tag="Sbal223_4516"
FT                   /gene_family="HOG000086255" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975733"
FT                   /db_xref="GeneID:7090261"
FT                   /translation="MTSFNATTRVPELSAKKPSRKASKNDHERMNVMRRIEAIAELKAL
FT                   GFTSDEIKAQLDSE"
FT                   /protein_id="YP_002360332.1"
FT   gene            39473..45433
FT                   /db_xref="GeneID:7090262"
FT                   /locus_tag="Sbal223_4517"
FT   CDS_pept        39473..45433
FT                   /locus_tag="Sbal223_4517"
FT                   /gene_family="HOG000000470" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02760"
FT                   /codon_start="1"
FT                   /product="conjugative transfer relaxase protein TraI"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: conjugative relaxase domain protein;
FT                   conjugative transfer relaxase protein TraI; PFAM: TrwC
FT                   relaxase; KEGG: ppr:PBPRC0022 DNA helicase TraI"
FT                   /db_xref="GI:217975734"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="GeneID:7090262"
FT                   /translation="MLSISPIASSAGGAASYYLSEEKNLNLPDVSLEKAADAKEGETNY
FT                   YLKEQSAEPNTQWYGKLAEQEGMLGKPVEEHQLKEVLAGSLNDQTLKTQNSNARNGFDF
FT                   TFSAPKSVSLLALVGGDKRLMTAHDDAVKFALSHIEKDAAQARQTNPDTKATSFENTGN
FT                   LLFAMVRHKTSREEDPQLHTHSLTANMTKDSEGTLRALASSFKQKGGIINGTGERVYNH
FT                   QKYYTSLYQSALARSVEQAGYQTRSLGNNLFEVEGVPQSLLDTFSTRSQQINEQTQSLG
FT                   LDSQAARDVAAKDTRKSKAYTSEATLFEQWKNKANNSGFNLTGFVTNSMSRETSLNALA
FT                   LKPAAIDAVSRAIEHASNTQNRFNYAKLVESATLEFTQGQKLDALDIKLALDKHIEDGA
FT                   LIPLDKESATFTSAAHLKAETNLLESIKPKTANMRQVVDTNTLQGKGLNADNQKKVSEL
FT                   FASTKQVNLVNVFGSSEQLATALLNVGEANGKRIHIITPDMKSKLHTSERVQRDSSTIG
FT                   KWIMNHFKPDHTHTLSSFTKTANNTNRDILVVENAHKLGLNDFNALLAQAKAGNSKVIL
FT                   LNHANAKQGMKAGNAIEVLKKGNVNESNWVATKQSNTAMRLHESKDSDRVNLIAKTYAQ
FT                   LPEKQHTQVITGTHKDVKQLNSAIRAELQNQGDVSRLGLNIPTLNPVFLSAQQREVVGQ
FT                   YTKGMVLTQWQKVGGRNQQQQLTVDSVNRDNNTLTLIDKNGKASEINPSSKAFKAAEYA
FT                   IAKPDYLHIANGDKLIMATNHQDSGLSKQIYTINALSKEWVTLKDESGKQHSVKASALH
FT                   HAPLNHGYATTPSNASPNASHHIVNIKAYSASKEWLHDTLTQGIKHIDIFTDKAQQFDD
FT                   RLEKSEVKPSSISRIMQAADMPEKFVNSQTTALLTQDVTAALNAIGAQHQDKGLIHNAV
FT                   DFAIQHISEKEAGYSQKELIVNAIKYAFEEKGTSITQHEIINTLQHMATNSTDKGAPSL
FT                   LSAEYHDGTRWTTQAAIDTEVRILDRLQAGKDQLAPLTSVEHAAQVLSQNQNLTDGQKD
FT                   ATLLITTTKDRFVGVQGLAGTGKSTMLETGIDLVKQSESILNTQPNKTPTQFIGLAPTH
FT                   AAVNELKDKNVESQTVQSLLSNFLSQDAKPDQYANTVFLLDESSMTSNAQMDKFTHLIE
FT                   TTGARAVFLGDTKQLTSQEAGKPFELALNKGAINSVTMKDIVRQQNSTLLSAVHNIVDR
FT                   QGESAIDKIQQQLPFDQYTAPTANDAVTPEKQATANINQSLNIISTLQLITDNPKKNQQ
FT                   LATEALPATVALEYLARTPKARENTLIIAYTNKERDDITHEIRQGLQQQKSLSNEQFTV
FT                   PRLRGVHASKAELATMLPYQQGLILTTSKDSYFEIMKVDKRNNMLTLADMKTGEEKHFF
FT                   PKNHGHKFTNLWAKSEQPLAEGDSIMLRKSDIDREMQGNKTYTVSSIDDKQMQLKSTDN
FT                   HTLTLSTKELKDAHWDYAYTRTADMAQGATYENVITAIKGQGALTNVRRAYIDITRASK
FT                   HVKIITDNPQKMMLSWVNNDPNKVSALETRDNYYPEHTPLFNDKPLPQENPKYLDVNGY
FT                   VDLKRMATELNAKLPAYSESLATQLLGEPNRDKSDKDNLTFGKEGSLTLTTTGQYRGYF
FT                   KDWKTGDKGTLINLIMVAEKCSYKDALYKADKMMNEPDKYNLVKNPQHDELTHAIPVKQ
FT                   SQLEARAKQYFNEAKPIENSLAQTYLAKQGIEVTKHENLRFHDAVYSSEKRGTFPALIA
FT                   NITNDKDETKAVEITYLDKSSGDIAALKINKRILGSKSGNSTTINKGNNSDYSIVAVGV
FT                   ENALKINADNKNGADVIALNNNNDTKTFNTNELRENVIVVLDTNNSQDTAKLASDLTDK
FT                   FSKENIHAVIIEPNLIPDGLNKVETTKQLVNEAVYSITTKDNTLSKAIQSLSNDIAGTK
FT                   NITMKDDSNNVATNKTKHDEHYQHLAMDSHRSPTKEHSPNIENPKLDIGEKTM"
FT                   /protein_id="YP_002360333.1"
FT   misc_feature    39575..40438
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="Sbal223_4517"
FT   misc_feature    39596..45427
FT                   /note="conjugative transfer relaxase protein TraI; Region:
FT                   TraI_TIGR; TIGR02760"
FT                   /db_xref="CDD:163003"
FT                   /locus_tag="Sbal223_4517"
FT   gene            complement(45496..45738)
FT                   /db_xref="GeneID:7090263"
FT                   /locus_tag="Sbal223_4518"
FT   CDS_pept        complement(45496..45738)
FT                   /locus_tag="Sbal223_4518"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0051 hypothetical protein"
FT                   /db_xref="GI:217975735"
FT                   /db_xref="GeneID:7090263"
FT                   /translation="MARNKTVQVACEPTLYEKIIAYRNMNKLSSDANAMRELALIGLRS
FT                   LDSEPVMGKPSDRELLESILFHVTKKDGDIVVSLD"
FT                   /protein_id="YP_002360334.1"
FT   gene            complement(45792..46145)
FT                   /db_xref="GeneID:7090264"
FT                   /locus_tag="Sbal223_4519"
FT   CDS_pept        complement(45792..46145)
FT                   /locus_tag="Sbal223_4519"
FT                   /gene_family="HOG000000469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0051 hypothetical protein"
FT                   /db_xref="GI:217975736"
FT                   /db_xref="GeneID:7090264"
FT                   /translation="MARNKAVQVACNPELYEKLTAYRNEKNLSSDADAMRELTLFALRI
FT                   LEHKDDAEGVSTRELLEVILTYTVKAQHTSSLVYYQTFNDSPVDMDSAKTKHKDTMRKA
FT                   EDKVEQLLAGDAK"
FT                   /protein_id="YP_002360335.1"
FT   gene            complement(46728..47003)
FT                   /db_xref="GeneID:7090265"
FT                   /locus_tag="Sbal223_4520"
FT   CDS_pept        complement(46728..47003)
FT                   /locus_tag="Sbal223_4520"
FT                   /gene_family="HOG000254286" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:VIBHAR_p08169"
FT                   /codon_start="1"
FT                   /product="type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: vha:VIBHAR_p08169 type I
FT                   restriction-modification system methyltransferase subunit"
FT                   /db_xref="GI:217975737"
FT                   /db_xref="GeneID:7090265"
FT                   /translation="MAHLFMLGKIALTQGVNKLVNGDHSLLHPFLMLHVKGQWGDLSED
FT                   DKQANDEALNQTGGRLLSAYNLPQGKIWIVTEADRSSSTVLLPSEY"
FT                   /protein_id="YP_002360336.1"
FT   gene            complement(47069..48049)
FT                   /db_xref="GeneID:7090266"
FT                   /locus_tag="Sbal223_4521"
FT   CDS_pept        complement(47069..48049)
FT                   /locus_tag="Sbal223_4521"
FT                   /gene_family="HOG000141063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /codon_start="1"
FT                   /product="domain of unknown function DUF1738"
FT                   /transl_table="11"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   sew:SeSA_B0128 antirestriction protein"
FT                   /db_xref="GI:217975738"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="GeneID:7090266"
FT                   /translation="MTHSITTPASHTKPFSEQASLQATSRLSKDDISKSKTKSKSAKAF
FT                   KKVDMYEAVTNKIIEALEKGVKPWVCPWVKSSRGNGLPINFDTKKSYSGINVCLLWFAA
FT                   FEAGFTSNQFLTYKQAQSLGAQVRKGEKGTNIIYYTNWEKENAEGEKENIPMIKSFTVF
FT                   NIEQIEGLNIPEVAAIEEGSIFESLDHVEIFLKNTGAKITEQGASAFYRPSTDSITMPS
FT                   RGRFSNHCDFYATALHELTHWTGAKHRLDRIKGSRFGSDDYAFEELIAEIGASFLMAEL
FT                   NVGGDVQHESYIASWLDRLKGDKRYVFKAASAASKAHQFLMGTQV"
FT                   /protein_id="YP_002360337.1"
FT   misc_feature    complement(47075..47908)
FT                   /note="Antirestriction protein [DNA replication,
FT                   recombination, and repair]; Region: COG4227"
FT                   /db_xref="CDD:33952"
FT                   /locus_tag="Sbal223_4521"
FT   misc_feature    complement(47561..47908)
FT                   /note="Domain of unknown function (DUF1738); Region:
FT                   DUF1738; pfam08401"
FT                   /db_xref="CDD:149455"
FT                   /locus_tag="Sbal223_4521"
FT   misc_feature    complement(<47300..47422)
FT                   /note="Protein of unknown function, DUF462; Region: DUF462;
FT                   cl01190"
FT                   /db_xref="CDD:154256"
FT                   /locus_tag="Sbal223_4521"
FT   gene            complement(48012..48356)
FT                   /db_xref="GeneID:7090267"
FT                   /locus_tag="Sbal223_4522"
FT   CDS_pept        complement(48012..48356)
FT                   /locus_tag="Sbal223_4522"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975739"
FT                   /db_xref="GeneID:7090267"
FT                   /translation="MASKLAVALRSCLPIPNATTKPPSTVLLTARQVWLSWSFHSASWP
FT                   LLVLSLSFTLPSYLSLTTTRLPRVRFAAARPCQSERWRASRTSGENEDDRPQTEQAAHD
FT                   TLNHYPSKPH"
FT                   /protein_id="YP_002360338.1"
FT   gene            complement(48431..48601)
FT                   /db_xref="GeneID:7090268"
FT                   /locus_tag="Sbal223_4523"
FT   CDS_pept        complement(48431..48601)
FT                   /locus_tag="Sbal223_4523"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975740"
FT                   /db_xref="GeneID:7090268"
FT                   /translation="MTANLVLNIPANGETSGGCAALFRLSDNTPWCALKRASAANLFTL
FT                   SVYWLLWRYVI"
FT                   /protein_id="YP_002360339.1"
FT   gene            complement(48613..48957)
FT                   /db_xref="GeneID:7090269"
FT                   /locus_tag="Sbal223_4524"
FT   CDS_pept        complement(48613..48957)
FT                   /locus_tag="Sbal223_4524"
FT                   /gene_family="HOG000000330" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0033"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0033 hypothetical protein"
FT                   /db_xref="GI:217975741"
FT                   /db_xref="GeneID:7090269"
FT                   /translation="MPINNIVSCTRELNRADFSFMNLFGGHHYPVTMSFLPSGAVTVVV
FT                   AGARYRCQANQVQRVLDESGLEFEGFACFKYLIEAGEINFHIPEDVHEQLKVHPEFKKY
FT                   SIIKSVDEDM"
FT                   /protein_id="YP_002360340.1"
FT   gene            complement(49085..50959)
FT                   /db_xref="GeneID:7090270"
FT                   /locus_tag="Sbal223_4525"
FT   CDS_pept        complement(49085..50959)
FT                   /locus_tag="Sbal223_4525"
FT                   /gene_family="HOG000000464" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="ParB domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   son:SO_A0031 ParB family partitioning protein"
FT                   /db_xref="GI:217975742"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:7090270"
FT                   /translation="MTNSIQAQATHTKATTLPASPKTQAGSHKPDIAQKSATAANAVVT
FT                   LAATTKPVLMQLPINQLVLSDLNVRKGDASKADDEQLYASILAHGILQNLLVEPKNAQG
FT                   LYPVLGGGRRLKQLIKAVKNNKLKPTSLVSVKLLTVDEVANFATELSLTENFMRANMHP
FT                   VDEFHAFAEMVNKGASIADVAARFGVKAKFVQQRMKLSMVAPVVLDAYKAGNVSLDIVM
FT                   VFTIASVEKQAEVWELAGDRRYNENQFRNMLKDAAVDAEHYLAQFVGQEEYEKAGGVVT
FT                   SDLFSDEVYLDDRALLETLATAKLEIEAAKLIARGWKWTQIKLVSEYDELAGFGRLTLK
FT                   EGEYEPAEMALAGCLLVLKSYGEPVSIYMGLVHKDDKKALAQLKASVQSGSLNDGDVKK
FT                   VEEKDVSGYSAALNEDLRAQRLIITKHALMSAPTVALDTLHFSVCVSAFTDSRYGSRPL
FT                   HISVNDTTCHPKTGALTDNKALQLIEEVKTSLNLTWVELPTVAERFNAFCALDVKEKEK
FT                   QVAYATASMLEASIDNSHAAAEVVISKLDVKWSNYWRPTTETFFKRVSLSCLIDMAQPV
FT                   MGEQWALQAAALKKKDLAMQVDSLVNGERKGLDDAQKSYFDALMPAGF"
FT                   /protein_id="YP_002360341.1"
FT   misc_feature    complement(50495..50797)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Sbal223_4525"
FT   misc_feature    complement(<50105..50758)
FT                   /note="plasmid partitioning protein; Provisional; Region:
FT                   PRK13832"
FT                   /db_xref="CDD:184353"
FT                   /locus_tag="Sbal223_4525"
FT   gene            complement(51620..52021)
FT                   /db_xref="GeneID:7090271"
FT                   /locus_tag="Sbal223_4526"
FT   CDS_pept        complement(51620..52021)
FT                   /locus_tag="Sbal223_4526"
FT                   /gene_family="HOG000237292" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975743"
FT                   /db_xref="GeneID:7090271"
FT                   /translation="MCKPSVTFEEMNTYLQGQYKHERLYGRTPATGWPADYATSVVSSH
FT                   MADLNANGIGYIGHHESATGQAIRYTVDEVKYSPRFFIVGYDSENDIVQKQCYFIDSAI
FT                   NIERARAKCLESANRYPIVRIKDLQGQFV"
FT                   /protein_id="YP_002360342.1"
FT   gene            complement(52023..52646)
FT                   /db_xref="GeneID:7090272"
FT                   /locus_tag="Sbal223_4527"
FT   CDS_pept        complement(52023..52646)
FT                   /locus_tag="Sbal223_4527"
FT                   /gene_family="HOG000000466" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: see:SNSL254_p_0132 hypothetical protein"
FT                   /db_xref="GI:217975744"
FT                   /db_xref="GeneID:7090272"
FT                   /translation="MTHSITTPASHTKPFSEQASLQATSRLSKDDIQQQKRGELTIIVL
FT                   TEMNFFHFCGLGLEGVANEAWYPYSQGLLFEAVERYLVAAKVAQNVVSIDQPRRNGASI
FT                   DYRVRFNVFSTDKKRVSVRFPVMIKNFGNDTQCLSLDELTRALSQNYRNKHVSIMWSLP
FT                   SGIISTVYVSVAADGGISDCYTHHALWFVMEGGCIELATNTGAI"
FT                   /protein_id="YP_002360343.1"
FT   gene            complement(53317..54645)
FT                   /db_xref="GeneID:7090273"
FT                   /locus_tag="Sbal223_4528"
FT   CDS_pept        complement(53317..54645)
FT                   /locus_tag="Sbal223_4528"
FT                   /gene_family="HOG000291432" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0039"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0039 hypothetical protein"
FT                   /db_xref="GI:217975745"
FT                   /db_xref="GeneID:7090273"
FT                   /translation="MTHSLLAQATHTNTIQSTVSLKTQAGSNKLDMLKGFKAGKLRKNA
FT                   KNKIAVLLSMATKIELRTQTMGMDDCFNDNAPQIVDVDFFWRWYEKEYSQLEIYVTVFD
FT                   GVLTKVRFSDCPYHFSDDIVLTFEEVKAKKPHFTYAQVKQALLDGYLCPLSNDSKAPEP
FT                   TPPNDDNTRKVVSFGDFQDRLESKRDRLENASSKAAAESNKFYESSRSLAACIPFGQPI
FT                   LVGHHSEGRARRHADKIFNDMGKSVAASKKAGYYADRAASVGTNGIASDDPEAIAKLKE
FT                   KLAGLERSQETMKAINKVIRSKHMTDADKIEYMTQTHKLTEKEAEELLKGDFCGRVGFA
FT                   SYSMSNNNANIRTVRDRIEDLEKLHNQAALSASGEIEGLSWSLYEEEGRIKITFDDVPS
FT                   EAVRNTLKMYSFKWSRFSKAWVRKITPNAIFRTKQLIAKLDTN"
FT                   /protein_id="YP_002360344.1"
FT   misc_feature    complement(53737..54114)
FT                   /note="Domain of unknown function (DUF3560); Region:
FT                   DUF3560; pfam12083"
FT                   /db_xref="CDD:152518"
FT                   /locus_tag="Sbal223_4528"
FT   gene            55743..57245
FT                   /db_xref="GeneID:7090274"
FT                   /locus_tag="Sbal223_4529"
FT   CDS_pept        55743..57245
FT                   /locus_tag="Sbal223_4529"
FT                   /gene_family="HOG000027748" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pput_5032"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppf:Pput_5032 hypothetical protein"
FT                   /db_xref="GI:217975746"
FT                   /db_xref="GeneID:7090274"
FT                   /translation="MNYSVHQYLLRNGPSLSSEITEYLIHSCGLSSQTARQRVSRATQD
FT                   ILRLELSFPRRAKFLFLKEQAGTGLYWGRLNEALLSCNSAYGYAISAIEERGGIIPKCY
FT                   FEIICGAPIKQKKHLSASTVLNRLFSTNLLKEVTVDSIGSCVYLGLHSNHVQSLIPHMK
FT                   ARILAEDLFLRGITSWLKNLGFVSYNQVKTRSNESNPVVSTTAWDLAAPSYLSPLVSGE
FT                   SQGGTIKPGFVVCDILLNNEVSERGIQPFLQKLNSLRSLKNVGKQLCFFFASSYSESAF
FT                   NKLKSVGVSPATISSVFDKEVNSGMKELIELLSQISRVSVSSEKLDVIFKTLGKVEGAA
FT                   SRLRGALFEYVVAEAMRASGYNGVEINKFCRNASGVQKEADVVCFNNKDVCFIEGKGYN
FT                   INKKVTRDDVDYWLIEQVPVFHEYCLSHPDWKNKKLIFEFWTSSTFSDEALARLEEAKK
FT                   ATKRYTINFKNNKDLFLFIADSNNQALLKTYKDHFINYPMTL"
FT                   /protein_id="YP_002360345.1"
FT   gene            57742..58716
FT                   /db_xref="GeneID:7090275"
FT                   /locus_tag="Sbal223_4530"
FT   CDS_pept        57742..58716
FT                   /locus_tag="Sbal223_4530"
FT                   /gene_family="HOG000027749" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975747"
FT                   /db_xref="GeneID:7090275"
FT                   /translation="MNEPIIKDHLGRKACKKIVSYCESWFIKHVVKPIFFLLPPSLLTM
FT                   LAVRKGMQEDVIDYVGQTAGAFLNNSALLIIICTYIYVVLMRAIYAGIENHAKPAKELE
FT                   VGDLLALLKAIDIVVGDKTKRVTSEVKGIINNANVINELKFLQSIRPEQQIPLLVVGLR
FT                   SVFEYMDKQKTVYRVGLLRIENDKPVDWFSFDPASLPPRTEAQTLSAPTSTVSQCIKNK
FT                   SLVIVEDIQKELNKRTKKERRYIKSNTQETDEGSQLCYPLIHPATNKVEYVFTIAGNRA
FT                   GCLNENYSELYAWVIRHFSIRVSLEHSLLIVKEKANESTKEAA"
FT                   /protein_id="YP_002360346.1"
FT   gene            58691..58861
FT                   /db_xref="GeneID:7090276"
FT                   /locus_tag="Sbal223_4531"
FT   CDS_pept        58691..58861
FT                   /locus_tag="Sbal223_4531"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217975748"
FT                   /db_xref="GeneID:7090276"
FT                   /translation="MSQPKKQLENNEVKVKYSVDVTSKEAAKKLESENFKNSIEKELDS
FT                   IAKKSKNSNNI"
FT                   /protein_id="YP_002360347.1"
FT   repeat_region   complement(59188..59215)
FT                   /mobile_element="insertion sequence:ISSba13, 3'"
SQ   Sequence 59223 BP; 16926 A; 14496 C; 13177 G; 14624 T; 0 other;
     TCAGGTACAA AAGTGCAGTA TTACTATAGT GCACTTGCTG TCTGGCCTCT GGTACCTTCC        60
     CGCCCCATAA CGGGGCTAGC AGGTACCGTC CGGCCAGAAT GCCAGAGACT GAAATCGCTT       120
     TGAATATTGT AAACAGAAAT CAACTTTAGG TGGGACTGGA AAGGACGTTG AAAAGCGGCT       180
     TGGCAGGGAG AAAGCTCGGG GCAAAAAAGC GCCCCTATTA AGAGCGCTTT GCATGGGGAG       240
     ACCCCATCCC CCCTTAGCTA AAATTCCCCG CTATCATTAT CAGCAGATGT ACAAGTGGGA       300
     TACATGATGA AAAACATAGT CGGTGTTGAT GCTCGATAAT GATTTTATGC TCGATAACGA       360
     CTGTATTTTG TTTATTGGAC ATTAAAAACT CCTTTGCAAA ATTACAGACT TATCTGTATT       420
     TGATAAAAAA CCTCCGTTCC ATTAAGATGG AAACGTAGAG TTACTTATCA TGTACTACGT       480
     AAGTAAGTAA TTTTGCAGAT TGAAATGATA ATCGGTAGCA GCCCTTAGAA AGTTTGCTAC       540
     CGATTTTTTT TTGCCTTAAA TTTAAAGCAA CATGCCGATA GTGGCACGAC AATTAGGTTT       600
     AGTCAATAGA TTGGCATTTT GTATGTGACT GTATAATAAA GGTATTTCGG GGTACCGAAA       660
     TTATTTAATA GGTCTATAAA TAAGGATTGT ACAATCTTCA AATCTAATAG GTTACTAGAA       720
     AAGTTGATAG ATTTATTAAT GCTTGAAAGC TATTAGGAAG ATTTAGATTT ACACAATCTT       780
     AGGTAACAAA ATCAAGACAG ATTCCCCTCT TTACGAAGTC GTAAAGGACT TCGCACAATC       840
     CAAGTTATGC AAAACTCAGC CCTTTCAGGG CTGTTTTTTT ATGTCCGGAT GCTACAAAAA       900
     AAAGCAGTTT TACATAACGT GAGATCACAT TGCGCGTATA CGACTTTAAG ACAGCGCTCT       960
     TTCCCGCTTC AAACCCCTCA AAAATAGACC TAAAGTCATT GTTAAACGGG TCATTATGCC      1020
     CCCTTAAAAA AGGGGCGAAT TTCACCACTT TTCAGTTTTG GCCGTTTGAG CGCTAAATCA      1080
     CTTCAAGTCT CGACTATTGA ACCAACGAAT TAGGGATCAG CAAAATATGA CCTTGTTTTT      1140
     CATCAACATT ATGCTGCTGT ATTTCAGTCT GAAACAAGCC TGTGGCATTA ACTAAATCAA      1200
     CTACGCTTAT TACCTTATCT GACTCTAAAA ACAGTGACAC TGGTGCAACC TGCTCACCTG      1260
     ACGCGATAAA TCCATTCTCT ACATGCTCTT GCAGCATATA AATCATATCA GGCTCTCGCT      1320
     GAGTGTCGCT GGGAGTTTCA CGATGATCTT GATAGACCGA TAACAGCTGT TTTTTAGCCT      1380
     GATTAAACGA CTGATTCGTC GTATTGGAAG CAACAGAAAT AAAGGGCCAG AAAGCAATAA      1440
     AAAATTGACA CCAAGGATTC TTTAGGCAAA TATACATGCA ACCACTTAAG CTGGCGACAG      1500
     AAAAAACGCT AAAAAATCTA TAGAATTTTT TAAAGAATGA GAGAAGGAAT TAGTTATGTA      1560
     TTATGTTGAC CCAAGCACTG TTATTTCACC TAAAACCTCA GTCAGTGCAG TTAGAGTGCT      1620
     GGAAGATAAA CAAGAAGGTA GTTTTTCAAT TGCTAGAATA CGTTACGATA ATGAGGATGT      1680
     TATTGCTTGT CGATGGAACG GTAGCGATTC AGAACCAAGT GGGCATCCCA ATTCAAGAGG      1740
     GATACCGACA TGGTTTATCA TTCCGACAGA AATTGAAAAT GATATTTTGC AAGGAGTAAT      1800
     AAAACGAGCG GAAACGGATA GATCTTTCAT ATTACAAGAA TTAGTGGCTT TAAAAAAAGA      1860
     ACTATCAGAT TTTAAACATA CAGGAACAGG CACGCATATC ACCATTTACC AACTAAAAAA      1920
     AATTAGATCA CTAACAGATG CCAATTTATT GGTCGAATTA GTGCGAACTG ATAACGACCT      1980
     AAAAAAATTG AAAGTTGATG TTTTTGATAT GGACAATAAA GGAACAAGAA CCAAGGATCC      2040
     AATATCTCTT TTGGGAGAAA AGCTACATCT ATCATTGGTG CGCCAAATTG ATTAATGAAA      2100
     TTCTTCCCTA AATTACGGAG ACTAGTCCTT ATGATTTCGT TATTACGTAG CGTTCAGATC      2160
     AGTCACATAA TCCAGCTAGG TCTTAATCGT GGGTATATCT GACCAACGGG TGGTGTACTT      2220
     CGGTGATAAA AACTGGCGAC GCATAGCCCA ATGCTGATCA TTCCCCTGCG CTGCAACATG      2280
     TAACACATCA TGACCATAGC GCTGATTGAG CACATCAAGG ACTTCCATTA ATTTAGGATC      2340
     ACTTTTCGGT GCATTAAATC GGGTAGCCGG AGGTATCTAG CCTCCAGCCC CCACACCACC      2400
     CTGCATGCGG CTCCGCACAG GGCGGTTCAT TTAGAACGCC TAACCTGTTT TCTGGTTCGG      2460
     ATAGTGAACC GCGATCCATC CATCTCTCAG TGAATACAAT CCTGCTTTCT TAAGATACTC      2520
     ATTACTCAGC GCTTGCTGTA TTCCTGGTGT TTTCGAGCTC CGCCATGGGC CTTTACTTGT      2580
     GATCCCACAA GCAACGGCAG CTTGGATCCT GACGCCACGT TTAAGTAAGT TTTGTACCTT      2640
     AGTCTATTGC GCGACAATTA GCCTGACCGG TTCAGCGACA ATTAGAATGG CCGGTTGATC      2700
     TGATACATTC TGGACAAAGT TTCCAAGGGA GTTCTTTGTG CCAGGTCGTA GAATTACAGA      2760
     TCAACAAATA AGGCTATTTA TGTCTAAACG AAAAGATCAT CCTCAAGTTA CTGCTGCGGT      2820
     TAAAGCGGGC ATATCTGAAC GCTCTGCACG GCGTATTGAA TCCGGCCAGC GACAATTAGG      2880
     CCCTTCAAAA CCTCGAAACT ACCGCACTCG TACTGACCCA CTAGAGCCTG TATGGGAACC      2940
     TGTCGTCCTG CCGCTTCTAC AACGGTCTGA TACTATTACT CCTGTTGGGG TGTTTGACTA      3000
     TCTTATTGAA GAATATTCAG ATGCTTTCCC TGCAAAGTTA AGACGAACCC TAGAGCGACG      3060
     TATACAAAAA TGGCGACAGA TAAATGGCCG AGACAAGGAG GTTATTTTCC GCCAAGTTAA      3120
     ACAATTGGGT CAGTTAGGAA TTATGGATTT TACTTGGGCT GATTTCACCG TCACGATACA      3180
     AGGAGTGGCT CTTAAACACA GATTATTTAA CTATCGATTA CCCGCAAGTG GTTGGAGCTA      3240
     CGCTGAAGTC GTATATGGTG GAGAGAGCTT TGTGGCCGTT GCTACAGGCT TACAAAATGC      3300
     CTTCACACAA TCAAATGGCG TTCCACAAGA AGTGAGAACA GATAGCTTGA GCGCCGCGTA      3360
     TAAAAACCAT TCTAACGAAA TATGGTTTAC CGAACGATTT TCTGAATTAT CAATGCATTA      3420
     TAGCTTCAAA CCTTCAAAAA ATAACACCGG CATTGCCCAT GAAAATGGGG CGATTGAAAG      3480
     TGCCAACAAT CATCTGAAAA ATCAAATACG ACAAGCTTTG GCTATTCGTG ATTCAAGTGA      3540
     CTTTGATTGC ATAGACGAAT ATGAAGTATT CATTGATGAG GTCGTCCAAA GACGCAACCG      3600
     CCGTATTATG CCACTTCTCA TTGAGGAGCA ACGACAATTA CAACCTTTGC CTAAATTTGA      3660
     CAGTGCCAAT TATGAAGTTC ACCCAGTAAA AGTATCAAGC ACCAGTACTT TTCAGTTAAA      3720
     ACGAGTGACT TATTCAGTCC CATCTAGACT TGTTGGTGCA ACATTACGCG TACATCTTTT      3780
     CGATAAGACA TTGGATATCT ATTGCCAGGG CGTGCACACA TCAACGCTCA CCCGCGTGCA      3840
     TACATCGGCA AATCATCGAG GTCATCAAAT TGATTACCGT CACTTAATCG GTGCGCTGAT      3900
     GAAAAAACCA CGAGCGTTTA GGGGGTGCCA ATGGCGAGAC CAACTCCTTC CAAATGAAGA      3960
     CTATCGTCAA ATATGGAAAG GTATCGATGC CCAATTAAGT GCTGACGAAG CGAGTCTTTA      4020
     TATGGTTAGG TTACTGAATA TTGCCTGTAA ATCAGAGCGA GAAGAGGCGG TAGGAAGATT      4080
     TGTCCTTGAT GGACTGAATA ACGCTCAACT GCCAAGCATA TTCGACTGTG AAGACCGTTT      4140
     TTTAAAAGAC GAAGAGTGGG AATACAACCC TCAAGTACAG CAACATAGCT TAGCGTCTTA      4200
     TCAGCAGCTC TTCGACGGGG AGAATGGATA TGTCAGTTGA AACATTACCC CTTCTTCTCA      4260
     AAGAGCTTCG GCTAGCGAGC TTACTTCCCC ATTGGGAGGC GTTGGCAGAA AAAGCCCGAG      4320
     AGCAACATTG GCCAATGGAG CGTTATTTAG CTGAATTATG CCAATTAGAA CTGAGTAGCA      4380
     GAGAGCAAAA ACGATTACAA CGTGGTCTAA AAGAGGCGAC GTTGCCAATA GGCAAATACC      4440
     TTGATACCTA TGATTTTAAT GAAGTTGAAG GTTTATCGAA GGAGCAGGTT TGGCATTTGG      4500
     CCGAGCATGC GCAGTGGTTA AAGACGGGAG ATAATATCTT GCTGTTCGGT GCTAGCGGTT      4560
     TAGGTAAAAC CCATATTGCC GCAGGACTGG GTTATCGGCT TGTAGAGCAA GGGCATAGAG      4620
     TCAAGTTTAT GAGTGCGAGC TTACTTGTGC AGCAACTGCA AAAAGCGAAA GAAGAGCTAA      4680
     GGTTGTCGGA AGCCTTGGTA AAATTGGATA AATTCGCGGT TCTAATTTTG GATGATTTAG      4740
     GCTATGTGCA AAAAAGCACA GAAGAAACGA GCGTATTGTT CGAGCTGATC GCGCATCGTT      4800
     ATGAAAGGCA CAGTCTAATC ATCACCTCAA ATCAGTCATT CGAAGATTGG GATAAGCTAT      4860
     TCAGTGATAC GGTGATGACA GTAGCCGCAA TCGATAGGTT GATCCACCAC GCAAAGATCT      4920
     TGCAATGCAA AGGAGAAAGT TACAGGCGAA AAGAAGCACA AAACAAGCTA AATTAAACAG      4980
     GACTTCAACC GGCCAAGTTA ATTGTCGCTG GATCGGCCAA TCTAATTGAC GCGCTATAAC      5040
     GATCGCGTGT TAAGCAGATC TCCCCAGATA AGAACATGAA CTTTCTTTGC ACTGCTGCAT      5100
     CATTTACGGT GGCCATTAGA TCACGTGGTT TCGTCGTCTT GTGCCAACTC ACCTCTAGCC      5160
     TACGCCTCAT ATGATGTTCT TGTTCATCAG CTCGCAAATT TGCTAGCGGC TTCCTTCAGA      5220
     CCAATCCTCG CGGATAAGCC CTTGCCATTC GCTAGTAGTT AACGTTTAAT AACAGCATGT      5280
     TATTGAACGG TGATCTTCCT ACAGAGGACT TTCACCTCAT TAGTTCATGC CCATGCTGGG      5340
     CGTACACAAA AACATCAAGG TGACGCGTTA CACTCGGCGG TTTTGGTATG GAATTCAGTG      5400
     CGTTTTCTAG GTTAGTCGTG GCGCACCTTA ATGCGGCGTT AGCTGCTATC TAATCAATCA      5460
     CTGATTTAAG GACTAAAAAT GGAAGTAAAG TATTATCATC AAAAAGAAGG CGCCTACGGA      5520
     AATATAATGT GGGACAAGAA ACTAGGTGAA TCCGAGGATA CGCATCCTAT AGAGTCAATA      5580
     AAGGTCGATG CACAGAATCA TCCTTTAGAG AAGTTTAGAA AACTCGGTTA CTTCGCGTCA      5640
     TGCTTCCCTG AAGGTGATGG AATAGCAATC CAAGATGAAA CTAAAAAAAA GACTAAAGGA      5700
     ATGGTGGCAG ACGATATTAT CACGTGTTTC GGATGGGATG TTTGTATTGT TGTAAATGGC      5760
     AGCTAACAAG CCAAGTAAGC GGCACAATTA CGCGTAGGCT CCCGTCACTT CGTTCCGTAT      5820
     TATAGCCTGC GGTAATTGAC CCTTCTTGGG TCGTTAGCCC ATATAAATTT TAATTCGAAA      5880
     TTCACTAATT AGAGCTAAAA GTCTAACTCG GAAATGTCCA AAAATGAGCT AGTGAATCAC      5940
     TCTACACCAA ACTGATTTAT AGCGAGACCG TACCCTGCCT AATTTGCCCT CAATGGGGTG      6000
     CGCTTAGAAT TCGGAAATTA TCCCACGCTA AGCGATCTTT TCTTTGTCCG AAACCGAACG      6060
     ATTACGGACA GATACATAAT TTTATGTACG AAAGTAAGCT AAATTGCTTT CGTACACAGC      6120
     ATGCATTACG TACATCCATT TCGGTCAGTA CCTTTAGTTA TTAAGCTAAT TTGAGGTGTT      6180
     CGAGAAAACC AAAGCCCTGT CACTACTACG ATTTAAAGTT CTTAACGTGG GATAATTTCC      6240
     CTTTTCCAAG CGCACCCAAC CTATATCAAC CAACTCAATT AACCCGATTA ACCCGATTAA      6300
     CTTGATTAAC TTGATTAACT TGATTATAAT TAAGCAATAA TTAAATGCGA GGTGACGTAA      6360
     TGAAAGTGAT AAGCGTATGG AATGAAAAAG GCGGGGTAGG TAAATCGACT ATCAGTTATA      6420
     ACCTAGCAGG TGCGGCTGTA ACAAAGGGAC TCAGTGTACT GCTAATCGAT GACGATCCTC      6480
     AAGGATCATG CGCTTGGTTA AGTAGCGATG GTTTTGCCCC ATTTGAAGTG GTCAAACACT      6540
     GGCCCACAAA TAAACCCAAT GTAGATCTAG TGATTGTTGA CATGACACCC AGCACCACAG      6600
     ACACACCTAA CGGTGTGGTG ATATTACCCT ACCAACCAAC AAGACTAGCA TATGGTGTAG      6660
     TGCCAAAACA TTTACCTAAA CTAAAGCAAG CGGGCTTACG AGTGGTGCAA GTGATCAGCA      6720
     TGGCCGATAT GCGAAAAACT GAACACAGAG AGTTTGCTAA AACTAAAATG CGCGAAGACA      6780
     AAACAATTCA ATTAGTACCC AATCGTGCCA TTTACGAACG CACAACAGGC TTAGGTCGAA      6840
     CCGTATTTGA CCCCGAATTA AAAGGAATGT ACGGGCTTAG GGATGCACAA AAAGACATGA      6900
     ATAAATTATT AGATGAGGTA CTCAAATGAG TCAGGGGCCA GCTTGGTTAG CCACCGCAGA      6960
     AAACAACACT CAAGGCAATG AAGTCGGCAC CGCAGCGGTT ATCGATAACA AAACGCCGCG      7020
     AGGTAAACCT GGGCCTAAAA AATCGCTGGT TAAACGCAAA GTAATTGGAC TGAACTTTAG      7080
     TGATAATCAG AACAAGAAGC TGGATGAATT AGAAATGCGG TTAAAACTAG CAGGGATAGA      7140
     TTTGCCACGC GGCAGAAGTG AAGCGGCTGA ACTGGCAATC AATACCCTGT TATTTATTCT      7200
     AACTCAATCA CCTAGTGATA GTGACCGCTG GATAAAGCGG CTACTAGAAA ACTTAGTAGG      7260
     TGAGGAAGAA AAACAACATG AGACAAGTCA AGCCAATTAA GCCAATTAAG CCAATTAAGC      7320
     CAATTAAGCC AATTAAGCCA ATTAAGCCAA TTAAGCCAAT TAAGCCAATT AAGCCAATCT      7380
     AAACAATTTT ATTCCTATGA GGGGTTTTGT GCCCATCCCC TCGAAATTAA CCTTAAGGCT      7440
     AAATTTGCCC AACGCGCCAA AAATGTAAAG TTAGCAAAAG GAGGATGAAT CCTAACGGTA      7500
     CGGTTTTGTA CGTTAAGCGT CAAATCAGTA AGTTGGGGTT GTAAGCGGGA AGCCGCCAAA      7560
     ATTTTGCAGG CCTGACTATG ACAACGTCAG TCCCTCAATC ATGGCGTCCA GATCGAGCTC      7620
     TTTCCCTTCA CTGATAAAGG TGTAATACCC ATTCAGAAAG ATATGCTGCC AGGCTACGGG      7680
     CGACATTCGT CTGAGAAGAG CAAGTCCCAG GGTGTTACCG ACATCTTCAT ACTTCTGCAG      7740
     CAATCGCGAC AGCAGGGCTG AATTATAATG ATGCTGAGTA GCCGCCCGCA CTGATTGCTG      7800
     ATTTCCAGCT CAACATCATT CTGTCCGGTC AGCTCTTTTT TGCCACCAAC CTGCGCGATC      7860
     GCTGAACGAA GCTGATGCCA GGATTCAATG CAATTTTGAG ACCGGTGACT GTTTCTGGCC      7920
     ACCTGCGGGT TACGAAGATA CCGGAGGATG TAAAGACTAC GGATCAGTTT ATCAAACTCA      7980
     AACAGGGCCT TCCTTCAGAA ACCCTACCGA ACAATAATTT TCGATATCCA AGTTCACCCC      8040
     ATCCAGTAGG CAGTGACTAA GCGAGGGTTT TACTTAGTGA AGATTTTCTT CTGGTTGAAT      8100
     TTTAAAGGCT TTGATACCTT CTTCGTTAAT TGTATTTAGG GCTTCATCAA AAGCCGCTTG      8160
     GTCGCTTTCA GGGGTTCTAA GCCGGAACCG CCGAAATTTC CGTCTGGGTG CAATTGGCTG      8220
     ACGGGCAACG GTGTCCGTTC AACGATTTTC TAGGGTATGC CATAGCCGCA GAACGTAGAT      8280
     GGGAGCAGAT CACGAAACGG AAAGAATCGC TAAGCATTAT GCTCGAAAAA ACCTAATATT      8340
     TCAACGAGCT ATGTTATATG TCAGAATGGG CCGATAAGAA TACGCCACGT ACGGGGGGAC      8400
     TTCTTCAAGG GACAAATCTC CTGGCATCTC AGAACAAAAT GTAGGCAAGT AACTGCCTCA      8460
     AATTTGATAG AAAAGAAGGT GCAATATATT TATCGCACCG TCCTGATGTT TATAGTGATT      8520
     AATTACTCAC AACTCTCATC GATCGAGGTC GGCTAAAATC GAGGTACTGG CCATTCCATG      8580
     CTTTTACTTT TTTCATCTCG TTAGTCCCTA CACTGCCGAC AAACTCACCA ATCCTGTTAT      8640
     ATGAAAGGTT ATCCCAATCA GACAAAAGTA CTTTTGCGTT AAGGCCTGCA TCGACATGAA      8700
     CCTCTTGGCC AATAATCCAA TTAGGCAAAG AATATCCAGA CCTAGAACCA ACTGGGAGGC      8760
     AATACTGTGC CCCTGTAGTG TTAGATACGA TACACCCTTC ATTTGCTTTT GCAGGAAGAG      8820
     CTTTACCATA CACAGAGAAT GAAATATCTG TTGGTGCTGA TGATAATGTT TTTTCAGCAA      8880
     TCGTCCTATT ATTGCATACC ACTGCTGCTT GGCTGGGTTT CAGGTCTGTC GGTATGTTGA      8940
     TGTGAAATTT GTTCATCACT GTACTGGCTG CCCTGTGGTT GGCCAATGTG AAGCGCTGCA      9000
     GACCATCGCG GGTCTCCACC TGCAACTGGC AGTCATTACC GGACAAGGTG TTGCTGTCAT      9060
     CCGGATAGGT GAAGCCGTAG GCGCCGTGCA GAGCCGGATA GATGTAACTG GGCAGACTCC      9120
     CCTGCGGGTC GTAATAGCCC ACCAGGGTGG TCACCGGCAC TCCGAACTGC TCGGGCTTGC      9180
     GCGCAACCTT GGTATCGATG GGGGAGACCT CCACCCAGCT CTGGCCATCC GAGGTGAAGC      9240
     TCTTCTTGAA GCCCCGGTTC ACCACAATTT CCTTGCCGTT GATAAAGAGG CGACTGTTGT      9300
     AACCGGCCCC GTGATCGATG GTCAGACTGC GCCCACGGTT GTCCGCTGAG GCAACCGGCA      9360
     CCCGGATATC ACGAGTCCAG CGTCCATCCC ACATGGCAAC CCTGACCAAG CCGTAATCCG      9420
     CCAGCAGGGC ACTCAGTCCG GCCTCGCTCA GGGCATCCAT GGGGGCATCG ATCTTCTCGA      9480
     TCCCCTCGAT TGTGTGCTGA TAGGGCTCCA TCCTGGCCGT CGCACTGCTC CACTTGCTAA      9540
     AGCCGGTGGC CGAGTTGGCA TCGAACACGG CCTTGCTCTC GAAGAAACGC TGAATGATGG      9600
     CAGCCGAGTT GGGAGTGTAG AGGGTGAATC GGTTAGCACC GGATAGAGGG CTGCCGCCCG      9660
     CCATCGCATC GAAGCCAAAC TTGCGGCCAT CGAACGGGGG CTGGCACTGG CCATCCAGAC      9720
     AGGCATCCTC ATTGGTTCGG GTCGGCGAGA AGTTGGGGAT GAAGCGACGC TTGTCACTGT      9780
     CCCAGCCCCA GCTGGAGTTG AGCTGCTCAG CACTGCGATG GACCGAACCA CTAAAACCAT      9840
     CTACATAGTG GCCAAGCCCG TAGTTGTGAC CTACCTCGTG GCTAAACTCG TTGCCGAGCG      9900
     AAGCGTCCAG AGTGACTATA CCTCCCCCGC CTGAGCCACC ATGCACCTGC ACCCCATTGG      9960
     CATACTTACC ACGACTGTTG TGTGCAGCTA GCTGAGCCAC CACAAACGGA TGGCTCCCCT     10020
     CCCCTTCGCC TGCACTGCTG TTGATACCAT AGTTGGCATT GTCGATACCG TGAGAGATAA     10080
     GTTCCTTGCC GATACGCTGG CGCATAGTGC CGCTATGCCA GCCCCCTTCG CTTGGATCGA     10140
     AATCGGTCAG CAGAGTACCG TTGGGTAGCA TAACTTCCGG CAGATAGAGT GCCGCATACT     10200
     GGTTGACGAT CATCCGGCTA GCAGGAATGG TCTGGAAGTA TTCTCGGTGA GCCTCCTTGT     10260
     CGTTGGCAAA GGCGAAGCGA TCCCGTGGCG TGATGAGCAT GCCGATGTCG ATGGTGTGCA     10320
     GCAGCAGCTC GCCGGGGGCA CCGACCTTGA TGTCACGCAG TTCACCACTG AAATTGCCCT     10380
     GACGAACGGA GAGGTTCAGT CCAGGCTGGA TCCACCCGGC AGGCAGCTCG CCGCTCCAGG     10440
     TATCCGGGGC ATAGGTGATG CGGTTGTTCT CCAGCTCCCC CTCACGGAAC CACTGCCCCT     10500
     TGGCAAACTT GAACTGCAGG GTCTGGCCAC GGGCGACGGT CACCTGCCGC TCGCCATAGA     10560
     AGATCGTCGA GTTGTAGCCT GCGCTGGAGC GCAAGCGCAC CATCTTGCCC TCCAGCTCCG     10620
     GGCTCACGGG CAGGTAGATA TCCCGAACCC AGCGGCCGTC AGCGGTCTGA ATCTCCACCA     10680
     GTGCACGACC CGTCAGCCGA TCCTTGAGGA AGGCGCCGCT CTTGTCGCTC AGTTTGGCCA     10740
     AATCAGCACT GCTGCTGATC ACCGCGGTGG GGCCGCTCTC TGGGACGAAA CTCACCCCGC     10800
     CTTCGGGAAC ACCTGCGAGG TGGTAGACAG TCTCAGGCAG CGCCGACGGG GGCGACAAGG     10860
     TCAGAGTGCC AAGCAGCTTG CCGCTGGCGT CGCGGGCCTC CACCACCATG GGGGTCACCC     10920
     CATCGGCCTG TAGCGGTTGC ACCAGCAGCA AACTCTTGCG CAGGCTGGTC AAGGTGGGCT     10980
     GGCGCTCCCC CTCCTTGGGG GAGGCTGGGA TAATCTGGCT CTGGGCAAAC TGCACTCTGG     11040
     CTGATAGTGA GCCGACCAGG TCATTTTGTG GGGCAGACGA GTTGAATATG AGAGGAGAGA     11100
     TTTGCTTAGC AGATACAGAC AATGCTGTAG CTGCAATCGA GGCTGCGATC AAACAGGAAA     11160
     TATAGTTGCG CTTCATTTTT TAATTACCAT TGATTAAATA TTAATTCATC ATGTTTTTTA     11220
     CAGTGAAAAA GTCAAATATT TTCAGAAGGA AAGTCATGTC CAGAAACTAA ATAGGAAATG     11280
     TCAAGAATAA AGAATGTGCT TTGTTGTCAC CTTGAATCGT CCAACTAGGG TATACCCTAT     11340
     CCTGATGTCA GGTCGTTCAG TTAAAAGTGT CAAAATAAAG TATTGAATTT AATTAATTGA     11400
     CACATTCAAG GCAAGATCTT AGATTTCTTC CTGACACTTT TAAGTTCAGG AGGTCTCTTG     11460
     CAGGGACAAC GCATCGGTTA CATCCGCGTC AGCAGCTTCG ATCAAAACCC AGAACGGCAA     11520
     CTGGAACATA TTCAGGTGGA CAAAGTTTTC ACCGACAAAG CCTCGGGGAA AGACACTCAG     11580
     CGCCCGCAGC TCGAAGCCTT GCTCTCCTTT GTTCGCGAAG GTGACACGGT CGTGGTACAC     11640
     AGCATGGATC GCCTTGCTCG CAACTTGGAT GATCTGCGTC GACTTGTGCA GGGACTTACC     11700
     CAGCGCAGTG TCTGCATTGA ATTCGTCAAG GAGCATCTGA CTTTCACTGG CGAAGATTCG     11760
     CCGATGGCAA ACCTTATGCT GTCAGTCATG GGGGCATTCG CCGAGTTCGA GCGAGCGTTG     11820
     ATCCGGGAAC GTCAACGGGA AGGTATTGCC TTGGCAAAAC AGCGTGGAGC TTATCGGGGT     11880
     CGCAAGAAAT CACTGTCTGA CCCAGAGATA GCGGAAGTGC GGCGGCGAGT CGTTGCTGGC     11940
     GAAAAGAAGG CGACACTTGC CCGTGAATTT GGCATCAGCA GGGAGACTCT GTACCAATAC     12000
     TTGCGGGTGC CGGAGTAACT TATGGCGATT GCTAGAAGCG AGCGACTAAC AGTTCTGTCG     12060
     GATGCCGAGC AGGAGGCGCT ATATGGCTTG CCGGACTTTG ACGATGCGCA GCGGCTGGAA     12120
     TACCTGGCCT TGACCGAAAA TGAGCTGGCG CTCGCCAGCA GCCGACCAAG CATCCATGCT     12180
     CAGCTCTATT GCATCCTGCA GATTGGTTAC TTCAAAGCCA AGAACGATTT CTTCCGTTTC     12240
     CACTGGCGTG ACGTCGAGGA TGATTGCGCT TTCGTGCTCA GCCGATATTT TCAAGGTGAG     12300
     GCATTCGAGG CCAAGCAGAT CTCCAAACAC GAGCACTACA GCCAGCGAGG TAAAATTGCC     12360
     GCGCTATTTG GCTACCAGCC GTGGGCCTCC AGCTACCTGC CATCACTTGA GCAACAGGCC     12420
     TCACTGATCG TGCGGCGCGA CGTGACGCCC AGCTTTGTGG CCGCTGAGCT GATCGTCTGG     12480
     CTCAACGAAC ACAAGATCAT TCGTCCCGGC TATACCACCC TGCAAGCGTT GGTCAGCGAA     12540
     GTCCTGTCAG TCGAACGTCG ACGACTGGGA GCCCTGCTAG CACAGGTGTT GGATGAACCG     12600
     GCCAAGACTG CGCTGAGCCA GCTCCTGGTG CGCGACGATA CGTTGTCACA ACTGGCGGCA     12660
     CTCAAGCAAG ACGCCAAGGA TTTCGGGTGG CGTCAGATGG CCAGAGAGCG TGAGAAACGT     12720
     GCCCTGCTGG CGCCGTTGCA CGAGATTGCC AAGGGGTTGC TGCCCAAACT GGGGATCTCT     12780
     CAACAGAACC TGTTGTATTA CGCGAGTCTG GCTAACTTCT ATACCGTCCA TGATTTGCGC     12840
     AACTTGAAGG CAGAACAGAC CCAGCTCTAC CTGTTGTGCT ATGCCTGGGT ACGCTATCGG     12900
     CAGCTCAGCG ATAACCTGGT CGATGCGATG GCGTTCCACA TGGATCAACT TGATCACGAA     12960
     AACCGAGCAG GAGCCAGGGA CACTTTCGCA GAGGAACAGG TCAAACGGCA TCAGGAAACG     13020
     CCCCAGGTTG GTCGCTTGCT GTCCCTGTAC GTGGACGACA GTGTTGCGGA TCCGACGCCA     13080
     TTCGGCGAGG TACGCCAACG AGCCTACAAG ATCATGGCCA AAGACGTGCT GCAAAACACG     13140
     GCGCAGCGCA TGAGCGTCAA GCCACTGAAT AAACTGACAT TGCACTGGCA GGCGGTGGAT     13200
     GGCCAAGCCA AACGTATCCG TCGTCATCTC AGACCTTTGT TTGTTGCGCT GCAGTTCGCC     13260
     GCCACCGATC CGGACAGCCA GTGGCTGGCG GCACTGACCT GGGCCAAAAG CGTGTTTGCC     13320
     AAGCAGCAGC GCCTGTCACA ACGACCACTC GCTGAATGCC CGGTAGCCAC ACTCCCCAAA     13380
     CGCTTGCGGC CCTACCTGCT GACCTTTGAT GCGGATGGTG AGCCGACAGG GCTACATGCT     13440
     GACCGCTACG AGTTCTGGTT GTACCACCAA GTCAAAAAAC GCTTCCAGTC TGGCGAGCTC     13500
     TATCTCGATG ACAGTTTGCA GCACCGGCAT TTCTCTGATG AGTTGGTGTC TATGGAAGAG     13560
     CACGCCCAGG AGCTGGCACA GATGGACATC CCGTTTCTGC GCCAACCGAT TGAAACACAG     13620
     CTCGATGTCT TGGCCACCGA GCTGCACAGG CAATGGCAGG CATTCAACCG TGAACTGAAA     13680
     CAGGGCAAGC TGACACACCT CGAATACGAC AAAGATGCGC AAAAACTGAC CTGGCGCAAG     13740
     CCCAAGAGGG AAAACCAAAA GGCGCGGGAA CATACGTTTT ACGAGCAATT ACCGTACTGC     13800
     GATGTCGCCG ATGTGTTCCG CTTCGTCAAC AACCAGTGTC AGTTCCTATC GGCACTGACT     13860
     CCGCTGCAAC CACGTTACGC CAAGAAGGTG GCTGATACCG ACAGCCTGAT TGCGGTCATC     13920
     ATCGCCCAGG CCATGAACCA CGGTAACCTG GTCATGGCGC GTACCAGCGA TATTCCATAC     13980
     CACATCCTGG AGAGCGCATA TCAGCAGTAC CTGCGGCAAG CATCGCTACA CGAGGCCAAT     14040
     GACTTCATCA GCAATGCCAT TGCTGCGCTG CCTATCTTCC CGTATTACTC GTTCGACCTC     14100
     GATGTGCTGT ACGGCGCTGT CGATGGGCAG AAATTCAGCG TTGAGCGGCC AACCGTGAAG     14160
     GCGCGCTACT CGCGCAAGTA CTTCGGGCGC GGCAAGGGTG TGGTGGCCTA TACGCTCTTG     14220
     TGTAACCACA TCCCGTTGAA CGGCTACCTG ATTGGTGCCC ATGATTACGA GGCCCACCAT     14280
     GTGTTCGACA TCTGGTATCG CAATACCTCT GACATTGTGC CAGAGGTCAT TACTGGCGAC     14340
     ATGCACAGTA TTAACAAGGC CAATTTCGCT ATTCTGCACT GGTTCGGGCG GCGTTTCGAA     14400
     CCACGCTATA CCGACCTCAA CCACCAGTTG CAGGCGTTGT ATTGTGTGGG CGACCCGGCG     14460
     CGATACGAGA AGTGCCTGAT CCAGCCAGTT GGCCAAATAG ATAGGCAGTT GATTGTCAGC     14520
     GAAAAGGCGA ACATTGATCG GATCATCGCC ACACTGGGTT TGAAGGAGAT GACGCAGGGA     14580
     ACGTTGATCC GCAAACTGTG CACCTACACC GCGCCAAACC CAACGCGGCG GGCCATCTTC     14640
     GAGTTTGATA AGCTCGTGCG CAGCATCTAC ACGCTACGCT ACCTGCGCGA CCCCCAATTG     14700
     GAACGTAACG TACATCGCTC ACAAAACCGG ATTGAGTCAT ACCATCAGCT ACGTTCAAGT     14760
     ATTGCGCAGG TGGGGGGCAA GAAAGAATTG ACTGGGCGGA CCGACATTGA GATCGAGATC     14820
     AGCAACCAGT GCGCCAGGCT GATCGCCAAC GCAGTCATCT ACTACAACTC GGCAATCCTG     14880
     TCGCGGTTGC TAACGAAGTG CGAAGCGGCA GGTAACGCCA AGGCCATCTC GGCGCTCACC     14940
     CAAATATCGC CGGCAGCCTG GCGGCACATT TTGCTGAACG GGCATTATAC CTTTCAGAGT     15000
     GACGGTAAGG TGATTGACCT GGACACGCTT GTGGCTGGGG TTGAACTGGT ATGACGGAAA     15060
     TTTCGGCGGT TCCGGCTTAC AACCCCTTTC AAATTGGTAG TCCCATACAG TCGATGTACC     15120
     ACATTCATCC ACGACTTCTA AAACCCAACG CCCAGACGAG TCACCTTCGT AAATAAAAAT     15180
     ACTCAGTAGC TCACCATCAA CAACCAGCTC CTTATTTAAA GGAGAATACT TTATTTTAAT     15240
     ATCATCAATC TCAATCGAAC TCATTGTAAT CTGTCCTATT GGGTAAAAGT GTTCTTATAC     15300
     AGTTTATGTA ATGACTTAGG TAGCAACAAA GATCTCTTTC TGACATTTAG CCAACGCTAT     15360
     ACGGGGGTGA AATCCAACGG TGCGAAAACG TATACCCCAA GCAAACCAGC CGCATCACAT     15420
     TGCCGATTGG TTCGCTATAT ATTGGTTTTA AACCCTATGC GTACCATTAG CGGGAACCGT     15480
     ACTCAAAAAA GACTAAGCAA TTTGGAAGTT TGGCGCAAAG GGTAAAGTCG GGTGCTCTCG     15540
     CAAAGTCACC ATCACAATCC AAAAATAGGG GAGAGTTCGG AATCCTCCCC TAGGTTCGTT     15600
     AACCTCTTAC TTCGTAGGCA AGAACAACGT TAAGCAACAT AGCACCGTTA CGGTACTCTA     15660
     CTTTACACAA ATCATCTCTA ATGAGTGCCA GTGCAGCTAA GAGTGTGAAA CACACGATAG     15720
     CGAGACTCAA AGTAGTTGTT TTTCTTTTCG GCATATCTTG CCTCCTAAAA GTAAAGAGGC     15780
     TACTATTTGT ATTGTCTGGA TACATTGTAG GCCTCGTTTG AATTTATAGT TCATTCGGGG     15840
     CTTTCAACTT TATAGCAAGT TACATAACAG CATTTCCATG CTCTTGCTAA AAAGCCAAGA     15900
     GCACCCGCTT GAAGTTTACC ACTTGTACTC ACATTCCCGT CAACGCTTTA TCTTTAAAAA     15960
     ATGGTGTAAC CATTTAATCT CTTAGCTTTA TTTGAATTCG TAACAAAATC AAAAGTCACT     16020
     ATTGGCATCC TGCTTGCAAT TCCTTTCTGC TAGACGTTTT TTCTTTAGCT GCTGATGTTC     16080
     AGCGCGTTTG TAGCTTAACG GTCGGATGAC AAAACTTACT TTCAGCGGTG CTTTTAGTTC     16140
     TCGCCCCTGC CAACGGCAGG AAATGGCGAG GCATTATTGT TTGTAGGTGG ATTTATCCAC     16200
     CGTTTCTTGT GCCTTTCAAT AAGTTATCTT TTACTACTAA TTAAGCTTTA CTTGAAAAGA     16260
     AAGAGCTTTA GGACTCCCAT TGCTTACTCC TTTTTCTTAC TCCCATTTAT GCCTTAATAT     16320
     ACAAGCCTTA TCCACAACCC ACGGGTAAAG TGAACAACGA ACCTAGAAGT CTGGTAAACA     16380
     AAGAGGGATA AATGCCTCTT TACAGACGGA TTAGGCCGCT TTAACGCATG ATTTAAGCGC     16440
     CTAAAAACGT CCAGACGCGC AAAGTCCCCG CCAATCAAGA CGGTCGCTTA AAATGTGGTT     16500
     CAGTGGGTTT GAGGTGGGTT CGTACTTTGT GAGAAAAACA TATCCGCGGT GAACCGCTGT     16560
     TTAACTGGGA GCTGGCGCTT GAACACTCGC CAAGTGAATG ATAAGCCGTT ATTGACGGCC     16620
     TTTTGATAGG CTTGCTTTAT CTGTGCTCGT ATCGTGTCTG TGTATGCACC GATAGCTTGC     16680
     AAGAAGTGAG TAGAAAGCCA TTTATAAGCC GCGACAGAGC GGATGGTTTT TTCTGTCTCG     16740
     CCTGCTATTT TGACTTCTTC AACAACAAAC ACACCCGCTT GCTTGAGCAT ACCAATGTAT     16800
     CGATACCAAG TAGAGCTCGG CATTGCATAA CCCCAGCGCT TAGCATGAGC GAGCATCAGA     16860
     GCATCGTGAC TGGTGGTGTC CATCCCGATA TTCTTCGCTT TACCAATTTG GCCACTCATA     16920
     AAATCACATG AGGTAATTAA GGTTACGATG ATTTCAAACA GCTTGCGCTT AGTCAGTTCT     16980
     GACATTTGCC TTGATATGCC GCCTTCGTCT ATTTCAAACT TTCTGCTGTA AATCAATTTA     17040
     CGCGCGTTAT TAATAACCTC GCTAAAATAA CGTGGTAAAC GTGACTTTAA GGCTTTAAAG     17100
     CCTTCAAGAC TGGCTTTATA GGCATTAGCA CCAACGGCGG TTTTATGGGT TTTGACATGC     17160
     AGAGCCGCTT CGCGCTTTGC TGAGCGCAAC TTTTGGCGTT TGATGCGGGC TTTGTCGGCT     17220
     TTAGACTTCT GCATGACACA CGTCCGCACT GCTACAGATC AGCATAGAAG ATCGAAAGAT     17280
     CAACGACTGA TTAAAGCAAC GAGGATTGAT GTGTCTTAGG TGTAAATGCT GCAAAGGGCA     17340
     GCTATTGAAA AAGTTAGGCA TTTTTTATGA TTCTCGTAGT TTAAGAGCTG CTTGGTTTCC     17400
     ACGCCAAACA TTGCGGAATA CATTAAACTA AACGATCGCA AAGATCAACG ATCTGAATTT     17460
     TAGACACAAA AAAGCCGACG CTACGAGTCG TCGGCTTTTT TGTCGAATGC TATATCGTCA     17520
     GATTGGAGGT CTAACACATT CTAGGCCTGA AAAATACACT ACATAGAAAA CTATGTAGTA     17580
     GTGCGATCTA TGTAATGCAC TTTCAAATCA AACCTTGAAA GTATGATAGC GTAATTTTCT     17640
     AAATTGTGAA GTTGTTTTTA GTCCATTTTT GTTGAGCTGA AAACAACCCG CCCTAATAAC     17700
     TCAAGTTCAT CTAATCTATA TAGTTCATCT TTATAAAATT CATTGTAGCT TTTGGCTTTT     17760
     ACCATCTGCT TTTCGTAAGA AAAAGCTTTC ACCCTCAAAA CGTCACCCTG CCTAAAAACG     17820
     TAAATTTTTC CATCTCTAAC TACTGTTTGC GTTGGGTCTA CAACTATCAA TGACCCATCT     17880
     TTCAATGCGG GCTCCATCGA ATCACCTGTA ACAGTAATGC AAAATAACTT CTTATAATTA     17940
     CTTAGCGCTG GCAAGTCCTT TACGAGAATG AGCTCATACA CTTCCTCGCG ATTACAATAC     18000
     CCTGAACCAG CAGCGACCTT CACATCTGAA TAAAACGGGA TACGTTTAAA GCTAGACTCA     18060
     CAATTGGACT TACAAGAATC TACATTAGCT TCTTCACGAT CTACAATATC AAAATAGTTA     18120
     TCTTCCAACT CGAAGGTTTC TATAATTTTC TTAATAAATT TCCGACGAGC TTGAGATTTC     18180
     CCGGCTTCCC ACTGTGAAAT AGTTGATTTT GTCACTCCGA TACGTCGCCC AAACTCCTCT     18240
     TGGCTAAATC CAAGGTCTAT CCTCAACTGC TTTAAATTTC TTTCAAATGA ACAATTCATA     18300
     CCGAACGGCC ATAAATTAAT TTCCGTATTT ATTATCAAGG AGATCACGTT CATAACGGTT     18360
     TCTTTTACAT GAACTTGGTT TAGTTAAAAC AAACATTACT TTACACCCTC AATTTGTTGC     18420
     TTTATCATCC ATCCCCATGA TCATCCATAC AGTAATTATC TCTCTTTCAT GACCAAGCCG     18480
     ACGCACGTCA ATGTCGAATT AGACGGCAAA ACAAACGAAA TGCTAGAAGC CTCGGCAAAA     18540
     CGTAACAATC GCTCTAAGCG CAAAGAGGCT CAAGCACGAC TCATTGACCA CCTTAGCCGC     18600
     TTCGATGAGA TGGGAATGGG TCTAAAAGGA AAAGATAAGT CTTAAATTTT TTTACCATCA     18660
     CGATCCAAAA ATAGGATCGC AATACAAAGG AAGTGTTATA TGACCACCAA AACCCAACAA     18720
     CCTAATGCAC AACAACCTAA CGCCCAACAA AATGAAGTAA ACGAAGAAAT TCTAAGACTC     18780
     GCAAAACATA TCCCCAGTGA TAGCACCATA TTCATAATGC GCTGGACTTT CCTATTCATC     18840
     ATTTGTGTCG TCGCTACTTT GCTGTTGTCT TGGGATGTAC ATGCTGCTGA TCCATTTGTA     18900
     AAGGCTAAAT CTGAAATTGT TGATACCGTT GGCACAGGCT CAACTGCACA GTTCGCCATT     18960
     CTCGTCGTGG GTTTATGTGC CGCTGCACTT ACCGGCTTTT TAACCAAAAA CTGGGGCGCA     19020
     GCTATTGGGG CTTTTGTCGT TGGAATGATC TTCGTCAACG TGGCCTTAAA GGTTGTAGGT     19080
     CTATAGCCCG TGGATAATCC CACTCAGTTT TTTAGCATCC CTAAACACCT CAATAACACC     19140
     CCTACGTTAT TAGGGTTTGC GATGGATGAA CTTGTTCCTG CCTTAGTGTT TTTTGCCGTG     19200
     TTATTCATGA TGGATCACGC GCTCATTGGC ATGGCGCTAG CCTCTTCATG GTTTTTAGGG     19260
     ATGCGCAGAA TGAAATCGCA ATACGGCATG AGCGTATTAC GCCTCACCGC TTATTGGTAC     19320
     GCCCCTGCAG AATTTAGCGC TTCATTTTTA AAACGAACTC CTGCGGCATG TCGCCGCTAC     19380
     TGGTTACGTT AAATGATGTG AATTAGGGGG CCAATCCCCC TAAGGATGCC CCATGTTACA     19440
     AAAGAACAAG ATCGACTTTA TTCGCATTGC CAAATCCCTC AACACACTTC TGTTAATCGG     19500
     CTTTACCGTA GCCATGATCA GTAACACGGT CCTAGCAAGT ATTGTATGGA AGGCCTACTT     19560
     CAATAAAAGC CGCACCGTTG TGCCACCGAC CATCAGCGCA GCTTTTACCG TATCAGACAC     19620
     GTCTATAGAT GAACCGTATT TACAGCAAAT GGCCGAATAC TTTGCCTTTC TAAAGCTCAA     19680
     TGTCACGCCC ACTTCGGTAG ACCATCAGTA CAAACAGCTC GCAAGCTATA TCGATGAAGC     19740
     TGATTGGCAT CAGATGCAAC CTTTACTGGT TGAAGATGCA GCCATGATTA AAAAACAAAA     19800
     CATCAGCAGT CACTTCACCA TCAATGAAAC CCAAATAGCC CTTGATGATC GTCTCGTCAA     19860
     AATAACGGGC ACGTTAAACA AATATGTCGG CAAACGCGCG CTAGAACCCG AAACCATCAG     19920
     CTACATCATT GCCATGAATT ATGACCATGG CCAACTGTCG CTCAAAGCCA TTAAGAAAGT     19980
     GCAAAAGGAC GTTAAATAAT GAAGATTACT AACCCACTTG TTTTCGCAGC CTGCGCGCTT     20040
     TTTCCTATGA GCGTGTTAGC GGCAAATACG CCCCCAAAAC ACTACGGATT CAATGACAGT     20100
     GAAACGGTTC CTATTGAGCT GTCGAGTGTT GATATCAACC GCTTAGTCGT TGAAGGTGAC     20160
     AAAATCACCT CGATTGATTG TCCAGAAGGA TTTTGCGTTG TCACTGGCAC GAAATCGGAT     20220
     AAATCCGGCG CTGCGCGCGT CAATCTCAAT CTGGCCATGC CATTCACAGC CTATGTATCA     20280
     ACTGAAAAGG GCAGACATTT CGGCTTATTC ATCAGCCCTA AAGCCATTCC TGCCGTGACC     20340
     TCTATCTTCA CTGCAGAACA TTATCGCGAA GAACAACCCT CCGTTTTCGA TAAGAAAACC     20400
     CCGTACCCCA CCATGATGAC CGAGTTCACC GCGCAAATGA TCCGCTACCT CGCCACGGGT     20460
     AAACCGATTG ACGGTTATCG TGTGCATGTC GTCAATGATG ACCTTGAACG CACCACGGTA     20520
     GACAGTGAGC CTAGAGGCAC GGAAACATCT ATCGATGACG CGATGTTTAT TCGCTTAAAT     20580
     GAGCAAATGC CCAAACCAGC AGGACTGACG ACAGAACCTG CTTTCGTGTT CACTGGTAAG     20640
     CATTTCAACG GCATCATTTA TCGCGTAACC AATCACGCAG CACTCCCAGT CACCCTCACC     20700
     ACAGCGCAGT TCTATTCCCC AACGACGCGA GCCGCTGCCT TATCAACCTA TGAATTAGCA     20760
     CCACAGCAAA CGGGCCACCT CTTTGTTGTC TCGGGCGGGG AGAGCATGCA ATGAAGCAAC     20820
     TCCTAGACTA CTTCAAAAAA GATCCCGAAG CCGACTTTGA GCAAGGCAGT GCGTTAAATG     20880
     AAGCCAATAA AAAACGCAAT TGGGTGATTG CAGGGGTGGG GGCCACGGTA CTCGGCGCCC     20940
     TCTATTTAGC GGGCGACGCC TACATGTCTG CCCCAAAACG TGCCCCTGAA ACCGCAGCGG     21000
     GCAATCCTAT CGATTTTGGT GCCGTGATTG ATAAAGATTT CACCGAGAAA GACAATCAGT     21060
     CTGCGCTCAC CGCACAACAA ATTGCCTTAG ATAAGCAGCA GAAAGCGATT GATAAAATGC     21120
     TGAAAAGCAT GGAAGCCATT GAGCGCAGCA ATGAAGCTAA TCGCCTTGAT TTAAAGCGTA     21180
     ATTTAGAGAC GTTCCAACTG ACCGTGTCTG AAAAAATTGA TGATAAGATT AATGCCGCTA     21240
     CCGCAAATGC AATGCAGCAT AGCAATAACA ATGTCACCGA TGAATTTTCA ACACAGGGCA     21300
     TCGATGCATC AGCCTATCCC GTTAGGCAAA GCACCCGCTA CTTAGGTGAA CAAACGCTGC     21360
     CGCCACGCCC GAGCGTAGGT GACGGACAAA GCTATTCTGC CCCCTATCAA GGCGGCGCTA     21420
     TCCCGCCACC TGCAACCCAA AATGGCATCG ATTCCTTTGC ATTAAATTGG GAAACGCCAG     21480
     ACCAAAACCT GCCAAAAAAA CGCACCCCTG AGAACTATGT TCCTGCAGGT ACGTTTGTCA     21540
     CGGCTGTCGT TACGGGCGGC GCAGATGCCA ATGCGGGTGT GAATGGCCAA GGCGATACGG     21600
     TGCCGATGGT ATTCCAAACC ACTAACCAAG GTGTACTCCC TAACGGCAAG CCCTCAAAGC     21660
     TCAATAACTG CACGGTTCTC GGTGCAGCTT ACGGGGAAAT CTCATCGAGT CGCGGCATTG     21720
     TGCGCACCAC TCGCCTCAGC TGTATTTTTG AAGATGAAAT CATCGACATT CCCGTCGAGG     21780
     CGACCGTATT TAACTATGGC CGCAATGGCA TTCGCGGTAC TGCCATTATG AAGAACGGCA     21840
     AAATCGTTCA GATGGCAGGG ATTAGTGGCA TTTTGACGGG CATTGGTGAG ACAGGTAAAG     21900
     CACTGAGCCA AACCACATCG AACTCAGCGC TAGGGTCAAC TTCAAGCGTC AATGGGGCCG     21960
     ATGCGCTGCT CAACTTAGCC GGCAGTGCCA GTTCAAGCGT GGGGAGCAAG CTCGCGGATT     22020
     ACTACATCAA ATTAGCTGAG CAATACCACC CGATTATTGA GCTCAATCCG GGCAATACCG     22080
     TCAACATCGT GTTTTTGAAA GGCTTCCCAC TCGATCCGGT TGGCATTCAA GAATACGAAG     22140
     AGGCGCTAGC GCAACAAGCC CAAAATCCTG TCAGTGCCAC AGCGCAAATC CTCAACACGA     22200
     TCAGCAACCC ACTGTTAGAA CAGATGCCAG GGAATATTAA GCCGCAGGCC CAAGGCGCAA     22260
     ACACGCCTAC ACCACAGCAG CAATATAACC AACAAGGCCA ACGCCCTCCT GTTAACTCAG     22320
     CCTTTGGCCG TGCGAATTAA TTCATTTAAG GAGTGACATT TTGAACCCAA TCATGAGCAA     22380
     AAATGCATTA CGTAACACCG GTATTATCGC ACTGGCTTCA TGGCTAGTGA GTGGCTGTGC     22440
     AGCAGGGCTG GATGGTGACT ATTCCTGCGA TAAGGTGGGC GGCATCAATG GCTGTACCAA     22500
     TATGATGGAA GTGAGGCAAC TCACTGACAG TGGTGTGTTC AATCAGCCAC AAGCACAAAG     22560
     CCCTGCGGTG ACGGCCTTAA GCGGCCAAAG CACAACTGCA CTTCCCAAGC TCGCGAGCCA     22620
     ACAACAAGAC TTTATCCCAT TGCCACGCCG CGACCGCCAC GGTGTACCGC TGCGCACCTC     22680
     AGAGTCAGTC CAAAAAGTAA CCATCTTCCC CTATCTCAAT GAGCAAGGTG ATTACGTTGA     22740
     TACCAGCGAC GTGTACATCG TGGTCGATAA GAGCCGTTGG ACGGGCAGAC CTGCCAAATA     22800
     CATCAAGCAG GATTAAGCCA TGAAACAACG TATTAAAAAC GATCTCGGCG CACTGTATGC     22860
     CAGCAGCAAA CAGCAGCACA ACCATCTGCA TCATGAATTG CCCTATCGCA TTTATGATGA     22920
     TGCTGAACAA GTCTTTGAAA ATGCTAATTC GCTTGGTTTT GGCTTTGCCA TTTCGCTGTT     22980
     TGGCGGGGCG AATGACGACT TGATCAAAAC CATGAACGCC TTGGTGTGCA CACTGCCAGA     23040
     GGGCGACAAA TGGCATTATC AATTCGTCAT GGTGGGTAAT AATCAAGTCG GTGAGCTCAT     23100
     CGAGCAAAAT CAAGCGCTGC TCAGTGGCCG CAATGCCATT TGCGATAAAT TTGCCTCAAA     23160
     TGAAGCTATC TATGCCAAAC ACAGTTCGAT CAAAGGCTTT GGCACCAAGC TAAGCCACGC     23220
     ATATCACTAC GATTTAAAGA ACACCAAAGG GTTTTTCTTT GTTTCAACCA CCGAGGACAT     23280
     GCCTGCACTG CTGGATATGC GCCTTGGCAT TGAGTCAGAG TTGGCGCAAA CAGGCATGCA     23340
     CATTCGCCGC TTAGCCGCTG ACAGCCTGAT TGAGCATTGC CGCGAACACT TAAATTTTTC     23400
     GCATCAACAA GATCGCGTTT CGCCCGCTAA ATATAACGAG TATCAACCTC TCAACACCCA     23460
     AATTCTCAGC CCTGACAGTG AGTTCATCAT TAACCGTGAT TCGGTCAATA TCCGTCACAC     23520
     ACCGATGCAA TCAGACAACA GTGTCGATAC CACCTTAATC AATCTTGGGC TAAAGGGGCT     23580
     GCCGAACGAC TTTAGGCTGT ATGCGTTTCC CAACTGCATT GCATCACTCA GTTACACCAT     23640
     GAACAGTGTT CAATGCCCTT ACCGTGTCAG CGTGTCTTTT TATATTAATA AAACCGGCGA     23700
     GCAAACCACC CGTAACGACA GCAAAATTGG TTCTCTGACC CAAACGGTCG GCTCCCCTAT     23760
     GCGGTTGTTG ATCCCCAGCG CCGCGGATGA ACTGGCTGAA CGCAAGGAGA TACAAAAAGG     23820
     ACTCGGCTTA CACGAGTTCA AAATCACCAC CATGACATTG AATGTCACCC TGTATACGAC     23880
     AGAAGCGAAA CAACGCCATG ACACAGCTAA AGCGATTGCG ACCTTCCGTA CAGCAGGCAT     23940
     GGATTTAATC CAAAACAATA AACTGCAAGG CATGTGCACC CTGTCCACAC TCCCGTTCTC     24000
     AATGAGCGAA GGCTTTATGA AAGACAGCCA AAAAGCGGGC CTGTGTTTCA TGATGAAAAC     24060
     CTCAAACTTG GTAAACTTTT TACCGATTGT GGCTGACTAC AAACGCTTAT CCGCAGGGTT     24120
     ACTCTTGCCA ACAATGCGCC ATCAAATTAG CTATTTCGAT CCGTTTAACT GCGGCAGTGA     24180
     TAACTACAAC ATGGCGATTA CGGGCGGCTC AGGGGCAGGG AAGTCATTCT TCATGCAAGC     24240
     CTTGGTGAAA TCTATTTTTG CCAAAGGGGG CAAGGCATGG ATTTTAGACA AAGGCCAAAG     24300
     CTATAAAAAA CTCACTCAAA CATTAGGCGG CGTCTATCTC GACAGTTCGC AGATTTTCCT     24360
     CAACCCGTTT ACCCACTTGG GTAAAGTCCA AAGCGTGCGG GATGCGGGCA CCTTTGGCAT     24420
     CATTTTAGAC GATGAAGGAC AAGTCGTTGA CCCGATCGCC GCAGTATTGG GCAACATCAC     24480
     CGAACTTATC GCCACCATGG CCTCACCGGA TGAAAAAATA TCTGGGTTTC AAAAAGCGAT     24540
     ATTGGGTGAC GCCATTCTAC TCGCGTGGAA AAAGGCCGGT AACGACACGC TGATTGACGA     24600
     TGTGCAAACG GCACTCTATG ACATTGCCGC ACAAAAAAAT GACGATACCC GTATCAGTGA     24660
     TATCGCTGCG CAATTAAACA AGTTCTGCTC ACAGGGCATT CATGGCGCCA TTTTCAATAA     24720
     GCCCTCGATG CTCAATCCCA ACATCGACAT CACCACGCTG GAACTCGATG GATTTAAAGG     24780
     CGAGCTACAA CGTCCGGTGA TTTTCGCGTT GATGGTGGCG ATTAGCCAAC AAATGTACTT     24840
     ATCGGGCCAA CGTTCTACAC CCAAAATCTG TGTGATTGAA GAAGCCTGGT CACTCATGAG     24900
     CGGCGCGAAT GCGCAGAGTA AGGATTTTAT CGAGGAGGGT TATCGCACAG TGCGTAAGTT     24960
     CGGCGGCAGC TTTGCCACAG TAACGCAAGG CATGAAAGAC TTCTTTGCCA ACGCAGAGGC     25020
     CGAAGCCGCC TATAACAGCT CAGATATTCA TATCACCTTG CGTCAAGGCG AAGGCTTTGG     25080
     AGACTTCTTG AACAAGCATC CTGACCACTT CTCGCCGTTT GAACAATCCA TGATCAAGTC     25140
     ATTCCCCCGC GCCGATGCGG CGGGCCATTC CTGCATCATG CTCAAAGCGG GTGGGCTAGT     25200
     GTCCTTTCAC CGGATTTTTG CCGATCCATG GTCGCGCGCC ATGCTCTCAA CCGAGCCTAA     25260
     AGAGTTTGAA TATTGCGAAA ACTTGATTAA GGGCGGCATG CCGTTACTCG ATGCCATTGA     25320
     ACTGACAGCC CAACATTTCT ATCCCGATGA TATGGCCCGC TTTGATGCCA TTTTGTCCGC     25380
     CGCAGCAACC CACAAAGAGG CCGAATAAAA TGGAAAAAAC CATCATACAA TCAATTTTAT     25440
     GGCTGGTGAC GCTGGGCGTC ATGATAACCC TCTGGGTGAC GCGCGAACCC CGTGTTGTCG     25500
     AGTATGACAT TAACGAAACC GTGGCGAGCT TTCACCAATC TATCGGTCAA AGCGAGCTAT     25560
     CCGACGAACA ACGCGAAAAA GAAATCACGC GATTTACCCA AACACTCGAT GATGTGGTGC     25620
     AGCAATACGC TCTGGATAAT CATGTCGTGG TGTTAGTCAG CCCCGCCGTC GTCAGTGGCG     25680
     CCGTGAATGT CACCCAAGAA ATTCAGCAGT CACTACTGCA AACCCTTCAA GCGCAAAACA     25740
     AGGCGAACCG CGCCCAAGCG AGCGAGGTCA CGGCTAAATG AATAAATTCG CGCTTCTGAT     25800
     GCTAGCGCTA TGCCCACTCT TACCACTCAA GGCTGCGTCC ATCGGCACCG TGGGCCAAGT     25860
     GTTCCCCATA GCTGAAATTG ACATGCTGCA GTGGATTGAA AACCGTCTGC AAACCTTAGA     25920
     AAAAACGGGT GAACTAGACA GTATGCGCGA GCAATTCCAA GAGAATGTCA AAGCCGGTGT     25980
     TAAGCGCCCT CGTCCAGTGG GACTTATCAC CACTAAAACC CCAGAAGTGT TTTTAGTCGA     26040
     TCCCACTTTA ACGCTGGCCA AAGATATCAA TGATGCTAAT GGCAATCTGA TTTATCCCAA     26100
     AGGCACACGG GTTAATCCAT TTGATACCAA AACATGGCCA GCATTGCAAA AGGCCAACGT     26160
     CGGCAAGTTT GAGTTCAGTA AAACGCTGGT GTTTTTTGAT GGGGATGATG TGCAGCAAGT     26220
     GTTATGGGCC AAAGAGTTTG CAACAACCCA TGAAAAGCAA CACATCAAAT GGATTTTAAC     26280
     GGGCGGCGAA CCCGAAACAC TGCATGGCCA ATTAGATGCG CGCGTTTACT TTGACCAGCA     26340
     AGGAAACCTC AGCCGCGCCT TAACACTTAA GCGCGTGCCG AGTGTCGTTA AGCAAGCGGG     26400
     GGTGATGTGG CAAGTGCGCG AAATAGATGT GTCCAATTTC CCTGTATTCA TGGAGGAAAC     26460
     AAACCATGCG ACACATTAAA CCTGCGTGGC TTGTAGCATT ATTAATGGGA GTCATTCCCG     26520
     CACAAGTCAA CGCGCAAGCG GCCTGTACGG GTACGTTCGT TAACCCGATG ACCGACATTT     26580
     GTTGGTCGTG TATCTTCCCG ATGACCATTG GCAGTGTGCC TATTATTCCT GGGAGCCTAC     26640
     CCGATACGCG CAACCCCGTA TCACCCATTT CATTTTGTCC CAAACCGCCG CCTATTTTTA     26700
     TGCAAATTGG CTTGAATATC GGCTACTGGG AGCCTGATAC CTTAGTAGAC GTCACGCGCG     26760
     TTCCTTACTG CATGGTCAAC ATGGGCATGA AGCTCGACAT GAGTAATTCC CCCCAAATTG     26820
     GCGGCCGCGT GACCAGTCGC GATAACGATG CCAGTGATGG CGCGTTTTAT CATGGGCACT     26880
     GGTACAAATA CCCTGTGGTC TATTGGCTGC AAATTATGCA AAGCGCAGCT TGTATGGCCA     26940
     CGGACAATTT CGACATTGCC TATTTAACAG AGATAGACCC ACTGTGGGAT GATGACGAGT     27000
     TGTCTTTTAT CCTCAATCCA GAGGCGATTC TATTTGGCAA TATCGTGTCA CAACTTGCTT     27060
     GTGCCACCGA AGCCGTGGCC ACCTCAACTA ACAGCATATT GCCCTTTGAT TTTCTGTTTT     27120
     GGTGTATGGG CTCACAAGGC AGTGCTTACC CCCTGACGGG CACCACCAAT TACCGCGACA     27180
     CGCCCATTCA GGCGGGTACG TTGATTTTAG AACGCCTGAA CTACAAATTG CATCGCCAAG     27240
     GCATCGTATG GGAATCCCAC GGTGAAGACG GCGCGATTTG CTATCAAACG CCGATGCCCC     27300
     TCATCCCCAA ATCCCGCTAT CGCTATCAAA TGACCAACAC CATACCCGAT GCGCTTTGGG     27360
     GACACCCGTA CACCACCACA ACGGTGATAT GGGAAAGTGG CCACGACAAC CCTGTGTCGG     27420
     GTGACAACTT TGGTTTTATC AACTTCAAAA AACGCAATTG CGTGTTTTTG TGACCAATAA     27480
     GGAGAGGGAT TTTCGATGAA AAAGTTTGAG ACCAAATTAC CAACAATTTA TACCGAGTTA     27540
     TGCACAAAAA TTGTGCATAA CTCTCTATTT CCACAATCAT TCAAGGGATT AGCCTTACTG     27600
     CTGAGCTTAT ACCTTGGATC AATTTCACCG GTATTCGCCC AAACGGATTA CAGTATTGAC     27660
     GAATTAACAG CGCTGTCGAT GCGAGAACGC CATACATTAC CACCGCTGAA CCTCGATCAA     27720
     ACCGCGCTGT TTGATAAAGC CCGCCAGTTC GAAGCGCAAA GCAAAGGCCA ATTAGACAAC     27780
     GCACTATCAC CGTTGCTCGA TGCCAAGCCC AACCCCAGCG CCGATGCTAA TGGTGTGATG     27840
     GTATTTGTGT CGTTGGGTAT GCCTGCGACC AGTTTGCAGC AGTTACTCAT GCAAAGCGCA     27900
     GACTTACAGG TGCCACTCAT TGTGCGCGGT GTACTGCCTC AAGGCTTTAC CGCCACCGTT     27960
     AAACAGATGA ATCACCTTAT CGATAACAAG GGTAAAACCA TACAGAGCGG TTTTGCGATT     28020
     AATCCCCAGT GGTTTACGCA ATTCGGCATT ACCCAAGTAC CCGCCTTTGT TGCGGTAAGA     28080
     CCCAACAAAT GTCAGGCAAA ACAGCCCTGC AGCAGCGATG ACTTTGACGT GATTTACGGC     28140
     AACGTTTCGT TGTATGACGC GCTGAACTTA TTGGCACAAC ACGGCAGCAT TCCCGATGTG     28200
     GCAGCGAAGA CATTAGCAAA GGGGGCGAAA TGACTCAGTT GAATAATGCC TTAATCCTCA     28260
     GTGCCATCCT CACATTGAGC GCCGCCTTGC CTGTTGTGGC GGCAAACAGC GAAAAGGATT     28320
     ACCGCGATAA TGTGCAGTGG GCCAAAGACA GTATCAAGCA GAATCAGAAC AAAGCGGGTT     28380
     ACACCGGTTT TGACGTTAAC AGCCTATGCA AAGATGCGAC ATGCCAGCAA GAAGTCGCCA     28440
     ACCCGAGCGA AAGCCGTTAC TACAACAACC CGAGCGCCAT GGACAGTGCC AAAATGCAAG     28500
     GCATGAGCAC GGATGGCCAA GCCCAAGCCG TGACGAGTGG CTTTAATAAT GGCCGCCCGA     28560
     CGATTGATGA AAACGATCCG GCATACCATA CCGCCGTTGG CTATCAAAAT GATGCTTACA     28620
     ATATCAGCCA CGGCATTTCA TCTAAATATC ATGACTGTGA AAAAGGGCTC GTTTGTGAGG     28680
     TCGATTCTCA GCCTCGTTCT TGCACGTTAC CCACCAATAA TCCGGTGCAA TGCTACCTGA     28740
     CGCCATTCGT CAAAAGCACA TCAACGCAAC ATAAAGAGCA TACGTTTCGA TTGAGTGGCC     28800
     TACCGCCATT TTCGGTTGAA TTGCCCAACC CTGACGCCAT CATTACGGGT CTTCGCTTCA     28860
     ATGGCGGCTT CTTGAGTTGG GGTAATCCTA TTTCGGTTGA AATATCACTG AATAAGGTAG     28920
     TCATTGGGAC TGTGCCCGTA AAAAAAGAAG CCGGTTCTTG TGACCAAAAT GGAGCTTGCC     28980
     CCTCTTCCGT CAATACCTCA CTCAATGCTA GCCACTACCA AGGCGGAGCT GCGCCGATGA     29040
     GTGTCAACGT AGGCACTATC TTTGGCTCTT GGGGTTGGCC ATTTTATCTG AGTGTAACTA     29100
     ACTTTCCGAT CACATTTATT ACCACCGAAA ACAATGTTGA AATTGGCTAC AACAACAGTT     29160
     GCGGCGCAGT CCTCCCCGAG TGCCAACAAG TCCAATCTCA ATGCGTAGAA GGTAAAGAAA     29220
     CACGCATGAT TAATGGGATA GCCGTGACAT TGGATTGCTG GAAAGAACAA ACCACCTATC     29280
     AATGTGCCTT TCCCAATACC TGCACCACCC TCGCAGATTG CAGCATTCAA TCGACCAGTT     29340
     GTGACACCCA ACTTGGCGGC GTTTGCATTA AAGATAAACA ACAACGCCTA TGTGATAAAC     29400
     AGCAATGCCG TGATACGGGC CTTATCTGCG GTGCAGACAG CTTTGCGCTC AGTGGTGACT     29460
     ATTACGATCC TGCGGCCACT CGCAGCACTG ACTTTAACCA TGCTGCGGCA GGACTGGCCG     29520
     CCGTCAGTGA CGCAGCCGGT GATGTGAAAG ACAAGGCCAA CATCAACGAA AACAGCGCCA     29580
     TCATTTTCAA AGGCAACATC ATGGAGTGCA GCGATAAAGC GCTGGGGATC AGCAATTGTT     29640
     GTCAGGACAG CGGTTGGGGT AACGGCATCG GCTTAACGTC CTGCAGTGAA GAAGAAAAAG     29700
     CGCTGGGTAC CGCAAAAGAG GACAAGCTCA CCGTATCACT TGGCCAATAT TGCGCTGAGA     29760
     AAGTGCTTGG CGTGTGTATC CGCAAGAAAA AAGCCTATTG CGCGTTTGAT AGCAAGCTCG     29820
     CGCGCATTGT GCAGGTTGAG GGCCGCGCGC AATTGGGCAA AAACTTCGGC AGCGCTAAAC     29880
     ATCCGGATTG CAGCGCCTTT TCCCCTAACG AACTGCAACG CATTGATATG TCGTCAATGG     29940
     ACTTTTCTGA TTTTTATGAA GACATGTACG ACGCCATCGA ACTGCCTAGC ACTGATGAAA     30000
     TTCAAAAACG CTTACAACAG TCGGTTGGAG GAACCAAACC ATGATGACGT GGTTAAATGA     30060
     CCGCTTACAA CATGCCGCAG TATCTCCTTT TTTTCGGTGG TCAAGCCGCG CGCCGTTGGC     30120
     GTGGTTGTCC ACAAAAAAAG GGGATGCGGT GGTCAACAAG CGCAGCGCGT TAGTGCTCCT     30180
     TATGCTGACA ACGTTTTGCC TCGGCGCAAA CGCCACGGAT GCACAAGGCT GGCGCTGGTA     30240
     TAACGAACCG ACCGCCCCCA AGAAGCAAGC ACCTAAAAAG GCCGAAACGC CAAGCGTCAC     30300
     ACTCACGCGC ACCCAAACAC TGACGCCCAC AGAGCAGATG GATTGGTTTC ACAGCTACTA     30360
     CCAAGACACG CTCAATGACG CGGCGATAAA CAGCCAAGAC AGCAAGAAAG TGGAAAGGGC     30420
     CATGCTGCTT AATCAGTACG TCAGCAATAA ATCCTCAGAG TTCGGCATGA CCTTTAAAAA     30480
     GGTCCTGCTA GATAACCCTG AGCTGTCTTA CACCAAAGAT AGACCGACGG AACAAGCGGC     30540
     AAGAAGCACC TATTTATCAT TAGAGCGCAA CAAGAAGATG CGCGCAGTAC GCAGCCTTGC     30600
     CGATGCGGGA TGGGGGCTGT TCTTTGTCTA CAAAGGCCAA GAAGAAATGG ATATTGCGCT     30660
     AGCGCCCAGC GTGCAGCAGT TCGCTACTGA GCATGGCATT GAGCTACTTG GCGTCACGCT     30720
     CGATGGTGTC GCACTGCCAG CCATCGTGCA GAACCGCCAA AACGACCAGC ACATAAACGT     30780
     CCCGTTTAGT CCTGCACTCG TGTTAGTTAA TCCTGGCACG GGGGAAATGA AACCGCTCGC     30840
     GTATGGCTTT ATCTCTCAAG ACGATTTACT GGGCCGCTTC CTGAACGTGG CCACCGATTT     30900
     CGCCCCTGAC TTTTAACGCA TAACACGACT CACTTAAACA AGGATTTCCC CATGAGCCTG     30960
     AAAAACATCA CCGACATGAT GCTCAAAGCC ATCAAGAGGC AGAAACTACC CTGCCTAACC     31020
     CTATTCACCT TCACATACTG TTTTGTGTTG AGTGCAGTTT ACGATATCAA CGGCGCCCCC     31080
     TTTCTCACCC TTTGCACCGT CGTATTCGGG GCACTATTCA TACTTTACCC CATGATACTC     31140
     TCCCCTAAAA ACGCGACTAT TTTGATGCCA AGACACCTTT TCAATCAAGG CAGTCAAACA     31200
     CGTCCATTAG GGATAATGCC GCTCGCATTC ATGAGCCTCT TGAACACTTT TCCCAGCTTA     31260
     ACCGCAACGC CCGCCATCGT GTTGATGTCG ATATTCAGCC TCATTTACTG CATTGCCAGC     31320
     CTATTTTTCG CAACCCTAAC ACTCGAAGAA CAGTTCAGTG CAGACCACGC GAACAAAACG     31380
     AGCACCCGCT TAGCCATTGA GATGCTAGGA TTTGAATTCG CCCCAGAGGC CATGCAACCG     31440
     CCGTCGTCTC CGCTGCAATA TTACCGCGCA CTCTCAACGC ATCATTTAAT CGCTTATCAC     31500
     GCACTCACAA GCCTTATCAC GCTCATCGCA CTATTGATTT TTATTGGCAC ATTCAACACC     31560
     CCTTGGGTTG GCGCGTTGTT GGCTTTGGCC GTCATAAAAG CCAGTTTAGA ACTGCTCTTT     31620
     TTATCGTTAG GCCAGCCGCC CACAGCGCCC ATATCCACAG CAAACATCAC GACTGAGGTG     31680
     ACACAATGAA ACAACTCACC ACCCTGATTA TCGGCATCTT CACGCTACTG TTATCATCCC     31740
     TTGGCCACAC AGCAACGATG GATACGCCTG TTGCGGCCAA TCCGAATGAT TACGCGTTAG     31800
     TGTTTTTCTT TCGCTCTGAT TGCCCGTTTT GCCACAAGTT CGCCCCGAAA CTGAAACAGC     31860
     TTGCGGCGCA AACTGGCACC TATACCTATG CCTTTTCGCT CGACAACCAA GGGATAGCAG     31920
     GTTTTGAAGT ACCCATTCCT TCCACGCCAG ACATTGCCGC CACCTTCTTT GAGAACCCGC     31980
     GCAGCGTGAC AGTGCCCGCC ACATTTTTAA TCAACGTCAA TACCCGTAAG TTTGTCCGTT     32040
     TAACGGTCGG TGATGTGACG TCCTCGCAGC TCCAACAAAG CTACCTTCAA TCCCTCAATG     32100
     ACCCACAAGT CATTGCAAGC ATGCGTTAGG AGCAACCTTC ATGGACACGA TGTTAATCAT     32160
     CAATATTTTA CTGGCCCTAG CCATTTATAA ATTCGTACTC GTCCCCGTGC ATGCATTGTT     32220
     AAGTGCCGTT TGCTTGCGTG CGCTACGCGC ACTACACCCG CGCCATAACG GCAACATAAG     32280
     CGGCAATACA GGAGGTAAAT CATGAAACGC TTAGCACTGA CGCGCACACT ACTGGGCGTT     32340
     ACTATTTCAT GTTTGCTGAC AACCCACGCT TATAGCGCGG GGGTTTCAGG TTCACTAAAC     32400
     GATTTTTTCA ATGGCCTAGG CTATGGCACT AACGTGACCA ATCCGGGCTC ATTCAAAGGC     32460
     CAAAGCGCCA ACTACTACAG CGGCGGCAAT CTCTTTGTGC GTAGCCCCAT TCGCGACGCG     32520
     CAGCTCGTGA GTGTGCAAAT GCCCAGCATT GCCGCAGGCT GTGGCGGTAT TGATATGTTT     32580
     ATGGGGGGAT TCAGCCACAT TAACTCTGAC GCCCTTGTGC AACAAGGCAA GGCTATTATC     32640
     GCCAACGCTG CACCGTTCGC CGTCGATTTA GCCCTGCAGA CGTGGGCACC ACAAATCAAA     32700
     CAGATTAAGG ACACGCTAAC GGCCATTGCT GATAAGTACC TCAATCAGTC GATCAATTCT     32760
     TGCGAGAGTG CCCAAGCGGG TGTCTCGGCG CTGGCGGGGT TTGCGGGGGT TGGCAGTCAA     32820
     AAATACATTT GTGCCACTAT GGGCACGCAA AATAACGCCT TTGCGGATTG GGTATCTGGC     32880
     CAGCAAGAAT GCGGCGCGGG CGGTCAAGCT AACAATCAGC TCGATAACGC CAAGAAAGAT     32940
     CCCGCACTAA AAGACATGGT GCGCAAAAAC ACCAATATTG TGTGGGCCGC CATTTTAAAA     33000
     AATACCTTCC TTGCCAGCGA TCCGACCTTG GCAGAATTTC TCATGTCGAT TTCGGGCACG     33060
     TATATCTATG ACGCGACCGG CAATGCGCGC GGTTATGGCT CACTGCTGAC CGACAACAAT     33120
     AACCTGATTA ATAGTCTGTT AGAGGGCGGC AAAGCCGAAA CCTATCAGTG CACCAATCAA     33180
     GCCATTGACC AATGCTTAGC ACCGACACAA CAAACGATCA CCATCCAAAG TAATCACGGC     33240
     CTGCAATACC GCGTGGAAAC CTTACTCAGA GGTATCGCCA GCAAGATGCA AAACGACCAG     33300
     CCACTCACAG ATAACGACAA GTCGCTGCTC GAATACACCA CACTGCCCAT CATGACCTTT     33360
     TTACGCACTG AACTAGAAGC AGGACTCACG CCCCAAACCA ATACTTACGC CAAAATCATC     33420
     AGCGTGCAGT TTATTACCCT CTATCTGCAA AACATGCTGT CGATTGTGAA GTCCTCTATC     33480
     ACGGCAACCA ACAATGATCC CAAAGACATT GACCGTATCG AGCGAGACAT TATCAACGCC     33540
     AACCGCTTTT TAGAAGGACT CACCGCTAAA GCTCAAAATG AGGCCGTATC GCAGCACCAG     33600
     CTCATTATGC AAAACCAGCA AATCAAACAG CAAATAACCG GCGCCATGAG CGCTAAAGCG     33660
     AAGGCCAACT TGAATTTTGG GAAACGATAA CCATGGCAGT TGAGATATTT ACCTACAGCA     33720
     ACGGGGACGT GGCCAAGCAA GTGATGAATG CCATTGCCGT GCTGTTCAAG TCCGATTCAT     33780
     TTGCCAGCAT GATAAGCATC TGTGCGCTGT TTGCCGTGGT GGCCACCGCA CTGCACTTTT     33840
     TCATCAAGCG TGACCATAAC GCGATTATGA AATGGTGCGC GGTTTACTTT GCCGTGCCAT     33900
     TGCTTGCCAT GAACACCACC GCCACAGTGC AAATTACCGA TTTAACCAAT CCGACGGGTA     33960
     ACTATCGCGT GGACAATGTG CCCGCGATTG TGGCGTATCC GGCCTCATGG GCATCGCATT     34020
     ATATGTATGC CACCACCCAA ACGGTGGAAG ATATTTTTCA CGTACCGGAC GATCAACAAT     34080
     ACAGTAAAAC GGGCATGATG TTTGGCTCTG AGCTGTACAA GTTATCCAGA CAAAGCGAGA     34140
     TAGAAAACAC CCAACTTAAA GGCTATTGGC AGCACTACAT CAGCAGTTGT ATTCGCGGAG     34200
     ATATGCTACT CAATCATAAA TACACATGGC GAGATTTAGC CAATGCGCCG GACATTTGGG     34260
     ACTTTCTAGC CACTCACAAC CCTTCGCCGC TACGGGCGAT TCAAATGGGC CCTAATGACT     34320
     ATCCTACCTG CAAAGAAGCC CTTCCGCGCC TCAAGCAACT TTTCCAAGCT GACAGCGCAA     34380
     AAAGCATCAA GTTACTGGGC AGTTGGATTT ATGGTGAAAA GGCCAAAAGC CAACAAAGCT     34440
     TTTTGAATAC CAGCATCAGC AGTGGTTATC AAAAGTACGC CAATATCAGT CAAAGCGCGT     34500
     CGCAAATAAC CTTGCAAAAC ATGACGATTA ACGCCCTGCG AAATGGCCTC GCAGATGATG     34560
     CAGCGGTGAG CAACAACACC GCCGCCGCAT TCAACTACGC CTATACGCAA AACAAAATGC     34620
     AAACCACATC GATGTGGGCG GGAATGGCCC TGCAGGCGCG GGAATTTTTG CCCATGCTGC     34680
     AATCAATTTT GTTTTTGCTG TTTAGTTGTG TCGCCTTTTT AGTGGTGGCG ATTGCCATGA     34740
     TCCCCTCACT CACGTTTCAA GTGCTCGGCA ACTATTTCAA AGGCTTTATC TACCTTGGCA     34800
     CATGGCCGGT GATGTTTGCC CTCATTAACT TCATCATGAC CACGCGCTTA TCGCTTAACG     34860
     CCACTGAAAT CACTAACATT TATGGCGGGA TCACCTTAAG CAACGTAGAT CCCTTACAAG     34920
     AAATGCACTC CCGCTATGCC GCCATGACAG GCTTTTTAAT GATGAGCGTA CCGACATTAA     34980
     TTGTCCCGCT CATTATGAAA GGCGGCGCGT CGGTAATGAG CAGTATGTCG CATCAGTTCG     35040
     CGGGCATGAT GAGCAGCGTT AACGCGCGCA CCTCTGCGAG TGCGGCAAGT GGTGATATCA     35100
     ATTTGGGTAA CGCTCAGGTG GATAACTACA GCTACAACAA CACCAACGGC AATAAAATCG     35160
     ACACCACTGG CGTTGAACGA ATTCATGGCA ACACCAAGCA AGATGCAACT GGCTATGAGA     35220
     CCACCACCTT TGATGATGGC AGACAAGTCA TTAGTGGCCA AAATGCCTTA AGCCGTAGCT     35280
     TGCCTGTGAA CATCAGCGGC AGTGACATGG TGACGAACTC GGCCTCGCAA TCTGCCTCAA     35340
     ACGCGATCAG TGCGAGCAAA ATAGAGGGTA AACAAGCAAG CGAAAGTATC GCCACCTCCA     35400
     CGAATACCGC ACTAAGTCAA ATGAGCGGGG TCAATACCTC GAACAGTTAT GGCAGCAATA     35460
     GCGCCACCGG CGATAGCGGC ACCCATAACA AAGGCTTCGC AGATATGCGT AGTACGGTTA     35520
     AGTCTTTTGC TAAGGACTTC AACCTGACAG AAGACCAAGC CACAAGTACC TTATTATCGA     35580
     TGTATGTCGG AGCAGAAGCA GGGGTGAAAC TCGGCACACC TGGGAGTGGA TTTCTTGGCT     35640
     CTAGTGCGCA CGTATCCGGC TCTACCGGCA CTAAAGGCTC AACCGATGAT GTCAGCACAG     35700
     ACCGTACCAG TGAAAGCGAA CGTGACAGTC TCCAGCAAAG CTACCTTGAC CAGTTCAGCG     35760
     CTAACGTTAA CACCGTCAAA TCCTATAACA GCGGCGAACA AGCCAGTACA ACCAACAGTA     35820
     AAAACGAAGG TGAAACCCAA ACCTTCCTAC AAGGGCTTAA CGAAGCGATT ACCCACACCA     35880
     AAAACGCCCA ATCCCAGCTC ACCGAAGCCC AAAGTTACAC TGACCTCGCC AATAATGTCA     35940
     AAAGTGGCTC AATCAGTATT GGGCGTGACT TTAATCAAGA CTTTGTGGAG TTCGTTCAAA     36000
     ACTCAAGAAA AAATGGTGAT TTCATGGACG TGATCAAGGG GCAAACACCA GAAATGCAGC     36060
     AAGAGCGTAA CCAACTCGCA GCCGAGTTTG CCAACACTCC TAAAGTCAAA GCGATGGTAG     36120
     AACAATACAA AAACCATGAA TTACCGCAAA ACCGCGATGA CATTGTGCAA GCTCAGGAGC     36180
     GTTACGCCGC TGACATTGAT TTCAATAAAC AGCAATCACC ACAGTATGCC CCAGCGCCGC     36240
     TCAATGACAG CCTCTACCAA ACGGGCGAAT TTGAGCGTAT CCAAGGCCAT GCGGCGCAAG     36300
     GCAACGCGGA AATTAGACAA GATGTGTTGC ACGAAGAACA GACTCATAAC GCATCTAGCG     36360
     TCCCGAGCAT TGATATAGAA CAGGCCCGTG CTGACGCAAA AGCGGCGCAC GCCCTAATTC     36420
     CCTCAGACAA TCTAATACCA CCAGACAATC GAAGTGATGA TGAAAAAATG GCAGAAACAG     36480
     TGCGTCAATC AAGTCCCTTT AATACAGGAC CAAAAATGTG ATAATAGCCA TGACTTTCAA     36540
     TCACAAAGAG ATAACTTCAT GAACATCATT AAAACATTTG CACTGTTGCT GTGCTTATTA     36600
     AGTCCCTTGG CGCAGGCTGA GACGACTCTA TTTGGTCTCA CCTTGGGTAA ATCCACGAGG     36660
     CAAGAGGCAG AGCAAACCTA CCCCCCCCAA TACAAAAATA CCGCATCGGG ATTGCCTAAT     36720
     AGCTGGAATT ATTATCGGGT TGATGGCAAG CAGTTTAATG AGCCGCTGCT TAAGTATGCC     36780
     ACCCTCTTTT TTGATGACGC TCAAACATTA GGAAGCATCC TGTTTACCTT CCCAATCTCC     36840
     TTAGAAAAGT ATAAGGCGCT AGAAGAACAA CTTAGCCGCC AATACCCACG TCTTAACACA     36900
     GCCCCCTTCG TATCGGAACC ATTACGCCTT GATAAAGCCG AGTTTCAAAA TGACACCACC     36960
     TATATCCGAC TAGATTACAG CGATTACGGT ACTTACTTGT CCTTTACTGA CCTCAAGTAT     37020
     CGCGCTGCCG CCCAAAAACG CCTCGCTGAA AAGAAAGCCC TCGAAGCCAA TAAACCGAAA     37080
     AAGGAACCCT AGACGTGACC TTAAACCCCA AACGTACTAA AGGCAGTAAC TACACCCGTG     37140
     GTGGCCAGAT TTTATTTCAC AATTTGCGGA TGTTTTTGCA GATTAACGCC GTGCTTATAC     37200
     GCTGGACGTG TTATGGCGTG CTCATCTTAA CAGCGCTGCT ATGCTATCTC TTCCTTGATA     37260
     AAGACACCTT AACGGGCGCT TATTATTATT GGATAAACCA AACGGTTAGC GTGTTTAGAC     37320
     CAGAAAGTCA TGTTATGCAG ACTGAATGGC AAGGCACTGT CTATACCAGT ACGTTAGGAT     37380
     CTCAATTAGA AAACCCGATA CTGATTGCGG CCAACAGCCG CTTTTGGTTA TGGACACAAA     37440
     TTTATCTCCT TATAAGCTGT GTGATTGGCA TCGTTTTCCT GTCAGTGGCC ATGTGGTATT     37500
     TCAAGAAAAA AGGGGATGAG CAAACCGAGG AACACTTTAT TCGGGGGATG CAAAAAGCCA     37560
     CGCCGAAGGA ATTAGCAAAA CAGCTTAAAA AGGACAGGCG TCAGTCCGAT TTCAAGCTCG     37620
     ATGGCATCGG TATTTTCAAA GAACGCTTTG AAGTACAGCA CTTGTTACTT GATGGCACGA     37680
     CAGGCGCGGG GAAGTCCGTG GCACTGCGTA AGTTTTTAAC GTGGATACGT GAACGCGGCG     37740
     ACAAGGCCAT TATCTATGAC AAAGGCTGTA CCTTTGTCAG CAAGTTCTAT AATCCAGCAA     37800
     CGGACGTACT GCTGAACCCG TTTGATGAAC GCTGTGCCTA TTGGGATGTG TGGTGTGATG     37860
     CGCATGAACC CTCAGATTTT GAGAACATGG CGAGCGCGCT CATTCCCCAG CATGGTGAGG     37920
     GCGATCCATT TTGGGTGCAG TCTGCACGTA CCATTTTTTC ATCTACTGCA TTTAAGATGC     37980
     AAGATGAACC TAAAAAGAAC CAAACCACTG AACGACTGCT TGAACTCATG CTGACCAGCG     38040
     AGCTTGAGTC CTTAAGTGAG TATCTTAAAG GGACCGAATC GGCCTCACTG GTATCCGATA     38100
     AAATCCAAAA AACGGCGATA TCCATTAAGT CGGTTCTCGC GGCTTACATC AAATCATTAC     38160
     GATTCCTTGC CGGACTGGAT GAAAAGGACG AACAGGGAAA ACTCCTTCGC CGCAAATTTT     38220
     CAATTCGTGA GTGGGTGAAA AACGATGCCG AAAATGGCTT TCTATTTCTA TCCAGTAACG     38280
     CACAGCAACA TGCCTCACTG CGCCCCTTAA TTTCAATGTG GCTATCCATT GCCTCGACCG     38340
     CCATTTTAGA ACAAGACGAA AACCCCGACC GCAGAATTTG GGTGTTGATG GATGAAGCAC     38400
     CAAGCTTGCA CAAGTTACCT GAACTTGCCG AAACAATCGC CGAAGTGCGC AAGTTCGGCG     38460
     GCTGTTATGT CATAGGCATT CAGTCATTTG CTCAGCTTAA AAAAGTCTAT GGCGAAAATG     38520
     CGGCGCTTGA AATGTTCGAC TTGCTTAACA CTCGCTTATT TTTCCGCTCA CCCTCTAACG     38580
     AAATGGCCAA AATCTCGTCT CACGATTTAG GCGAGCAAGA AGTCGATGTC TCTAAAGAGC     38640
     AATACAGCTA CGGCGCTAAT GAAATCAGGG ATGGCGTATC ACTGGGCCAT CAAACCATTA     38700
     CCCGCCCTGT TGTCACGCCC TCTGAAATCA TGCAGCTTGA AGATTTACAA TTCTGGCTAC     38760
     GCACGCCTGG CAATTATCCC GTGGTAAGAG TGGATTTAGT CTTTAACCAA ATGCGCTCAC     38820
     TGTGCGCCCC GTTTATCAAA CGCAACTACA CCCCGTCTGA AAACATAAAG CAGATTGAAT     38880
     GGAGTCTGAA CTATCACCAG TTCAGTGCGG TTCAACACGT CGATAAGGCA GATAAAACCA     38940
     AGCTCCAAAG CATTCATGAC ACCATGTATG AAGGGGATGA AAACAATGAT GAACGCAGCG     39000
     CGGAAGCGCA GCGCATGACC AAACTTGCTG AAAAAACCGA TGCGGTCGCC CAAAGCCTCA     39060
     TCGATGCGAA AAAGGCCAAA CCGACTGAGT TAGCGCTCAA GGATGCGCAG AAGAAAAAAG     39120
     CCGCTGAAAA ACAAAAGGCC AATGACCAGC ACATTGAGGA TGCACAGCGA CTTGAAGAGC     39180
     AACAAATAGC CTCAGTACAC GAAGAAATAT CGCTCGACTA AAGGAGCTAA GACGATGACC     39240
     TCATTCAACG CCACGACACG AGTGCCCGAA TTGTCGGCGA AAAAGCCCTC ACGTAAAGCC     39300
     TCTAAAAATG ACCATGAACG GATGAACGTC ATGCGTCGAA TTGAAGCCAT CGCGGAACTC     39360
     AAAGCGCTGG GCTTCACGTC TGACGAAATC AAAGCTCAAC TCGACTCAGA ATAAACCTAC     39420
     CGGATTAGTT CACCTCGCGC CCCGCGCGAG GTCCTTCTAA AGGAATATCA TTATGCTTTC     39480
     CATCAGTCCC ATTGCGTCGA GCGCTGGCGG CGCGGCCAGC TACTACCTCA GTGAAGAAAA     39540
     GAACCTCAAT TTGCCTGACG TGTCGTTAGA AAAAGCAGCG GACGCCAAAG AAGGGGAAAC     39600
     CAACTATTAC TTGAAAGAGC AGAGCGCCGA GCCCAATACC CAATGGTATG GCAAACTGGC     39660
     AGAGCAAGAG GGAATGCTAG GCAAGCCCGT TGAAGAGCAT CAACTCAAAG AGGTGTTAGC     39720
     CGGTAGCCTG AACGACCAAA CGCTTAAAAC CCAAAACAGC AACGCCCGCA ACGGTTTTGA     39780
     CTTTACCTTT TCGGCGCCTA AATCCGTCAG TTTACTTGCA CTCGTGGGCG GCGATAAACG     39840
     CTTAATGACA GCGCACGATG ACGCGGTAAA ATTCGCGTTA TCGCATATCG AGAAAGATGC     39900
     GGCGCAGGCC AGACAAACTA ACCCTGATAC CAAAGCGACC TCTTTTGAAA ACACGGGCAA     39960
     TTTGCTGTTT GCAATGGTGC GTCACAAAAC CAGCCGTGAA GAAGATCCGC AGTTGCACAC     40020
     CCACTCACTC ACCGCCAACA TGACCAAGGA CAGCGAGGGC ACATTGCGCG CGCTGGCAAG     40080
     CAGCTTTAAA CAAAAAGGCG GCATCATCAA TGGCACGGGT GAGCGGGTTT ATAACCATCA     40140
     AAAATACTAT ACCTCGCTGT ATCAAAGCGC CTTAGCCCGC AGTGTTGAAC AAGCGGGTTA     40200
     TCAAACTCGT TCACTGGGTA ATAATTTGTT TGAAGTGGAA GGTGTCCCGC AGTCCTTACT     40260
     CGATACATTT TCAACCCGTA GCCAGCAAAT CAACGAACAA ACCCAAAGCT TAGGTTTAGA     40320
     CTCACAAGCC GCGCGGGACG TCGCCGCAAA GGACACCCGC AAGAGTAAAG CCTATACCAG     40380
     CGAAGCCACC TTGTTTGAGC AATGGAAAAA CAAAGCCAAT AACAGCGGCT TTAACCTGAC     40440
     AGGCTTTGTA ACAAACAGCA TGTCACGAGA AACATCACTC AATGCGTTAG CGCTCAAACC     40500
     CGCTGCTATC GATGCGGTGA GTCGCGCGAT TGAGCACGCC AGTAACACCC AAAACCGTTT     40560
     TAATTACGCG AAATTAGTGG AATCCGCCAC GCTTGAATTT ACGCAAGGCC AGAAGCTCGA     40620
     TGCGCTCGAT ATTAAATTGG CACTCGATAA GCACATTGAA GATGGCGCAC TCATTCCGCT     40680
     TGATAAAGAG TCTGCGACCT TTACCAGCGC TGCCCACCTC AAAGCCGAAA CCAACCTGCT     40740
     AGAGAGCATC AAGCCAAAAA CGGCCAACAT GCGCCAAGTG GTCGATACCA ACACGCTTCA     40800
     AGGCAAAGGC TTAAATGCGG ACAACCAAAA GAAAGTCTCT GAACTGTTCG CCAGTACCAA     40860
     ACAAGTTAAC CTAGTGAACG TCTTTGGTAG CAGTGAACAG CTCGCAACCG CCCTATTAAA     40920
     TGTCGGTGAG GCCAACGGTA AACGTATTCA CATCATTACC CCTGACATGA AAAGCAAACT     40980
     GCACACCAGT GAACGGGTGC AACGGGACTC ATCGACTATT GGCAAGTGGA TAATGAACCA     41040
     CTTCAAACCT GACCACACCC ATACACTCAG CAGCTTTACT AAAACGGCCA ACAACACTAA     41100
     CCGCGATATT TTAGTGGTTG AGAACGCCCA TAAACTCGGC CTTAACGACT TTAATGCCCT     41160
     GCTCGCGCAA GCCAAAGCGG GCAACAGTAA AGTGATTTTG CTCAATCACG CCAATGCCAA     41220
     GCAAGGCATG AAAGCCGGTA ACGCTATCGA GGTACTTAAA AAAGGCAACG TAAACGAAAG     41280
     CAACTGGGTC GCCACCAAAC AAAGCAACAC CGCCATGCGA CTGCATGAAA GCAAAGACAG     41340
     TGACAGGGTT AACCTGATTG CAAAAACTTA CGCGCAACTG CCCGAGAAGC AACACACCCA     41400
     AGTCATTACG GGCACCCATA AAGATGTGAA GCAACTCAAC AGCGCCATTC GCGCTGAATT     41460
     GCAAAATCAA GGTGATGTAT CGCGCCTTGG GCTCAACATC CCTACCCTTA ATCCCGTGTT     41520
     CTTATCCGCG CAGCAACGGG AAGTCGTCGG CCAGTACACC AAGGGCATGG TACTCACCCA     41580
     ATGGCAAAAA GTCGGTGGCC GCAATCAACA GCAGCAATTG ACGGTGGACA GCGTTAACCG     41640
     TGATAACAAC ACCCTCACGC TGATAGACAA AAACGGTAAA GCGTCCGAGA TTAACCCCAG     41700
     CAGCAAAGCC TTTAAAGCCG CAGAGTACGC GATCGCTAAA CCGGACTATT TACATATCGC     41760
     CAATGGCGAC AAACTCATCA TGGCCACAAA CCATCAAGAC AGTGGTTTGA GCAAACAAAT     41820
     TTATACGATC AACGCCCTGT CCAAAGAATG GGTCACGCTC AAAGACGAAA GCGGCAAACA     41880
     GCACAGCGTT AAAGCCAGTG CATTGCACCA TGCGCCGCTC AATCATGGTT ACGCCACCAC     41940
     GCCAAGCAAT GCCAGCCCTA ATGCAAGTCA CCACATCGTC AACATTAAAG CCTATAGCGC     42000
     CTCAAAAGAG TGGTTACATG ACACGCTGAC ACAAGGCATC AAACACATCG ATATATTCAC     42060
     CGACAAGGCA CAACAATTTG ATGACCGACT AGAAAAAAGT GAGGTGAAAC CATCCAGTAT     42120
     TTCGCGCATC ATGCAAGCCG CTGACATGCC AGAAAAGTTC GTGAATAGCC AAACCACGGC     42180
     CCTGCTCACC CAAGATGTGA CCGCAGCACT GAATGCCATT GGTGCCCAGC ATCAAGACAA     42240
     AGGGCTTATT CACAATGCCG TGGATTTTGC CATCCAGCAC ATTAGCGAGA AAGAAGCCGG     42300
     TTACTCACAA AAAGAACTGA TTGTTAATGC GATCAAGTAC GCCTTTGAGG AAAAAGGCAC     42360
     CAGCATTACC CAACATGAAA TCATCAACAC CCTGCAACAC ATGGCCACGA ACAGCACGGA     42420
     TAAAGGCGCG CCCTCACTCC TGAGCGCCGA ATACCACGAC GGCACCCGCT GGACAACCCA     42480
     AGCCGCTATC GATACCGAAG TGCGTATTTT AGACAGACTG CAAGCGGGCA AAGATCAACT     42540
     TGCGCCCCTT ACCAGCGTTG AACACGCCGC GCAGGTACTC AGTCAAAATC AAAACCTGAC     42600
     CGATGGCCAA AAAGACGCGA CCTTGCTTAT CACCACCACC AAAGACCGAT TTGTGGGTGT     42660
     TCAAGGGTTA GCGGGAACGG GTAAATCGAC CATGCTTGAA ACGGGTATCG ATCTCGTTAA     42720
     ACAAAGCGAA TCCATTCTCA ACACACAACC CAATAAGACA CCGACACAAT TCATAGGTCT     42780
     AGCGCCGACA CACGCCGCCG TTAACGAACT CAAAGACAAG AACGTCGAAA GCCAAACGGT     42840
     TCAATCACTC CTAAGCAACT TTTTAAGCCA AGATGCGAAA CCGGACCAAT ACGCCAACAC     42900
     AGTGTTCTTG CTCGATGAGT CCTCGATGAC CAGTAACGCC CAAATGGATA AATTTACCCA     42960
     TTTGATTGAG ACAACAGGCG CGCGCGCCGT GTTCTTGGGT GACACTAAAC AGTTAACGTC     43020
     CCAAGAAGCG GGTAAACCTT TTGAACTTGC GTTAAACAAA GGCGCAATCA ATAGCGTCAC     43080
     CATGAAAGAC ATTGTGCGCC AACAGAACAG CACGCTACTG AGTGCAGTAC ACAATATTGT     43140
     CGATCGCCAA GGCGAAAGTG CTATTGATAA AATTCAGCAA CAATTACCCT TTGACCAATA     43200
     CACCGCGCCC ACTGCGAACG ACGCGGTAAC GCCCGAAAAG CAGGCTACCG CTAACATCAA     43260
     TCAAAGCTTG AATATCATTT CAACTTTGCA GTTGATAACC GATAACCCGA AGAAAAACCA     43320
     GCAACTGGCG ACCGAAGCCC TGCCCGCCAC GGTGGCACTG GAATACTTGG CCAGAACACC     43380
     TAAAGCGCGT GAAAATACCC TTATCATTGC GTACACCAAC AAGGAACGCG ACGACATTAC     43440
     CCACGAAATC CGCCAAGGGT TACAGCAACA AAAAAGCCTC AGTAACGAGC AATTCACTGT     43500
     ACCGAGATTA CGTGGAGTCC ATGCCAGCAA GGCCGAACTG GCGACCATGT TGCCCTATCA     43560
     GCAGGGGTTA ATCCTGACGA CCAGTAAAGA CAGTTATTTT GAAATTATGA AGGTCGATAA     43620
     GCGCAATAAC ATGCTCACCC TCGCGGATAT GAAAACCGGC GAGGAAAAGC ATTTCTTTCC     43680
     CAAAAATCAT GGCCACAAAT TTACGAACCT TTGGGCTAAG AGTGAGCAAC CTCTCGCAGA     43740
     AGGCGACAGT ATCATGCTCC GCAAAAGCGA TATTGACCGT GAAATGCAGG GCAACAAAAC     43800
     CTATACCGTT AGCAGCATTG ACGATAAACA AATGCAGCTC AAATCCACGG ATAACCACAC     43860
     ATTAACGCTC TCAACCAAAG AGTTGAAAGA TGCTCATTGG GATTACGCAT ACACCCGCAC     43920
     CGCCGATATG GCGCAAGGGG CAACCTATGA GAATGTCATT ACTGCGATTA AGGGCCAAGG     43980
     TGCATTAACT AACGTAAGGC GCGCGTATAT CGATATCACC CGTGCCAGTA AGCACGTAAA     44040
     AATCATCACC GATAACCCGC AAAAAATGAT GCTCTCATGG GTCAATAACG ATCCCAATAA     44100
     AGTCTCTGCA CTTGAGACAA GAGATAACTA TTACCCTGAA CATACCCCGC TATTTAATGA     44160
     CAAACCCTTG CCGCAGGAAA ACCCCAAGTA CCTCGATGTG AATGGATATG TGGATCTAAA     44220
     ACGGATGGCC ACCGAGCTAA ATGCCAAGCT TCCAGCCTAC AGTGAATCAC TGGCAACGCA     44280
     GCTTTTAGGT GAGCCGAACC GCGATAAATC AGACAAAGAT AACCTGACAT TTGGCAAAGA     44340
     AGGGAGCCTA ACATTGACCA CAACAGGCCA ATATCGTGGC TATTTTAAAG ACTGGAAAAC     44400
     CGGCGATAAA GGCACCCTAA TTAACCTGAT TATGGTCGCT GAAAAATGCA GTTATAAAGA     44460
     TGCGCTTTAT AAAGCCGATA AAATGATGAA CGAACCCGAT AAATATAATC TGGTGAAAAA     44520
     CCCACAGCAT GATGAACTAA CACATGCCAT TCCGGTTAAG CAAAGCCAAT TAGAAGCGCG     44580
     CGCGAAGCAA TACTTTAACG AAGCTAAACC TATAGAAAAC TCACTCGCAC AAACCTATTT     44640
     AGCCAAGCAA GGAATCGAGG TTACGAAGCA TGAAAACTTA CGTTTTCACG ATGCCGTTTA     44700
     TTCGTCAGAA AAACGTGGAA CCTTCCCCGC ATTAATCGCG AACATCACCA ATGATAAGGA     44760
     TGAGACTAAG GCAGTAGAAA TTACTTACCT TGATAAATCC AGCGGTGACA TTGCAGCGCT     44820
     AAAAATAAAT AAGCGCATAC TCGGCTCCAA ATCGGGGAAC AGCACGACGA TCAACAAAGG     44880
     CAATAATTCA GACTATAGTA TTGTCGCTGT CGGCGTAGAG AATGCGCTTA AGATAAATGC     44940
     TGACAATAAA AACGGGGCTG ACGTTATTGC GCTAAACAAT AATAATGACA CTAAAACATT     45000
     CAATACAAAT GAATTGCGCG AAAACGTGAT AGTGGTACTT GATACCAATA ATTCACAAGA     45060
     CACTGCAAAA CTGGCAAGTG ACCTTACGGA TAAATTCAGC AAGGAAAATA TACATGCGGT     45120
     TATTATTGAA CCCAATCTGA TACCTGACGG CTTAAACAAA GTCGAAACGA CAAAGCAATT     45180
     AGTCAACGAA GCAGTCTATA GCATCACGAC AAAAGACAAC ACCCTATCTA AAGCCATTCA     45240
     ATCACTGAGT AATGACATTG CAGGTACGAA AAATATCACG ATGAAAGATG ACAGCAATAA     45300
     CGTAGCGACG AATAAAACAA AGCATGATGA ACACTATCAA CATTTAGCAA TGGATAGCCA     45360
     CCGTTCACCC ACGAAAGAAC ATAGCCCCAA TATCGAAAAC CCTAAATTGG ATATTGGTGA     45420
     AAAGACTATG TAAACACCAT AAAACAAGGC GGTTAATTAC AACCGCCTTT TTACGCATTG     45480
     ACAATAAAAC AAAGCCTAAT CCAAACTAAC AACAATATCG CCATCCTTTT TAGTCACATG     45540
     AAATAAGATG GACTCCAATA ATTCACGATC ACTCGGCTTA CCCATTACCG GTTCACTATC     45600
     TAAAGAACGG AGCCCAATCA ATGCCAACTC TCTCATGGCA TTAGCATCAC TCGATAGTTT     45660
     ATTCATGTTT CGATATGCAA TAATCTTTTC ATACAACGTT GGCTCGCAAG CAACCTGAAC     45720
     CGTTTTATTT CTAGCCATAT ATCACGCTCT CTATTTACCT AGATGAATAT TTTTTTAACA     45780
     CGGTATGACC ATTATTTAGC ATCACCCGCC AATAGCTGTT CAACTTTATC CTCAGCCTTT     45840
     CTCATGGTGT CTTTATGCTT TGTTTTCGCA CTGTCCATAT CCACAGGTGA GTCATTAAAC     45900
     GTCTGGTAAT AGACAAGACT ACTGGTGTGC TGCGCCTTAA CGGTATAGGT AAGAATCACC     45960
     TCTAACAGTT CGCGAGTAGA TACCCCCTCG GCATCATCTT TATGCTCAAG AATGCGCAGA     46020
     GCAAACAAGG TTAACTCCCT CATTGCATCA GCATCACTTG ATAGGTTCTT CTCGTTCCGG     46080
     TACGCAGTGA GCTTCTCGTA AAGTTCGGGG TTACAAGCTA CCTGCACCGC TTTGTTTCGT     46140
     GCCATCTAAC GCTCCTAATC TAATTTTACG CTTATTGGCA TGCCAATAAG CGCATTGACG     46200
     CAATGATATC ACCATAATTG AGTCAATGTA CTTTCATTGA CCGATAAAAA CAAGTCAATG     46260
     ACATAGCAAC GAACAATAAA AATTAATCTT TAAAAACAAT ACATTGCCTA GCATCCATTA     46320
     ATTCAATGAC ATGTCATTGC ACAGCGCTAC AGCCCGCGCC TGTACTGCAT CTATTGACAA     46380
     TTCAATGACC GGTCTTTACG CAGTCATTGC ACTTTTAGGA ATATTTGAAA CGAATTTTCA     46440
     AAAAAAAATA TTTATTTTGA TAGTGGAATT ATATTATTTA AATTCAATAC CTTACACCAC     46500
     AAACAACCAT AAAAATTGAT TTATCAAGTT CTGCGTGGGG TGTGGTCTTA TTTTCAAGGT     46560
     TCCAACTTCA CTATTTTGCC AGGGTTTTGC ACTTTTCATT TTTTAGGGTT TTTTGGGGGA     46620
     TTTTCGATTT TTGCTAGGCG GCTGCCGTAT GAAGCGGCAA AAGTATCGCG GGATTTACAG     46680
     GCAAAAAAAA CGCACTCAAT GAGTGCGTTC TCTGCAAGCG TGGCGGCTTA ATATTCGCTT     46740
     GGTAGTAAAA CGGTGCTACT ACTTCTATCC GCTTCGGTCA CGATCCAAAT TTTACCCTGT     46800
     GGCAAATTAT AAGCAGACAA CAAGCGGCCA CCCGTTTGAT TTAATGCTTC ATCGTTTGCC     46860
     TGCTTATCAT CTTCGGATAG ATCACCCCAT TGGCCTTTAA CATGCAGCAT TAAAAATGGA     46920
     TGCAATAAAC TATGATCACC ATTGACCAAT TTATTGACAC CTTGAGTCAA TGCTATTTTA     46980
     CCTAACATAA ATAAATGCGC CATTGTAAAT CACCTCCATA ATATCGCTAC AAATGCGCCT     47040
     AATATTCATC AGGCGCTTAT AATAAGATTT ATACTTGCGT ACCCATTAAA AATTGATGCG     47100
     CCTTAGATGC TGCGCTTGCG GCCTTAAATA CATAACGCTT ATCCCCTTTT AATCTGTCTA     47160
     GCCAACTGGC TATATAGGAC TCATGCTGAA CGTCACCGCC AACATTTAAT TCAGCCATTA     47220
     AAAAACTTGC GCCTATTTCT GCGATTAATT CCTCAAAGGC ATAATCATCT GAACCAAAGC     47280
     GAGAACCTTT AATTCTATCT AAACGATGTT TGGCGCCTGT CCAGTGTGTT AATTCGTGCA     47340
     AGGCTGTAGC ATAAAAATCA CAATGATTTG AAAAACGGCC ACGGCTCGGC ATAGTGATTG     47400
     AATCTGTTGA GGGGCGATAA AATGCGCTGG CCCCTTGCTC TGTTATTTTC GCGCCAGTAT     47460
     TCTTTAAAAA AATCTCTACA TGGTCTAACG ACTCAAAAAT AGAACCTTCT TCAATAGCGG     47520
     CCACTTCTGG AATATTTAGC CCCTCTATTT GTTCGATATT GAAAACCGTA AAGGATTTAA     47580
     TCATAGGGAT ATTCTCTTTT TCCCCTTCGG CGTTTTCCTT TTCCCAATTG GTGTAATAAA     47640
     TAATATTGGT GCCTTTTTCA CCTTTGCGAA CTTGTGCGCC TAATGACTGC GCCTGTTTAT     47700
     AGGTCAAAAA CTGGTTTGAT GTGAAACCCG CCTCAAACGC TGCAAACCAA AGTAAGCAAA     47760
     CATTAATACC GCTATAGGAT TTTTTAGTAT CAAAATTAAT CGGCAATCCA TTACCCCTTG     47820
     ATGATTTAAC CCAAGGACAC ACCCAAGGCT TAACGCCCTT TTCTAACGCC TCAATAATTT     47880
     TATTAGTGAC AGCCTCATAC ATATCCACTT TTTTAAATGC TTTTGCACTT TTACTTTTTG     47940
     TTTTGCTTTT TGAGATATCG TCTTTGGAGA GCCTGCTTGT CGCTTGTAAG CTGGCTTGCT     48000
     CGCTGAAAGG CTTAGTGTGG CTTGCTGGGG TAGTGATTGA GTGTGTCATG GGCTGCTTGC     48060
     TCCGTTTGGG GTCTATCATC TTCGTTTTCG CCTGACGTCC TGCTCGCTCG CCATCGTTCT     48120
     GATTGACAAG GGCGCGCAGC GGCGAAGCGA ACCCTTGGCA AGCGGGTTGT GGTGAGCGAC     48180
     AGATAAGACG GAAGCGTAAA CGAAAGGGAT AGAACCAGGA GCGGCCATGA TGCCGAATGA     48240
     AACGACCAGC TTAGCCACAC TTGCCGCGCA GTGAGTAGGA CTGTGCTTGG CGGTTTGGTA     48300
     GTTGCGTTAG GGATTGGCAA GCAGGAACGT AGAGCCACGG CAAGCTTGCT TGCCATCAGT     48360
     GGATCACGTT ATCGCGGGGA GCGAAGCGAA AAGCCCGACC GAAGGGAACG CCCAAGTTCA     48420
     TCAGTGGTAT TTAGATGACA TAGCGCCACA GCAGCCAATA GACACTCAGA GTAAATAGAT     48480
     TAGCCGCCGA GGCACGTTTC AAAGCACACC AAGGGGTATT GTCAGATAAA CGGAAAAGGG     48540
     CGGCGCAGCC GCCGCTTGTT TCGCCGTTTG CGGGAATATT GAGGACTAGG TTTGCGGTCA     48600
     TTATCACCGC ACTCACATGT CTTCATCTAC GGATTTGATG ATGCTGTATT TTTTAAACTC     48660
     TGGATGCACT TTAAGCTGCT CGTGAACATC TTCGGGAATA TGAAAATTGA TCTCACCCGC     48720
     CTCAATCAAA TATTTAAAAC AAGCAAAGCC CTCAAACTCA AGCCCAGACT CATCAAGCAC     48780
     GCGCTGCACT TGGTTTGCTT GGCATCGATA CCGCGCCCCC GCGACAACCA CAGTCACCGC     48840
     GCCAGAGGGC AGAAAGCTCA TCGTCACCGG ATAGTGATGG CCACCAAACA GATTCATAAA     48900
     GGAAAAATCA GCGCGATTAA GTTCACGGGT ACAACTAACG ATATTATTGA TTGGCATGAT     48960
     AGCGCCCCTC ATTGCTTATG AACCGACACT TTTTTGAACG GCACGCTTGA TAAAATCGTT     49020
     TGTGCTTCTG CTTAGACGTT GATTTACCCT GATAGCTCAG GGTAAATCAG CATCGGTATG     49080
     AGGGTTAAAA ACCTGCTGGC ATCAGCGCAT CAAAGTAAGA TTTTTGAGCA TCGTCCAGCC     49140
     CTTTACGCTC ACCATTGACT AAGCTATCAA CCTGCATGGC CAAATCCTTT TTCTTGAGTG     49200
     CGGCGGCTTG TAATGCCCAC TGCTCACCCA TGACAGGCTG AGCCATATCA ATTAAACAAG     49260
     ACAAGCTCAC GCGCTTAAAG AAGGTTTCAG TGGTTGGGCG CCAGTAGTTA GACCATTTCA     49320
     CATCAAGCTT AGATATCACG ACCTCAGCGG CGGCATGGCT ATTATCAATG GATGCCTCAA     49380
     GCATGGAAGC CGTGGCGTAA GCCACCTGCT TTTCTTTCTC TTTTACATCG AGGGCGCAAA     49440
     AAGCGTTAAA GCGTTCAGCG ACCGTTGGCA GTTCAACCCA CGTTAAATTT AGGCTGGTCT     49500
     TCACCTCTTC AATTAACTGC AACGCTTTGT TATCCGTGAG CGCTCCCGTT TTAGGATGGC     49560
     AAGTGGTGTC GTTAACGCTG ATATGCAGTG GACGGCTGCC ATAACGTGAG TCTGTGAACG     49620
     CGCTTACACA GACAGAGAAA TGCAACGTAT CAAGCGCCAC CGTTGGCGCA CTCATTAACG     49680
     CATGTTTCGT GATAATCAAA CGCTGCGCCC GTAAGTCCTC ATTGAGTGCC GCCGAATAGC     49740
     CGCTAACGTC CTTCTCTTCA ACTTTTTTCA CATCACCATC ATTCAATGAG CCAGATTGCA     49800
     CACTGGCTTT TAATTGTGCC AGTGCCTTTT TGTCGTCTTT ATGCACCAAA CCCATATAGA     49860
     TACTGACAGG CTCACCATAA CTTTTTAACA CTAGCAAACA CCCCGCTAGC GCCATTTCAG     49920
     CGGGTTCATA CTCACCCTCT TTTAAGGTAA GACGTCCAAA CCCTGCAAGT TCATCATACT     49980
     CAGAAACTAA CTTTATCTGT GTCCACTTCC AGCCACGCGC GATTAACTTT GCTGCTTCGA     50040
     TTTCCAATTT TGCGGTCGCT AACGTCTCAA GCAAGGCTCT ATCATCAAGG TAGACTTCAT     50100
     CACTGAACAA GTCTGAGGTC ACAACCCCAC CCGCCTTTTC GTATTCCTCT TGGCCTACGA     50160
     ACTGAGCCAG ATAATGCTCT GCATCCACAG CGGCATCTTT AAGCATATTG CGGAACTGGT     50220
     TTTCGTTGTA ACGTCTATCA CCTGCCAGCT CCCACACTTC GGCTTGCTTT TCGACACTGG     50280
     CAATCGTAAA CACCATTACG ATATCAAGTG ACACGTTCCC CGCTTTATAC GCATCGAGCA     50340
     CGACCGGCGC GACCATGCTT AACTTCATCC GCTGCTGTAC GAACTTCGCT TTGACACCAA     50400
     ACCGCGCCGC CACATCAGCA ATGCTAGCGC CCTTATTCAC CATCTCAGCA AATGCGTGAA     50460
     ATTCATCGAC TGGGTGCATA TTGGCGCGCA TGAAGTTTTC AGTCAGAGAT AGCTCGGTCG     50520
     CAAAATTCGC CACTTCATCC ACAGTCAGTA ACTTGACCGA CACCAGCGAG GTAGGTTTCA     50580
     ACTTATTATT TTTAACCGCT TTAATCAGTT GTTTCAGCCT GCGGCCACCG CCCAACACAG     50640
     GGTATAAACC CTGTGCATTC TTAGGCTCGA CTAACAAATT TTGTAAAATG CCATGCGCCA     50700
     AAATAGAGGC ATACAACTGT TCATCGTCAG CTTTAGACGC ATCCCCTTTA CGCACGTTCA     50760
     AATCAGACAG CACCAATTGA TTAATCGGTA ACTGCATTAA CACTGGCTTG GTTGTAGCGG     50820
     CCAACGTCAC CACAGCGTTA GCCGCTGTTG CCGATTTTTG AGCAATATCG GGCTTGTGAG     50880
     AGCCTGCTTG AGTCTTTGGA CTGGCAGGTA AAGTGGTGGC TTTAGTGTGA GTTGCTTGCG     50940
     CTTGAATTGA GTTTGTCATT GCTTGTTTTC CTGTCGTTTA AATATCGTTC TCGTCTTCGC     51000
     CTAACTTCCT GACTCATTTC ACGTTCTGAC AGACAAGGGC GCGCAGCGGC GAAGCCTCCC     51060
     TTGGCGGGCA GGTTGTGAAA TGAGACAGAT TAGAAGTGAC AGCGCAGACG TGAACGGTAT     51120
     TGACAGGGAA ACGATGACAA GCGATAGAGA AGCGCACGCT TACGCACACT TTAGCCGGCA     51180
     ATGAACCGGA CAGTGCTTGT GACTTTGATG TTTGCTTTGG TTTGGGACTT GGTGGTTGCG     51240
     TTAGGGATTG GCAAGCAGGA ACGTAGAGCC ACGGCAAGCT TGCTTGCCAT CAGTGGATCA     51300
     CGTTATCGCG GGGAGCGAAG CGAAAAGCCC GACCGAAGGG AACGCCCAAG TTCATCAGTG     51360
     GTATTTAGAT GACATAGCGC GACAGCAGCC AATAGACACT CAGAGTAAAT AGATTGACCG     51420
     CCGAGGCACG TTTCAAAGCA AACCAAGGGG TATTGTCAGA TAAACGGAAA AGGGCGGCGC     51480
     AGCCGCCGCT TGTTTCGCGT TTTACGGGGA GCTAACAAGG GGCAGCCTGA GCTTAAATCA     51540
     CATGGCTCAA GCTGATATTA AGCTATCCCT TCCAAGGCTT TCTCTGGCGG AATGTCCCCC     51600
     TGTAAGACGT TCAGGCTGTT TACACAAACT GCCCTTGTAG ATCCTTAATT CTCACTATCG     51660
     GATAGCGATT AGCACTCTCT AAGCATTTAG CGCGAGCCCT TTCGATATTG ATCGCTGAAT     51720
     CAATAAAATA GCATTGTTTT TGGACAATAT CGTTTTCAGA GTCATAGCCA ACAATAAAAA     51780
     AGCGAGGGGA ATATTTAACC TCGTCCACGG TATAACGGAT CGCCTGACCT GTCGCGGATT     51840
     CGTGATGGCC AATGTACCCG ATCCCGTTAG CATTCAAATC AGCCATGTGG CTACTGACAA     51900
     CCGATGTTGC ATAGTCCGCA GGCCAACCCG TTGCAGGGGT GCGACCATAT AAACGTTCAT     51960
     GTTTATATTG CCCTTGTAAA TAGGTGTTCA TTTCTTCAAA CGTCACTGAG GGTTTGCACA     52020
     TATCATATCG CCCCCGTGTT AGTGGCCAAC TCAATGCAGC CCCCTTCCAT CACAAACCAA     52080
     AGGGCATGAT GTGTATAGCA ATCGCTTATC CCCCCGTCAG CCGCCACCGA CACATAAACC     52140
     GTTGATATGA TCCCCGAGGG TAAAGACCAC ATGATTGAAA CGTGCTTATT TCGATAGTTC     52200
     TGACTTAACG CCCTCGTTAG TTCATCAAGT GAGAGGCATT GCGTATCGTT GCCAAAATTC     52260
     TTAATCATCA CAGGAAAACG AACCGAAACC CGTTTTTTGT CAGTGCTAAA CACATTAAAA     52320
     CGCACGCGAT AATCAATACT TGCGCCATTG CGTCGAGGTT GATCGATTGA TACGACATTT     52380
     TGAGCCACTT TTGCCGCGAC TAAGTACCGC TCGACCGCTT CAAACAATAA CCCTTGTGAA     52440
     TAGGGATACC ATGCCTCATT AGCCACGCCC TCAAGTCCGA GGCCGCAGAA GTGAAAGAAA     52500
     TTCATTTCAG TTAAAACAAT GATCGTCAAC TCGCCCCTTT TTTGCTGTTG AATATCGTCT     52560
     TTGGAGAGCC TGCTTGTCGC TTGTAAGCTG GCTTGCTCGC TGAAAGGCTT AGTGTGGCTT     52620
     GCTGGGGTAG TGATTGAGTG TGTCATGGGC TGCTTGCTCC GTTTGGGGTC TATCATCTTC     52680
     GTTTTCGCCT GACGTCCTGC TCGCTCGCCA TCGTTCTGAT TGACAAGGGC GCGCAGCGGC     52740
     GAAGCGAACC CTTGGCAAGC GGGTTGTGGT GAGCGACAGA TAAGACGGAA GCGTAAACGA     52800
     AAGGGATAGA ACCAGGAGCG GCCATGATGC CGAATGAAAC GACCAGCTTA GCCACACTTG     52860
     CCGCGCAGTG AGTAGGACTG TGCTTGGCGG TTTGGTAGTT GCGTTAGGGA TTGGCAAGCA     52920
     GGAACGTAGA GCCACGGCAA GCTTGCTTGC CATCAGTGGA TCACGTTATC GCGGGGAGCG     52980
     AAGCGAAAAG CCCGACCGAA GGGAACGCCC AAGTTCATCA GTTATGTTTA GATGACATAG     53040
     CGCCACAGCA GCCAATAGAC ACTCAGAATG AATAGATTAA CCACCACGCC ACTTTTCCAA     53100
     GCTAGCTAAG GGGTATTATC AGATAAACGC TAAAGGGCGG CGTAGCCGCC GCTTGTTTCG     53160
     CCGTTTGCGG GAATATTGAG GACTAGGTTT GCGGTCATTA TCACCGCACT CACATGTCTT     53220
     CATCTACGGA TTTGATGATG CTGTATTTTT TAAACTCTGG ATGCACTTTA AGCTGCTCGT     53280
     TCAAAAGGGG CAATTATTGC CCCCCTTTGA CGACTGTTAA TTTGTGTCCA GCTTGGCGAT     53340
     CAGTTGTTTT GTGCGAAAAA TGGCGTTAGG CGTGATTTTG CGTACCCACG CTTTTGAGAA     53400
     TCGCGACCAC TTGAAAGAAT ACATTTTGAG AGTGTTGCGA ACTGCCTCAC TAGGTACATC     53460
     GTCAAACGTG ATTTTGATCC GCCCCTCTTC TTCATACAAT GACCAAGAAA GCCCCTCAAT     53520
     CTCACCGCTT GCACTCAATG CCGCTTGATT ATGTAACTTT TCCAAATCTT CAATTCGATC     53580
     CCTTACGGTG CGAATGTTCG CATTATTGTT ACTCATTGAG TAACTAGCAA ACCCTACCCG     53640
     ACCGCAAAAA TCCCCCTTTA GTAATTCTTC CGCTTCTTTT TCGGTTAGCT TATGCGTTTG     53700
     CGTCATGTAC TCGATTTTGT CGGCGTCCGT CATATGCTTA GAGCGGATAA CTTTATTGAT     53760
     CGCTTTCATC GTTTCTTGTG AACGCTCCAA GCCTGCGAGT TTTTCTTTTA GTTTGGCGAT     53820
     AGCTTCGGGA TCATCCGATG CAATGCCATT AGTGCCAACG CTGGCCGCTC TGTCAGCGTA     53880
     ATAACCCGCT TTTTTGCTTG CCGCAACAGA TTTACCCATA TCATTAAAAA TCTTGTCTGC     53940
     GTGGCGTCTA GCGCGTCCCT CGCTATGGTG CCCCACTAAA ATCGGCTGGC CGAACGGAAT     54000
     ACAAGCAGCA AGGCTCCGAG ACGACTCATA AAATTTGTTT GATTCTGCCG CCGCTTTGCT     54060
     TGAGGCGTTC TCTAAGCGGT CGCGCTTGCT TTCTAGGCGA TCTTGGAAAT CGCCAAAACT     54120
     AACCACTTTG CGGGTGTTGT CATCGTTTGG CGGTGTTGGC TCTGGCGCTT TTGAATCGTT     54180
     CGACAACGGG CATAAATAGC CGTCTAACAA TGCCTGTTTA ACTTGTGCAT AGGTAAAATG     54240
     CGGCTTTTTC GCTTTGACTT CTTCAAAGGT CAAAACGATA TCGTCAGAAA AATGATAGGG     54300
     ACAATCAGAA AAACGCACTT TAGTTAGTAC ACCATCAAAA ACGGTTACAT AAATTTCTAG     54360
     CTGTGAGTAT TCCTTTTCGT ACCAGCGCCA AAAGAAATCG ACATCAACGA TCTGCGGGGC     54420
     GTTATCGTTA AAACAATCAT CCATCCCCAT TGTTTGGGTT CTCAGTTCAA TTTTTGTCGC     54480
     CATTGACAAC AACACGGCAA TTTTATTTTT TGCGTTTTTG CGCAGCTTTC CCGCTTTAAA     54540
     GCCTTTCAAC ATATCGAGCT TGTTGGAGCC TGCTTGAGTC TTGAGGCTAA CAGTAGATTG     54600
     AATGGTATTA GTGTGAGTTG CTTGTGCTAA AAGTGAGTGT GTCATGGCTT GTTTTCCTGT     54660
     TGTTTGAATA TCGTTCTCGT CTCCGCCTGA CTTCCTGCCT CATTTTTACG TTCTGGTTTG     54720
     CAAGGGCGCG AAGCGCTTGT TTACCCTTGC AAAACAGGTT GTTGAAATGA GACAGATTAG     54780
     AAGTCAAAGC GGGGACGAGT TCGGTATTCG CTTTAGACAG GAAAACCATG ATGCGCGAAA     54840
     GGCCAGCACA AGCTTACTCA CACTTTGCCA GTCAAGGCTC TGTTAGTGCT TGCAGTCTTT     54900
     TAGATATTTG GATTTTAAAT ATCTGGTGAT CGGTTAGGTG AACTCTCCCC TGGTTAATTT     54960
     GCCCTTTAAT TAACCAAGGG AGGACGTTCA CCCAATGCGT TAGTCACCGT TTAACCGGTG     55020
     CGGAACGCGA CCGCTAAAAA CGATGGTGGA TCTTGGCCGT TGCCATAATG GGGATCTGAG     55080
     AATGATTGAA TCAAGTATTT AAAATATTTC AAATACTTAA ATTGAGGGGC GTTCTCGCGG     55140
     TCAGGCCGCA TCACAAAAAC ACATTGAAAT CAGGCAACCC TCAAAATTTT GAGAATCATT     55200
     TCGCAAAAAT TTCAGGCAAA TTTTGATTAA GTGGATGATG TTGTTAGTCT ATTTGTCAGA     55260
     TGTGCCTTTC CCTGCAAGGA AACATGTCTT ATTGATAGAT TGGTTATCGG TATACAGTGA     55320
     CTGATAATGG TTTGGTGCTG CCTCCAAGTT TGCACCTTTT TTTTGCCTTA CAGCCCCCTA     55380
     AAAAACCAAT GCTTTAATCA CCGTTTAGCC GGTGCGGAAC GCGACCGCTA AAAATAGGTT     55440
     TCTGTGAATC AGACTTGCCT AGTCTGGTTT ACGCATACAA TCCTGCCATT TTACGCTAGT     55500
     TTTGTCCCCG AATATTGTTA GAGGGGGTCT TGATCGAGTA TTGCGATTTA TCTAGCTCAT     55560
     TAGACTTAGA GTTGACTGTG AAACTGGCGC GGTAATTCAT CGTAAAATAT GCGACTGTGA     55620
     CATGTGTTCT ATATTTTCAT CATTCTATCT GTCTGAACCT CTTGTATAGC AACGTATGTG     55680
     TGCCTAAACG TTTATTCTGC TACGATGTAT ATTACATCTT GTATATATTG CGCAGTGTGA     55740
     CAATGAATTA CTCGGTTCAT CAATATCTAT TGAGAAATGG TCCTAGCTTA AGCTCTGAAA     55800
     TAACAGAATA TCTGATCCAT TCCTGTGGAT TGAGTTCTCA AACTGCTAGA CAGCGTGTTT     55860
     CGCGAGCGAC TCAAGACATA CTGCGTTTAG AGCTTTCATT TCCAAGACGT GCTAAGTTTT     55920
     TATTTCTCAA AGAACAAGCT GGAACAGGGC TTTACTGGGG ACGATTGAAC GAAGCACTTT     55980
     TGTCTTGTAA TTCAGCATAT GGTTATGCCA TTTCCGCTAT TGAAGAGCGT GGAGGGATTA     56040
     TCCCAAAGTG TTATTTCGAG ATTATCTGCG GCGCCCCTAT CAAGCAGAAA AAACATTTAT     56100
     CAGCGAGTAC TGTTCTTAAT CGGCTGTTTA GTACAAATCT TTTAAAGGAG GTTACGGTAG     56160
     ATAGTATCGG TTCATGCGTT TATCTCGGAC TTCATTCCAA TCATGTACAG TCTCTAATAC     56220
     CTCATATGAA AGCTAGGATC TTGGCAGAAG ATCTGTTTTT AAGAGGTATA ACAAGCTGGC     56280
     TGAAAAACCT AGGTTTTGTA TCATACAATC AAGTAAAAAC ACGTTCGAAT GAAAGCAATC     56340
     CAGTGGTTAG CACTACCGCA TGGGACTTGG CCGCACCATC ATATCTAAGT CCGCTTGTTA     56400
     GCGGCGAGTC GCAAGGGGGA ACAATTAAAC CTGGATTCGT TGTATGTGAT ATTTTACTTA     56460
     ATAATGAGGT TAGTGAAAGA GGAATTCAGC CATTCCTTCA AAAGCTAAAT TCATTACGCA     56520
     GTCTTAAAAA CGTAGGCAAA CAGCTATGTT TCTTTTTTGC TTCTTCATAT AGTGAAAGTG     56580
     CGTTTAATAA ATTAAAGTCA GTTGGCGTGT CTCCCGCCAC TATTTCTTCA GTATTTGATA     56640
     AAGAAGTTAA TAGTGGGATG AAGGAGCTAA TTGAGCTTCT TTCCCAAATA TCAAGAGTGA     56700
     GTGTTTCAAG TGAAAAATTG GATGTCATTT TTAAAACATT AGGGAAAGTA GAAGGAGCAG     56760
     CAAGTCGTCT AAGAGGGGCA TTATTCGAAT ATGTTGTGGC AGAAGCTATG AGAGCCAGTG     56820
     GATATAATGG AGTGGAAATC AATAAGTTTT GTAGAAATGC AAGCGGAGTA CAAAAAGAAG     56880
     CCGATGTTGT TTGTTTTAAC AATAAAGATG TGTGTTTTAT CGAAGGTAAA GGGTACAACA     56940
     TTAATAAGAA GGTGACTAGA GATGATGTTG ATTATTGGCT AATTGAGCAA GTACCTGTTT     57000
     TTCATGAATA CTGTTTATCT CATCCTGATT GGAAAAACAA AAAACTTATC TTTGAATTTT     57060
     GGACATCCAG TACGTTCTCT GATGAGGCAT TGGCTCGTCT TGAAGAAGCT AAAAAGGCTA     57120
     CTAAAAGGTA CACAATAAAC TTTAAGAATA ATAAGGATTT ATTTTTATTT ATTGCGGATT     57180
     CTAATAACCA AGCATTGTTG AAAACGTATA AAGATCACTT TATTAATTAT CCAATGACGC     57240
     TTTAAAATTT TTATGGAGGC ACACCGAATC TGGCCGCATA ATTGGAAATT TAAGTTCTAA     57300
     TTTTTTGAAA AATTCAGCCT TTAATCGTGC GCATGAATCA GTATACCTAG TCTTATTCAC     57360
     AGGTTGAAGC GGAACATTTC CCATTAACTT TTCGCTAACG CGCTTTCACC CCAAACGAGT     57420
     TAACAAGTTA TCGACGGTTC AGTGAAGAAC GGACTTTCTG GCCTAAAATT TTCCATCGTT     57480
     ATACTCCGTT TGATGTAACT CACTAAAGTT CATCAAAAGT GGGATAAGTA TACAGCCGTA     57540
     TTCAAACTAT AATGACTTAG AACGCCTTTC ATCCTGTATT TGTGCGCATT TTTCCGGATG     57600
     GTGAATTTAA TGAAAACCTG ATAAACTACT TTTATACAGA TAGTTAACTG TGCGCGCCTT     57660
     CACTGTTCTA ACGAGTTGAA TGCGCACTAA TCAAATGCTA GCAATCAACA TCGCATGCCC     57720
     ATTAAGGAAT TTATTTAGTA GATGAATGAA CCAATAATTA AAGACCATTT AGGGAGAAAA     57780
     GCATGCAAAA AGATAGTTTC CTATTGTGAA TCATGGTTTA TAAAGCATGT TGTAAAACCT     57840
     ATATTTTTCT TATTGCCACC AAGTTTGTTG ACAATGCTTG CCGTAAGAAA AGGTATGCAA     57900
     GAAGATGTTA TTGACTATGT TGGTCAAACG GCAGGTGCAT TCCTTAATAA TTCAGCATTG     57960
     CTTATTATTA TTTGCACTTA TATTTATGTT GTATTAATGA GAGCTATATA TGCAGGAATT     58020
     GAAAATCATG CAAAACCCGC AAAAGAATTA GAGGTCGGTG ATTTATTAGC TTTATTAAAA     58080
     GCTATCGATA TTGTAGTTGG TGATAAAACA AAACGAGTTA CCTCAGAAGT TAAGGGAATC     58140
     ATCAATAATG CCAATGTGAT TAACGAACTG AAATTTTTAC AGTCGATTCG ACCAGAACAA     58200
     CAAATACCAT TATTAGTCGT TGGGCTAAGA AGTGTTTTTG AATATATGGA TAAACAAAAA     58260
     ACGGTTTATC GTGTAGGCTT GCTGCGAATA GAAAATGACA AGCCAGTTGA TTGGTTTTCT     58320
     TTTGATCCTG CATCATTACC ACCAAGAACA GAAGCACAGA CATTAAGTGC TCCAACAAGC     58380
     ACGGTATCAC AGTGTATTAA AAACAAATCA TTGGTTATCG TTGAAGATAT CCAAAAGGAG     58440
     CTAAACAAAA GAACTAAAAA AGAAAGGCGA TATATTAAAA GTAATACTCA AGAAACTGAT     58500
     GAAGGCTCGC AACTATGCTA CCCTTTGATA CATCCAGCTA CAAACAAAGT TGAGTATGTT     58560
     TTTACTATTG CAGGTAATCG CGCTGGCTGC TTGAATGAAA ATTATTCAGA ATTGTATGCT     58620
     TGGGTAATAC GACATTTTTC TATTCGTGTT TCGTTGGAGC ACAGCCTACT TATTGTTAAG     58680
     GAGAAAGCTA ATGAGTCAAC CAAAGAAGCA GCTTGAAAAC AACGAAGTAA AAGTTAAGTA     58740
     TTCAGTAGAT GTCACATCTA AAGAAGCTGC TAAAAAACTA GAATCTGAAA ATTTCAAAAA     58800
     TAGCATTGAA AAAGAGCTCG ACTCAATCGC TAAAAAAAGT AAAAATTCGA ACAATATATA     58860
     GCTAGCAAGT CACTCCTGGT GACGCCTGCT GCGCACCAGT AATGAGACGT TATTTCATAG     58920
     AAATTTTATT TCGAAACTTA CTAATTCGAG CTAAAAGTTT AACTCGGTAA TGCCGAAAAG     58980
     TGAGCTAGTG AATCACTCTA CACCAGACTG ATTCACGCGA GCCTTAAAAC AGACCCATCT     59040
     CGCCCCGTTT CTTCCTTCCA ACGGGGCTTT TTTTACCCTA AAATGAATCA AATCTCTAGA     59100
     GAACTGATTC ATACCTCATT TAAAGGCGCT TTTCTGCTGT TGAATACACC GCTAATCGTT     59160
     CACGCTTGCC TACGGCCACA ACAAACACGG TGTTTTTCAA GATAGTTGTC ACTCTATAGC     59220
     GCG                                                                   59223
//

If you have problems or comments...

PBIL Back to PBIL home page