(data stored in ACNUC7421 zone)

HOGENOMDNA: SHEB2_4

ID   SHEB2_4; SV 1; empty ; DNA; empty ; PRO; 65448 BP.
XX
AC   NC_011668;
XX
PR   Project: 58775;
XX
DE   Shewanella baltica OS223 plasmid pS22302, complete sequence.
XX
OS   Shewanella baltica OS223
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-65448
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Meincke,L., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Brettar,I., Rodrigues,J., Konstantinidis,K. and
RA   Tiedje,J.;
RT   "Complete sequence of plasmid2 of Shewanella baltica OS223";
RL   Unpublished
XX
RN   [2]
RP   1-65448
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (15-DEC-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-65448
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Meincke,L., Brettin,T., Detter,J.C.,
RA   Han,C., Kuske,C.R., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Ovchinnikova,G., Brettar,I., Rodrigues,J., Konstantinidis,K. and
RA   Tiedje,J.;
RT   "Direct Submission";
RL   Submitted (04-DEC-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001254.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003209
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..65448
FT                   /strain="OS223"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella baltica OS223"
FT                   /plasmid="pS22302"
FT                   /db_xref="taxon:407976"
FT   gene            436..1416
FT                   /db_xref="GeneID:7094401"
FT                   /locus_tag="Sbal223_4417"
FT   CDS_pept        436..1416
FT                   /locus_tag="Sbal223_4417"
FT                   /gene_family="HOG000141063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /codon_start="1"
FT                   /product="domain of unknown function DUF1738"
FT                   /transl_table="11"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   sew:SeSA_B0128 antirestriction protein"
FT                   /db_xref="GI:217980265"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="GeneID:7094401"
FT                   /translation="MTHSITTPASHTKPFNEQASLQATSRLSKDDISKSKTKSKSAKAF
FT                   KKVDMYEAVTNKIIEALEKGVKPWVCPWVKSSRGNGLPINFDTKKSYSGINVCLLWFAA
FT                   FEAGFTSNQFLTYKQAQSLGAQVRKGEKGTNIIYYTNWEKENAEGEKENIPMIKSFTVF
FT                   NIEQIEGLNIPEVAAIEEGSIFESLDHVEIFLKNTGAKITEQGASAFYRPSTDSITMPS
FT                   RGRFSNHCDFYATALHELTHWTGAKHRLDRIKGSRFGSDDYAFEELIAEIGASFLMAEL
FT                   NVGGDVQHESYIASWLDRLKGDKRYVFKAASAASKAHQFLMGTQV"
FT                   /protein_id="YP_002364241.1"
FT   misc_feature    577..1410
FT                   /note="Antirestriction protein [DNA replication,
FT                   recombination, and repair]; Region: COG4227"
FT                   /db_xref="CDD:33952"
FT                   /locus_tag="Sbal223_4417"
FT   misc_feature    577..924
FT                   /note="Domain of unknown function (DUF1738); Region:
FT                   DUF1738; pfam08401"
FT                   /db_xref="CDD:149455"
FT                   /locus_tag="Sbal223_4417"
FT   misc_feature    1063..>1185
FT                   /note="Protein of unknown function, DUF462; Region: DUF462;
FT                   cl01190"
FT                   /db_xref="CDD:154256"
FT                   /locus_tag="Sbal223_4417"
FT   gene            1482..2835
FT                   /db_xref="GeneID:7094338"
FT                   /locus_tag="Sbal223_4418"
FT                   /pseudo
FT   repeat_region   complement(1565..2636)
FT                   /mobile_element="insertion sequence:ISSba17"
FT   gene            complement(1589..2536)
FT                   /db_xref="GeneID:7094398"
FT                   /locus_tag="Sbal223_4419"
FT   CDS_pept        complement(1589..2536)
FT                   /locus_tag="Sbal223_4419"
FT                   /gene_family="HOG000114768" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /codon_start="1"
FT                   /product="Integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   asa:ASA_P4G054 transposase"
FT                   /db_xref="GI:217980266"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="GeneID:7094398"
FT                   /translation="MNYQQLTEGQRYQIALLYKENCSCREIGQRVGVSKSTISRELRRN
FT                   GTTAGYVAQHAHSQCEQRRGVAAKRSVSQSTIEFVEFALEWKWSPEQISAVAKLIGLSV
FT                   SHEWIYQYVFANKSRGGVLYEHLRQGKRRYRKGYGQKRGGIPDAVSIELRPAIVDERAR
FT                   LGDWEADLVLGKQGTGAIVTLAERKSRIYLTKKVFSKDAMEVSKAIISMLSDYKDACHT
FT                   ITFDNGREFSEHKVIAEALEAEMYFAHPYSSQERGLNENTNGLLRQFIPKGTDLRTVSD
FT                   EDLQRYQGALNSRPRKCLGFRQPSVVFAELRKAA"
FT                   /protein_id="YP_002364242.1"
FT   misc_feature    complement(1604..2536)
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="Sbal223_4419"
FT   misc_feature    complement(1727..2056)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal223_4419"
FT   gene            3410..3778
FT                   /db_xref="GeneID:7094339"
FT                   /locus_tag="Sbal223_4420"
FT   CDS_pept        3410..3778
FT                   /locus_tag="Sbal223_4420"
FT                   /gene_family="HOG000000469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0051"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0051 hypothetical protein"
FT                   /db_xref="GI:217980267"
FT                   /db_xref="GeneID:7094339"
FT                   /translation="MARNKVIQVACPPDLYSKVQDYKGAKNLASNADAMRELTLFALRV
FT                   IEHSSDEDEGISTRELLEVLLGNVIKIHHQTSINYYQNFNEEQYNNNMKEPDVVPSYKR
FT                   LMAKAEERTQQILEGDKN"
FT                   /protein_id="YP_002364243.1"
FT   gene            complement(3829..9789)
FT                   /db_xref="GeneID:7094340"
FT                   /locus_tag="Sbal223_4421"
FT   CDS_pept        complement(3829..9789)
FT                   /locus_tag="Sbal223_4421"
FT                   /gene_family="HOG000000470" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02760"
FT                   /codon_start="1"
FT                   /product="conjugative transfer relaxase protein TraI"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: conjugative relaxase domain protein;
FT                   conjugative transfer relaxase protein TraI; PFAM: TrwC
FT                   relaxase; KEGG: ppr:PBPRC0022 DNA helicase TraI"
FT                   /db_xref="GI:217980268"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014129"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="GeneID:7094340"
FT                   /translation="MLSISPIASSAGGAASYYLSEEKNLNLPDVSLEKAADAKEGETNY
FT                   YLKEQSAEPNTQWFGKLAEQEGMLGKPVEEHQLKEVLAGSLNDQTLKTQNSNARNGFDF
FT                   TFSAPKSVSLLALVGGDKRLMTAHDDAVKFALSHIEKDAAQARQTNPDTKATSFENTGN
FT                   LLFAMVRHKTSREEDPQLHTHSLTANMTKDSEGTLRALASSFKQKGGIINGTGERVYNH
FT                   QKYYTSLYQSALARSVEQAGYQTRSLGNNLFEVEGVPQSLLDTFSTRSQQINEQTQSLG
FT                   LDSQAARDVAAKDTRKSKAYTSEATLFEQWKNKANNSGFNLTSFVTDSMSRETSLNALA
FT                   LKPAAIDAVSRAIEHASNTQNRFNYAKLVESATLEFTRGQKLDALDIKLALDKHIEDGA
FT                   LIPLDKESATFTSAAHIKAETNLLESIKPKTANMRQVVDTNTLQGKGLNADNQKKVSEL
FT                   FASTKQVNLVNVFGSSEQLATALLNVGEANGKRIHIITPDMKSKLQTSERVQRDSSTVV
FT                   KWIMNHFKPDHTHTLSSFTKTANNTNRDILVVENANKLGLNDFNALLAQAKAGNSKVIL
FT                   LNHANAKQGMKAGNAIEVLKKGNVNESNWVATKQSNTAMRLHESKDSDRVNLIAKTYAQ
FT                   LPEKQHTQVIAGTHKDVKQLNSAIRAELQNQGDVSRLGLNIPTLNPVFLSAQQREVVGQ
FT                   YTKGMVLTQWQKVGGRNQQQQLTVDSVNRDNNTLTLIDKNGKASEINPSSKAFKAAEYV
FT                   IAKPDNLHIANGDKLIMATNHQDSGLSKQIYTINALSKEWVTLKDESGKQHSVKASALH
FT                   HAPLNHGYATTPSNASPNASHHIVNIKAYSASKEWLHDTLTQGIKHIDIFTDKAQQFDD
FT                   RLEKSEVKPSSISRIMQAADMPEKFVNSQTTALLTQDVTAALNAIGAQHQDKGLIHNAV
FT                   DFAIQHISEKEAGYSQKELIVNAIKYAFEEKGTSITQHEIINTLQHMATNSTDKGAPSL
FT                   LSAEYHDGTRWTTQAAIDTEVRILDRLQAGKDQLAPLTSVEHAAQVLSQNQNLTDGQKD
FT                   ATLLITTTKDRFVGVQGLAGTGKSTMLETGIDLVKQSESILNTQPNKTPTQFIGLAPTH
FT                   AAVNELKDKNVESQTVQSLLSNFLSQDAKPDQYANTVFLLDESSMTSNAQMDKFTHLIE
FT                   TTGARAVFLGDTKQLTSQEAGKPFELALNKGAINSVTMKDIVRQQNSTLLSAVHNIVDR
FT                   QGESAIDKIQQQLPFDQYTAPTANDAVTPEKQATANINQSLNIISTLQPLTDNPKKNQQ
FT                   LATEALPATVALEYLARTPKARENTLIIAYTNKERDDITHEIRQGLQQQKSLSNEQFTV
FT                   PRLRGVHASKAELATMLPYQQGLILTTSKDSYFEIMKVDKRNNMLTLADMKTGEEKHFF
FT                   PKNHGHKFTNLWAKSEQPLAEGDSIMLRKSDIDREMQGNKTYTVSRIDDKQMQLKSTDN
FT                   HTLTLSTKELKDAHWDYAYTRTADMAQGATYENVITAIKGQGALTNVRRAYIDITRASK
FT                   HVKIITDNPQKMMLSWVNNDPNKVSALETRDKYYPEHTPLFNDKPLPQENPKYLDVNGY
FT                   VDLKLMATELNAKLPAYSESLATQLLGEPNHDKSDKDNLTFGKEGSLTLTTTGQYRGYF
FT                   KDWKTGDKGTLINLIMVAEKCSYKDALYKADKMMNEPDKYNLVKNPQHDELTHAIPVKQ
FT                   SQLEARAKQYFNEAKPIENSLAQTYLNKQGIDVKQHENLRFHDAVYSSEKRGTFPALIA
FT                   NITNDKDETKAVEITYLDKSSGDIAALKINKRILGSKSGNSTTINKGNNSDYSIVAVGV
FT                   ENALKINADNKNGADVIALNNNNDTKTFNTNELRENVIVVLDTSNSQDTAKLASDLTDK
FT                   FSKENIHAVIIEPNLIPDGLNKVETTKQLVNEAVYSITTKDNTLSKAIQSLSNDIAGTK
FT                   NITMKDDSTNVATNKIKHDEHYQHLAMDSHRSPTKEHSPNIDNPKLDIGEKTM"
FT                   /protein_id="YP_002364244.1"
FT   misc_feature    complement(8824..9687)
FT                   /note="TrwC relaxase; Region: TrwC; cl08490"
FT                   /db_xref="CDD:164117"
FT                   /locus_tag="Sbal223_4421"
FT   misc_feature    complement(3847..9666)
FT                   /note="conjugative transfer relaxase protein TraI; Region:
FT                   TraI_TIGR; TIGR02760"
FT                   /db_xref="CDD:163003"
FT                   /locus_tag="Sbal223_4421"
FT   gene            9901..10152
FT                   /db_xref="GeneID:7094341"
FT                   /locus_tag="Sbal223_4422"
FT   CDS_pept        9901..10152
FT                   /locus_tag="Sbal223_4422"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980269"
FT                   /db_xref="GeneID:7094341"
FT                   /translation="MPPLCSLVSYFVGKYRFEQRRTVTVLHLTQIIPDQCQCDYQRETH
FT                   DSQTQDGGIFLRHNLPLKSKEATICIAMYIRLPRWLMD"
FT                   /protein_id="YP_002364245.1"
FT   gene            complement(10251..10430)
FT                   /db_xref="GeneID:7094342"
FT                   /locus_tag="Sbal223_4423"
FT   CDS_pept        complement(10251..10430)
FT                   /locus_tag="Sbal223_4423"
FT                   /gene_family="HOG000086255" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980270"
FT                   /db_xref="GeneID:7094342"
FT                   /translation="MTSFNTTTRAPELSAKKPSRKASKNDNERMNVMRRIEAIRDLKEM
FT                   GFTQEEIQQQLAQE"
FT                   /protein_id="YP_002364246.1"
FT   gene            complement(10427..10705)
FT                   /db_xref="GeneID:7094343"
FT                   /locus_tag="Sbal223_4424"
FT   CDS_pept        complement(10427..10705)
FT                   /locus_tag="Sbal223_4424"
FT                   /gene_family="HOG000027790" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980271"
FT                   /db_xref="GeneID:7094343"
FT                   /translation="MNATVINPITALEEAYLSQLEHPEVKKALLRREAAQAKHDSVSRK
FT                   LADGSSVVSLNDLSFWESEVVAAKAELEKFLVSPPYGEIAKRKELKR"
FT                   /protein_id="YP_002364247.1"
FT   gene            complement(10733..12856)
FT                   /db_xref="GeneID:7094344"
FT                   /locus_tag="Sbal223_4425"
FT   CDS_pept        complement(10733..12856)
FT                   /locus_tag="Sbal223_4425"
FT                   /gene_family="HOG000266197" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02759"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system coupling
FT                   protein TraD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system
FT                   coupling protein TraD; PFAM: Type IV conjugative transfer
FT                   system coupling protein TraD; KEGG: ppr:PBPRC0019
FT                   conjugative transfer protein TraD"
FT                   /db_xref="GI:217980272"
FT                   /db_xref="InterPro:IPR014128"
FT                   /db_xref="GeneID:7094344"
FT                   /translation="MTLNPKRTKGSNYTRGGQILFHNLRMFLQINAVLIRWTCYGVLIL
FT                   TALLCYLFLDKDTLMGAYYYWINQTVSVFRPDSHVMQTQWQGTVYTSTLGSQLENPTLI
FT                   AANSRFWLWTQIYLLISCVIGIVFLSVAMWYFKKKGDEQTEEHFIRGMQKATPKELAKQ
FT                   LKKDKRQSDFKLDGIGIFKERFEVQHLLLDGTTGAGKSVALRKFLTWIRERGDKAIIYD
FT                   KGCTFVSKFYNPATDVLLNPFDERCAYWDVWCDAHEPSDFENMASALIPQHGEGDPFWV
FT                   QSARTIFSSTAFKMQDEPKKNQTTERLLELMLTSELESLSEYLKGTESASLVSDKIQKT
FT                   AISIKSVLAAYIKSLRFLAGLDEKDEQGKLLRRKFSIREWVKNDAENGFLFLSSNAQQH
FT                   ASLRPLISMWLSIASTAILEQDEDPDRRIWVLMDEAPSLHKLPELAETIAEVRKFGGCY
FT                   VIGIQSFAQLKKVYGENAALEMFDLLNTRLFFRSPSNEMAKISSHDLGEQEVDVSKEQY
FT                   SYGANEIRDGVSLGHQTITRPVVTPSEIMQLEDLQFWLRTPGNYPVVRVDLVFNQMRSL
FT                   CAPFIKRNYTPSENIKQIEWSLNYHQFSAVQHVDKADKTKLQSIHDTMYEGDENNDERS
FT                   AEAQRMTKLAEKTDAVAQSLIDAKKAKPTELALKDAEKKKAAEKQKANDQHIEDAQRLE
FT                   ELQIVSVEDAEIG"
FT                   /protein_id="YP_002364248.1"
FT   misc_feature    complement(11102..12820)
FT                   /note="type IV conjugative transfer system coupling protein
FT                   TraD; Region: TraD_Ftype; TIGR02759"
FT                   /db_xref="CDD:131806"
FT                   /locus_tag="Sbal223_4425"
FT   misc_feature    complement(12464..12751)
FT                   /note="F sex factor protein N terminal; Region: TraD_N;
FT                   pfam12615"
FT                   /db_xref="CDD:153049"
FT                   /locus_tag="Sbal223_4425"
FT   misc_feature    complement(11159..12418)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4425"
FT   misc_feature    complement(order(12254..12262,12272..12277))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4425"
FT   misc_feature    complement(order(11555..11560,12188..12193,12197..12199,
FT                   12254..12262,12272..12274))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4425"
FT   misc_feature    complement(11558..11572)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4425"
FT   gene            complement(12859..13392)
FT                   /db_xref="GeneID:7094345"
FT                   /locus_tag="Sbal223_4426"
FT   CDS_pept        complement(12859..13392)
FT                   /locus_tag="Sbal223_4426"
FT                   /gene_family="HOG000000471" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980273"
FT                   /db_xref="GeneID:7094345"
FT                   /translation="MNIIKTGALLLCLLSPLAQADTTLFGLTLGKSTRQEVEQSYTLQD
FT                   KNTASGLPDSWNYYRVSGEQFNEPLLKHATLYFDNTQTLGRINFTFPSSLEKYKALEEQ
FT                   LSRQYPRIKMAPFVSEPLRLDKTEFQNDTTHIRLEYNVYNILLSFTDLKYRAIEKKPIA
FT                   ELKALEANNPKKEP"
FT                   /protein_id="YP_002364249.1"
FT   sig_peptide     complement(13330..13392)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT                   /locus_tag="Sbal223_4426"
FT   gene            complement(13430..16243)
FT                   /db_xref="GeneID:7094346"
FT                   /locus_tag="Sbal223_4427"
FT   CDS_pept        complement(13430..16243)
FT                   /locus_tag="Sbal223_4427"
FT                   /gene_family="HOG000000472" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07916"
FT                   /codon_start="1"
FT                   /product="TraG domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraG domain protein; KEGG: ppr:PBPRC0016
FT                   putative sex pilus assembly and mating pair TraG"
FT                   /db_xref="GI:217980274"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="GeneID:7094346"
FT                   /translation="MAVEIFTYSNGDVAKQVMNAIAVLFKSDSFASMISICALFAVVAT
FT                   ALHFFIKRDHNAIMKWCAVYFAVPLLAMNTTATVQITDLTNPTGNYRVDNVPAIVAFPA
FT                   SWASHYMYATTQTVEDIFHVPDDQQYSKTGMMFGSELYKLSRQSEIENTQLKGYWQHYI
FT                   SSCIRGDMLLNHKYTWRDLANAPDIWDFLATHNPSPLRAIQMGPNDYPTCKEALPRLKQ
FT                   LFQADSAKSIKLLGSWIYGEKAKSQQSFLNTSISGGYQKYANISQSASQITLQNMTINA
FT                   LRNGLADDAAVSNNTAAAFNYAYTQNKMQTTSMWAGMALQAREFLPMLQSILFLLFSSV
FT                   AFLVVAIAMIPSLTFQVLGNYFKGFIYLGTWPVMFALINFIMTTRLSLNATEITNIYGG
FT                   ITLSNVDPLQEMHSRYAAMTGFLMMSVPTLIVPLIMKGGASVMSSMSHQFAGMMSSVNA
FT                   RTSASAASGDINLGNAQVDNYSYNNTNGNKIDTTGVERIHGNTKQDATGYETTTFDDGR
FT                   QVINGQNALSRSLPVNISGSDVVTNSASQSASNAISASKIEGKQASESIATSTNTALSQ
FT                   MSGVNTSNSYGSNSATGDSGTHNKGFADMRSTVKSFAKDFNLTEDQATSTLLSMYVGAE
FT                   AGVKLGTPGSGFLGSSAHVSGSTGTKGSTDDVSTARTSESERDSLQQSYLDQFSANVNT
FT                   VKSYNSGEQASTTNSKNEGETQTFLQGLNEAITHTKNAQSQLTEAQSYTDLANNVKSGS
FT                   ISIGRDFNQDFVDYVQDARDKQGDFMEVIKGQTPEMQQERNQLAAEFTNSPKVKAMVEQ
FT                   YKNNELPQNRDDIMQAQERYAADIDFNKQQSPQYAPAPFNDSLYQTGEFERIQGHAAQG
FT                   NAEIRQDVLHEEQTHNASSVPSIDMEQARADAKAAHALIKPDNRSDDEKMAETVRQSSP
FT                   FNTGPKM"
FT                   /protein_id="YP_002364250.1"
FT   misc_feature    complement(14867..16234)
FT                   /note="TraG-like protein, N-terminal region; Region:
FT                   TraG_N; pfam07916"
FT                   /db_xref="CDD:149152"
FT                   /locus_tag="Sbal223_4427"
FT   gene            complement(16246..17634)
FT                   /db_xref="GeneID:7094347"
FT                   /locus_tag="Sbal223_4428"
FT   CDS_pept        complement(16246..17634)
FT                   /locus_tag="Sbal223_4428"
FT                   /gene_family="HOG000000473" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06122"
FT                   /codon_start="1"
FT                   /product="TraH family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraH family protein; KEGG: vvu:VV2_0648
FT                   hypothetical protein"
FT                   /db_xref="GI:217980275"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="GeneID:7094347"
FT                   /translation="MKRLALTRTLLGVTISCLLTTHAHSAGVSGSLNDFFNGLGYGTNV
FT                   TNPGSFKGQSANYYSGGNLFVRSPIRDAQLVSVQMPSIAAGCGGIDMFMGGFSHINSDA
FT                   LVQQGKAIIANAAPFAVDLALQTWAPQIKQIKDTLTAIADKYLNQSINSCESAQAGVSA
FT                   LAGFAGVGSQKYICATMGTQNNAFADWVSGQQECGAGGQANNQLDNAKKDPALKDMVRK
FT                   NTNIVWAAILKNTFLASDPTLAEFLMSISGTYIYDATGNARGYGSLLTDNNNLINSLLE
FT                   GGKAESYQCTNQAIDQCLAPTQQTITIQSNHGLQYRVETLLRGIASKMQNDQPLTDNDK
FT                   SLLEYTTLPIMTFLRTELEAGLTPQTNTYAKIISVQFITLYLQNMLSIVKSSITATNND
FT                   PKDIDRIERDIINANRFLEGLTAKAQNEAVSQHQLIMQNQQIKQQITGAMSAKAKANLN
FT                   FGER"
FT                   /protein_id="YP_002364251.1"
FT   sig_peptide     complement(17557..17634)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.823 at
FT                   residue 26"
FT                   /locus_tag="Sbal223_4428"
FT   misc_feature    complement(16480..17541)
FT                   /note="Conjugative relaxosome accessory transposon protein;
FT                   Region: TraH; cl05580"
FT                   /db_xref="CDD:186660"
FT                   /locus_tag="Sbal223_4428"
FT   gene            complement(17631..17819)
FT                   /db_xref="GeneID:7094348"
FT                   /locus_tag="Sbal223_4429"
FT   CDS_pept        complement(17631..17819)
FT                   /locus_tag="Sbal223_4429"
FT                   /gene_family="HOG000086253" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980276"
FT                   /db_xref="GeneID:7094348"
FT                   /translation="MDTMLIINILLALAIYKFVLVPVHALLSAVCLRALRALNLRLNGN
FT                   ISGNISGNISGNTGGQS"
FT                   /protein_id="YP_002364252.1"
FT   gene            complement(17830..18273)
FT                   /db_xref="GeneID:7094349"
FT                   /locus_tag="Sbal223_4430"
FT   CDS_pept        complement(17830..18273)
FT                   /locus_tag="Sbal223_4430"
FT                   /gene_family="HOG000000474" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02738"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   thiol-disulfide isomerase TrbB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly thiol-disulfide isomerase TrbB; KEGG:
FT                   ppr:PBPRC0015 putative thiol-disulfide isomerase"
FT                   /db_xref="GI:217980277"
FT                   /db_xref="InterPro:IPR014109"
FT                   /db_xref="GeneID:7094349"
FT                   /translation="MKQLTTLIIGIFTLLLSSLGHTATMDTPVAANPNDYALVFFFRSD
FT                   CPFCHQFAPKLKQLAAQTGTYTYAFSLDNQGIAGFEVPIPSTPDIAATFFENPRSVTVP
FT                   ATFLINVNTRKFVRLTVGDVTPSQLQQSYLQSLNDPQVIASMR"
FT                   /protein_id="YP_002364253.1"
FT   sig_peptide     complement(18205..18273)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.825 at
FT                   residue 23"
FT                   /locus_tag="Sbal223_4430"
FT   misc_feature    complement(17896..>18213)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Sbal223_4430"
FT   gene            complement(18270..19004)
FT                   /db_xref="GeneID:7094350"
FT                   /locus_tag="Sbal223_4431"
FT   CDS_pept        complement(18270..19004)
FT                   /locus_tag="Sbal223_4431"
FT                   /gene_family="HOG000000475" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980278"
FT                   /db_xref="GeneID:7094350"
FT                   /translation="MSLKNITDMMLKAINRQKLPCLTLFTFTYCFVLSAIYDINGAPFL
FT                   TLCTVVFGALFILYPMMLSPKNAAILMPRHLFNQGSQTRVLGIMPLAFMSFLNTFPSLT
FT                   ATPAIVLMSIFTLIYCIASLFFATLTLDEQFSADHANKTSTRLAIEMLGFEFAPKAVQP
FT                   PSPLQYYRTLSTHHLIAYHALTSLITLIALLIFIGTFNTPWVGALLALAVIKASLELLF
FT                   LSLGQPPTAPIFTANITTEVTQ"
FT                   /protein_id="YP_002364254.1"
FT   gene            complement(19040..19915)
FT                   /db_xref="GeneID:7094351"
FT                   /locus_tag="Sbal223_4432"
FT   CDS_pept        complement(19040..19915)
FT                   /locus_tag="Sbal223_4432"
FT                   /gene_family="HOG000000476" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02739"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TraF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TraF; KEGG: ppr:PBPRC0014 sex pilus
FT                   assembly and synthesis protein TraF"
FT                   /db_xref="GI:217980279"
FT                   /db_xref="InterPro:IPR014110"
FT                   /db_xref="GeneID:7094351"
FT                   /translation="MRTLLNNRLQHAAASPFFRWSSRAPLAWLSTKNGDAVVNKRSALV
FT                   LLMLTTFCHGANATDAQGWRWYNEPTAPKKQAPKKAETPSVTLTRTKTLTPTEQMDWFH
FT                   SYYQDTLNDAAINSQDSEKVEKAMLLNQYVSNKSSEFGMTFKKVLLDNPELSYTKDRPT
FT                   EQAARSTYLSLERNKKMRAVRSLADAGWGLFFVYKGQEEMDIALAPSVQQFATEHGIEL
FT                   LGVTLDGVALPAIVQNRQNDQHINVPFSPALVLVNPGTGEMKPLAYGFISQDDLLGRFL
FT                   NVATDFAPDF"
FT                   /protein_id="YP_002364255.1"
FT   sig_peptide     complement(19739..19915)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.960 at
FT                   residue 59"
FT                   /locus_tag="Sbal223_4432"
FT   misc_feature    complement(19043..19795)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:185959"
FT                   /locus_tag="Sbal223_4432"
FT   gene            complement(19912..21729)
FT                   /db_xref="GeneID:7094352"
FT                   /locus_tag="Sbal223_4433"
FT   CDS_pept        complement(19912..21729)
FT                   /locus_tag="Sbal223_4433"
FT                   /gene_family="HOG000000477" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02750"
FT                   /codon_start="1"
FT                   /product="conjugal transfer mating pair stabilization
FT                   protein TraN"
FT                   /transl_table="11"
FT                   /note="TraN; TrhN; involved in stabilizing mating pairs
FT                   during plasmid conjugation; F plasmid TraN appears to
FT                   recognize OmpA in the recipient cell"
FT                   /db_xref="GI:217980280"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="GeneID:7094352"
FT                   /translation="MTQLNNALILSAILTLSAALPVMAANSEKDYRDNVQWAKDSIKQN
FT                   QNKAGYTGFDVNSLCKDATCQQEVANPSESRYYNNPSAMDSAKMQGMSTDGQAQAVTSG
FT                   FNNGRPTIDENDPAYHTAVGYQNDAYNISHGISSKYHDCEKGLVCEVDSQPRSCTLPTN
FT                   NPVQCYLTPFVKSTSTREKEHSFRLSGKPPFTITLPNPNAEIKRIRFNGDYSSWGGATK
FT                   LEIKLNDIYIGHIPSQRAAGDCIVNGFCPSSVNATLSTDNYQGGTSPLTVNIGTILGGT
FT                   WDWAFYLPIENLPITFVTTESDVEIGYNNSCGAVLPECQQVQSQCIEGKETRMINGISV
FT                   TLDCWKEETTYQCAFPNTCDAIADCSIQSTSCDTQLGGVCIKDKQQRLCDKQQCRDTGL
FT                   ICGADSFALSGDYYDPAATRSTDFNHAAAGLAAVSDAAGDVKDKANINENSAIIFKGNI
FT                   MECSDKALGISNCCQDSGWGNGIGLTSCSEEEKALGTAKEDKLTVSLGQYCAEKVLGVC
FT                   IRKKKAYCAFDSKLARIVQVEGRAQLGKNFGSAKHPDCSAFSPNELQRIDMSSMDFSDF
FT                   YEDMYDAIELPSTDEIQKRLQQSVGGTKP"
FT                   /protein_id="YP_002364256.1"
FT   sig_peptide     complement(21655..21729)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT                   /locus_tag="Sbal223_4433"
FT   misc_feature    complement(19930..21660)
FT                   /note="conjugal transfer mating pair stabilization protein
FT                   TraN; Reviewed; Region: PRK12355"
FT                   /db_xref="CDD:183467"
FT                   /locus_tag="Sbal223_4433"
FT   misc_feature    complement(19954..>20274)
FT                   /note="Mating pair stabilisation protein TraN; Region:
FT                   TraN; cl06164"
FT                   /db_xref="CDD:186676"
FT                   /locus_tag="Sbal223_4433"
FT   gene            complement(21726..22466)
FT                   /db_xref="GeneID:7094353"
FT                   /locus_tag="Sbal223_4434"
FT   CDS_pept        complement(21726..22466)
FT                   /locus_tag="Sbal223_4434"
FT                   /gene_family="HOG000000478" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02742"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system pilin assembly
FT                   protein TrbC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system pilin
FT                   assembly protein TrbC; PFAM: Type-F conjugative transfer
FT                   system pilin assembly protein TrbC; KEGG: ppr:PBPRC0012
FT                   conjugative transfer protein TrbC"
FT                   /db_xref="GI:217980281"
FT                   /db_xref="InterPro:IPR014113"
FT                   /db_xref="GeneID:7094353"
FT                   /translation="MKKFETKLPTTYTALCTKIVDNSLFSHSFKGLALLMSLLCLGSIS
FT                   QVFAQTDYSIDELKALSMRERHTLPPLNVDQAALFDKARQFEAQSKGQLDNALSPLLDA
FT                   KPNPSADANGVMVFVSLGMPATSLQQLLMQSADLQVPLIVRGVLPQGFTATVKQMNHLI
FT                   DNKGKTIQSGFAINPQWFTQFGITQVPAFVAVRPNKCQAKQPCSSDDFDVIYGNVSLYD
FT                   ALNLLAQHGSIPDVAAKTLAKGAK"
FT                   /protein_id="YP_002364257.1"
FT   sig_peptide     complement(22317..22466)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 50"
FT                   /locus_tag="Sbal223_4434"
FT   misc_feature    complement(21729..22124)
FT                   /note="Type-F conjugative transfer system pilin assembly
FT                   protein; Region: TrbC_Ftype; cl09883"
FT                   /db_xref="CDD:186869"
FT                   /locus_tag="Sbal223_4434"
FT   gene            complement(22489..23502)
FT                   /db_xref="GeneID:7094354"
FT                   /locus_tag="Sbal223_4435"
FT   CDS_pept        complement(22489..23502)
FT                   /locus_tag="Sbal223_4435"
FT                   /gene_family="HOG000222151" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06834"
FT                   /codon_start="1"
FT                   /product="TraU family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraU family protein; KEGG: ppr:PBPRC0011
FT                   putative sex pilus assembly and synthesis protein TraU"
FT                   /db_xref="GI:217980282"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="GeneID:7094354"
FT                   /translation="MRHIKLAWLVALSLLMGLIPSQANAQAACTGTFVNPMTDICWSCI
FT                   FPMTIGSVPIIPGSLPDTRNPVSPISFCPKPPPIFMQIGLNIGYWEPDTLVDVTRVPYC
FT                   MVNMGMKLDMSNSPQIGGRVTSRDNDASDGAFYHGHWYKYPVIYWLQIMQSAACMATDN
FT                   FDIAYLTEIDPLWDDDELSFILNPEAILFGNLVSQLACATEAVATSTNSILPFDFLFWC
FT                   MGSQGSAYPLTGTTNYRDTPIQAGTLILERLNYKLHRQGIVWESHGEDGAICYQTPMPL
FT                   MPKSRYRYQMTNTIPDALWAHPYTTTTVIWESGHDNPVSGDNFGFINFKKRNCVFL"
FT                   /protein_id="YP_002364258.1"
FT   sig_peptide     complement(23425..23502)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 26"
FT                   /locus_tag="Sbal223_4435"
FT   misc_feature    complement(22492..23418)
FT                   /note="TraU protein; Region: TraU; cl06067"
FT                   /db_xref="CDD:186673"
FT                   /locus_tag="Sbal223_4435"
FT   gene            complement(23489..24193)
FT                   /db_xref="GeneID:7094355"
FT                   /locus_tag="Sbal223_4436"
FT   CDS_pept        complement(23489..24193)
FT                   /locus_tag="Sbal223_4436"
FT                   /gene_family="HOG000222133" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02743"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system protein TraW"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system protein
FT                   TraW; KEGG: ppr:PBPRC0010 sex pilus assembly and synthesis
FT                   protein TraW"
FT                   /db_xref="GI:217980283"
FT                   /db_xref="InterPro:IPR014114"
FT                   /db_xref="GeneID:7094355"
FT                   /translation="MNKFALLMLALCPLLPLKAASIGTVGQVFPIAEIDMLQWIENRLQ
FT                   TLEKTGELDSMREQFQENVKAGVKRPRPVGLITTKTPEVFLVDPTLTLAKDINDANGNL
FT                   IYPKGTRVNPFDTKTWPALQKANVGKFEFSKTLVFFDGDDVQQVLWAKEFATTHDKPHT
FT                   IKWILTGGEPETLHGQLDARVYFDQQGNLSRALTLKRVPSVVKQAGVMWQVREMDVSNF
FT                   PVFMEETNNAAH"
FT                   /protein_id="YP_002364259.1"
FT   sig_peptide     complement(24134..24193)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.830 at
FT                   residue 20"
FT                   /locus_tag="Sbal223_4436"
FT   misc_feature    complement(23546..24133)
FT                   /note="Sex factor F TraW protein N terminal; Region:
FT                   TraW_N; cl10149"
FT                   /db_xref="CDD:186917"
FT                   /locus_tag="Sbal223_4436"
FT   gene            complement(24190..24561)
FT                   /db_xref="GeneID:7094356"
FT                   /locus_tag="Sbal223_4437"
FT   CDS_pept        complement(24190..24561)
FT                   /locus_tag="Sbal223_4437"
FT                   /gene_family="HOG000000480" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PSLT089"
FT                   /codon_start="1"
FT                   /product="conjugal transfer protein TrbI"
FT                   /transl_table="11"
FT                   /note="KEGG: stm:PSLT089 conjugal transfer protein TrbI"
FT                   /db_xref="GI:217980284"
FT                   /db_xref="GeneID:7094356"
FT                   /translation="MEKNLIQAFLWLVTLSVMITIWVTREPSIVEYDINETVASFHQSI
FT                   GQSELSDEQREKEITRFTQTLDDVVREYALDNHVVVLVSPAVVSGAVNVTQEIQQSLLQ
FT                   TLHAQNKANRAQSSEVTPK"
FT                   /protein_id="YP_002364260.1"
FT   misc_feature    complement(24241..24552)
FT                   /note="Type-F conjugative transfer system protein
FT                   (TrbI_Ftype); Region: TrbI_Ftype; cl11515"
FT                   /db_xref="CDD:187087"
FT                   /locus_tag="Sbal223_4437"
FT   gene            complement(24563..27151)
FT                   /db_xref="GeneID:7094357"
FT                   /locus_tag="Sbal223_4438"
FT   CDS_pept        complement(24563..27151)
FT                   /locus_tag="Sbal223_4438"
FT                   /gene_family="HOG000000481" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02746"
FT                   /codon_start="1"
FT                   /product="type-IV secretion system protein TraC"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-IV secretion system protein TraC;
FT                   KEGG: ppr:PBPRC0008 putative sex pilus assembly and
FT                   synthesis protein TraC"
FT                   /db_xref="GI:217980285"
FT                   /db_xref="InterPro:IPR014117"
FT                   /db_xref="GeneID:7094357"
FT                   /translation="MKQRIKNDLGALYASSKQQHNHLHHELPYRIYDDAEQVFENANSL
FT                   GFGFAISLFGGANDDLIKTMNALVCTLPEGDKWHYQFVMVGNNQVGELIEQNQALLSGR
FT                   NAICDKFASNEAIYAKHSSTKGFGTKLSSAYHYDLKNTKGFFFVSTTEDMPALLDMRLG
FT                   IESELAQTGMHIRRLGADDLIEHCREHLNFSHQQDRVSPAKYNEYQPLNTQILSPDSEF
FT                   IINRDSVNIRHTPMQSDNSVDTTLINLGLKGLPNDFRLYAFPNCIASLSYTMNSVQCPY
FT                   RVSVSFYINKTGEQTTRNDSKIGSLTKTVNSPMRLLIPSAADELAERKEIQKGLSSHAF
FT                   KITTMTLNVTLYTTEEKHRHDTSKAIATFRTAGIDLIRNNKLQGMCTLSTLPFSMSEGF
FT                   MKDSQKAGLCFMMKTSNLVNFLPIVADYKRLSAGLLLPTMRHQISYFDPFNCGSDNYNM
FT                   AITGGSGAGKSFFMQALVKSIFAKGGKAWILDKGQSYKKLTQTLGGVYLDSSQIFLNPF
FT                   THLGKVLSVRDAGTFGPILDDEGQAIDPITEVLGNITALIATMASPDEKLTGFQTALLG
FT                   DAILLAWQKCGNDTLIDDVQKALYDIAAQKNDDTRISDIAAQLNKFCSSGIHGAIFNKP
FT                   SMLDPNIDITTLELDGFKGELQRPVIFALMVTISQQMYLSGQRSIPKICVIEEAWSLMS
FT                   GANAQSKDFINEGYRTVRKFGGSFATVTQGMNDFFANAEAEAALNSSDIHITLRQGDGF
FT                   GDFLNKHPDHFSPFEQHMIKSFPRANDAGHSCVMLKAGGLVSFHRIFADPWSRAMLSTE
FT                   PKEFEHCENLIKGGMPLLDAIELTAQHFYPDDMARFDAILSAAATHKEAA"
FT                   /protein_id="YP_002364261.1"
FT   misc_feature    complement(24632..27076)
FT                   /note="type-IV secretion system protein TraC; Region:
FT                   TraC-F-type; TIGR02746"
FT                   /db_xref="CDD:162997"
FT                   /locus_tag="Sbal223_4438"
FT   misc_feature    complement(<25601..25810)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4438"
FT   misc_feature    complement(order(25745..25753,25763..25768))
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4438"
FT   misc_feature    complement(order(25679..25684,25688..25690,25745..25753,
FT                   25763..25765))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="Sbal223_4438"
FT   gene            complement(27155..27613)
FT                   /db_xref="GeneID:7094358"
FT                   /locus_tag="Sbal223_4439"
FT   CDS_pept        complement(27155..27613)
FT                   /locus_tag="Sbal223_4439"
FT                   /gene_family="HOG000000482" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02747"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraV"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraV; PFAM: Type IV conjugative transfer system protein
FT                   TraV; KEGG: ppr:PBPRC0007 hypothetical protein"
FT                   /db_xref="GI:217980286"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="GeneID:7094358"
FT                   /translation="MLNTIMSKNALRNTGIIALASWLLSGCAAGLDSDYSCDKVGGING
FT                   CTNMMEVRQLTDSGVFNQPQAQSPAVTALSGQSTTALPKLASQQQDFIPLPRRDRHGVP
FT                   LRTSESVQKVTIFPYLNEQGDYVDTSDVYIVVDKSRWTGRPAKYIKQD"
FT                   /protein_id="YP_002364262.1"
FT   sig_peptide     complement(27521..27613)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.844 at
FT                   residue 31"
FT                   /locus_tag="Sbal223_4439"
FT   misc_feature    complement(27191..27562)
FT                   /note="Type IV conjugative transfer system lipoprotein
FT                   (TraV); Region: TraV; cl11514"
FT                   /db_xref="CDD:187086"
FT                   /locus_tag="Sbal223_4439"
FT   gene            complement(27631..29157)
FT                   /db_xref="GeneID:7094359"
FT                   /locus_tag="Sbal223_4440"
FT   CDS_pept        complement(27631..29157)
FT                   /locus_tag="Sbal223_4440"
FT                   /gene_family="HOG000000483" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06447"
FT                   /codon_start="1"
FT                   /product="TraB pilus assembly family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TraB pilus assembly family protein; KEGG:
FT                   ppr:PBPRC0006 putative sex pilus assembly and synthesis
FT                   protein TraB"
FT                   /db_xref="GI:217980287"
FT                   /db_xref="InterPro:IPR010501"
FT                   /db_xref="GeneID:7094359"
FT                   /translation="MKQLLDYFKKDPEADFEQGSALNEANKKRNWVIAGVGATVLGALY
FT                   LAGDAYMSAPKRAPETAAGNPIDFGAVIDKDFTEKDNQSALTAQQIALDKQQKAIDKIL
FT                   SSMQAIERNNEANRLDLKRNLETFQLTITERIDDKINAANANAMQHSNVTDEFSTEGID
FT                   ASAYPVRQSTRYLGEQTLPPRPSVGDGQSGYAAPYQGGAIPPPATQNGIDSFALNWETP
FT                   EENLPKKRTPENYVPAGTFVTAVVTGGADANAGVNGQGDTVPMVFQTTNQGVLPNGKPS
FT                   KLNNCTVLGAAYGEISSSRGIVRTTRLSCIFEDEIIDIPVEATVFNYGRNGIRGTAIMK
FT                   NGKIVQMAGISGILTGIGETGKALSQTTSNSALGSTSSVNGSDALLNLAGSASSSVGSK
FT                   LADYYIKLAEQYHPIIELNPGNTVNIVFLKGFPLDPVGIQEYEEALAQQAQNPVSATAQ
FT                   ILNTISNPLLEQMPGNIKPQAQGTNTPTPQQQYNQQGQRPPVNSAFGRAN"
FT                   /protein_id="YP_002364263.1"
FT   misc_feature    complement(27859..29094)
FT                   /note="conjugal transfer pilus assembly protein TraB;
FT                   Provisional; Region: PRK13729"
FT                   /db_xref="CDD:184281"
FT                   /locus_tag="Sbal223_4440"
FT   misc_feature    complement(27859..28458)
FT                   /note="Bacterial conjugation TrbI-like protein; Region:
FT                   TrbI; cl04242"
FT                   /db_xref="CDD:186623"
FT                   /locus_tag="Sbal223_4440"
FT   gene            complement(29154..29969)
FT                   /db_xref="GeneID:7094360"
FT                   /locus_tag="Sbal223_4441"
FT   CDS_pept        complement(29154..29969)
FT                   /locus_tag="Sbal223_4441"
FT                   /gene_family="HOG000000484" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02756"
FT                   /codon_start="1"
FT                   /product="type-F conjugative transfer system secretin TraK"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type-F conjugative transfer system secretin
FT                   TraK; KEGG: ppr:PBPRC0005 hypothetical protein"
FT                   /db_xref="GI:217980288"
FT                   /db_xref="InterPro:IPR014126"
FT                   /db_xref="GeneID:7094360"
FT                   /translation="MKIANPLVFAACALFPMSVLAANTPPKHYGFNDSETVPIELSSVD
FT                   INRLVVEGDKITSIDCPEGFCVVTGTKSDKSGAARVNLNLAMPFTAYVSTEKGRHFGLF
FT                   ISPKAIPAVTSIFTAEHYREEQPSVFDKKTPYPTMMTEFTAQMIRYLATGKPIDGYRVH
FT                   VVNDDLERTTVDSEPRGTETSIDDAMFTRLNEQMPKPAGLTTEPAFVFTGKHFNGIIYR
FT                   VTNHAALPVTLTTAQFYSPTTRAAALSTYELAPQQTGHLFVVSGGESMQ"
FT                   /protein_id="YP_002364264.1"
FT   sig_peptide     complement(29904..29969)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 22"
FT                   /locus_tag="Sbal223_4441"
FT   misc_feature    complement(29181..29960)
FT                   /note="TraK protein; Region: TraK; pfam06586"
FT                   /db_xref="CDD:148287"
FT                   /locus_tag="Sbal223_4441"
FT   misc_feature    complement(29175..29921)
FT                   /note="conjugal transfer protein TraK; Provisional; Region:
FT                   PRK13736; cl05878"
FT                   /db_xref="CDD:186671"
FT                   /locus_tag="Sbal223_4441"
FT   gene            complement(29969..30535)
FT                   /db_xref="GeneID:7094361"
FT                   /locus_tag="Sbal223_4442"
FT   CDS_pept        complement(29969..30535)
FT                   /locus_tag="Sbal223_4442"
FT                   /gene_family="HOG000000485" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02761"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraE"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraE; PFAM: TraE family protein; KEGG: vvy:VVP06 putative
FT                   conjugative transfer protein TraE"
FT                   /db_xref="GI:217980289"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="GeneID:7094361"
FT                   /translation="MLQKNKIDFIRIAKSLNTLLLIGFTVAMISNTVLASIVWKAYFNK
FT                   SRTVVPPTISAAFTVSDTSIDEPYLQQMAEYFAFLKLNVTPASVDHQYKQLASYIDEAD
FT                   WHQMQPLLVEDAAMIKKQNISSHFTINETQIALDDRLVKLTGTLNKYVGKRALEPETIS
FT                   YIIAMNYDHGQLSLKAIKKVQKDVK"
FT                   /protein_id="YP_002364265.1"
FT   misc_feature    complement(29978..30535)
FT                   /note="TraE protein; Region: TraE; cl05060"
FT                   /db_xref="CDD:186644"
FT                   /locus_tag="Sbal223_4442"
FT   sig_peptide     complement(30428..30535)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 36"
FT                   /locus_tag="Sbal223_4442"
FT   gene            complement(30576..30878)
FT                   /db_xref="GeneID:7094362"
FT                   /locus_tag="Sbal223_4443"
FT   CDS_pept        complement(30576..30878)
FT                   /locus_tag="Sbal223_4443"
FT                   /gene_family="HOG000000486" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02762"
FT                   /codon_start="1"
FT                   /product="type IV conjugative transfer system protein TraL"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type IV conjugative transfer system protein
FT                   TraL; PFAM: TraL family protein; KEGG: vvy:VVP05 putative
FT                   conjugative transfer protein TraL"
FT                   /db_xref="GI:217980290"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="InterPro:IPR014130"
FT                   /db_xref="GeneID:7094362"
FT                   /translation="MDNPTQFFSIPKHLNNTPTLLGFAMDELVPALVFFAVLFMMDHAL
FT                   IGMVLASSWFLGMRRMKSQYGMSVLRLTAYWYAPAEFSASFLKRTPAACRRYWLR"
FT                   /protein_id="YP_002364266.1"
FT   misc_feature    complement(30579..30863)
FT                   /note="TraL protein; Region: TraL; cl06278"
FT                   /db_xref="CDD:186680"
FT                   /locus_tag="Sbal223_4443"
FT   gene            complement(30882..31253)
FT                   /db_xref="GeneID:7094363"
FT                   /locus_tag="Sbal223_4444"
FT   CDS_pept        complement(30882..31253)
FT                   /locus_tag="Sbal223_4444"
FT                   /gene_family="HOG000000487" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRC0003 hypothetical protein"
FT                   /db_xref="GI:217980291"
FT                   /db_xref="GeneID:7094363"
FT                   /translation="MTTKIQQPNAQQNEVNEEILRLAKHIPSDSTIFIMRCTFLFIICV
FT                   IATLLLSWDVHAADPFAPAKSEIVDTVGTGSTAQFAILVVGLCAAALTGFLTKNWGAAI
FT                   GAFVVGMIFINVALKVVGL"
FT                   /protein_id="YP_002364267.1"
FT   misc_feature    complement(30885..31139)
FT                   /note="TraA; Region: TraA; cl11503"
FT                   /db_xref="CDD:187079"
FT                   /locus_tag="Sbal223_4444"
FT   gene            complement(31308..31586)
FT                   /db_xref="GeneID:7094364"
FT                   /locus_tag="Sbal223_4445"
FT   CDS_pept        complement(31308..31586)
FT                   /locus_tag="Sbal223_4445"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vha:VIBHAR_p08218 conjugative transfer protein
FT                   TraY"
FT                   /db_xref="GI:217980292"
FT                   /db_xref="GeneID:7094364"
FT                   /translation="MVKWFTPGGYFVYFCFPLLYYPSHDHPYSNYLSFMTKPTHVNVVL
FT                   DGKTNEMLEASAKRNNRSKRKEAQARLIDHLSRFDEMGMGLKGKDKS"
FT                   /protein_id="YP_002364268.1"
FT   misc_feature    complement(<31350..31466)
FT                   /note="TraY family; Region: TraY; cl14193"
FT                   /db_xref="CDD:187259"
FT                   /locus_tag="Sbal223_4445"
FT   gene            31623..32252
FT                   /db_xref="GeneID:7094365"
FT                   /locus_tag="Sbal223_4446"
FT   CDS_pept        31623..32252
FT                   /locus_tag="Sbal223_4446"
FT                   /gene_family="HOG000127685" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="putative phage repressor"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase S24
FT                   and S26 domain protein; KEGG: vfi:VFB18 DNA-binding protein
FT                   RDGA"
FT                   /db_xref="GI:217980293"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="GeneID:7094365"
FT                   /translation="MKLGDRLKNTRKIKGLTQLQIAEGVGVSKVAVSRWELGYSQPKGE
FT                   KLNALCNLLEIDSNWLLTGLKDECKNVAMIPFYSSVSIAAGSGSINEVTVEEKIAIPLW
FT                   VYNKQLNKKDVCCVRVSGKSMLPVLNDGSIIALNPHQKSIKDGMMYVIRQNDLLRVKIL
FT                   IEKPSSIVIRSYNPDFEGEELSKEELELSDFEIIGQVFWYSSTLDI"
FT                   /protein_id="YP_002364269.1"
FT   misc_feature    31632..31805
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4446"
FT   misc_feature    order(31644..31646,31656..31658,31731..31733)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4446"
FT   misc_feature    order(31653..31655,31728..31730)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4446"
FT   misc_feature    order(31674..31679,31710..31712,31719..31721,31731..31736)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal223_4446"
FT   misc_feature    31971..>32153
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Sbal223_4446"
FT   misc_feature    order(31992..31994,32103..32105)
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Sbal223_4446"
FT   gene            32698..33432
FT                   /db_xref="GeneID:7094366"
FT                   /locus_tag="Sbal223_4447"
FT   CDS_pept        32698..33432
FT                   /locus_tag="Sbal223_4447"
FT                   /gene_family="HOG000245283" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0058"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0058 hypothetical protein"
FT                   /db_xref="GI:217980294"
FT                   /db_xref="GeneID:7094366"
FT                   /translation="MQKSKADKARIKRQKLRSAKREAALHVKTHKTAVGANACKASLEG
FT                   FKALKSRLPRYFNEVINNARKLIYSRKFEIDEGGISRQMSELTKRKLFEIIVTLITSCD
FT                   FMSGQIGKAKNIGMDTTSHDALMLAHAKRWGYAMPSSTWYRYIGMLKQAGVFVVEEVKI
FT                   AGETEKTIRSVAAYKWLSTHFLQAIGAYTDIIRAQIKQAYQKAINNGLSFTWRVFKRQL
FT                   PVKQRFTADMFFSQSTNPPQTH"
FT                   /protein_id="YP_002364270.1"
FT   gene            34178..34333
FT                   /db_xref="GeneID:7094367"
FT                   /locus_tag="Sbal223_4448"
FT   CDS_pept        34178..34333
FT                   /locus_tag="Sbal223_4448"
FT                   /gene_family="HOG000086256" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01848"
FT                   /codon_start="1"
FT                   /product="Hok/gef cell toxic protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Hok/gef cell toxic protein; KEGG:
FT                   asa:ASA_P5G151 hypothetical protein"
FT                   /db_xref="GI:217980295"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="GeneID:7094367"
FT                   /translation="MPKRKTTTLSLAIVCFTLLAALALIRDDLCKVEYRNGAMLLNVVL
FT                   AYEVRG"
FT                   /protein_id="YP_002364271.1"
FT   sig_peptide     34178..34240
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.561 at
FT                   residue 21"
FT                   /locus_tag="Sbal223_4448"
FT   misc_feature    34184..34327
FT                   /note="Hok/gef family; Region: HOK_GEF; cl11494"
FT                   /db_xref="CDD:187074"
FT                   /locus_tag="Sbal223_4448"
FT   gene            35053..35706
FT                   /db_xref="GeneID:7094368"
FT                   /locus_tag="Sbal223_4449"
FT   CDS_pept        35053..35706
FT                   /locus_tag="Sbal223_4449"
FT                   /gene_family="HOG000117788" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 12"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: slo:Shew_0602
FT                   methyltransferase type 12"
FT                   /db_xref="GI:217980296"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:7094368"
FT                   /translation="MNQEASIAGQAVYSKKVLSIYDFWVLGVSNNYFWKCPTRLISEQF
FT                   SMLVSSNHLDVGVGSGYYLKNYLPQTTKRIALLDLNENSLDTTSKAISHFQPEVYCGDV
FT                   LEPLELSIEKFDSISVNYLLHCLPGNLIGKGIMFKHLKSHMNEGGVLFGSTILGKGTKL
FT                   NFFAKKLMGVYNKKGIFSNNNDDLDSLVTSLNEHFIDVKVEVIGCVALFSGKKI"
FT                   /protein_id="YP_002364272.1"
FT   misc_feature    35212..35508
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Sbal223_4449"
FT   misc_feature    order(35218..35238,35287..35292,35356..35364,35413..35415)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Sbal223_4449"
FT   gene            35746..35844
FT                   /db_xref="GeneID:7094369"
FT                   /locus_tag="Sbal223_4450"
FT                   /pseudo
FT   gene            complement(36173..36841)
FT                   /db_xref="GeneID:7094399"
FT                   /locus_tag="Sbal223_4451"
FT                   /pseudo
FT   gene            complement(37223..37468)
FT                   /db_xref="GeneID:7094400"
FT                   /locus_tag="Sbal223_4452"
FT   CDS_pept        complement(37223..37468)
FT                   /locus_tag="Sbal223_4452"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:DP1919"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dps:DP1919 hypothetical protein"
FT                   /db_xref="GI:217980297"
FT                   /db_xref="GeneID:7094400"
FT                   /translation="MDNKYIKPIENLSIGKIIEVDGSRIIAEIDPTISDLSRVFAGENY
FT                   PIGQFGSIIKVHFGRRSIYGLVSRLRMKADYQGFSD"
FT                   /protein_id="YP_002364273.1"
FT   gene            complement(37470..38612)
FT                   /db_xref="GeneID:7094370"
FT                   /locus_tag="Sbal223_4453"
FT   CDS_pept        complement(37470..38612)
FT                   /locus_tag="Sbal223_4453"
FT                   /gene_family="HOG000086257" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:DP1918"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dps:DP1918 hypothetical protein"
FT                   /db_xref="GI:217980298"
FT                   /db_xref="GeneID:7094370"
FT                   /translation="MAFNTTVFEQKKFREAINKLEELLSHSKAVLLGAGASVCAGLPLT
FT                   NQLTERALISDKLSDDSKQILTAIQNSFAGANPASHIEDYLSELVDWLAITARRANRNV
FT                   TASSVSIGGTEYSNEQLLQTINEIKLAIFDVINVEVDSAVHERFVQALHRPMRPGKDSL
FT                   PSTIDYLVMNYDTLIEDSLALSQLRYADGLEGGVSGWWNPSTFEQNNLDARVFKLHGSI
FT                   NWAEHASSSTPLRIAPHLKRSQDQAAKIMIWPASTKYRETQLDPYANLMHRARAVLNPR
FT                   DGSQRVLLIAGYSFGDAHINLEIERGLRASNGNLTVIAFTSDPVPSGALKIWYEDSSIN
FT                   EQVLIFADKGFYHADHKAISTNSIEWWKFENLTQILEGGI"
FT                   /protein_id="YP_002364274.1"
FT   gene            complement(38622..39842)
FT                   /db_xref="GeneID:7094371"
FT                   /locus_tag="Sbal223_4454"
FT   CDS_pept        complement(38622..39842)
FT                   /locus_tag="Sbal223_4454"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /codon_start="1"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: pph:Ppha_0745 restriction
FT                   modification system DNA specificity domain"
FT                   /db_xref="GI:217980299"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="GeneID:7094371"
FT                   /translation="MEQVLYSLPEGWHLETIGEVASKLVTGKTPSTKKAEYYSSSEVDW
FT                   FTPSDFGSTAVLNNSRRKLSSLAIEDGTIKKMPKDSILLVAIGATIGKVGLAEDESCFN
FT                   QQVTGIHFKEKIHPKYAYYWLSYIKPEIITKSSQATLPIINQTGIKGLSFLYPEKEEQK
FT                   CIVEKLDALLTRIDTAIEHLQESITLKNSLLQSALDGQFSAITERMTIESLAEVKGGKR
FT                   LPKGEKLSDEETEHPYIRVADFTDKGTIDLSGIKYISKEIHEQIKRYVISKDDLYISIA
FT                   GTIGKTGFVPSELDGANLTENAAKLVIKDKQQLDLSYLYLFTLTSDFSAQAGLATKTVA
FT                   QPKLALTRLSKIEIPICSLEEQKSLVSTIEALKSKIHDAEAVLLGKIEDLKSLKASILD
FT                   SAFKGEL"
FT                   /protein_id="YP_002364275.1"
FT   misc_feature    complement(39312..39818)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal223_4454"
FT   misc_feature    complement(38628..39809)
FT                   /note="Restriction endonuclease S subunits [Defense
FT                   mechanisms]; Region: HsdS; COG0732"
FT                   /db_xref="CDD:31076"
FT                   /locus_tag="Sbal223_4454"
FT   misc_feature    complement(38727..39224)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal223_4454"
FT   gene            complement(39845..41323)
FT                   /db_xref="GeneID:7094372"
FT                   /locus_tag="Sbal223_4455"
FT   CDS_pept        complement(39845..41323)
FT                   /locus_tag="Sbal223_4455"
FT                   /gene_family="HOG000065146" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /codon_start="1"
FT                   /product="N-6 DNA methylase"
FT                   /transl_table="11"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: ftn:FTN_1152 type I
FT                   restriction-modification system, subunit M
FT                   (methyltransferase)"
FT                   /db_xref="GI:217980300"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="GeneID:7094372"
FT                   /translation="MSLQQKIDRITDILRRDDGISGAMHYTEQTSWVLFLKFLDDYESE
FT                   KEDEAVLSGKDYQPVLDEEHRWSNWACPKNAEGKLDINQVRTGDDLTDYVNNELFPYLK
FT                   SFANAAVTGSDPKSFAYKIGAIFQYLDNKVASGHTLREVLDIIDTLNFQSSDEMFELSL
FT                   VYEGLLQNMGDAGGYAGEFYTPRPVVRAMIKAIDPQAGQTIYDAAAGSCGFLVEVFEHL
FT                   KAKKSALSTEQWDFIQRDTFFGFEKTSLAYVMGMMNMILHGIESPNLFRGNTLTQNIRD
FT                   IQEKDRYDIILANPPFGGKEKDQIQQNFPIRANATELLFLQHFMKTLKSGGKAAIVVPE
FT                   GVLFQTNSAFKQVKQELLENFNLHTILSLPAGVFLPYSGVKTNVLFFERSGGTSDVWYY
FT                   ECEPEKKLTKNKPITDEHLKEFVELYRSRETTERSWTVSASKLSEDYDLSAKNPAKQKD
FT                   AEHLAPSDILKQIRIKEKLVSGLLDEIEDLLAEK"
FT                   /protein_id="YP_002364276.1"
FT   misc_feature    complement(39941..40834)
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="Sbal223_4455"
FT   gene            complement(41327..43177)
FT                   /db_xref="GeneID:7094373"
FT                   /locus_tag="Sbal223_4456"
FT   CDS_pept        complement(41327..43177)
FT                   /locus_tag="Sbal223_4456"
FT                   /gene_family="HOG000086258" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:VV2203"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vvy:VV2203 hypothetical protein"
FT                   /db_xref="GI:217980301"
FT                   /db_xref="GeneID:7094373"
FT                   /translation="MKITLSPNHLHPDEQSFQLNKFSALIGENGCGKSSILQTIFEGRM
FT                   SDVMLSDWKVVCFSSGHNERYSRAFSNYLKKARKSKSGLSLHCFYYDKTWSPLLIFLAS
FT                   VLKKQGKVRNLLKSLGHVQESDDLGDDISSILSCGFRIDRPYINKVAVALKQEETGATD
FT                   TIRSTPFFRSLSSFIENIIDGAYDFEDIISKQDIKITSKDIFNTSFESAHVEGGTDIIS
FT                   DDPAVTFLTQAIDANNPITKTSLSLKFYNDLSLDEVSDGEYQLLFVYALLDLFDNEKTL
FT                   FLFDEADSHLHYRNINKLWASIDNAKGRALMTTHLLDSISEIGVENIHIVKQGRVLPFT
FT                   ERKELQERLEQLSNINKAKLKTYALHELIVLMDNENDWEIFTRLVIRKLGQEKQDEIKS
FT                   QLRKICCISVESGWNSHTSSFAAKKLKWLESFVSYIDGSNHKAKNVYLICDRDSLPLAS
FT                   IDNENLQLNGGKELTSSIAGKSEINAHILVWRRREMKHYLLSYTALKHHQLLTKINNDS
FT                   LGLACHLHQNMNGDHQCLVDEETGNEAPLVTQHFEEALEFNEGLGQLASNKVKSILDQL
FT                   ININGNGLDINKLQAYIDLIPPDEISEDITNMYNFIIGKL"
FT                   /protein_id="YP_002364277.1"
FT   misc_feature    complement(42188..>42469)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Sbal223_4456"
FT   misc_feature    complement(42407..42418)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Sbal223_4456"
FT   misc_feature    complement(order(42368..42370,42380..42406))
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Sbal223_4456"
FT   misc_feature    complement(42320..42337)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Sbal223_4456"
FT   misc_feature    complement(42302..42313)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Sbal223_4456"
FT   misc_feature    complement(42227..42247)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Sbal223_4456"
FT   gene            complement(43179..45494)
FT                   /db_xref="GeneID:7094374"
FT                   /locus_tag="Sbal223_4457"
FT   CDS_pept        complement(43179..45494)
FT                   /locus_tag="Sbal223_4457"
FT                   /gene_family="HOG000065168" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08463"
FT                   /codon_start="1"
FT                   /product="EcoEI R domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; protein of unknown function DUF450;
FT                   EcoEI R domain protein; SMART: DEAD-like helicases; KEGG:
FT                   ftn:FTN_1155 type I restriction-modification system,
FT                   subunit R (restriction)"
FT                   /db_xref="GI:217980302"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:7094374"
FT                   /translation="MSSEADTRANYIDPALKAAHWQPGNIIREHYFTDGRKLAGGVRGR
FT                   RCFVDYLLHKDNRYLAVVEAKKESEHPTKGLQQAIDYAKKLLVRFVYSSNGKQTYEFDL
FT                   ETGKGNYIEFYPTPQELENRYAGVNSDLGQQLRNVPFHLEGAMQPRYYQELAVHAATDA
FT                   IGKGKTRVLLTLATGTGKTFIAFQIIHKLFQSRWNKESPGTRRPRILFLADRNILADQA
FT                   INTFNPYEKDLIKINGEEVRKRGGVVPTNAHIFFAIYQAIAERENIEGYYKAYPSDFFD
FT                   LVMIDECHRGSANETGSWRAILDHFGSAVHIGLTATPKREANVDTYDYFGTPAFEYSLK
FT                   DGINDGFLTPYRVKRVRTNLDELVLTKDDQVIEGESGQDVYQVEDYDKKITVDERTELV
FT                   AKAILDNINPLEKTIVFCENQNHALTMRDMINKHKKLKDPHYCVRVTSDEGKVGRELLE
FT                   KFQDNDKDIPTIITSSQMLTTGVDARNVRNVVLDRTVGSMVEFKQIVGRGTRVFDGKDY
FT                   FTIVDFRGATNKFYDKDWDGEPEAPEPGGIGEPTSPPCTPEPPGGADGPEPEPGEPKLR
FT                   LKVKLSKHRELKVIDVETRYIDENGKPLTVQEFVERLISQLPGLFKSVEELTTIWSDPD
FT                   ERETLLSKLVQAGFDKDQLATLRRMFEAEECDIFDLLAFLAFEQPMATRKARADQVRTN
FT                   SAFFKQYQQEKAQQFLHFVLNRYEQTGSTELSRERLPALIELSGLGTVKDASTAFGGKP
FT                   AYLLAAFKQLQQQLYHVN"
FT                   /protein_id="YP_002364278.1"
FT   misc_feature    complement(<45204..45494)
FT                   /note="Type I restriction enzyme R protein N terminus
FT                   (HSDR_N); Region: HSDR_N; cl01057"
FT                   /db_xref="CDD:154173"
FT                   /locus_tag="Sbal223_4457"
FT   misc_feature    complement(<43905..45488)
FT                   /note="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases
FT                   [Defense mechanisms]; Region: HsdR; COG4096"
FT                   /db_xref="CDD:33853"
FT                   /locus_tag="Sbal223_4457"
FT   misc_feature    complement(44541..44984)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal223_4457"
FT   misc_feature    complement(44949..44963)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal223_4457"
FT   misc_feature    complement(44628..44639)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal223_4457"
FT   misc_feature    complement(43236..>43748)
FT                   /note="EcoEI R protein C-terminal; Region: EcoEI_R_C;
FT                   pfam08463"
FT                   /db_xref="CDD:149498"
FT                   /locus_tag="Sbal223_4457"
FT   gene            complement(45516..45731)
FT                   /db_xref="GeneID:7094375"
FT                   /locus_tag="Sbal223_4458"
FT   CDS_pept        complement(45516..45731)
FT                   /locus_tag="Sbal223_4458"
FT                   /gene_family="HOG000225392" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3980"
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: spc:Sputcn32_3980 transcriptional regulator"
FT                   /db_xref="GI:217980303"
FT                   /db_xref="GeneID:7094375"
FT                   /translation="MIRCHLARLMGERKMRISDVMRETGLSRTTVTLLYKETALKVDLE
FT                   ALDKLCDLFNCPLSDILEKMPSDRQG"
FT                   /protein_id="YP_002364279.1"
FT   misc_feature    complement(45528..45731)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="Sbal223_4458"
FT   gene            46135..46311
FT                   /db_xref="GeneID:7094376"
FT                   /locus_tag="Sbal223_4459"
FT   CDS_pept        46135..46311
FT                   /locus_tag="Sbal223_4459"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /codon_start="1"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; Prophage CP4-57
FT                   regulatory; KEGG: eli:ELI_00675 hypothetical protein"
FT                   /db_xref="GI:217980304"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="GeneID:7094376"
FT                   /translation="MTEQKQSSQLLSYQEVCKLTQLSQATIRRYVKNGSFPSPVTLSPG
FT                   ARSVRFRLEDVQK"
FT                   /protein_id="YP_002364280.1"
FT   misc_feature    46156..46305
FT                   /note="Prophage CP4-57 regulatory protein (AlpA); Region:
FT                   Phage_AlpA; cl01302"
FT                   /db_xref="CDD:120549"
FT                   /locus_tag="Sbal223_4459"
FT   gene            complement(46425..47054)
FT                   /db_xref="GeneID:7094377"
FT                   /locus_tag="Sbal223_4460"
FT   CDS_pept        complement(46425..47054)
FT                   /locus_tag="Sbal223_4460"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; KEGG: son:SO_A0026 resolvase
FT                   family site-specific recombinase"
FT                   /db_xref="GI:217980305"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="GeneID:7094377"
FT                   /translation="MFIRAYLRASTDEQDANRAKNELVQFSENKNIRIASFYTETQSGA
FT                   KIERPELGRLIMDSHPGDVLLIEKVDRLSRLPFEQWKILKTKLVKANIHIVVVDQPMTH
FT                   GILSGTEEHTMIAKVLTEFMIDLAAAMARDDYETRRKRQAQGIEKAKTLGKYLGRQPDH
FT                   GLRQNIRLLLDEGKSWSQVQSLLKCSRSTIAKAAKLNELKNDESIL"
FT                   /protein_id="YP_002364281.1"
FT   misc_feature    complement(46440..47054)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="Sbal223_4460"
FT   misc_feature    complement(46617..47048)
FT                   /note="Serine recombinase (SR) family, Partitioning
FT                   (par)-Resolvase subfamily, catalytic domain; Serine
FT                   recombinases catalyze site-specific recombination of DNA
FT                   molecules by a concerted, four-strand cleavage and
FT                   rejoining mechanism which involves a transient...; Region:
FT                   SR_Res_par; cd03767"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4460"
FT   misc_feature    complement(order(46830..46832,46839..46844,47025..47027,
FT                   47031..47033))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4460"
FT   misc_feature    complement(47025..47027)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal223_4460"
FT   gene            47297..47566
FT                   /db_xref="GeneID:7094378"
FT                   /locus_tag="Sbal223_4461"
FT   CDS_pept        47297..47566
FT                   /locus_tag="Sbal223_4461"
FT                   /gene_family="HOG000295466" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:XAC0341"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xac:XAC0341 hypothetical protein"
FT                   /db_xref="GI:217980306"
FT                   /db_xref="GeneID:7094378"
FT                   /translation="MSSIEIDDIKIKYSPLNKELVVDGELLSIFIYEGDSSGRWVLEVV
FT                   DECGTSTVWDYQFESDQAAFDEALNTINEEGIKAFKIQPEENLH"
FT                   /protein_id="YP_002364282.1"
FT   gene            complement(47662..47814)
FT                   /db_xref="GeneID:7094379"
FT                   /locus_tag="Sbal223_4462"
FT   CDS_pept        complement(47662..47814)
FT                   /locus_tag="Sbal223_4462"
FT                   /gene_family="HOG000027781" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980307"
FT                   /db_xref="GeneID:7094379"
FT                   /translation="MSHQEYTEIEKARLIDLPKLPAGKLYQWLAKKPAWVQTRVAKQLS
FT                   LSNTN"
FT                   /protein_id="YP_002364283.1"
FT   gene            complement(47887..48222)
FT                   /db_xref="GeneID:7094380"
FT                   /locus_tag="Sbal223_4463"
FT   CDS_pept        complement(47887..48222)
FT                   /locus_tag="Sbal223_4463"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980308"
FT                   /db_xref="GeneID:7094380"
FT                   /translation="MKENANESAIAALTRAVNEKKHLSTSGKKALIDIQTQNNKSKKSK
FT                   ITHTEGKRRNVYFSARSLNDLGKVEDVDGVTMSSAIQAALYLLAITTEVEREKIYKELK
FT                   IKSNSDK"
FT                   /protein_id="YP_002364284.1"
FT   gene            complement(48330..49004)
FT                   /db_xref="GeneID:7094381"
FT                   /locus_tag="Sbal223_4464"
FT   CDS_pept        complement(48330..49004)
FT                   /locus_tag="Sbal223_4464"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG1192"
FT                   /codon_start="1"
FT                   /product="chromosome partitioning ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: cco:CCC13826_0610 hypothetical protein"
FT                   /db_xref="GI:217980309"
FT                   /db_xref="GeneID:7094381"
FT                   /translation="MPILTIAAEKGGCGKTLLTVNIAAAAQRAGLKKILIIDGDSREES
FT                   YEWAMARKTAGLGKEIDIQKYSHEQSAEQQGLNISKEAANYDLTIIDTAATHSTFSNDA
FT                   MISSDMVLTPFIVNEKDCRQKSIDRALKIHNVLNEHFPDIKTKILMTRVSTLNQLQQID
FT                   RVKQQISASNGSYLNSFLTDLNPFWKNWDLGMSCYESTLNSAKRAQNEADMLVMEILES
FT                   CM"
FT                   /protein_id="YP_002364285.1"
FT   misc_feature    complement(48342..49004)
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Sbal223_4464"
FT   misc_feature    complement(48552..48998)
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4464"
FT   misc_feature    complement(48957..48977)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4464"
FT   misc_feature    complement(order(48729..48731,48957..48959))
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal223_4464"
FT   gene            49050..49211
FT                   /db_xref="GeneID:7094382"
FT                   /locus_tag="Sbal223_4465"
FT   CDS_pept        49050..49211
FT                   /locus_tag="Sbal223_4465"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217980310"
FT                   /db_xref="GeneID:7094382"
FT                   /translation="MLTLVCIHTLVCTLFFVNSPHVEKLGQNSTVPSFTTISQINICGG
FT                   RKFALRAQ"
FT                   /protein_id="YP_002364286.1"
FT   gene            49441..50061
FT                   /db_xref="GeneID:7094383"
FT                   /locus_tag="Sbal223_4466"
FT   CDS_pept        49441..50061
FT                   /locus_tag="Sbal223_4466"
FT                   /gene_family="HOG000245285" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PBPRC0031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRC0031 hypothetical protein"
FT                   /db_xref="GI:217980311"
FT                   /db_xref="GeneID:7094383"
FT                   /translation="MVKWLTISYFDMHSVNSSYDFCDVLDNALLHLYLSVAETERFTPK
FT                   AKRNEILLRYLKPMIKDKRYQQAKKEVKCLVALGRVASCDLESKLIELNELSQRYDLQA
FT                   TKAKQLFDLLRFIEAELTLPTRFLNVRDNERKLPNTIYMLQEHIENGFTVSGEQVAPVS
FT                   LFLESDKVIDVVDLVNATGWFLAEIQQHNVDEKQGHILLHPKK"
FT                   /protein_id="YP_002364287.1"
FT   gene            50154..50426
FT                   /db_xref="GeneID:7094384"
FT                   /locus_tag="Sbal223_4467"
FT   CDS_pept        50154..50426
FT                   /locus_tag="Sbal223_4467"
FT                   /gene_family="HOG000000460" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SARI_00053"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ses:SARI_00053 hypothetical protein"
FT                   /db_xref="GI:217980312"
FT                   /db_xref="GeneID:7094384"
FT                   /translation="MIDLTAEQRHLAKIVHDYACRFPLTEDGDAQLLQSCYDYMDAFKR
FT                   VMDSASKVQMDYICLQYPGYFRFAKWMERLAQGIAVGVIDIPKDH"
FT                   /protein_id="YP_002364288.1"
FT   gene            50806..51048
FT                   /db_xref="GeneID:7094385"
FT                   /locus_tag="Sbal223_4468"
FT   CDS_pept        50806..51048
FT                   /locus_tag="Sbal223_4468"
FT                   /gene_family="HOG000008424" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /codon_start="1"
FT                   /product="bifunctional antitoxin/transcriptional repressor
FT                   RelB"
FT                   /transl_table="11"
FT                   /note="Qin prophage; bifunctional antitoxin of the
FT                   RelE-RelB toxin-antitoxin system/transcriptional repressor"
FT                   /db_xref="GI:217980313"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="GeneID:7094385"
FT                   /translation="MGTINIRIDDELKERSFAVLEKLGVSPSEALRQMLEYVATSGAMP
FT                   FKPVLLTAEDEALISLVKERLASPRKGIEVSLDDL"
FT                   /protein_id="YP_002364289.1"
FT   misc_feature    50806..51045
FT                   /note="RelB antitoxin; Region: RelB; cl01171"
FT                   /db_xref="CDD:186367"
FT                   /locus_tag="Sbal223_4468"
FT   gene            51038..51322
FT                   /db_xref="GeneID:7094386"
FT                   /locus_tag="Sbal223_4469"
FT   CDS_pept        51038..51322
FT                   /locus_tag="Sbal223_4469"
FT                   /gene_family="HOG000219994" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /codon_start="1"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG:
FT                   ypi:YpsIP31758_2227 addiction module antitoxin"
FT                   /db_xref="GI:217980314"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR012753"
FT                   /db_xref="GeneID:7094386"
FT                   /translation="MIYKLVFDPRALKEWNKLGDPIRQQLKKKLAEILQHPHIGANKLR
FT                   DLPDCYKIKLRTSGYRLVYQVQDERITVFVVAVGKRERLAVYSTAEKRL"
FT                   /protein_id="YP_002364290.1"
FT   misc_feature    51038..51298
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Sbal223_4469"
FT   gene            complement(51610..54864)
FT                   /db_xref="GeneID:7094387"
FT                   /locus_tag="Sbal223_4470"
FT   CDS_pept        complement(51610..54864)
FT                   /locus_tag="Sbal223_4470"
FT                   /gene_family="HOG000240457" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /codon_start="1"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: shn:Shewana3_4244 HsdR family type I
FT                   site-specific deoxyribonuclease; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM: type
FT                   III restriction protein res subunit; protein of unknown
FT                   function DUF450; SMART: DEAD-like helicases"
FT                   /db_xref="GI:217980315"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:7094387"
FT                   /translation="MITEDQLEQECIRWFTDQGYLYKNGYDIAPDGDSPERDDYHQVVL
FT                   KQRLLNQLAIINPELPIEALNDVVNTVSSPDTPILIKNNRVFHKFVIEGVPVEYTAVED
FT                   GESKTKHTHAQLMDFTTTDNNEFLIVNQFTITGTKGNRRPDVLVFINGLPISVIELKNP
FT                   ADEHADIWNAFNQLQTYKDEISDLFIFNEALVVSDGWTARVGSLTANKERFLPWKTVTG
FT                   EDDKPLLEFQLETMVRGFFKPDLLLDYIRYFILFEIDNDNIIKKIAGYHQFHAVRAAVE
FT                   ATVKAKQADSDLPMVAESIGKYQVQATKGLDKIKAGSGKAGVVWHTQGSGKSISMVCYA
FT                   SKLLQQPAMNNPTIVVVTDRNDLDGQLYNTFGMAQETLKQIPQQADGRDLLRQLLLNRQ
FT                   SGGIIFTTIQKFALLDDEIEHPILSTRANIVVVSDEAHRSQYGNKSKLVEVKDANGNVT
FT                   GSKYVFGYSKYMRDALPNASFIGFTGTPIAMDDKDTRGVFGEYVSVYDIQDAVDDGATV
FT                   PIYYESRLAKLDINQAEIEELNDQVEDEIGEEEETASREQIKSQWATLEKLVGAEPRIQ
FT                   QVALDLVNHFSTRSETFPGKAMIVAMSREICVDLYNAIVAIKPEWHHPDPDKGAIKIVM
FT                   TGSASDKEKMQPHIHDKKTKKLFEKRYKDTQDELQLVIVRDMWLTGFDAPCCHTMYIDK
FT                   PMKGHNLMQAIARVNRVFKDKPGGLVVDYIGIANELKNALKTYTNSQGKGQPTVDTAEA
FT                   FSVLMEKIDIVRGMFATPVDGAVFNYRPEFETNALRLLPGAVNHLSGLSHRNSKGEEVR
FT                   DGKRRFLDVMAAMTKAFSLCNTMDETQGYKNEIAFYSAIKTAFIKHSTVDKKRSDEERN
FT                   TALKQILDNAIIADGVDDIFNMVGLDKPNIGLLSEEFLEDVKNMKEKNLAVELLEKLLR
FT                   DEVKARMKNDVVQEKKYSERIMTTLQKYHNRSIETAQVIEELIKWAKEMAADAEMAEGL
FT                   NLSPDEIAFYRALVMNEASVRELGDDSLRGLAIELTQQLRKSATVDWQKRDSVRARMRN
FT                   LVRRLLRRWKYPPDAAEAAIKLVLEQAEVLADDWYR"
FT                   /protein_id="YP_002364291.1"
FT   misc_feature    complement(51739..54864)
FT                   /note="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases
FT                   [Defense mechanisms]; Region: COG0610"
FT                   /db_xref="CDD:30955"
FT                   /locus_tag="Sbal223_4470"
FT   misc_feature    complement(54226..54501)
FT                   /note="Type I restriction enzyme R protein N terminus
FT                   (HSDR_N); Region: HSDR_N; cl01057"
FT                   /db_xref="CDD:154173"
FT                   /locus_tag="Sbal223_4470"
FT   misc_feature    complement(53407..53901)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal223_4470"
FT   misc_feature    complement(53866..53880)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal223_4470"
FT   misc_feature    complement(53554..53565)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal223_4470"
FT   misc_feature    complement(51616..52653)
FT                   /note="Domain of unknown function (DUF3387); Region:
FT                   DUF3387; pfam11867"
FT                   /db_xref="CDD:152303"
FT                   /locus_tag="Sbal223_4470"
FT   gene            complement(54861..56009)
FT                   /db_xref="GeneID:7094388"
FT                   /locus_tag="Sbal223_4471"
FT   CDS_pept        complement(54861..56009)
FT                   /locus_tag="Sbal223_4471"
FT                   /gene_family="HOG000221866" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_1089"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shw:Sputw3181_1089 hypothetical protein"
FT                   /db_xref="GI:217980316"
FT                   /db_xref="GeneID:7094388"
FT                   /translation="MFKIDKESNRISRIETKRFSDLGFRERDHLQEWLANQPDALGEEL
FT                   LIIQKEFDGFDDTRERLDLLAMDKDGNLIIIENKLDDTGRDVMWQALKYASYCSNLTKS
FT                   QIVDIYQGYLIKYCGGGDAKSQLCEFLDAPDLSEVVLNSGMNQRLMLVAANFRKEVTST
FT                   ALWLLNHGIQVQCFKVTPYSMAEDLFLNVEQIIPTPEAKELMIGMNAKEAEEKNTEAEL
FT                   KNRHRIRMAFWERALESMKSSQCDLFNNINPSKDHWLSAGSGVRSCPFTLIFGVREVRV
FT                   QLEMTRTGGLENKFLFDQLLEQISPIESSFGQPLEWLRLDDKKASRVQLRKEFDGYDRE
FT                   QWQEMIDWLVEHMILLEKAFKSPLQVASDKLKNTTFEGGAEA"
FT                   /protein_id="YP_002364292.1"
FT   gene            complement(56027..57313)
FT                   /db_xref="GeneID:7094389"
FT                   /locus_tag="Sbal223_4472"
FT   CDS_pept        complement(56027..57313)
FT                   /locus_tag="Sbal223_4472"
FT                   /gene_family="HOG000002669" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /codon_start="1"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: hin:HI1286 type I
FT                   restriction/modification specificity protein"
FT                   /db_xref="GI:217980317"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="GeneID:7094389"
FT                   /translation="MSFKTYTLGEIASNTSRRFNFVGNEQVCFINTGDILDGHFLTNER
FT                   VQSKGLPGQAKKAIQHGDILYSEIRPGNKRHLLVEGDVDDYVVSTKFMVITCDHDVVLP
FT                   EYLYLVLTSKECEAEFKVIADSRSGTFPQITFDAVAYYPIELPSLNEQRNVVEIIKSIT
FT                   QKLNVNKDINSTSEDIAQAIFKSWFVDFDPVKAKMNGEQPEGMDAATASLFPEKLVESE
FT                   LGLIPEGWHIHNTQDLFEVRDGTHDSPKKAENGYYLVTSKHITKGKIDTSSAYLISELD
FT                   FEQVNQRSKVDTFDILLTMIGTVGEVVVVYDNPVEFAIKNVGLFKTSQKPELVWLFYWH
FT                   LQSFKMKNYLEVRMAGTTQQYLTLKTLRTIPVLVPSQNLLQKFNELISPLMGKISDNHN
FT                   QNQSLSEMRDILLPKLLSGEIDLDKVLDV"
FT                   /protein_id="YP_002364293.1"
FT   misc_feature    complement(56783..57307)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal223_4472"
FT   misc_feature    complement(56057..57304)
FT                   /note="Restriction endonuclease S subunits [Defense
FT                   mechanisms]; Region: HsdS; COG0732"
FT                   /db_xref="CDD:31076"
FT                   /locus_tag="Sbal223_4472"
FT   misc_feature    complement(56096..56635)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal223_4472"
FT   gene            complement(57303..59006)
FT                   /db_xref="GeneID:7094390"
FT                   /locus_tag="Sbal223_4473"
FT   CDS_pept        complement(57303..59006)
FT                   /locus_tag="Sbal223_4473"
FT                   /gene_family="HOG000239473" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /codon_start="1"
FT                   /product="N-6 DNA methylase"
FT                   /transl_table="11"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: shn:Shewana3_4240 N-6
FT                   DNA methylase"
FT                   /db_xref="GI:217980318"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="GeneID:7094390"
FT                   /translation="MNQTEQQFLKELEGKLWNAADKLRSTLDAAQYKHAVLGLIFVKYV
FT                   SDAFKLRQDEIKADIANPEHEYYLDPADYSEEELAEEIAIELEQRDFYTEKNVFWLPTE
FT                   SRWQFLQDNGPLVIGGAELDINGKAKKITSVGHLIDNALEGIERDNPKLKGVLNKSYSS
FT                   LKIDQAKLNELINLIATIPFVHADLNSKDILGHVYEYMLGQFALAEGKKGGQFYTPASI
FT                   VSLIVEMIEPFEGRVYDPAMGSGGFFVQSEKFIERHAHEKQVDALTQKHKISIYGQEYN
FT                   YTTWQLAAMNMAIRGLDYDFGKEPASTYTNVQHPDLRADFIMANPPFNMKEWNTGVDDN
FT                   DPRFKYGQPPSGNANFAWMQHMLHHLAPEGSQALLLANGSMSSTTNNEGTIRQALIEND
FT                   LIECMVALPGQLFTNTQIPACIWFLTKNKNPRVDKAGRKLRGRKGEVLFIDARNLGYMK
FT                   DRVLRDFSFEDIQKVADVFHAWKTGETVNGVTYEDQAGFCKSATLAEIAKHDFVLTPGR
FT                   YVGAADEIDDGVPFAEKMEMLTTKLSEQFTESAKLEAEIKKNLAGLGYEF"
FT                   /protein_id="YP_002364294.1"
FT   misc_feature    complement(<58875..58973)
FT                   /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
FT                   /db_xref="CDD:152596"
FT                   /locus_tag="Sbal223_4473"
FT   misc_feature    complement(57426..58442)
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="Sbal223_4473"
FT   gene            59117..59713
FT                   /db_xref="GeneID:7094391"
FT                   /locus_tag="Sbal223_4474"
FT   CDS_pept        59117..59713
FT                   /locus_tag="Sbal223_4474"
FT                   /gene_family="HOG000219981" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: pin:Ping_2569
FT                   phage integrase family protein"
FT                   /db_xref="GI:217980319"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:7094391"
FT                   /translation="MEAWNKGKRVGQKKAFKLEDIWRIRIRLELEERLFELALFNLAID
FT                   CKLRSCDLRNLKVQDVSRSGCVMSRTIVKQQKTQQEVHFEITPKTQQTLSQWIIQNSLA
FT                   PTDYLFPSPRREGQPISYHYYTTMVNRWVTDIGLDKTQYGTHSLRRTKASLIYAKTKNL
FT                   RAIQLLLGHAKLESTIEYLGVEIEDALRISESCET"
FT                   /protein_id="YP_002364295.1"
FT   misc_feature    59246..59662
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal223_4474"
FT   misc_feature    order(59261..59266,59345..59347,59549..59554,59657..59659)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal223_4474"
FT   misc_feature    order(59261..59263,59345..59347,59552..59554,59561..59563,
FT                   59630..59632,59657..59659)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal223_4474"
FT   misc_feature    order(59261..59263,59552..59554,59561..59563,59630..59632,
FT                   59657..59659)
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal223_4474"
FT   misc_feature    order(59261..59263,59561..59563,59657..59659)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal223_4474"
FT   gene            60203..61051
FT                   /db_xref="GeneID:7094392"
FT                   /locus_tag="Sbal223_4475"
FT   CDS_pept        60203..61051
FT                   /locus_tag="Sbal223_4475"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07512"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1526"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   shn:Shewana3_4223 hypothetical protein"
FT                   /db_xref="GI:217980320"
FT                   /db_xref="InterPro:IPR011091"
FT                   /db_xref="GeneID:7094392"
FT                   /translation="MYEKVFATTSPVELHGAYIWSVKAAASLQPLLSTLEVALRNSIHN
FT                   SATTLIAPDWYDKLNTKQRKSWKVAQRDKNNITWHKSEVARVKKKLASKMPPKGLTRHD
FT                   LLVAKMDFGFWDNLLRECFSINGDKHALWPQCIPTIFPNLPKGHTNASIQREISSLREL
FT                   RNDIAHNSPIWKHKTVIDQQTAIQYINHQLDKIVEIISWLSSEKVDWLEVHMLQSEARR
FT                   VASIKYLHLCQRKNTNEFTEPLSSYKRSLRGKLKQLDKDEFDVIETFNNQLYLVAKLTV
FT                   Q"
FT                   /protein_id="YP_002364296.1"
FT   misc_feature    <60254..60724
FT                   /note="Abi-like protein; Region: Abi_2; cl01988"
FT                   /db_xref="CDD:154694"
FT                   /locus_tag="Sbal223_4475"
FT   gene            complement(61456..61854)
FT                   /db_xref="GeneID:7094393"
FT                   /locus_tag="Sbal223_4476"
FT   CDS_pept        complement(61456..61854)
FT                   /locus_tag="Sbal223_4476"
FT                   /gene_family="HOG000218473" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /codon_start="1"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /transl_table="11"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: shw:Sputw3181_1496 histone family
FT                   protein nucleoid-structuring protein H-NS"
FT                   /db_xref="GI:217980321"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="GeneID:7094393"
FT                   /translation="MTDFISTLTHARKFKAAVSTLALTELHSFQEKLLALIDTREKEEA
FT                   EAVNLNAERNAQLNEIKRKMLELGLSAEDLNHVTMPKKKREPRPAKYQIEVDGEMLTWT
FT                   GQGRMPTELKKEIDEGFELSDFLIVQKN"
FT                   /protein_id="YP_002364297.1"
FT   misc_feature    complement(61471..61854)
FT                   /note="Domain in histone-like proteins of HNS family;
FT                   Region: HNS; cl09251"
FT                   /db_xref="CDD:186852"
FT                   /locus_tag="Sbal223_4476"
FT   misc_feature    complement(61486..61764)
FT                   /note="H-NS histone family; Region: Histone_HNS; pfam00816"
FT                   /db_xref="CDD:144421"
FT                   /locus_tag="Sbal223_4476"
FT   gene            62349..64223
FT                   /db_xref="GeneID:7094394"
FT                   /locus_tag="Sbal223_4477"
FT   CDS_pept        62349..64223
FT                   /locus_tag="Sbal223_4477"
FT                   /gene_family="HOG000000464" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /codon_start="1"
FT                   /product="ParB domain protein nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   son:SO_A0031 ParB family partitioning protein"
FT                   /db_xref="GI:217980322"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:7094394"
FT                   /translation="MTNSIQTQATHTKAAISPTSHKTKAGSNKPDILQKSVKASNAVVT
FT                   LAATAKPVLMQLPINQLVLSDLNVRKGDASKADDEQLYASILAHGILQNLLVEPKNAQG
FT                   LYPVLGGGRRLKQLIKAVKNNKLKPTSLVSVKLLTVDEVANFATELSLTENFMRANMHP
FT                   VDEFHAFAEMVNKGASIADVAARFGVKAKFVQQRMKLSMVAPVVLDAYKAGNVSLDIVM
FT                   VFTIASVEKQAEVWELAGDRRYNENQFRNMLKDAAVDAEHYLAQFVGQEEYEKAGGVVT
FT                   SDLFSDEVYLDDRALLETLATAKLEIEAAKLIARGWKWTQIKLVSEYDELAGFGRLTLK
FT                   EGEYEPAEMALAGCLLVLKSYGEPVSIYMGLVHKDDKKALAQLKASVQSGSLNDGDVKK
FT                   IEEKDASGYSAALNEDLRAQRLIITKHALMSAPTVALDTLHFSVCVSAFTDSRYGSRPL
FT                   HISVNDTTCHPKTGALTDNKALQLIEEVKTSLNLTWVELPTVAERFNAFCALDVKEKEK
FT                   QVAYATASMLEASIDNSHAAAEAVISTLDVKWSNYWRPTAETFFKRVSLSCLIDMAQPV
FT                   MGEQWALQAAALKKKDLAMQVDSLVNGERKGLDDAQKSYFDALMPAGF"
FT                   /protein_id="YP_002364298.1"
FT   misc_feature    62511..62813
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="Sbal223_4477"
FT   misc_feature    62550..>63203
FT                   /note="plasmid partitioning protein; Provisional; Region:
FT                   PRK13832"
FT                   /db_xref="CDD:184353"
FT                   /locus_tag="Sbal223_4477"
FT   gene            64365..64610
FT                   /db_xref="GeneID:7094395"
FT                   /locus_tag="Sbal223_4478"
FT   CDS_pept        64365..64610
FT                   /locus_tag="Sbal223_4478"
FT                   /gene_family="HOG000011021" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Maqu_2667"
FT                   /codon_start="1"
FT                   /product="HicA protein"
FT                   /transl_table="11"
FT                   /note="KEGG: maq:Maqu_2667 HicA protein"
FT                   /db_xref="GI:217980323"
FT                   /db_xref="GeneID:7094395"
FT                   /translation="MTKTDKYLIKLKSAKTLTWNELTGALKALGYKQVEGDGSRVKFDN
FT                   GVPKELINMHKPHPSNELKAYALRQVRDKLTEWGKL"
FT                   /protein_id="YP_002364299.1"
FT   gene            64607..64945
FT                   /db_xref="GeneID:7094396"
FT                   /locus_tag="Sbal223_4479"
FT   CDS_pept        64607..64945
FT                   /locus_tag="Sbal223_4479"
FT                   /gene_family="HOG000011008" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05534"
FT                   /codon_start="1"
FT                   /product="HicB family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: HicB family protein; KEGG: maq:Maqu_2668 HicB
FT                   family protein"
FT                   /db_xref="GI:217980324"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="GeneID:7094396"
FT                   /translation="MMHNTMTFKGYHGSVEISPDDDILFGQVLFISPLINYEAETAKGL
FT                   EKAFQDAVNDYLTDCAQQDVTPEKPCKGSLNIRLGHDLHLAASVAAFQASMSTNDFIKR
FT                   AVQKSVGS"
FT                   /protein_id="YP_002364300.1"
FT   misc_feature    64616..64936
FT                   /note="Predicted nuclease of the RNAse H fold, HicB family
FT                   [General    function prediction only]; Region: HicB;
FT                   COG4226"
FT                   /db_xref="CDD:33951"
FT                   /locus_tag="Sbal223_4479"
FT   misc_feature    64772..64924
FT                   /note="HicB family; Region: HicB; pfam05534"
FT                   /db_xref="CDD:114265"
FT                   /locus_tag="Sbal223_4479"
FT   gene            64964..65308
FT                   /db_xref="GeneID:7094397"
FT                   /locus_tag="Sbal223_4480"
FT   CDS_pept        64964..65308
FT                   /locus_tag="Sbal223_4480"
FT                   /gene_family="HOG000000330" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SO_A0033"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_A0033 hypothetical protein"
FT                   /db_xref="GI:217980325"
FT                   /db_xref="GeneID:7094397"
FT                   /translation="MPINNIVSCTRELNRADFSFMNLFGGHHYPVTMSFLPSGAVTVVV
FT                   AGARYRCQANQVQRVLDESGLEFEGFACFKYLIEAGEINFHIPEDVHEQLKVHPEFKKY
FT                   SIIKSVDEDM"
FT                   /protein_id="YP_002364301.1"
SQ   Sequence 65448 BP; 16735 A; 14164 C; 15046 G; 19503 T; 0 other;
     TATTCATTCT GAGTGTCTAT TGGCTGCTGT GGCGCTATGT CATCTAAACA TAACTGATGA        60
     ACTTGGGCGT TCCCTTCGGT CGGGCTTTTC GCTTCGCTCC CCGCGATAAC GTGATCCACT       120
     GATGGCAAGC AAGCTTGCCG TGGCTCTACG TTCCTGCTTG CCAATCCTTA ACGCAACCAC       180
     CAAACCACCA AACCGCCAAG CACAGTCCTA CTCACTGCGC GGCAAGTGTG GCTAAGCTGG       240
     TCGTTCATTT CGGCATCATG GCCGCTCCTG GTGCTATCCC TTTCGTTTAC GCTGCCGTCT       300
     TATCTGTCGC TCACCACAAC CCGCTTGCCA AGGGTTCGCT TCGCCGCTGC GCGCCCTTGT       360
     CAATCAGAAC GATGGCGAGC GAACAGGACG TCAGGCGAAA ACGAAGATGA TAGACCCCAA       420
     ACGGAGCAAG CAGCCATGAC ACACTCAATC ACTACCCCAG CAAGCCACAC TAAGCCTTTC       480
     AATGAGCAAG CCAGCTTACA AGCAACAAGC AGGCTCTCCA AAGACGATAT CTCAAAAAGC       540
     AAAACAAAAA GTAAAAGTGC AAAAGCATTT AAAAAAGTGG ATATGTATGA GGCTGTCACT       600
     AATAAAATTA TTGAGGCGTT AGAAAAGGGC GTTAAGCCTT GGGTGTGTCC TTGGGTTAAA       660
     TCATCAAGGG GTAATGGATT GCCGATTAAT TTTGATACTA AAAAATCCTA TAGCGGTATT       720
     AATGTTTGCT TACTTTGGTT TGCAGCGTTT GAGGCGGGTT TCACATCAAA CCAGTTTTTG       780
     ACCTATAAAC AGGCGCAGTC ATTAGGCGCA CAAGTTCGCA AAGGTGAAAA AGGCACCAAT       840
     ATTATTTATT ACACCAATTG GGAAAAGGAA AACGCCGAAG GGGAAAAAGA GAATATCCCT       900
     ATGATTAAAT CCTTTACGGT TTTCAATATC GAACAAATAG AGGGGCTAAA TATTCCAGAA       960
     GTGGCCGCTA TTGAAGAAGG TTCTATTTTT GAGTCGTTAG ACCATGTAGA GATTTTTTTA      1020
     AAGAATACTG GCGCGAAAAT AACAGAGCAA GGGGCCAGCG CATTTTATCG CCCCTCAACA      1080
     GATTCAATCA CTATGCCGAG CCGTGGCCGT TTTTCAAATC ATTGTGATTT TTATGCTACA      1140
     GCCTTGCACG AATTAACACA CTGGACAGGC GCCAAACATC GTTTAGATAG AATTAAAGGT      1200
     TCTCGCTTTG GTTCAGATGA TTATGCCTTT GAGGAATTAA TCGCAGAAAT AGGCGCAAGT      1260
     TTTTTAATGG CTGAATTAAA TGTTGGCGGT GACGTTCAGC ATGAGTCCTA TATAGCCAGT      1320
     TGGCTAGACA GATTAAAAGG GGATAAGCGT TATGTATTTA AGGCCGCAAG CGCAGCATCT      1380
     AAGGCGCATC AATTTTTAAT GGGTACGCAA GTATAAATCT TATTATAAGC GCCTGATGAA      1440
     TATTAGGCGC ATTTGTAGCG ATATTATGGA GGTGATTTAC AATGGCGCAT TTATTTATGT      1500
     TAGGTAAAAT AGCATTGACT CAAGGTGTCA ATAAATTGGT CAATGGTGAT CATAGTTTAT      1560
     TGGGTGAATT CAAGTCCGAA GTGCAACGCT AGGCCGCCTT TCTTAGCTCT GCAAACACCA      1620
     CCGAAGGTTG TCTGAACCCT AGGCACTTAC GTGGCCTGCT GTTCAGTGCG CCCTGATAGC      1680
     GCTGTAAGTC CTCATCTGAC ACTGTTCTGA GATCTGTTCC TTTAGGGATA AACTGCCGCA      1740
     GAAGTCCGTT CGTGTTCTCG TTGAGCCCAC GCTCCTGCGA CGAGTAGGGA TGGGCAAAAT      1800
     ACATCTCCGC CTCCAGTGCC TCCGCTATCA CCTTGTGCTC GCTGAACTCA CGACCATTGT      1860
     CGAAGGTTAT CGTGTGGCAC GCATCCTTGT AGTCACTCAA CATTGAGATA ATCGCTTTGC      1920
     TGACCTCCAT CGCATCCTTT GAAAAAACTT TTTTTGTCAG ATAAATTCGA CTCTTACGCT      1980
     CAGCCAGCGT GACGATTGCA CCGGTTCCCT GTTTACCCAG CACCAGGTCG GCCTCCCAGT      2040
     CCCCAAGGCG AGCACGCTCA TCAACAATAG CAGGGCGTAG CTCTATGGAA ACCGCGTCAG      2100
     GGATACCTCC TCGCTTCTGC CCATACCCTT TGCGATAACG ACGCTTACCT TGCCTGAGAT      2160
     GTTCATACAG AACGCCACCA CGAGATTTAT TCGCAAAGAC ATACTGATAA ATCCACTCAT      2220
     GACTGACCGA AAGACCAATC AATTTTGCCA CAGCACTTAT CTGCTCAGGG CTCCACTTCC      2280
     ACTCCAGAGC AAACTCAACA AACTCAATGG TACTCTGGCT TACAGACCGC TTTGCTGCCA      2340
     CACCCCGTCG CTGCTCACAC TGACTATGAG CATGCTGCGC AACATAACCC GCTGTTGTAC      2400
     CATTGCGCCT GAGTTCACGG GAAATCGTAG ATTTACTGAC CCCGACCCGC TGCCCAATCT      2460
     CACGACAACT ACAATTCTCT TTATAAAGCA GGGCAATCTG GTATCGTTGC CCCTCAGTTA      2520
     GCTGCTGGTA GTTCATGGTT ACTCGCTCAT CTTTGGTCGG AAGAGGGGTA GCTTATCAGC      2580
     AGCTAACTCC CTCCTCACCA TTTTGACCGA GCGTTGCACT TATTATCTGA ATTCTGGTTG      2640
     CATCCATTTT TAATGCTGCA TGTTAAAGGC CAATGGGGTG ATCTATCCGA AGATGATAAG      2700
     CAGGCAAACG ATGAAGCATT AAATCAAACG GGTGGCCGCT TGTTGTCTGC TTATAATTTA      2760
     CCACAGGGTA AAATTTGGAT CGTGACCGAA GCGGATAGAA GTAGCAGCAC CGTTTTACTA      2820
     CCAAGCGAAT ATTAAGCTGT AAGGCTTGCA GAGAACGCAC TCATTGAGTG CGTTTTTTTT      2880
     GCCTGTAAAT CCCGCGATAC TTTTGCCGCT TCATACGGCA GCCGCCTAGC AAAAATCGAA      2940
     AATCCCCCAA AAACCCCTAA AAAATGAAAA GTGCAAAACC CTGGCAAAAT AGTGAAGTTG      3000
     GAACCTTGAA AATAAGACCA CACCCCACGC AAGAATTGAT AAATCGATTC TCATGGTTGT      3060
     TTGTGGTGTA AGTGATTGAA TTTAAAGTGC GTAATTTAAG TTTTAAATAA AAATTATTTT      3120
     TTAAAAATTC GTTTGAAATT TACCATAAAG TGTATTTCTC GCGTATCGCT TGTCAGGTGC      3180
     ATGTGTATTA GAACCCTATT CACGTTGGGT TGTAGAGGTG TGTATTTCAC TTGTATTGCA      3240
     AATTGGTGGG TTTTATAAGT CACTGTTTTA AAATTAATTA TTGCTTTGGT GTATTACTCG      3300
     TGAAATACTT GGAAATAGAG CGAAATACAT GTGAGCTACA CTCTTTATTG TGAAGAATCA      3360
     TTGTGTATTG CCGTTGTATC GTAGTTTTTT TCCTATTGAG GTATGAATAA TGGCTAGAAA      3420
     TAAAGTGATC CAAGTAGCGT GTCCTCCTGA TCTATATTCA AAAGTCCAAG ATTACAAAGG      3480
     GGCTAAAAAT CTGGCGAGTA ATGCTGATGC AATGAGGGAG TTAACCTTGT TTGCTCTGCG      3540
     GGTCATTGAG CATTCAAGTG ACGAAGATGA GGGGATTTCA ACAAGGGAAT TGCTCGAAGT      3600
     TCTTCTTGGT AATGTGATAA AAATCCATCA TCAAACCTCT ATCAACTACT ATCAAAATTT      3660
     CAACGAAGAA CAATACAATA ATAATATGAA AGAGCCTGAT GTTGTTCCAT CATATAAAAG      3720
     GTTAATGGCT AAGGCTGAGG AAAGAACACA ACAAATATTG GAGGGTGATA AAAATTAGAA      3780
     ATATATCGTG CGACAATTAA AAAAGGAGGT TAACACCTCC ATTTTTATTT ACATTGTTTT      3840
     TTCACCAATA TCCAATTTAG GATTGTCGAT GTTGGGGCTA TGTTCTTTCG TGGGTGAACG      3900
     GTGGCTATCC ATTGCTAAAT GTTGATAGTG TTCATCGTGC TTTATTTTAT TCGTCGCTAC      3960
     GTTAGTGCTG TCATCCTTCA TCGTGATATT TTTTGTGCCT GCAATATCAT TACTCAGTGA      4020
     TTGAATGGCT TTAGATAGGG TGTTGTCTTT TGTCGTTATG CTATAGACCG CTTCATTGAC      4080
     TAATTGTTTT GTCGTTTCGA CTTTGTTTAA GCCGTCAGGT ATCAGATTGG GTTCAATAAT      4140
     AACCGCATGT ATATTCTCCT TGCTGAATTT ATCCGTAAGG TCACTTGCCA GTTTTGCAGT      4200
     GTCTTGTGAA TTACTAGTAT CAAGTACCAC TATCACGTTT TCGCGCAATT CATTTGTATT      4260
     GAATGTTTTA GTGTCATTAT TATTGTTTAG CGCAATAACG TCAGCCCCGT TTTTATTGTC      4320
     AGCATTTATC TTAAGCGCGT TCTCTACACC GACAGCGACA ATACTATAGT CTGAATTATT      4380
     GCCTTTGTTG ATCGTCGTGC TGTTCCCAGA TTTAGAGCCG AGTATGCGCT TATTTATTTT      4440
     TAGCGCTGCA ATGTCACCGC TGGATTTATC AAGGTAAGTA ATTTCTACCG CCTTAGTCTC      4500
     ATCTTTATCA TTGGTGATGT TCGCAATTAA TGCGGGGAAG GTCCCACGTT TTTCTGACGA      4560
     ATAAACGGCA TCGTGAAAAC GTAAGTTTTC ATGCTGCTTT ACGTCGATGC CTTGCTTGTT      4620
     TAAATACGTC TGTGCGAGTG AGTTTTCGAT AGGTTTCGCT TCATTAAAGT ATTGCTTCGC      4680
     GCGCGCTTCT AATTGACTTT GCTTAACCGG AATGGCATGT GTTAATTCAT CATGCTGTGG      4740
     GTTTTTTACC AGATTATATT TATCGGGTTC GTTCATCATT TTATCGGCTT TATAAAGTGC      4800
     ATCTTTATAA CTGCACTTTT CAGCGACCAT AATCAGGTTG ATTAAGGTGC CTTTATCGCC      4860
     GGTTTTCCAG TCTTTAAAAT AGCCACGATA TTGGCCCGTT GTGGTCAATG TTAGGCTCCC      4920
     CTCTTTGCCA AATGTCAGGT TATCTTTGTC TGATTTATCG TGGTTCGGCT CACCTAAAAG      4980
     CTGCGTTGCC AGTGATTCAC TGTAGGCCGG AAGCTTGGCA TTTAGCTCGG TGGCCATCAG      5040
     TTTTAGATCC ACATATCCAT TCACATCGAG GTACTTTGGG TTTTCCTGCG GTAAAGGTTT      5100
     GTCATTAAAT AGCGGGGTAT GTTCAGGGTA ATATTTATCT CTTGTCTCAA GTGCAGAGAC      5160
     TTTATTGGGA TCGTTATTGA CCCATGAGAG CATCATTTTT TGCGGGTTAT CGGTGATGAT      5220
     TTTTACGTGC TTACTGGCAC GGGTGATATC GATATACGCG CGCCTTACGT TAGTTAATGC      5280
     ACCCTGGCCC TTAATCGCAG TAATGACATT CTCATAGGTT GCCCCTTGCG CCATATCGGC      5340
     GGTGCGGGTG TATGCGTAAT CCCAATGAGC ATCTTTCAAC TCTTTGGTTG AGAGCGTTAA      5400
     TGTGTGGTTA TCCGTGGATT TGAGCTGCAT TTGTTTATCG TCAATGCGGC TAACGGTATA      5460
     GGTTTTGTTG CCCTGCATTT CACGGTCAAT ATCGCTTTTG CGGAGCATGA TACTGTCGCC      5520
     TTCTGCGAGA GGTTGCTCAC TCTTAGCCCA AAGGTTCGTG AATTTGTGGC CATGATTTTT      5580
     GGGGAAGAAA TGCTTTTCCT CGCCAGTTTT CATATCCGCG AGGGTGAGCA TGTTATTGCG      5640
     CTTATCGACC TTCATAATTT CAAAATAACT GTCTTTACTG GTCGTCAGGA TTAACCCCTG      5700
     CTGATAGGGC AACATGGTCG CCAGTTCGGC CTTGCTGGCA TGGACTCCAC GTAATCTCGG      5760
     TACAGTGAAT TGCTCGTTAC TGAGGCTTTT TTGTTGCTGT AACCCTTGGC GGATTTCGTG      5820
     GGTAATGTCG TCGCGTTCCT TGTTGGTGTA CGCAATGATA AGGGTATTTT CACGCGCTTT      5880
     AGGTGTTCTG GCCAAGTATT CCAGTGCCAC AGTGGCGGGC AGGGCTTCGG TCGCAAGTTG      5940
     CTGGTTTTTC TTTGGGTTAT CAGTTAGCGG CTGCAAAGTT GAAATGATAT TCAAGCTTTG      6000
     ATTGATGTTA GCGGTAGCCT GCTTTTCGGG CGTTACCGCG TCGTTCGCGG TGGGCGCGGT      6060
     GTATTGGTCA AAGGGTAATT GTTGCTGAAT TTTATCAATA GCGCTTTCGC CTTGGCGATC      6120
     GACAATATTG TGTACCGCAC TCAGTAGTGT GCTGTTCTGT TGGCGCACAA TGTCTTTCAT      6180
     GGTGACGCTA TTGATTGCGC CTTTGTTTAA CGCGAGTTCA AAAGGTTTAC CCGCTTCTTG      6240
     GGACGTTAAC TGTTTAGTGT CACCCAAGAA CACGGCGCGC GCGCCTGTTG TCTCAATCAA      6300
     ATGGGTAAAT TTATCCATTT GGGCGTTACT GGTCATCGAG GATTCATCGA GCAAGAACAC      6360
     GGTGTTGGCG TATTGGTCAG GTTTCGCATC TTGGCTTAAA AAGTTGCTTA GGAGTGATTG      6420
     CACCGTTTGG CTTTCGACGT TCTTGTCTTT GAGTTCGTTA ACGGCGGCGT GTGTCGGCGC      6480
     TAGACCGATG AATTGTGTCG GTGTCTTATT GGGTTGTGTG TTGAGAATGG ATTCGCTTTG      6540
     TTTAACAAGA TCGATACCCG TTTCAAGCAT GGTCGATTTA CCCGTACCCG CTAACCCTTG      6600
     AACACCCACA AATCGGTCTT TGGTGGTGGT GATAAGCAAG GTCGCGTCTT TTTGGCCATC      6660
     GGTCAGGTTT TGATTTTGAC TGAGTACCTG CGCGGCGTGT TCAACGCTGG TAAGGGGCGC      6720
     AAGTTGATCT TTGCCCGCTT GCAGTCTGTC TAAAATACGC ACTTCGGTAT CGATAGCGGC      6780
     TTGGGTTGTC CAGCGGGTGC CGTCGTGGTA TTCGGCGCTC AGGAGTGAGG GCGCGCCTTT      6840
     ATCCGTGCTG TTCGTGGCCA TGTGTTGCAG GGTGTTGATG ATTTCATGTT GGGTAATGCT      6900
     GGTGCCTTTT TCCTCAAATG CGTACTTGAT CGCATTAACA ATCAGCTCTT TTTGTGAGTA      6960
     ACCGGCTTCT TTCTCGCTAA TGTGCTGGAT GGCAAAGTCC ACGGCATTGT GAATAAGCCC      7020
     TTTGTCTTGA TGCTGGGCAC CAATGGCATT CAGTGCTGCG GTCACATCTT GGGTGAGCAG      7080
     GGCCGTGGTT TGGCTATTCA CGAACTTTTC TGGCATGTCA GCGGCTTGCA TGATGCGCGA      7140
     AATACTGGAT GGTTTCACCT CACTTTTTTC TAATCGGTCA TCAAATTGTT GTGCCTTGTC      7200
     GGTGAATATA TCGATGTGTT TGATGCCTTG TGTCAGGGTG TCATGTAACC ACTCTTTTGA      7260
     GGCGCTATAG GCTTTAATGT TGACGATGTG GTGACTTGCA TTAGGGCTGG CATTGCTTGG      7320
     CGTGGTGGCG TAACCATGAT TGAGCGGCGC ATGGTGCAAT GCACTGGCTT TAACGCTGTG      7380
     CTGTTTGCCG CTTTCGTCTT TGAGCGTGAC CCATTCTTTG GACAGGGCGT TGATCGTATA      7440
     AATTTGTTTG CTCAAACCAC TGTCTTGATG GTTTGTGGCC ATGATGAGTT TATCGCCGTT      7500
     GGCGATATGT AAATTGTCCG GTTTAGCGAT CACGTACTCT GCGGCTTTAA AGGCTTTGCT      7560
     GCTGGGGTTA ATCTCAGATG CTTTACCGTT TTTGTCTATC AGCGTGAGGG TGTTGTTATC      7620
     ACGGTTTACA CTGTCCACCG TCAATTGCTG CTGTTGATTG CGGCCACCGA CTTTTTGCCA      7680
     TTGGGTGAGT ACCATGCCCT TGGTGTACTG GCCGACGACT TCCCGTTGCT GCGCGGATAA      7740
     GAACACGGGA TTAAGGGTAG GGATGTTGAG CCCAAGGCGC GATACATCAC CTTGATTTTG      7800
     CAGTTCTGCG CGAATGGCGC TGTTAAGCTG CTTCACATCT TTATGGGTGC CCGCAATGAC      7860
     TTGGGTGTGT TGCTTCTCGG GCAGTTGCGC GTAAGTTTTT GCAATCAGGT TAACCCTGTC      7920
     ACTGTCTTTG CTTTCATGCA GTCGCATGGC TGTGTTGCTT TGTTTGGTGG CGACCCAGTT      7980
     GCTTTCGTTT ACGTTGCCTT TTTTAAGTAC CTCGATAGCG TTACCGGCTT TCATGCCTTG      8040
     CTTGGCATTG GCGTGATTGA GCAAAATCAC TTTACTGTTA CCCGCTTTGG CTTGCGCGAG      8100
     CAGGGCATTA AAGTCGTTAA GGCCGAGTTT ATTGGCGTTC TCAACCACTA AAATATCGCG      8160
     GTTAGTGTTG TTGGCCGTTT TAGTAAAGCT GCTGAGTGTA TGGGTGTGGT CGGGTTTGAA      8220
     GTGGTTCATT ATCCACTTCA CCACAGTCGA TGAATCGCGT TGCACTCGTT CACTGGTTTG      8280
     CAGTTTGCTT TTCATGTCAG GGGTAATGAT GTGAATACGT TTACCGTTGG CCTCACCGAC      8340
     ATTGAGCAGG GCGGTCGCGA GCTGTTCACT GCTACCAAAG ACGTTCACTA GGTTAACTTG      8400
     TTTGGTACTG GCGAACAGTT CAGAGACTTT CTTTTGGTTG TCCGCATTTA AGCCTTTGCC      8460
     TTGAAGCGTG TTGGTATCGA CCACTTGGCG CATGTTGGCC GTTTTTGGCT TGATGCTCTC      8520
     TAGCAGGTTA GTTTCGGCTT TGATGTGGGC GGCGCTGGTA AAGGTCGCAG ACTCTTTATC      8580
     AAGCGGAATG AGTGCGCCAT CTTCAATGTG CTTATCGAGT GCCAATTTAA TATCGAGCGC      8640
     ATCGAGCTTC TGGCCGCGCG TAAATTCAAG CGTGGCTGAT TCCACTAATT TCGCGTAATT      8700
     AAAACGGTTT TGGGTGTTAC TGGCGTGCTC AATCGCACGA CTCACCGCAT CGATAGCGGC      8760
     GGGTTTGAGC GCTAACGCAT TGAGTGATGT TTCTCGTGAC ATGCTGTCCG TCACGAAGCT      8820
     TGTCAGGTTA AAGCCGCTGT TATTGGCTTT GTTTTTCCAT TGCTCAAACA AGGTGGCTTC      8880
     GCTGGTATAG GCTTTACTCT TGCGGGTGTC CTTTGCGGCC ACATCCCGCG CCGCTTGGGA      8940
     GTCTAAACCT AAGCTTTGGG TTTGTTCGTT GATTTGCTGG CTACGGGTTG AAAAGGTATC      9000
     GAGTAAGGAC TGCGGGACAC CTTCCACTTC AAACAAATTA TTACCCAGTG AACGAGTTTG      9060
     ATAACCCGCT TGTTCAACAC TGCGCGCTAA GGCGCTTTGA TAGAGCGAGG TGTAGTATTT      9120
     TTGATGGTTA TAAACCCGCT CACCCGTGCC ATTGATGATG CCGCCTTTTT GTTTAAAGCT      9180
     GCTTGCCAGC GCGCGCAATG TGCCCTCGCT GTCCTTGGTC ATGTTGGCGG TGAGTGAGTG      9240
     GGTATGCAGC TGCGGATCTT CTTCACGGCT AGTTTTGTGG CGTACCATTG CAAACAGCAA      9300
     ATTGCCCGTG TTTTCAAAAG AGGTCGCTTT GGTATCAGGG TTGGTTTGTC TGGCCTGCGC      9360
     CGCATCTTTC TCGATATGCG ATAACGCGAA TTTTACCGCG TCATCGTGCG CTGTCATTAA      9420
     GCGTTTATCG CCGCCCACGA GTGCAAGCAA ACTGACGGAT TTAGGCGCCG AAAAGGTAAA      9480
     GTCAAAACCG TTGCGGGCGT TGCTGTTTTG GGTTTTAAGC GTTTGGTCGT TCAGGCTACC      9540
     GGCTAACACC TCTTTGAGTT GATGTTCTTC AACGGGCTTA CCTAACATTC CCTCTTGCTC      9600
     TGCCAGTTTG CCAAACCATT GGGTATTGGG CTCGGCGCTT TGCTCTTTCA AGTAATAGTT      9660
     GGTTTCCCCT TCTTTGGCGT CCGCTGCTTT TTCTAACGAC ACGTCAGGCA AATTGAGGTT      9720
     CTTTTCTTCA CTGAGGTAGT AGCTGGCCGC GCCGCCAGCG CTCGACGCAA TGGGACTGAT      9780
     AGAAAGCATG GTGGCACTCC TTTGGTCTGT CGATAAGGAG TGTGTCAAGC ATTGCAACGG      9840
     GGGGGGAGTT GGGTGCTCAT GGCCAATAAC ATCACAATCC AAAAATAGGG GAGGGTTCGG      9900
     ATGCCTCCCC TATGTTCGCT AGTCTCTTAC TTCGTAGGCA AGTACCGCTT TGAACAACGC      9960
     CGTACCGTTA CGGTACTCCA CCTCACACAA ATCATTCCTG ACCAGTGCCA GTGCGACTAT     10020
     CAACGTGAAA CACACGATAG CCAGACTCAA GATGGCGGTA TTTTTCTTCG GCATAACTTG     10080
     CCCCTTAAAA GTAAAGAGGC TACTATCTGT ATTGCTATGT ACATTAGATT GCCTCGTTGG     10140
     TTAATGGATT AACTACGGGG CTTTCGTCTA TCTGGCCTTT GCAAATCTAT GCTCTTGCCA     10200
     AACAGCCAAG AGCACCCGCG ACTATGCTAA CACACTCGAT CTTTTCTTAG TTACTCTTGC     10260
     GCTAACTGTT GTTGAATTTC TTCTTGGGTA AATCCCATCT CTTTCAAATC TCGGATGGCT     10320
     TCAATTCGAC GCATGACATT CATCCGTTCA TTGTCATTTT TAGAGGCTTT ACGTGAGGGC     10380
     TTTTTCGCCG ACAATTCGGG CGCTCGTGTC GTGGTGTTGA ATGAGGTCAT CGTTTTAGCT     10440
     CCTTTCGTTT AGCGATTTCG CCGTAGGGCG GGGATACCAG GAATTTCTCT AGCTCTGCTT     10500
     TAGCGGCTAC AACCTCGCTT TCCCAAAACG AGAGGTCATT GAGGGACACT ACCGATGAAC     10560
     CATCAGCCAA TTTTCGACTG ACGCTATCGT GCTTTGCTTG GGCGGCCTCA CGTCGAAGCA     10620
     GTGCCTTTTT CACCTCAGGA TGTTCAAGCT GACTTAGATA GGCTTCTTCA AGTGCTGTTA     10680
     TGGGATTAAT TACCGTCGCA TTCATACGTT TTTCCTTTTT GTTTGAGACC TGTTAACCAA     10740
     TTTCTGCGTC TTCTACAGAC ACGATTTGCA GCTCTTCAAG TCGCTGTGCA TCCTCAATGT     10800
     GCTGGTCATT GGCCTTTTGT TTTTCAGCGG CTTTTTTCTT CTCTGCATCC TTGAGCGCTA     10860
     ACTCAGTCGG TTTGGCCTTT TTCGCATCGA TGAGGCTTTG GGCGACCGCA TCGGTTTTTT     10920
     CAGCAAGTTT GGTCATGCGC TGCGCTTCCG CGCTGCGTTC ATCATTGTTT TCATCACCTT     10980
     CATACATGGT GTCATGAATG CTTTGGAGCT TGGTTTTATC CGCTTTATCG ACGTGTTGAA     11040
     CCGCACTGAA CTGGTGATAG TTCAGACTCC ATTCAATCTG CTTTATGTTT TCAGACGGGG     11100
     TGTAGTTACG TTTGATAAAC GGGGCGCACA GTGAGCGCAT TTGGTTAAAG ACTAAATCCA     11160
     CTCTTACCAC GGGATAATTG CCAGGCGTGC GTAGCCAAAA TTGTAAATCT TCAAGCTGCA     11220
     TGATTTCAGA GGGCGTGACC ACAGGGCGGG TAATGGTTTG ATGGCCCAGT GATACGCCAT     11280
     CCCTGATTTC ATTAGCACCG TAGCTGTATT GCTCTTTAGA GACATCAACT TCTTGCTCGC     11340
     CTAAATCGTG AGACGAGATT TTGGCCATTT CGTTAGAGGG TGAGCGGAAA AATAAGCGAG     11400
     TGTTGAGCAA GTCGAACATT TCAAGTGCCG CATTTTCGCC ATAGACTTTT TTAAGCTGCG     11460
     CGAATGACTG AATGCCTATG ACATAACAAC CGCCGAACTT ACGCACTTCG GCGATTGTTT     11520
     CGGCAAGTTC AGGTAACTTG TGCAAGCTTG GTGCTTCATC CATCAACACC CAAATTCTGC     11580
     GGTCGGGATC TTCGTCTTGT TCTAAAATGG CGGTCGATGC AATGGATAGC CACATTGAGA     11640
     TCAAGGGGCG CAATGATGCA TGTTGCTGTG CGTTACTGGA TAGAAATAGA AAGCCATTTT     11700
     CGGCATCGTT TTTCACCCAC TCACGAATTG AAAATTTGCG GCGAAGGAGT TTTCCCTGTT     11760
     CGTCCTTTTC ATCCAGTCCG GCAAGGAATC GTAATGATTT GATGTAAGCC GCGAGAACCG     11820
     ACTTAATGGA TATCGCCGTT TTTTGGATTT TATCGGATAC CAGTGAGGCC GATTCGGTCC     11880
     CTTTAAGATA CTCACTTAAG GACTCAAGCT CGCTGGTCAG CATGAGTTCA AGCAGTCGTT     11940
     CTGTGGTTTG GTTCTTTTTA GGTTCATCTT GCATCTTAAA TGCAGTAGAT GAAAAAATGG     12000
     TGCGAGCAGA TTGCACCCAA AATGGATCGC CCTCGCCGTG TTGGGGAATG AGCGCGCTTG     12060
     CCATGTTCTC AAAATCCGAG GGTTCATGCG CATCACACCA CACATCCCAG TAAGCACAGC     12120
     GTTCATCAAA CGGGTTGAGT AGTACGTCCG TTGCCGGATT ATAGAACTTG CTGACAAAGG     12180
     TACAGCCTTT GTCATAGATA ATGGCTTTGT CGCCCCGTTC ACGTATCCAC GTTAAAAACT     12240
     TACGCAGCGC CACGGACTTT CCCGCGCCCG TGGTGCCATC AAGTAGCAAG TGCTGTACTT     12300
     CAAAGCGTTC TTTGAAAATA CCAATGCCAT CGAGCTTGAA ATCGGATTGG CGCTTGTCTT     12360
     TTTTAAGCTG TTTTGCTAAT TCTTTCGGCG TGGCTTTTTG CATGCCCCGA ATAAAGTGTT     12420
     CCTCGGTTTG CTCGTCCCCT TTTTTCTTGA AATACCACAT GGCCACGGAC AGAAAAACGA     12480
     TGCCAATCAC ACAGCTTATA AGGAGATAAA TTTGTGTCCA CAACCAAAAG CGGCTGTTGG     12540
     CCGCAATCAG TGTCGGGTTT TCTAATTGAG ACCCTAACGT ACTGGTATAG ACTGTGCCTT     12600
     GCCACTGCGT TTGCATAACA TGACTGTCTG GTCTAAACAC GCTAACCGTT TGGTTTATCC     12660
     AATAATAATA AGCGCCCATT AAGGTGTCTT TATCAAGGAA GAGATAGCAT AGCAGCGCTG     12720
     TTAAGATGAG CACGCCATAA CACGTCCAGC GGATAAGCAC GGCGTTAATC TGCAGGAACA     12780
     TCCGCAAATT GTGAAATAAA ATCTGGCCAC CACGGGTGTA GTTACTGCCT TTAGTACGTT     12840
     TGGGGTTTAA GGTCACGTCT AGGGTTCCTT TTTCGGGTTA TTGGCTTCGA GGGCTTTGAG     12900
     CTCAGCTATA GGTTTCTTTT CAATAGCGCG ATACTTTAGG TCAGTAAAAG ATAAGAGTAT     12960
     GTTGTAAACG TTGTACTCCA GTCGGATATG GGTGGTGTCA TTTTGAAATT CGGTTTTATC     13020
     GAGGCGTAAT GGCTCCGATA CGAAAGGGGC CATTTTTATG CGTGGGTATT GGCGGCTAAG     13080
     TTGTTCTTCT AGCGCCTTAT ACTTTTCTAA GGAGCTTGGG AAGGTAAAAT TGATGCGGCC     13140
     TAAGGTTTGG GTATTATCAA AATAGAGGGT GGCATGCTTA AGCAACGGCT CATTAAACTG     13200
     CTCACCACTC ACACGATAAT AATTCCAGCT ATCAGGCAAT CCCGATGCGG TATTTTTGTC     13260
     TTGGAGGGTG TAGCTTTGCT CAACCTCTTG TCTCGTGGAT TTGCCCAAGG TGAGGCCAAA     13320
     CAGTGTGGTA TCAGCCTGCG CCAAGGGGCT TAATAAGCAC AGCAACAGTG CACCTGTTTT     13380
     AATGATGTTC ATGAGGTTAT CTCTTTGTGA TTGAAAGTCA TGGCTATTAT CACATTTTTG     13440
     GTCCTGTATT AAAGGGACTT GATTGACGCA CTGTTTCTGC CATTTTTTCA TCGTCACTTC     13500
     GATTGTCTGG CTTTATTAGG GCGTGCGCCG CTTTTGCGTC AGCACGGGCC TGTTCCATAT     13560
     CAATGCTCGG GACGCTAGAC GCGTTATGAG TCTGTTCTTC GTGCAACACA TCTTGTCTAA     13620
     TTTCCGCATT GCCTTGCGCC GCATGGCCTT GGATGCGCTC AAATTCGCCC GTTTGATAGA     13680
     GGCTGTCATT GAACGGCGCT GGGGCATACT GTGGTGATTG CTGTTTATTG AAATCAATGT     13740
     CAGCGGCGTA ACGCTCCTGA GCTTGCATAA TGTCATCTCG GTTTTGCGGT AATTCATTGT     13800
     TCTTGTATTG CTCTACCATC GCTTTGACTT TCGGGCTGTT CGTAAATTCG GCCGCGAGTT     13860
     GGTTTCGCTC TTGCTGCATT TCTGGTGTTT GTCCTTTGAT CACCTCCATG AAATCACCTT     13920
     GCTTATCTCT TGCGTCTTGT ACGTAATCAA CAAAATCTTG ATTAAAGTCA CGCCCAATAC     13980
     TGATTGAGCC ACTTTTGACA TTATTGGCGA GGTCAGTGTA ACTTTGGGCT TCGGTGAGCT     14040
     GGGATTGGGC GTTTTTGGTG TGGGTAATCG CTTCGTTAAG CCCTTGTAGG AAGGTTTGGG     14100
     TTTCACCTTC GTTTTTACTG TTGGTTGTAC TGGCTTGTTC GCCGCTGTTA TAGGATTTGA     14160
     CGGTGTTAAC GTTAGCGCTG AACTGGTCAA GGTAGCTTTG CTGGAGACTG TCACGTTCGC     14220
     TTTCACTGGT ACGGGCTGTG CTGACATCAT CGGTTGAGCC TTTAGTGCCG GTAGAGCCGG     14280
     ATACGTGCGC ACTAGAGCCA AGAAATCCAC TCCCAGGTGT GCCGAGTTTC ACGCCTGCTT     14340
     CTGCTCCGAC ATACATCGAT AATAAGGTAC TTGTGGCTTG GTCTTCTGTC AGGTTGAAGT     14400
     CCTTAGCAAA AGACTTAACC GTACTACGCA TATCTGCGAA GCCTTTGTTA TGAGTGCCAC     14460
     TGTCGCCGGT GGCGCTATTG CTGCCATAAC TGTTCGAGGT ATTGACCCCG CTCATTTGAC     14520
     TTAGTGCGGT ATTCGTGGAG GTGGCGATAC TTTCGCTTGC TTGTTTACCC TCTATTTTGC     14580
     TCGCACTGAT CGCGTTTGAG GCAGATTGCG AGGCCGAGTT CGTCACCACG TCACTGCCGC     14640
     TGATGTTCAC TGGCAAGCTA CGACTTAAGG CATTTTGGCC ATTAATGACT TGTCTGCCAT     14700
     CGTCAAAGGT GGTGGTCTCA TAGCCGGTTG CATCTTGCTT GGTGTTGCCA TGAATGCGTT     14760
     CAACGCCAGT GGTGTCGATT TTATTGCCGT TGGTGTTGTT GTAGCTGTAG TTATCCACCT     14820
     GAGCGTTACC CAAATTGATA TCACCACTTG CCGCACTCGC AGAGGTGCGC GCGTTAACGC     14880
     TGCTCATCAT GCCCGCGAAC TGATGCGACA TACTGCTCAT TACCGACGCG CCGCCTTTCA     14940
     TAATGAGCGG GACAATTAAT GTCGGTACGC TCATCATTAA AAAGCCGGTC ATGGCGGCAT     15000
     AGCGGGAGTG CATTTCTTGT AAGGGATCTA CGTTGCTTAA GGTGATACCG CCGTAAATGT     15060
     TAGTGATTTC GGTGGCGTTA AGGGATAAGC GCGTGGTCAT GATGAAGTTG ATGAGGGCAA     15120
     ACATCACCGG CCATGTGCCA AGGTAGATAA AGCCTTTGAA ATAGTTGCCG AGCACTTGAA     15180
     ACGTGAGTGA GGGGATCATG GCAATCGCCA CCACTAAAAA GGCGACAGAG CTAAACAGCA     15240
     AAAACAAAAT TGATTGCAGC ATGGGCAAAA ATTCGCGCGC CTGCAGGGCC ATTCCCGCCC     15300
     ACATCGATGT GGTTTGCATT TTGTTTTGTG TATAGGCGTA GTTGAATGCG GCGGCGGTGT     15360
     TGTTGCTCAC CGCTGCATCA TCCGCGAGGC CATTTCGCAA GGCGTTAATC GTCATGTTTT     15420
     GCAGCGTGAT TTGCGACGCG CTTTGACTGA TATTGGCGTA CTTTTGATAA CCACCACTGA     15480
     TGCTGGTATT CAAAAAGCTT TGTTGGCTTT TGGCCTTTTC ACCATAAATC CAACTGCCCA     15540
     GTAACTTGAT GCTTTTTGCG CTGTCAGCTT GGAAAAGTTG CTTGAGGCGC GGAAGGGCTT     15600
     CTTTGCAGGT AGGATAGTCA TTAGGGCCCA TTTGAATCGC CCGTAGCGGC GAAGGGTTGT     15660
     GAGTGGCTAG AAAGTCCCAA ATGTCCGGCG CATTGGCTAA ATCTCGCCAT GTGTATTTAT     15720
     GATTGAGTAG CATATCTCCG CGAATACAAC TGCTGATGTA GTGCTGCCAA TAGCCTTTAA     15780
     GTTGGGTGTT TTCTATCTCG CTTTGTCTGG ATAACTTGTA CAGCTCAGAG CCAAACATCA     15840
     TGCCCGTTTT ACTGTATTGT TGATCATCCG GTACGTGAAA AATATCTTCC ACCGTTTGGG     15900
     TGGTGGCATA CATATAATGC GATGCCCATG AGGCCGGAAA CGCCACAATC GCGGGCACAT     15960
     TGTCCACGCG ATAGTTACCC GTCGGATTGG TTAAATCGGT AATTTGCACC GTGGCGGTGG     16020
     TGTTCATGGC AAGCAATGGC ACGGCAAAGT AAACCGCGCA CCATTTCATA ATCGCGTTAT     16080
     GGTCACGCTT GATGAAAAAG TGCAGCGCGG TGGCCACCAC GGCAAACAGC GCACAGATGC     16140
     TTATCATGCT GGCAAATGAA TCGGACTTGA ACAGCACGGC AATGGCATTC ATCACTTGCT     16200
     TGGCCACGTC ACCGTTGCTG TAGGTGAAAA TCTCAACTGC CATGGTTATC GCTCCCCAAA     16260
     ATTCAAGTTG GCCTTAGCTT TAGCGCTCAT GGCGCCCGTT ATTTGCTGTT TGATTTGCTG     16320
     GTTTTGCATA ATGAGCTGAT GCTGCGATAC GGCCTCATTT TGAGCTTTAG CGGTGAGTCC     16380
     TTCTAAAAAG CGGTTGGCGT TGATAATGTC ACGCTCGATA CGATCAATGT CTTTGGGATC     16440
     ATTGTTGGTT GCCGTGATAG AGGATTTCAC AATCGACAGC ATGTTTTGCA GATAGAGGGT     16500
     AATAAACTGC ACGCTGATGA TTTTGGCGTA AGTATTGGTT TGGGGCGTGA GTCCTGCTTC     16560
     TAGTTCAGTG CGTAAAAAGG TCATGATGGG CAGTGTCGTG TATTCGAGCA GCGACTTGTC     16620
     GTTATCTGTT AGTGGCTGGT CGTTTTGCAT CTTGCTGGCG ATACCTCTGA GTAAGGTTTC     16680
     TACGCGGTAT TGCAGGCCGT GATTACTTTG GATGGTGATC GTTTGTTGTG TCGGTGCTAA     16740
     GCATTGGTCA ATGGCTTGAT TGGTGCATTG ATAACTTTCA GCTTTGCCGC CCTCTAACAG     16800
     ACTATTAATC AGGTTATTGT TGTCGGTCAG CAGTGAGCCA TAACCGCGCG CATTGCCGGT     16860
     CGCGTCATAA ATGTAAGTGC CTGAAATCGA CATGAGAAAT TCTGCCAAGG TCGGATCGCT     16920
     GGCAAGGAAG GTATTTTTTA AAATGGCGGC CCACACAATA TTGGTATTTT TGCGCACCAT     16980
     GTCTTTTAGT GCGGGATCTT TCTTGGCGTT ATCGAGCTGA TTGTTAGCTT GACCGCCCGC     17040
     GCCGCATTCT TGCTGGCCAG ATACCCAATC CGCAAACGCG TTATTTTGTG TGCCCATGGT     17100
     GGCACAAATG TATTTTTGAC TGCCAACACC TGCAAACCCC GCCAGTGCCG AGACACCCGC     17160
     TTGGGCACTC TCGCAAGAAT TGATCGACTG ATTGAGGTAC TTATCAGCAA TGGCCGTTAG     17220
     CGTGTCCTTA ATCTGTTTGA TTTGTGGTGC CCACGTCTGC AGGGCTAAAT CGACGGCGAA     17280
     CGGTGCAGCG TTGGCGATAA TAGCCTTGCC TTGTTGCACA AGGGCGTCAG AGTTAATGTG     17340
     GCTGAATCCC CCCATAAACA TATCAATACC GCCACAGCCT GCGGCAATGC TGGGCATTTG     17400
     CACACTCACG AGCTGCGCGT CGCGAATGGG GCTACGCACA AATAAATTGC CGCCGCTGTA     17460
     GTAGTTGGCG CTTTGGCCTT TGAATGAGCC CGGATTGGTC ACGTTCGTGC CATAGCCTAG     17520
     GCCATTGAAG AAATCGTTTA GCGAACCTGA AACCCCCGCA CTATGCGCGT GGGTTGTCAG     17580
     CAAGCATGAA ATAGTGACGC CCAGTAGTGT GCGCGTCAGT GCTAAGCGTT TCATGATTGA     17640
     CCTCCAGTAT TACCGCTTAT GTTGCCGCTT ATGTTGCCGC TTATGTTGCC ATTAAGGCGC     17700
     AGGTTTAGTG CGCGTAGCGC ACGCAAGCAA ACAGCACTTA GCAATGCATG CACTGGGACG     17760
     AGTACGAATT TATAGATGGC TAGGGCCAGT AAAATATTGA TGATTAACAT CGTGTCCATG     17820
     AGATTGCTCC TAACGCATGC TTGCAATGAC TTGTGGGTCA TTGAGGGATT GAAGGTAACT     17880
     TTGTTGAAGC TGCGAGGGCG TCACATCACC GACGGTTAAA CGGACAAACT TACGGGTATT     17940
     GACGTTGATT AAAAATGTGG CAGGCACTGT CACGCTGCGC GGGTTCTCAA AGAAGGTGGC     18000
     GGCAATGTCT GGCGTGGAAG GAATAGGCAC TTCAAAACCT GCTATGCCTT GGTTGTCGAG     18060
     CGAAAAGGCA TAGGTATAGG TGCCAGTTTG CGCGGCAAGC TGTTTCAGTT TCGGGGCGAA     18120
     CTGGTGGCAA AACGGGCAGT CAGAGCGAAA GAAAAACACT AACGCGTAAT CATTGGGATT     18180
     GGCTGCAACA GGTGTATCCA TCGTTGCTGT GTGGCCAAGG GATGATAACA GTAGCGTGAA     18240
     GATGCCGATA ATCAGGGTGG TGAGTTGTTT CATTGTGTCA CCTCAGTCGT GATGTTTGCT     18300
     GTGAATATGG GCGCGGTGGG CGGTTGGCCT AACGATAAAA AGAGCAGTTC CAAACTGGCT     18360
     TTTATGACGG CCAAAGCCAA CAACGCGCCA ACCCAAGGGG TGTTGAATGT GCCAATAAAA     18420
     ATCAATAGTG CGATGAGCGT GATAAGGCTT GTTAGTGCGT GATAAGCGAT TAAATGATGT     18480
     GTTGAGAGTG TGCGGTAATA TTGCAGCGGA GACGGAGGTT GCACGGCCTT TGGGGCGAAT     18540
     TCAAATCCTA GCATCTCAAT GGCTAAGCGG GTGCTCGTTT TGTTTGCGTG GTCTGCACTG     18600
     AACTGTTCAT CGAGTGTTAG GGTTGCGAAA AATAGGCTGG CAATGCAGTA AATGAGGGTG     18660
     AATATCGACA TCAACACGAT GGCGGGCGTT GCGGTTAAGC TGGGGAAGGT GTTCAAGAAG     18720
     CTCATGAATG CGAGCGGCAT TATCCCTAAT ACACGTGTTT GACTGCCTTG ATTGAAAAGG     18780
     TGTCTTGGCA TCAAAATAGC CGCGTTTTTA GGGGAGAGCA TCATGGGGTA AAGTATGAAT     18840
     AGTGCCCCGA ATACGACGGT GCAAAGGGTG AGAAAGGGGG CGCCGTTGAT ATCGTAAATC     18900
     GCACTCAACA CAAAACAGTA TGTGAAGGTG AATAGGGTTA AGCAGGGTAG TTTCTGCCTA     18960
     TTGATGGCTT TGAGCATCAT GTCGGTGATG TTTTTCAGGC TCATGGGGAA ATCCTTGTTT     19020
     AAGTGAGTCG TGTTATGCGT TAAAAGTCAG GGGCGAAATC GGTGGCCACG TTCAGGAAAC     19080
     GGCCCAGTAA ATCGTCTTGA GAGATAAAGC CATACGCGAG CGGTTTCATT TCCCCCGTGC     19140
     CAGGATTAAC TAACACGAGT GCGGGACTAA ACGGGACGTT TATGTGCTGG TCGTTTTGGC     19200
     GGTTCTGCAC GATGGCTGGC AGTGCTACAC CATCGAGCGT GACGCCAAGT AGCTCAATGC     19260
     CATGCTCAGT AGCGAATTGC TGCACGCTGG GCGCTAGCGC AATATCCATT TCTTCTTGGC     19320
     CTTTGTAGAC AAAGAACAGC CCCCATCCCG CATCGGCAAG GCTGCGTACT GCGCGCATCT     19380
     TCTTGTTGCG CTCTAATGAT AAATAGGTGC TTCTTGCCGC TTGTTCCGTC GGTCTATCTT     19440
     TGGTGTAAGA CAGCTCAGGG TTATCCAGCA GGACCTTTTT GAAGGTCATG CCAAACTCTG     19500
     ACGATTTATT ACTGACGTAC TGATTAAGCA GCATGGCCTT TTCCACTTTC TCGCTGTCTT     19560
     GGCTGTTTAT CGCCGCGTCA TTGAGCGTGT CTTGGTAGTA GCTGTGGAAC CAATCCATCT     19620
     GCTCGGTGGG CGTCAGCGTT TTGGTGCGCG TGAGTGTGAC GCTTGGCGTT TCGGCCTTTT     19680
     TAGGCGCTTG CTTCTTGGGG GCTGTCGGTT CGTTATACCA GCGCCACCCT TGTGCATCCG     19740
     TGGCGTTTGC ACCGTGGCAA AACGTTGTCA GCATAAGGAG CACTAACGCG CTGCGCTTGT     19800
     TGACCACTGC ATCCCCATTT TTTGTGGACA ACCACGCCAA CGGCGCGCGG CTTGACCACC     19860
     GAAAAAAAGG AGATGCTGCG GCATGTTGTA AGCGGTTATT TAACAACGTC CTCATGGTTT     19920
     GGTTCCTCCA ACCGACTGTT GTAAGCGTTT TTGAATTTCG TCAGTGCTGG GCAGTTCGAT     19980
     GGCGTCGTAC ATGTCTTCAT AAAAATCAGA AAAGTCCATT GACGACATAT CAATGCGTTG     20040
     CAGTTCGTTG GGGGAAAAGG CGCTGCAATC AGGATGCTTG GCGCTGCCAA AGTTTTTACC     20100
     CAATTGCGCG CGGCCTTCAA CCTGCACAAT GCGCGCGAGT TTGCTATCAA ACGCGCAATA     20160
     GGCTTTTTTC TTGCGGATAC ACACGCCAAG TACTTTCTCA GCGCAATATT GGCCAAGTGA     20220
     TACGGTGAGC TTGTCTTCTT TGGCAGTGCC CAGCGCTTTT TCTTCTTCAC TGCAGGACGT     20280
     TAAGCCGATG CCGTTACCCC AACCGCTGTC CTGACAACAA TTGCTTATCC CCAGCGCTTT     20340
     ATCGCTGCAT TCCATGATGT TGCCTTTGAA AATGATGGCG CTGTTTTCGT TGATGTTGGC     20400
     TTTGTCTTTC ACATCACCGG CTGCGTCACT GACGGCGGCC AGTCCTGCCG CAGCATGGTT     20460
     AAAGTCAGTG CTGCGAGTGG CCGCAGGATC GTAATAGTCA CCACTGAGCG CAAAGCTGTC     20520
     TGCACCGCAG ATAAGGCCCG TATCACGGCA TTGCTGTTTA TCACATAGGC GTTGTTGTTT     20580
     ATCTTTAATG CAAACGCCGC CAAGTTGGGT GTCACAACTG GTCGATTGAA TACTGCAATC     20640
     TGCGATGGCG TCGCAGGTAT TGGGAAAGGC ACATTGATAG GTGGTTTCTT CTTTCCAGCA     20700
     ATCCAATGTC ACGCTGATCC CATTAATCAT GCGTGTTTCT TTACCTTCAA TACATTGAGA     20760
     TTGGACTTGT TGGCACTCGG GGAGGACTGC GCCGCAACTG TTGTTGTAGC CAATTTCAAC     20820
     GTCGCTTTCT GTTGTCACGA ATGTGATCGG TAGATTTTCG ATTGGGAGGT AAAAAGCCCA     20880
     ATCCCATGTA CCACCCAGAA TAGTGCCAAT ATTGACTGTA AGTGGTGATG TACCGCCTTG     20940
     ATAGTTATCA GTGCTTAAGG TGGCGTTGAC ACTTGAGGGA CAAAAGCCAT TTACAATGCA     21000
     GTCACCAGCG GCGCGTTGTG AAGGAATGTG GCCGATATAG ATGTCATTAA GTTTGATTTC     21060
     AAGTTTTGTC GCGCCACCCC AACTTGAGTA ATCGCCGTTG AATCGTATCC GTTTAATTTC     21120
     AGCGTTGGGA TTAGGCAGTG TAATGGTAAA TGGCGGCTTA CCTGACAACC GGAATGAGTG     21180
     CTCTTTTTCA CGCGTTGACG TGCTTTTGAC AAAGGGTGTT AGGTAGCATT GCACCGGATT     21240
     ATTGGTGGGC AACGTGCAAG AACGTGGCTG AGAATCGACT TCACAAACGA GCCCTTTTTC     21300
     ACAGTCATGA TATTTAGATG AAATGCCGTG GCTGATATTG TAAGCATCAT TTTGATAGCC     21360
     AACGGCGGTA TGGTATGCCG GATCGTTTTC ATCAATCGTC GGGCGGCCAT TATTAAAGCC     21420
     ACTCGTCACG GCTTGGGCTT GGCCATCCGT GCTCATGCCT TGCATTTTGG CACTGTCCAT     21480
     GGCGCTCGGG TTGTTGTAGT AACGGCTTTC GCTTGGGTTA GCGACTTCTT GCTGACATGT     21540
     CGCATCTTTG CATAGGCTGT TAACGTCAAA ACCGGTGTAA CCCGCTTTGT TCTGATTCTG     21600
     CTTGATACTG TCTTTGGCCC ACTGCACATT ATCGCGGTAA TCCTTTTCGC TGTTTGCCGC     21660
     CATAACAGGC AAGGCGGCAC TCAATGTGAG GATGGCACTG AGGATTAAGG CATTATTCAA     21720
     CTGAGTCATT TCGCCCCCTT TGCTAATGTC TTCGCCGCCA CATCGGGAAT GCTGCCGTGT     21780
     TGTGCAAGTA AGTTCAGCGC GTCATACAAC GAAACGTTGC CGTAAATCAC GTCAAAGTCA     21840
     TCGCTGCTGC AGGGCTGTTT TGCCTGACAT TTGTTGGGTC TTACAGCAAC AAAGGCGGGT     21900
     ACTTGGGTAA TGCCGAATTG CGTAAACCAC TGGGGATTAA TCGCAAAACC GCTCTGTATG     21960
     GTTTTACCCT TGTTATCGAT GAGGTGGTTC ATCTGTTTAA CGGTGGCGGT AAAGCCTTGA     22020
     GGCAGTACAC CGCGCACAAT GAGTGGCACT TGTAAGTCTG CGCTTTGCAT GAGCAATTGC     22080
     TGCAAACTGG TGGCAGGCAT ACCCAACGAC ACAAATACCA TCACACCATT AGCATCGGCA     22140
     CTGGGGTTGG GCTTTGCATC GAGCAATGGT GATAGCGCGT TGTCTAATTG GCCTTTGCTT     22200
     TGCGCTTCGA ACTGACGAGC TTTATCAAAC AGTGCGGCTT GGTCTACGTT CAGTGGGGGT     22260
     AATGTGTGGC GTTCTCGCAT CGACAGCGCT TTTAATTCGT CAATACTGTA ATCCGTTTGG     22320
     GCGAACACCT GTGAAATTGA TCCAAGGCAC AATAAGCTCA TGAGCAGGGC TAAGCCTTTA     22380
     AATGAATGTG AAAATAGGCT GTTATCCACA ATTTTTGTGC ATAAAGCGGT ATATGTTGTT     22440
     GGTAATTTGG TCTCAAACTT TTTCATCGAA AATCCCTCTC CTTATTGTTC ACAAAAACAC     22500
     GCAATTGCGT TTTTTGAAGT TGATAAAACC AAAGTTGTCA CCCGACACAG GGTTGTCGTG     22560
     GCCACTTTCC CAGATCACCG TTGTCGTGGT GTAAGGGTGC GCCCATAGCG CATCGGGTAT     22620
     GGTGTTGGTC ATTTGATAGC GATAGCGGGA TTTGGGCATG AGGGGCATCG GCGTTTGATA     22680
     GCAAATTGCG CCGTCTTCAC CGTGGGATTC CCATACGATG CCTTGGCGAT GCAATTTGTA     22740
     GTTCAGGCGC TCTAAAATCA ACGTACCCGC CTGAATGGGC GTGTCGCGGT AATTGGTGGT     22800
     GCCAGTCAGG GGGTAGGCAC TGCCTTGTGA GCCCATACAC CAAAACAGAA AATCAAAAGG     22860
     CAATATGCTG TTAGTTGAGG TGGCCACGGC TTCGGTTGCA CAGGCGAGTT GTGACACTAA     22920
     ATTGCCAAAT AAAATGGCTT CGGGATTGAG GATAAATGAC AACTCGTCAT CATCCCACAG     22980
     TGGATCTATC TCTGTTAAAT AGGCAATGTC GAAATTGTCT GTGGCCATAC AGGCTGCGCT     23040
     TTGCATAATT TGCAGCCAAT AAATTACTGG GTATTTGTAC CAGTGCCCAT GATAAAACGC     23100
     GCCATCACTG GCATCGTTAT CGCGACTTGT AACGCGACCG CCAATTTGGG GGGAATTACT     23160
     CATGTCGAGC TTCATGCCCA TGTTGACCAT GCAGTAAGGG ACGCGCGTCA CGTCCACTAA     23220
     GGTATCAGGC TCCCAGTAGC CGATATTCAA GCCAATTTGC ATAAAAATAG GCGGCGGTTT     23280
     GGGACAAAAT GAAATGGGTG ATACGGGGTT GCGCGTATCG GGTAGGCTCC CAGGAATAAT     23340
     AGGCACACTG CCAATGGTCA TCGGGAAGAT ACACGACCAA CAAATGTCGG TCATCGGGTT     23400
     AACGAATGTG CCCGTACAGG CGGCCTGTGC GTTGGCTTGT GAAGGAATTA GACCCATCAA     23460
     TAAAGATAAG GCTACAAGCC ACGCGAGTTT AATGTGCCGC ATTGTTTGTT TCCTCCATGA     23520
     ATACGGGGAA ATTGGACACA TCCATTTCGC GCACTTGCCA CATCACGCCC GCTTGCTTCA     23580
     CGACACTTGG AACGCGCTTA AGTGTTAAGG CGCGGCTGAG GTTTCCTTGC TGGTCAAAGT     23640
     AAACGCGCGC ATCTAATTGG CCATGCAGTG TTTCGGGTTC GCCGCCCGTT AAAATCCATT     23700
     TGATGGTGTG TGGCTTGTCA TGGGTTGTTG CAAACTCTTT GGCCCATAAC ACTTGCTGCA     23760
     CATCATCCCC ATCAAAAAAC ACCAGCGTTT TACTGAACTC AAACTTGCCG ACGTTGGCCT     23820
     TTTGCAATGC TGGCCATGTC TTGGTGTCAA ATGGGTTTAC GCGCGTCCCT TTGGGATAAA     23880
     TCAGGTTGCC ATTCGCATCA TTGATATCTT TGGCCAGCGT TAAGGTGGGA TCGACCAAAA     23940
     ACACCTCAGG GGTTTTAGTG GTAATGAGCC CCACCGGACG AGGGCGCTTA ACACCGGCTT     24000
     TGACATTCTC TTGGAATTGC TCGCGCATAC TGTCTAGCTC ACCCGTTTTC TCTAAGGTTT     24060
     GCAGACGGTT TTCAATCCAC TGCAGCATGT CAATTTCAGC AATCGGGAAC ACTTGCCCCA     24120
     CGGTGCCGAT AGACGCAGCC TTGAGCGGTA ATAGTGGGCA TAACGCCAAC ATCAGAAGCG     24180
     CGAATTTATT CATTTAGGCG TGACCTCGCT AGATTGGGCA CGGTTCGCCT TGTTTTGCGC     24240
     ATGAAGGGTT TGCAGTAGTG ATTGCTGAAT TTCTTGGGTG ACATTCACCG CGCCACTGAC     24300
     GACGGCAGGG CTGACTAACA CCACGACATG ATTATCCAGA GCGTATTCAC GAACCACATC     24360
     ATCGAGTGTT TGGGTAAATC GAGTGATTTC TTTTTCGCGT TGTTCGTCGG ATAGCTCGCT     24420
     TTGACCGATA GATTGGTGAA AGCTGGCCAC GGTTTCGTTA ATGTCATACT CGACAATACT     24480
     GGGTTCGCGC GTTACCCAGA TGGTTATCAT GACGCTCAGC GTCACCAGCC ATAAAAAGGC     24540
     TTGAATAAGG TTTTTTTCCA TTTTATGCGG CCTCTTTGTG GGTTGCTGCT GCGGACAAAA     24600
     TGGCATCAAA ACGAGCCATA TCATCGGGAT AGAAATGTTG GGCTGTCAGT TCAATGGCAT     24660
     CGAGTAACGG CATGCCGCCT TTAATAAGGT TCTCACAATG CTCAAATTCT TTCGGCTCGG     24720
     TTGAGAGCAT GGCGCGCGAC CATGGATCGG CAAAAATCCG GTGAAAGGAC ACTAGCCCGC     24780
     CCGCTTTGAG CATCACGCAG GAATGACCCG CATCATTGGC GCGGGGGAAT GACTTGATCA     24840
     TGTGTTGCTC GAAGGGCGAG AAGTGGTCAG GATGCTTGTT CAAGAAATCC CCAAAGCCAT     24900
     CACCTTGGCG CAAGGTGATA TGAATATCTG AACTGTTCAG TGCCGCTTCG GCCTCGGCGT     24960
     TGGCAAAGAA GTCGTTCATG CCTTGCGTTA CTGTGGCAAA GCTGCCGCCG AACTTACGCA     25020
     CTGTGCGATA ACCTTCGTTG ATGAAATCCT TACTTTGCGC ATTCGCGCCG CTCATGAGTG     25080
     ACCACGCTTC TTCAATCACA CAGATTTTCG GAATAGAACG TTGGCCCGAT AAGTACATTT     25140
     GTTGGCTAAT CGTCACCATC AACGCGAAAA TCACCGGACG TTGTAGCTCG CCTTTAAATC     25200
     CATCAAGTTC CAGCGTGGTA ATGTCAATAT TGGGATCGAG CATCGAGGGC TTATTGAAAA     25260
     TTGCGCCATG AATACCGCTT GAACAGAACT TGTTTAATTG CGCAGCGATA TCACTGATAC     25320
     GGGTATCGTC ATTTTTTTGT GCGGCAATGT CATAGAGTGC CTTTTGCACA TCGTCAATCA     25380
     GCGTGTCGTT ACCGCATTTT TGCCATGCCA GCAAAATAGC ATCGCCGAGT AATGCCGTCT     25440
     GAAATCCGGT GAGCTTTTCA TCAGGTGATG CCATGGTGGC GATAAGCGCG GTGATGTTTC     25500
     CCAACACTTC GGTGATGGGA TCAATGGCTT GACCTTCATC ATCGAGGATA GGGCCAAAAG     25560
     TACCCGCATC CCGCACGCTT AAAACTTTGC CTAAGTGGGT AAACGGGTTT AGGAAAATCT     25620
     GCGAACTATC GAGATAGACG CCGCCTAATG TTTGAGTGAG TTTTTTGTAA CTCTGACCCT     25680
     TGTCAAGAAT CCATGCCTTG CCCCCTTTGG CAAAAATCGA TTTTACCAAG GCTTGCATGA     25740
     AGAATGACTT CCCTGCCCCT GAGCCGCCCG TGATGGCCAT GTTGTAGTTA TCACTGCCGC     25800
     AGTTAAACGG ATCGAAATAG CTAATTTGAT GGCGCATTGT TGGCAAGAGT AACCCTGCGG     25860
     ATAAGCGTTT GTAGTCTGCA ACAATCGGTA AAAAGTTCAC CAAGTTTGAG GTTTTCATCA     25920
     TGAAACACAG GCCCGCTTTT TGGCTGTCTT TCATAAAGCC TTCGCTCATT GAGAACGGGA     25980
     GGGTGGACAG TGTGCACATG CCTTGCAGTT TATTGTTTCG GATTAAATCA ATGCCTGCCG     26040
     TGCGAAATGT CGCAATCGCC TTTGAGGTGT CGTGGCGGTG CTTCTCTTCT GTCGTATACA     26100
     GGGTGACATT CAATGTCATG GTGGTGATTT TAAAGGCGTG TGAGCTGAGT CCTTTTTGTA     26160
     TCTCCTTGCG TTCAGCCAGT TCATCCGCGG CACTGGGGAT TAACAACCGC ATAGGGGAGT     26220
     TGACCGTTTT GGTCAAAGAT CCAATTTTGC TGTCGTTACG GGTTGTTTGC TCACCCGTTT     26280
     TATTAATATA AAAAGACACG CTGACACGGT AAGGGCATTG AACACTGTTC ATGGTGTAAC     26340
     TGAGTGATGC AATACAGTTG GGAAACGCAT ATAGCCTAAA GTCGTTCGGC AGCCCCTTTA     26400
     GCCCAAGATT GATTAAGGTG GTATCGACAC TGTTGTCTGA TTGCATCGGT GTGTGACGGA     26460
     TATTGACCGA ATCACGGTTA ATGATGAACT CACTGTCAGG GCTGAGGATT TGGGTGTTGA     26520
     GAGGTTGATA CTCGTTATAT TTAGCGGGCG AAACGCGATC TTGTTGATGC GAAAAATTTA     26580
     AATGCTCGCG GCAATGCTCA ATCAGATCGT CAGCGCCTAA GCGGCGAATG TGCATGCCTG     26640
     TTTGCGCCAG CTCTGATTCA ATGCCAAGAC GCATATCCAG CAGTGCGGGC ATATCTTCGG     26700
     TGGTTGACAC AAAGAAAAAC CCTTTAGTGT TCTTTAGATC GTAGTGATAT GCGCTGCTGA     26760
     GCTTGGTGCC AAAGCCTTTG GTCGAACTGT GTTTTGCATA GATAGCTTCA TTTGAGGCAA     26820
     ATTTATCGCA AATGGCATTG CGGCCACTGA GCAGCGCTTG ATTTTGCTCG ATGAGCTCAC     26880
     CGACTTGATT ATTACCGACC ATGACGAATT GATAATGCCA TTTGTCGCCC TCTGGCAGTG     26940
     TGCACACCAA GGCGTTCATG GTTTTGATTA AGTCGTCATT AGCCCCGCCA AACAGCGAAA     27000
     TGGCAAAGCC AAAACCAAGC GAATTAGCAT TTTCAAAGAC TTGTTCAGCA TCATCATAAA     27060
     TGCGATAGGG CAATTCATGA TGCAGATGGT TGTGTTGCTG TTTGCTGCTG GCATAGAGTG     27120
     CGCCGAGATC GTTTTTAATA CGTTGTTTCA TGGCTTAATC CTGCTTGATG TATTTGGCAG     27180
     GTCTACCCGT CCAACGGCTC TTATCGACCA CGATGTAGAC ATCGCTGGTA TCAACGTAAT     27240
     CACCTTGCTC ATTGAGATAC GGGAAGATGG TTACTTTTTG GACTGACTCA GAGGTGCGCA     27300
     GCGGTACACC GTGGCGGTCG CGGCGTGGCA AAGGGATAAA GTCTTGTTGT TGGCTCGCGA     27360
     GCTTGGGAAG TGCAGTTGTG CTTTGGCCGC TTAAGGCTGT CACCGCAGGG CTTTGTGCTT     27420
     GTGGCTGATT GAACACACCA CTGTCGGTGA GTTGCCTCAC TTCCATCATA TTGGTACAGC     27480
     CATTGATGCC GCCGACTTTA TCGCAGGAAT AGTCACTATC TAGCCCCGCC GCACAGCCAC     27540
     TTAATAGCCA TGAAGCCAGT GCGATAATAC CGGTGTTACG TAATGCGTTT TTGCTCATGA     27600
     TTGTGTTCAA CATGTCACTC CTTAAATGAA TTAATTCGCA CGGCCAAAGG CTGAGTTAAC     27660
     AGGGGGGCGC TGGCCTTGTT GGTTATATTG CTGCTGTGGT GTAGGCGTGT TTGTGCCTTG     27720
     GGCCTGCGGC TTAATATTCC CTGGCATCTG TTCTAACAGT GGGTTGCTGA TCGTGTTGAG     27780
     GATTTGCGCT GTGGCACTGA CAGGATTTTG GGCTTGCTGC GCTAGCGCTT CTTCGTATTC     27840
     TTGAATGCCA ACTGGATCGA GCGGGAAGCC TTTCAAAAAC ACGATGTTGA CGGTATTGCC     27900
     CGGATTGAGC TCAATAATCG GGTGGTATTG CTCAGCTAAT TTGATGTAGT AATCCGCGAG     27960
     CTTGCTACCC ACGCTTGAAC TGGCACTGCC GGCTAAGTTG AGCAGTGCAT CACTGCCATT     28020
     GACGCTTGAG GTTGACCCTA GCGCTGAGTT CGATGTGGTT TGGCTCAGTG CTTTACCTGT     28080
     CTCACCAATG CCCGTCAAAA TACCGCTAAT CCCTGCCATC TGAACGATTT TGCCGTTCTT     28140
     CATAATGGCA GTACCGCGAA TACCATTGCG GCCATAGTTA AATACGGTCG CCTCGACTGG     28200
     AATGTCGATG ATTTCATCTT CAAAAATACA GCTGAGGCGA GTGGTGCGCA CAATGCCGCG     28260
     ACTCGATGAG ATTTCCCCGT AAGCTGCACC GAGAACCGTG CAGTTATTGA GCTTTGAGGG     28320
     CTTGCCGTTA GGGAGTACAC CTTGGTTAGT GGTTTGGAAT ACCATCGGCA CCGTATCGCC     28380
     TTGGCCATTC ACACCCGCAT TGGCATCTGC GCCGCCCGTA ACGACAGCTG TGACAAACGT     28440
     ACCTGCAGGA ACATAGTTCT CAGGGGTGCG TTTTTTTGGC AGGTTTTCTT CTGGCGTTTC     28500
     CCAATTTAAT GCAAAGGAAT CGATGCCATT TTGGGTTGCA GGTGGCGGGA TAGCGCCGCC     28560
     TTGATAGGGG GCAGCATACC CGCTTTGTCC GTCACCCACG CTCGGGCGTG GCGGCAGCGT     28620
     TTGTTCACCT AAGTAGCGTG TGCTTTGCCT AACGGGATAG GCAGATGCAT CGATGCCCTC     28680
     TGTCGAAAAT TCATCGGTGA CATTGCTATG CTGCATTGCA TTTGCGTTTG CTGCATTAAT     28740
     CTTATCATCA ATTCTTTCAG TGATGGTTAG TTGGAATGTC TCTAAATTAC GTTTTAAATC     28800
     AAGGCGATTA GCTTCATTGT TGCGCTCAAT GGCTTGCATG CTGCTCAGTA TTTTATCAAT     28860
     CGCTTTCTGC TGCTTATCTA AGGCAATTTG TTGTGCGGTG AGCGCAGACT GATTGTCTTT     28920
     CTCGGTGAAA TCTTTATCAA TCACGGCACC AAAATCGATA GGATTGCCCG CTGCGGTTTC     28980
     GGGGGCACGT TTAGGGGCAG ACATATAGGC GTCGCCCGCT AAATAGAGGG CACCGAGTAC     29040
     CGTTGCCCCC ACACCTGCAA TCACCCAATT GCGTTTTTTA TTGGCTTCAT TTAACGCACT     29100
     GCCTTGCTCA AAGTCGGCTT CGGGGTCCTT TTTGAAGTAG TCTAGGAGTT GCTTCATTGC     29160
     ATGCTCTCCC CGCCCGAGAC AACAAACAGG TGGCCTGTTT GTTGTGGTGC TAATTCATAG     29220
     GTTGATAAGG CTGCGGCTCG CGTCGTTGGT GAGTAGAACT GCGCTGTGGT GAGGGTGACT     29280
     GGGAGTGCTG CGTGATTGGT TACGCGATAA ATGATGCCGT TGAAATGCTT ACCAGTGAAC     29340
     ACGAAAGCAG GTTCTGTTGT CAGTCCTGCA GGTTTGGGCA TTTGCTCATT TAAGCGAGTA     29400
     AACATCGCGT CATCGATAGA TGTTTCCGTG CCTCTCGGCT CACTGTCTAC CGTGGTGCGT     29460
     TCAAGGTCAT CATTGACGAC ATGCACACGA TAACCGTCAA TCGGTTTACC CGTGGCGAGG     29520
     TAGCGGATCA TTTGCGCGGT GAACTCGGTC ATCATGGTTG GGTACGGGGT TTTCTTATCG     29580
     AAAACGGAGG GTTGTTCTTC GCGATAATGT TCTGCAGTGA AGATAGAGGT CACGGCAGGA     29640
     ATGGCTTTAG GGCTGATGAA TAAGCCGAAA TGTCTGCCCT TTTCAGTTGA TACATAAGCT     29700
     GTGAATGGCA TGGCCAGATT GAGATTGACG CGCGCTGCAC CGGATTTATC CGATTTAGTG     29760
     CCAGTGACAA CGCAAAATCC TTCTGGACAA TCAATCGAGG TGATTTTGTC ACCTTCAACG     29820
     ACTAAGCGGT TGATATCAAC ACTCGACAGC TCGATAGGAA CCGTTTCACT GTCATTGAAT     29880
     CCGTAGTGTT TTGGGGGCGT ATTTGCCGCT AACACGCTCA TAGGAAAAAG CGCGCAGGCT     29940
     GCGAAAACAA GTGGGTTAGC AATCTTCATT ATTTAACGTC CTTTTGCACT TTCTTAATGG     30000
     CTTTGAGCGA CAGTTGGCCA TGGTCATAAT TCATGGCAAT GATGTAGCTA ATGGTTTCGG     30060
     GTTCTAGCGC GCGTTTGCCC ACATATTTGT TTAACGTGCC TGTGAGTTTG ACGAGACGAT     30120
     CATCAAGGGC AATTTGGGTT TCATTGATGG TGAAGTGACT GCTGATGTTT TGTTTTTTAA     30180
     TCATGGCGGC ATCTTCAACC AGTAAAGGTT GCATCTGATG CCAATCAGCT TCATCGATAT     30240
     AGCTCGCGAG CTGTTTGTAC TGATGGTCTA CCGAAGCGGG CGTGACATTG AGCTTTAGAA     30300
     AGGCAAAGTA TTCGGCCATT TGCTGTAAAT ACGGTTCGTC TATAGATGTG TCTGATACGG     30360
     TAAAGGCTGC GCTGATGGTC GGTGGTACAA CGGTGCGGCT TTTATTGAAG TAGGCCTTCC     30420
     ATACAATACT TGCTAGGACA GTGTTACTGA TCATGGCTAC GGTAAAGCCG ATTAACAGAA     30480
     GTGTGTTGAG GGATTTTGCA ATGCGAATAA AGTCGATCTT GTTCTTTTGT AACATGGGGC     30540
     ATCCTTAGGG GGATTGGCCC CCTAATTCAC ATCATTTAAC GTAACCAGTA GCGGCGACAT     30600
     GCCGCAGGCG TTCGTTTTAA AAATGAAGCG CTAAATTCTG CTGGGGCGTA CCAATAAGCG     30660
     GTGAGGCGTA ATACGCTCAT GCCGTATTGC GATTTCATTC TGCGCATCCC TAAAAACCAT     30720
     GAAGAGGCTA GTACCATGCC AATGAGCGCG TGATCCATCA TGAATAACAC GGCAAAAAAC     30780
     ACTAAGGCAG GAACCAGTTC ATCCATCGCA AACCCTAATA GCGTAGGGGT GTTATTGAGG     30840
     TGTTTAGGGA TGCTAAAAAA CTGAGTGGGG TTATCCACGG CCTATAGACC TACAACCTTT     30900
     AAGGCCACGT TGATGAAGAT CATACCAACG ACAAAAGCCC CAATAGCTGC GCCCCAGTTT     30960
     TTGGTTAAAA AGCCGGTAAG TGCAGCGGCA CATAAACCCA CGACGAGAAT GGCGAACTGT     31020
     GCAGTTGAGC CGGTGCCAAC GGTATCAACA ATTTCAGATT TAGCCGGTGC AAAAGGATCT     31080
     GCAGCATGTA CATCCCAAGA CAACAGCAAA GTAGCGATGA CACAAATGAT GAATAGGAAG     31140
     GTGCAGCGCA TTATGAATAT GGTGCTATCA CTGGGGATAT GTTTTGCGAG TCTTAGAATT     31200
     TCTTCGTTTA CTTCATTTTG TTGGGCGTTA GGTTGTTGGA TTTTGGTGGT CATATAACAC     31260
     TTCCTTTGTA TTGCGATCCT ATTTTTGGAT CGTGATGGTA AAAAAATTTA AGACTTATCT     31320
     TTTCCTTTTA GACCCATTCC CATCTCATCG AAGCGGCTAA GGTGGTCAAT GAGTCGTGCT     31380
     TGAGCCTCTT TGCGCTTAGA GCGATTGTTA CGTTTGGCCG AGGCTTCTAA CATTTCGTTT     31440
     GTTTTGCCGT CTAAAACGAC ATTGACATGC GTCGGCTTGG TCATGAAAGA GAGATAATTA     31500
     CTGTATGGAT GATCATGGGA TGGATAATAA AGCAGCGGAA AACAAAAGTA AACAAAATAA     31560
     CCACCAGGGG TAAACCATTT AACCATTAAT AGGGTGTGCC CACTAGTAAT AAGATACGGG     31620
     CTATGAAACT AGGTGATAGA TTAAAAAACA CGCGAAAAAT TAAGGGTTTA ACTCAGCTTC     31680
     AAATCGCAGA GGGGGTAGGT GTGTCCAAAG TCGCTGTTTC TCGTTGGGAA TTAGGGTATA     31740
     GCCAACCCAA AGGAGAGAAG TTGAATGCGC TTTGCAATTT ACTTGAGATT GATAGCAATT     31800
     GGCTTCTAAC AGGGTTAAAA GATGAATGTA AAAATGTAGC TATGATTCCT TTTTATTCTT     31860
     CCGTATCAAT TGCTGCTGGT TCTGGATCTA TAAACGAAGT TACAGTTGAA GAAAAAATTG     31920
     CTATACCACT TTGGGTTTAC AATAAACAGC TAAACAAAAA AGATGTGTGT TGCGTTAGAG     31980
     TCTCAGGTAA GTCGATGCTT CCTGTGCTTA ACGATGGTTC AATTATTGCT TTAAATCCAC     32040
     ATCAAAAATC AATAAAAGAT GGAATGATGT ATGTTATCCG TCAAAACGAT TTGTTGCGTG     32100
     TAAAAATACT CATAGAGAAG CCAAGCAGTA TAGTTATTCG TTCATATAAC CCCGATTTTG     32160
     AAGGTGAAGA ATTAAGTAAG GAGGAGCTAG AATTGAGCGA TTTTGAGATA ATTGGACAGG     32220
     TTTTTTGGTA TTCATCAACT TTAGATATAT AAGTAAACAA AAAAAACATG GAATTTTAAA     32280
     ATCTTAAAAT CTATAATATC CCTAAGTTTT GAAGCAAAAA GTGCATTACA TAGCGCACAC     32340
     TACTACATAG TTCACTATGT AGTGTATTTT TCAAAATTTA GAATGTGTCA ATCTCTCAAT     32400
     TGACTATATA GCATTCGACA AAAAAGCCGA CTTACCACAT GGGTCGGTTT TTTTGTACCT     32460
     AAAATTCAGT GCATTCAGAT CGTTGATCTT TGCGATCGTT TCATTTACAG TTGTCCGCAA     32520
     TGTTTGGCGT GAGAAACCAA GCAGCCCTAA AACATGTGGA ATCATAAAAA ATGCCTAACT     32580
     TTTTCAATGG CTGCCCTTTG CAGCATTTAC ACCTAAGACA CATCAATCCA CATTGCTTTA     32640
     ATCAGTCGTT GATCTTTCGA TCTTCTTTAC TGAGCTGTAG CAGTGCGGGC GTGTGTCATG     32700
     CAGAAGTCTA AAGCCGACAA AGCCCGCATC AAACGCCAAA AGTTGCGCTC AGCAAAGCGC     32760
     GAAGCGGCAC TGCATGTCAA AACCCATAAA ACCGCCGTTG GCGCTAATGC CTGTAAAGCC     32820
     AGTCTCGAAG GGTTTAAAGC CTTAAAGTCG CGTTTACCTC GTTATTTTAA TGAGGTCATT     32880
     AATAATGCCC GTAAATTGAT TTACAGCCGA AAGTTCGAAA TAGACGAAGG TGGCATATCA     32940
     AGACAGATGT CAGAACTGAC TAAGCGCAAG CTGTTTGAAA TCATCGTAAC CTTAATTACC     33000
     TCGTGTGATT TTATGAGTGG CCAAATCGGT AAAGCGAAGA ATATCGGGAT GGACACCACC     33060
     AGTCACGATG CGCTGATGCT CGCTCATGCT AAGCGCTGGG GTTATGCAAT GCCGAGCTCT     33120
     ACTTGGTATC GATACATTGG TATGCTCAAG CAAGCGGGTG TGTTTGTTGT TGAAGAAGTC     33180
     AAAATAGCAG GCGAGACAGA AAAAACCATC CGCTCTGTCG CGGCTTATAA ATGGCTTTCT     33240
     ACTCACTTCT TGCAAGCTAT CGGTGCATAC ACCGACATAA TCCGCGCACA GATAAAGCAA     33300
     GCTTATCAAA AGGCCATCAA TAACGGCCTG TCATTCACTT GGCGAGTGTT CAAGCGCCAG     33360
     CTCCCAGTTA AACAGCGGTT CACCGCGGAT ATGTTTTTCT CACAAAGTAC GAACCCACCT     33420
     CAAACCCACT GAACCACATT TTAAGCGACC GTCTTGATTG GCGGGGACTT TGCGCGTCTG     33480
     TAGGTTTTTA GGCGCTTAAA TCATGCGTTA TGGCGGCCTA ATCAGTCTAT AAAGCGCCAT     33540
     TTATCTCTCT TTGTTTACCA GACTTCTCAG TTCGCTGTTC ACTTTACCCG TGGGTTGTGG     33600
     ATAAGGCTTG TATATTAAGG CATAAATGGG AGTAAGAAAA AGGAGTAAGA AGTGGGAGTC     33660
     CTAAAGCTCT TTCTTTTCAA GTAAAGCTTA ATTAGTAGTA AAAGATAAAT TATTAAAAGG     33720
     CACAAGAAAC GGTGGATAAA TCCACCTGCA AGCAATAATG CCTCGCCATT TCCTGCCGTT     33780
     GGCAGGGGCG AGAACTAAAA GCACCGCTGA AAGTGAATTT TGTCATGCGA CCGTTAAGCT     33840
     ACAAACGCGC TGAACATCAG CAGCTAAAGA AAAAGCGTCT AGCAGAAAGG AATTGCAAGC     33900
     AGGATGCCAA TGGTGACTTT TGATTTTGTT ACGAATTCAA ATAAAGCTAA GAGATTAAAT     33960
     GGTTACACCA TTTTTTAAAG ATAAAGCATT GACGGGAATG TGAGTACAAG TGGTAAACTT     34020
     CAAGCGGGTG CTCTTGGCTT TTTAGCAAGA GCATGGAAAT GCTGTTATGT AACTTGCTAG     34080
     AAAGTTGAAA GCCCCGAATG AACTATAAAT TCAAACGAGG CCTACAATGT ACCTAAGCAA     34140
     TACAAATAGT AGCCTCTTTA CTTTTAGGAG GCAAGATATG CCGAAAAGAA AAACAACTAC     34200
     TTTGAGTCTC GCTATCGTGT GTTTCACACT CTTAGCTGCA CTGGCACTCA TTAGAGATGA     34260
     TTTGTGTAAA GTAGAGTACC GTAACGGTGC TATGTTGCTT AACGTTGTTC TTGCCTACGA     34320
     AGTAAGAGGC TAACGAACCT AGGGGAGGAT TTCGAACCCT CCCCTATTTT TGGATTGTGA     34380
     TGGTGACTTT GCGAGAGCAC CCGACTTTAG CCTTTAATAA TTTTCGATAT CCAAACTTTA     34440
     CATTTTTGGC GCGTTGGGCA AATTTAGCCT AAATGATCGT CAAGAAGTTA TCGGCGTTGC     34500
     AGCAATAGGC TCACCAACAC ATGACCAGTC AACAAAACTC CATGGTTTCA TACCAATTTC     34560
     CACACTGTTA GCGTATGTGG AAGAACGCGA ATAACAAGTG TTTGATGTTT CGAGATACTT     34620
     TTTCTCATCT GACATGGACA ATTTAGTGCG AATGTACTAA CAAACTTCTG TCCCAACTCG     34680
     TGTCAGGCCG ATCAGTTCTG GCACGTTTAT GCCCCATTGT GAGCCAGAGA GGGATTGAAC     34740
     TCAGTTTCAA ACCCTGCAAC TTGCCTTACT TTTCCTCATG CCTAGAGATC CAACAATGTA     34800
     GCTAAATTTT CTAATCCACA ACAGACTGAA CTTCAATCAC AGTTACGCAC GAATATGTTG     34860
     TTCAACTATT TCTAGGCTAT TGAATAGTAG AGAACTAAAG GGAAGTTTTT GATTGATAAC     34920
     GTGCCTTGAA TCGGAAGCAA TGTGTGCTGG CACGTTATTA AAAGGTTATA TTTTTTATCT     34980
     CTGGTATGAT TTGCAATCTT CACTTTTTAG TATAAATTGC ACTTTAATAA TTTATAACTA     35040
     TATGAAATTA AAATGAATCA AGAAGCCTCA ATTGCTGGAC AAGCGGTTTA CTCGAAGAAA     35100
     GTACTATCAA TATACGATTT CTGGGTTTTA GGAGTATCAA ATAACTATTT TTGGAAATGC     35160
     CCAACTAGAC TTATTAGTGA GCAATTTTCA ATGTTAGTTT CATCTAATCA CTTAGATGTT     35220
     GGCGTTGGCT CAGGTTATTA CCTTAAGAAT TACCTACCAC AAACAACAAA ACGTATCGCT     35280
     TTGCTAGATT TGAATGAAAA TAGTCTTGAT ACAACCTCAA AAGCAATTAG TCATTTTCAA     35340
     CCTGAAGTTT ACTGTGGGGA TGTACTTGAG CCTCTTGAAT TAAGTATCGA AAAATTTGAC     35400
     TCAATTAGTG TTAATTATTT GCTTCATTGT TTGCCTGGAA ATTTAATTGG TAAAGGCATT     35460
     ATGTTTAAGC ATTTAAAAAG CCATATGAAC GAAGGTGGGG TTTTGTTTGG TAGTACAATT     35520
     TTAGGTAAGG GTACGAAACT GAACTTTTTC GCTAAAAAAT TGATGGGTGT TTACAATAAG     35580
     AAAGGCATAT TTAGTAATAA CAACGATGAT TTAGACTCAT TGGTGACATC GTTAAATGAA     35640
     CACTTTATTG ATGTAAAAGT GGAAGTTATA GGGTGTGTTG CATTGTTCTC AGGTAAAAAA     35700
     ATATAACAAA TGATCTGCTC CAGTGATACT GGACACTCAC GTAAGATAAG TGGTCGATGG     35760
     GATAGCATGT GCGCGTTTAA AAAACAGCAT AACAGCGGCA AATGGTGCAA AGATAAAGCC     35820
     TCAAGCAAAG CGTTACATCC TTAAGTTCAT CGCGACTCAG CTCTTGGGAT TATTTTTGTT     35880
     TATCCGAAAT GAAGAAAATT CCGCGAAAAT TCAGCTCGCT TTTGTCCAAA AATGAGCCAG     35940
     TGAAACACTC TACCCCAGAC TGATTCACGC CAACCGCTAA AACCCGCTCT AGCGCCCCAT     36000
     TTACGGCTAT TCTGGGGCGG TTTTTTCCCT TAAGATGAAT CAAATCTCTA GAGAACTGAT     36060
     TCTGCCTCTG GTATTGCCTA TTTAGTCCTA GCGGCGAACG TGGCTACCGT TAAAGGGTTC     36120
     TCTGACTAAA AGAACGGTTT GTCACCACGC TCCTCTGTAA CCCTTGATAT CACTAGGCTA     36180
     CAGCCAAAAA ATCGATTTCA GAATCACTCA TAAAATAATC AATAACCTCT TGAATATTAA     36240
     TAGAAACTCT TCGGTTGTAA AATTCATATT TTCCAATGAA GCTGATGTGC TGCCATGCTA     36300
     CTGGTGATAA TCGGCTGATT TTATTCGCTT TATCTGGTTC TGCTTTAAGA TAAAATTGAT     36360
     AAAGGTAAGA CAGTAACGTC GCATTATAGA AAATGACCGC ATTGGCGATT AACCGGATCG     36420
     ACTCTGCTGC AATATCCAAT TCTATTTCAT TCTTACCTCT AAGGGATTTT CCACCACTGA     36480
     CCTTGGCTAT TGTGCCACTT AACTGGTGAT AGGATTCACC GCGGCATAGA GAAGCTTGCA     36540
     CCACCGAGCG CATCTCTTGG CTATCAATGT AGTCCAGCAA ATAATCAGAC ATCATTATTT     36600
     GATCTAAAGC GATGAGGGCC TTAAGTGTTG CATTGGTTTT AAACGATGAT AATTTACGCA     36660
     CAACCTGACT TTGCGTGGTT TGCTTTAAAG CCAGAGACAC TAAGATCCGC AGGATGTTAT     36720
     CCCACTCTTT AATGATCAGG GCCTTATCCA CTTGTTTGCT CGGTTTGAGT ATATATTTCT     36780
     CGTAACTCGA CACGTTATTA AAGCCAACTA ACCTGTTATT TGCCGTTTCT GCTACCTCCT     36840
     CTGCCAGATG AAATGCAACA CTTAAGCAGT GCTTTGGCTT AACATAGCTA TCGCATACTT     36900
     ATTCAAGGGC AGATTCATCT AATAAGATAG GGTTATGGGC GCAACACATT TAACGCAAGA     36960
     AGATCGCTTT TACATTGAAA AGCGGCTCAC CGACAAGACA TCGATACGCT GCATTGCAAA     37020
     AGAGCTAGGA CGTTGTCCTG GCACAATATG AACAATTTAC GTGATTTCTA GGGGAATAAA     37080
     AAATATGAAT TTACAGGTTC TCAATATTTG TCATTAATTC AGTTGGTTAG CTATTTTTAG     37140
     GTGAGTATTT TTAAAATCGA TTTTTTGGCT ACAGCCTAGT GATAGCAAGG GTTACAGAGG     37200
     AACGTGGTGA CAAACCGTTC TTTTAGTCAG AGAACCCTTG GTAGTCAGCC TTCATACGCA     37260
     ATCGGCTGAC TAAACCATAG ATAGAGCGGC GGCCAAAGTG GACTTTGATG ATTGATCCAA     37320
     ATTGGCCAAT TGGATAGTTT TCACCAGCAA ATACGCGGGA TAAGTCTGAA ATAGTAGGGT     37380
     CGATCTCGGC GATAATACGC GAGCCATCCA CCTCAATAAT TTTCCCGATA GAGAGATTCT     37440
     CAATGGGTTT TATGTATTTA TTATCCATAT CAAATACCTC CTTCAAGGAT CTGGGTTAGG     37500
     TTTTCAAACT TCCACCATTC AATGCTATTG GTTGAGATTG CCTTGTGGTC GGCGTGATAA     37560
     AAACCTTTAT CGGCAAAAAT AAGTACTTGT TCGTTGATTG AGCTGTCTTC ATACCAAATT     37620
     TTCAGCGCGC CACTAGGTAC AGGGTCGCTC GTAAACGCAA TCACGGTTAA ATTGCCATTT     37680
     GAAGCCCTTA AACCACGTTC GATTTCTAGA TTGATATGGG CATCGCCAAA GCTATAACCT     37740
     GCAATCAATA AAACTCGTTG GCTACCATCT CGCGGGTTTA AAACAGCTCT TGCTCTGTGC     37800
     ATTAAATTTG CGTAGGGGTC GAGTTGAGTT TCACGGTATT TAGTCGATGC AGGCCAAATC     37860
     ATAATCTTCG CAGCTTGATC TTGGCTGCGC TTCAAATGCG GAGCAATACG CAGTGGTGTT     37920
     GATGAAGAAG CATGTTCAGC CCAATTGATG GAACCATGTA GCTTAAACAC TCGGGCATCT     37980
     AGATTGTTCT GTTCAAACGT CGAAGGGTTC CACCATCCTG ATACGCCGCC TTCTAAACCA     38040
     TCGGCATATC GCAATTGTGA TAGTGCGAGT GAGTCTTCAA TTAACGTGTC GTAGTTCATC     38100
     ACCAGATAAT CAATGGTGCT CGGAAGGCTG TCTTTGCCTG GCCGCATTGG TCGATGCAGT     38160
     GCCTGAACAA AACGCTCATG CACAGCAGAG TCTACTTCAA CATTAATTAC GTCAAAAATA     38220
     GCGAGTTTTA TCTCGTTTAT CGTTTGTAAT AGCTGCTCGT TACTATATTC AGTACCACCA     38280
     ATAGATACAC TACTAGCGGT TACATTGCGA TTTGCTCGAC GAGCAGTGAT GGCAAGCCAA     38340
     TCTACGAGTT CACTTAAGTA GTCTTCTATA TGCGAAGCTG GATTTGCGCC AGCAAAAGAG     38400
     TTTTGTATGG CAGTCAATAT CTGCTTTGAA TCATCAGAGA GCTTGTCACT TATTAGTGCT     38460
     CTTTCAGTTA GCTGGTTTGT TAATGGTAGG CCAGCGCAAA CACTCGCCCC TGCACCTAAC     38520
     AGAACCGCTT TTGAGTGTGA GAGCAATTCT TCGAGTTTAT TGATTGCTTC TCTGAACTTT     38580
     TTTTGTTCAA AAACTGTGGT ATTGAATGCC ATACTCCCTC CTTAGAGCTC GCCTTTGAAG     38640
     GCAGAATCGA GAATTGATGC TTTTAAACTT TTCAAGTCTT CTATTTTCCC TAGAAGGACT     38700
     GCTTCCGCAT CGTGAATTTT ACTTTTCAGC GCTTCAATTG TAGATACCAA TGATTTCTGT     38760
     TCTTCCAAGG AACATATTGG TATTTCAATC TTGCTTAAAC GAGTTAGCGC CAACTTTGGC     38820
     TGTGCAACGG TCTTCGTCGC TAATCCTGCC TGAGCAGAGA AGTCAGAGGT CAATGTAAAT     38880
     AGATACAGGT AGCTTAAATC TAGTTGTTGT TTATCTTTGA TAACCAACTT AGCGGCGTTT     38940
     TCTGTCAGGT TTGCACCGTC CAATTCTGAA GGGACGAAAC CTGTCTTACC GATAGTCCCA     39000
     GCAATACTGA TATAAAGGTC GTCCTTGGAA ATCACATAGC GTTTGATTTG TTCGTGGATT     39060
     TCTTTCGATA TGTACTTGAT ACCAGATAAA TCTATCGTTC CTTTATCTGT AAAATCTGCC     39120
     ACTCGGATAT ATGGGTGCTC AGTCTCTTCA TCACTTAGCT TTTCGCCTTT TGGTAAGCGC     39180
     TTACCACCTT TTACCTCAGC TAGCGATTCA ATCGTCATTC TCTCAGTGAT AGCTGAAAAC     39240
     TGACCATCGA GTGCTGATTG AAGAAGGCTA TTTTTCAGTG TGATGCTTTC CTGCAAATGC     39300
     TCGATGGCGG TGTCGATGCG GGTAAGCAGT GCATCGAGTT TTTCGACGAT GCATTTTTGT     39360
     TCTTCTTTTT CAGGATACAA GAATGAAAGA CCTTTAATGC CCGTCTGATT AATTATCGGG     39420
     AGTGTGGCCT GTGAAGATTT CGTGATTATT TCTGGTTTTA TATAACTTAA CCAATAATAC     39480
     GCATACTTAG GATGAATTTT TTCTTTAAAG TGTATCCCTG TAACTTGTTG ATTGAAGCAA     39540
     GATTCATCTT CCGCTAGGCC AACTTTTCCA ATAGTTGCGC CAATAGCTAC CAAAAGAATA     39600
     GAGTCCTTTG GCATTTTCTT TATCGTACCG TCTTCAATTG CTAAAGAACT AAGCTTCCGT     39660
     CGAGAATTAT TCAACACAGC AGTGGAGCCA AAATCTGATG GAGTAAACCA ATCCACTTCG     39720
     CTAGAAGAGT AATATTCTGC CTTTTTTGTT GATGGTGTCT TACCTGTAAC CAATTTAGAT     39780
     GCTACTTCAC CAATAGTTTC TAAGTGCCAC CCCTCAGGCA ATGAATATAA AACCTGTTCC     39840
     ATGCTTATTT CTCCGCCAAC AGGTCTTCAA TTTCATCCAA TAGGCCTGAC ACCAGTTTTT     39900
     CTTTGATGCG GATCTGCTTA AGAATATCGC TAGGTGCTAA ATGCTCGGCA TCTTTCTGTT     39960
     TGGCTGGGTT TTTGGCGGAT AGATCATAGT CCTCAGATAA TTTGCTGGCT GAAACTGTCC     40020
     AGGAGCGTTC GGTGGTTTCA CGGCTGCGGT AAAGCTCAAC AAACTCTTTT AGGTGCTCAT     40080
     CGGTGATCGG TTTGTTTTTG GTGAGCTTCT TTTCTGGCTC GCATTCGTAA TACCACACAT     40140
     CGCTGGTGCC TCCGCTGCGC TCAAAAAACA GCACGTTGGT TTTAACACCT GAATATGGCA     40200
     AAAATACCCC GGCGGGCAGG CTTAATATAG TGTGCAGGTT AAAGTTTTCC AGCAGTTCCT     40260
     GTTTGACTTG CTTAAACGCA CTGTTGGTTT GGAACAGCAC GCCTTCTGGT ACTACGATGG     40320
     CTGCCTTACC GCCACTTTTA AGGGTTTTCA TAAAGTGCTG TAAAAACAGC AATTCGGTGG     40380
     CATTCGCTCT AATGGGAAAG TTTTGTTGGA TCTGATCTTT TTCTTTCCCG CCAAACGGTG     40440
     GGTTAGCCAG AATAATATCG TAACGGTCTT TTTCCTGAAT ATCGCGGATA TTCTGAGTTA     40500
     AGGTATTACC ACGGAACAAA TTGGGTGACT CGATGCCATG TAAAATCATG TTCATCATGC     40560
     CCATAACGTA AGCCAGCGAG GTTTTTTCGA AACCAAAGAA GGTATCGCGT TGGATAAAGT     40620
     CCCATTGCTC AGTAGAAAGC GCACTCTTTT TTGCTTTTAG GTGTTCAAAA ACTTCAACCA     40680
     AGAATCCGCA TGAGCCAGCC GCTGCATCGT AAATGGTTTG CCCGGCTTGT GGGTCAATGG     40740
     CCTTGATCAT GGCACGCACT ACTGGGCGCG GGGTGTAAAA TTCACCCGCA TAACCACCGG     40800
     CATCGCCCAT GTTTTGCAAT AAGCCTTCAT AGACCAACGA CAGCTCGAAC ATTTCATCAC     40860
     TGGACTGGAA ATTCAGCGTA TCGATAATAT CCAGCACTTC ACGCAAGGTA TGGCCAGACG     40920
     CTACCTTGTT GTCTAAATAC TGGAAGATGG CACCAATTTT ATAAGCGAAT GATTTAGGGT     40980
     CTGAACCGGT AACGGCGGCA TTGGCAAAGC TTTTTAAATA AGGGAATAAC TCGTTATTCA     41040
     CATAATCGGT TAAGTCATCA CCCGTGCGAA CTTGATTAAT GTCTAACTTG CCCTCGGCAT     41100
     TTTTCGGGCA GGCCCAATTT GACCAGCGGT GCTCTTCATC TAAGACGGGT TGATAGTCTT     41160
     TACCTGACAA CACGGCTTCA TCTTCTTTTT CAGATTCATA ATCATCCAAA AACTTTAAGA     41220
     ACAACACCCA AGAGGTTTGC TCGGTGTAGT GCATAGCACC ACTAATGCCA TCGTCGCGGC     41280
     GCAGTATGTC GGTAATTCGG TCAATCTTTT GTTGTAATGA CATGGCTTAT AGTTTTCCGA     41340
     TAATAAAATT GTACATATTG GTGATGTCTT CGCTGATTTC GTCTGGCGGA ATCAGGTCTA     41400
     TATAGGCTTG GAGCTTGTTA ATGTCTAACC CATTTCCATT AATGTTAATT AACTGATCTA     41460
     GAATGCTTTT TACTTTATTT GATGCGAGTT GACCAAGCCC TTCATTAAAC TCTAAGGCTT     41520
     CCTCAAAATG TTGAGTTACC AAAGGAGCTT CGTTGCCAGT TTCTTCATCT ACTAAGCACT     41580
     GATGGTCGCC ATTCATATTC TGATGGAGAT GGCAGGCCAA CCCTAAAGAG TCATTATTAA     41640
     TTTTTGTGAG CAATTGGTGA TGCTTCAATG CCGTATATGA AAGAAGGTAA TGCTTCATTT     41700
     CTCGCCTTCT CCAAACAAGG ATATGGGCAT TAATTTCGGA TTTTCCTGCT ATCGAAGATG     41760
     TAAGCTCCTT ACCGCCATTA AGCTGTAAGT TTTCGTTATC TATACTCGCT AATGGTAGGC     41820
     TATCTCTATC GCAAATTAAG TAAACATTTT TGGCTTTGTG ATTACTTCCA TCAATGTAGC     41880
     TTACAAAGGA CTCTAGCCAT TTGAGTTTTT TTGCTGCAAA AGATGAAGTA TGGGAGTTCC     41940
     AGCCCGATTC TACGGAAATG CAGCATATCT TCCGTAATTG AGATTTGATC TCGTCTTGTT     42000
     TTTCTTGCCC TAATTTTCTT ATAACAAGAC GAGTGAAAAT CTCCCAATCG TTTTCGTTAT     42060
     CCATAAGCAC GATGAGTTCA TGAAGTGCAT AAGTCTTCAG CTTTGCTTTA TTTATATTTG     42120
     ATAGTTGCTC TAAACGTTCT TGCAACTCTT TTCTCTCTGT GAAGGGCAAA ACACGGCCTT     42180
     GCTTTACAAT ATGAATATTC TCAACTCCGA TTTCAGATAT GGAATCCAAT AGGTGAGTTG     42240
     TCATCAAGGC TCTACCTTTT GCATTGTCAA TACTTGCCCA AAGCTTATTG ATATTTCTGT     42300
     AATGGAGGTG GCTATCAGCT TCATCAAAAA GAAATAGCGT TTTCTCGTTA TCGAAAAGGT     42360
     CTAATAGCGC ATAAACAAAC AACAGCTGAT ATTCACCATC ACTCACTTCA TCTAGTGAAA     42420
     GATCATTATA AAATTTTAAA CTGAGGCTTG TTTTAGTTAT GGGGTTGTTG GCATCGATTG     42480
     CTTGGGTTAA AAAAGTAACT GCAGGATCGT CACTAATTAT GTCAGTCCCG CCTTCGACGT     42540
     GAGCAGACTC GAAAGATGTA TTGAAGATAT CTTTGCTAGT TATTTTAATG TCTTGTTTTG     42600
     AAATTATATC TTCAAAATCA TATGCTCCAT CGATAATATT TTCGATGAAG CTTGAAAGAC     42660
     TTCTAAAAAA AGGGGTTGAG CGTATGGTAT CTGTTGCCCC AGTTTCTTCT TGTTTTAAAG     42720
     CCACTGCAAC TTTGTTAATG TATGGCCGAT CAATTCTGAA TCCACAAGAT AGTATTGAAC     42780
     TAATATCATC CCCTAAATCA TCACTTTCTT GAACGTGCCC TAACGATTTT AGTAAGTTCC     42840
     TTACTTTACC TTGCTTTTTG AGAACAGAAG CCAAAAAGAT TAATAAAGGA GACCAGGTTT     42900
     TGTCATAGTA AAAACAGTGT AACGATAACC CAGATTTTGA TTTTCTAGCC TTTTTAAGAT     42960
     AGTTAGAGAA TGCTCTTGAA TACCGCTCGT TATGTCCAGA GGAAAAGCAA ACAACTTTCC     43020
     AATCAGATAG CATTACGTCC GACATACGCC CTTCAAAAAT AGTTTGAAGA ATAGACGACT     43080
     TTCCACACCC ATTTTCGCCG ATTAAAGCAG AAAATTTATT GAGCTGAAAT GATTGCTCAT     43140
     CCGGATGAAG GTGGTTTGGA GATAAAGTTA TTTTCATTTT AATTCACATG ATATAGCTGT     43200
     TGTTGTAATT GTTTAAAAGC CGCCAGCAAA TAGGCTGGTT TTCCACCGAA TGCTGTTGAG     43260
     GCGTCTTTCA CTGTGCCCAA CCCCGATAGC TCAATAAGTG CAGGCAAGCG CTCGCGTGAT     43320
     AACTCCGTGC TGCCGGTTTG CTCATATCGG TTAAGCACAA AGTGCAAAAA CTGCTGTGCC     43380
     TTTTCTTGCT GATATTGTTT AAAGAAAGCG CTGTTAGTAC GAACTTGATC GGCACGAGCT     43440
     TTACGGGTTG CCATGGGCTG TTCGAAGGCT AAAAAAGCCA GCAGATCGAA GATATCGCAC     43500
     TCTTCTGCTT CAAACATGCG TCGTAGTGTG GCGAGCTGAT CTTTATCAAA GCCAGCTTGT     43560
     ACGAGTTTAC TGAGTAAGGT TTCACGTTCG TCTGGGTCAG ACCAAATTGT TGTTAGCTCT     43620
     TCCACCGACT TGAATAACCC TGGTAATTGA CTAATTAGAC GCTCAACAAA TTCTTGCACT     43680
     GTGAGTGGTT TACCGTTTTC ATCGATATAA CGGGTTTCAA CATCAATCAC TTTGAGTTCA     43740
     CGATGTTTGC TTAGTTTCAC TTTTAACCGT AGCTTTGGTT CACCCGGCTC AGGCTCTGGG     43800
     CCATCTGCTC CTCCGGGTGG TTCTGGCGTG CAGGGTGGCG ACGTTGGCTC GCCAATGCCA     43860
     CCTGGCTCTG GTGCTTCAGG CTCTCCATCC CAATCTTTGT CATAAAACTT ATTGGTTGCA     43920
     CCGCGAAAAT CGACAATGGT GAAATAGTCT TTGCCATCAA AAACACGGGT TCCGCGACCG     43980
     ACAATTTGTT TAAACTCCAC CATTGAGCCA ACGGTTCTAT CCAGCACTAC ATTACGCACG     44040
     TTACGGGCAT CTACCCCAGT GGTTAACATT TGTGATGAGG TAATGATGGT GGGGATGTCT     44100
     TTATCGTTAT CTTGGAATTT TTCCAGTAGC TCGCGGCCAA CTTTACCTTC GTCACTGGTT     44160
     ACACGCACAC AGTAATGGGG ATCTTTCAGC TTTTTGTGTT TGTTGATCAT GTCACGCATG     44220
     GTCAGTGCAT GATTTTGGTT TTCGCAAAAG ACGATGGTTT TTTCTAGTGG ATTGATATTG     44280
     TCCAAAATGG CTTTTGCGAC CAGCTCTGTA CGCTCATCAA CAGTGATTTT TTTGTCGTAA     44340
     TCTTCTACCT GATAAACGTC TTGCCCAGAC TCTCCTTCGA TTACTTGGTC ATCTTTGGTT     44400
     AGCACCAGTT CATCTAAGTT AGTACGTACC CGCTTAACTC GATATGGCGT TAAAAAGCCA     44460
     TCGTTGATGC CATCTTTTAA TGAGTATTCA AATGCTGGTG TTCCAAAGTA ATCATAGGTA     44520
     TCCACGTTGG CTTCACGTTT TGGTGTAGCT GTTAGGCCGA TATGTACCGC ACTGCCAAAA     44580
     TGATCGAGTA TGGCTCGCCA AGAGCCTGTC TCATTAGCAC TGCCACGGTG ACACTCGTCA     44640
     ATCATTACAA GGTCAAAGAA ATCACTTGGA TATGCTTTGT AGTAGCCTTC AATATTTTCA     44700
     CGCTCAGCAA TGGCTTGGTA GATAGCAAAA AAGATATGCG CATTGGTTGG CACTACACCG     44760
     CCACGCTTGC GTACCTCTTC CCCATTAATT TTAATTAGAT CTTTTTCGTA CGGATTAAAG     44820
     GTATTGATGG CTTGATCTGC CAAAATATTG CGATCAGCTA AAAACAAAAT TCGTGGCCTA     44880
     CGTGTGCCCG GAGATTCTTT GTTCCAACGT GACTGGAACA ATTTATGGAT GATTTGAAAA     44940
     GCAATAAAAG TTTTGCCTGT GCCCGTAGCA AGCGTTAACA GCACCCGCGT CTTACCTTTA     45000
     CCAATAGCAT CTGTGGCAGC ATGTACCGCT AACTCTTGGT AATAGCGCGG CTGCATTGCA     45060
     CCTTCTAGAT GGAAAGGCAC ATTACGAAGT TGTTGGCCTA GATCTGAATT AACACCCGCG     45120
     TAGCGGTTTT CAAGCTCTTG TGGTGTTGGG TAAAACTCGA TGTAGTTGCC TTTGCCAGTT     45180
     TCTAAATCGA ACTCATAGGT TTGTTTGCCG TTGCTTGAAT AGACAAAACG AACGAGTAGC     45240
     TTCTTAGCAT AGTCTATGGC TTGTTGAAGA CCTTTGGTTG GATGTTCAGA TTCTTTTTTT     45300
     GCTTCAACAA CTGCAAGGTA ACGATTGTCT TTGTGGAGCA GATAATCGAC GAAGCAACGA     45360
     CGACCACGGA CACCGCCAGC AAGCTTACGG CCATCGGTAA AGTAATGTTC CCGAATGATG     45420
     TTGCCCGGTT GCCAATGTGC GGCTTTTAAC GCTGGATCGA TGTAGTTTGC TCTGGTATCT     45480
     GCTTCTGACG ACATGTCGTC ACTCCTTGAT AATTTTTAGC CCTGTCTATC GCTTGGCATT     45540
     TTTTCCAATA TGTCGCTCAA TGGGCAGTTA AATAAATCGC ATAGCTTATC GAGCGCTTCT     45600
     AAGTCCACCT TGAGCGCGGT TTCTTTGTAA AGTAGCGTGA CGGTGGTACG GCTTAGGCCG     45660
     GTTTCTCGCA TCACGTCGCT AATGCGCATT TTTCTCTCGC CCATTAAACG GGCTAGATGG     45720
     CAGCGAATCA TGCTTTCTCC ACGGTATTTT TTAACCCTAA AATTTGGGGA ATTATCACAG     45780
     TTGCATACCC TATCACTATT ATGATTTTTC TCAACTTATT TGAGTTGAAA CCAAATTTTT     45840
     AGAATGGTGG ACAGTGGCTT AATAATTTAA AAATGTGGTT TACTACGCAA TAAGCGTCTC     45900
     ACTTTCACAT GTGAAAATGG GGCAGTTAAT CGATACTTGT GCAAAATGTT AACGTAGCCT     45960
     ACGAAAAAAG GACTGCATTA CCGCCTCATT ATCTGCATCT GTAATACTAA ACCACGAATT     46020
     TGACGGGCTT ATTTTCACGC CAAACTGCCC AAAATGGGCC TGAGCACCGC GCGCCTTTGC     46080
     GTTGCTCACC CTGCAAACTA TTCCTTGATT ATTCATTAAC TGTCAGGAGT AGTTATGACC     46140
     GAGCAAAAAC AATCAAGTCA GCTATTAAGC TATCAAGAAG TTTGCAAACT AACGCAACTA     46200
     TCTCAGGCAA CCATTCGCCG TTATGTGAAA AATGGTTCTT TTCCTTCTCC AGTCACACTA     46260
     TCACCTGGCG CTAGAAGCGT GAGATTTCGC CTTGAAGATG TGCAAAAGTG AGCCAGTGAA     46320
     TCACTCTAGG ATAGACTGAT TCACGCGAGC CTTAAAACAG ACCCATTTCG CCCCGTATCT     46380
     TCCTTCCAAC GGGGCTTTTT TTTGCCTTAG AGTGAATCAA ATCTTTAGAG AATTGATTCA     46440
     TCGTTTTTTA GCTCATTCAA CTTAGCTGCT TTGGCAATGG TAGAACGACT GCATTTAAGC     46500
     AGACTCTGCA CTTGTGACCA GCTTTTCCCT TCATCGAGTA GTAACCGAAT ATTTTGCCTT     46560
     AATCCATGGT CTGGCTGACG CCCAAGGTAT TTGCCTAAGG TTTTGGCCTT TTCGATGCCT     46620
     TGAGCCTGTC GCTTTCTTCT TGTCTCGTAA TCATCTCTGG CCATTGCTGC GGCCAAATCA     46680
     ATCATGAACT CCGTCAGTAC CTTTGCGATC ATGGTATGTT CTTCTGTGCC ACTTAAGATC     46740
     CCATGTGTCA TTGGCTGGTC AACAACGACA ATATGAATAT TGGCTTTTAC CAACTTAGTT     46800
     TTTAAGATCT TCCATTGTTC GAAGGGGAGG CGAGACAACC TATCGACTTT TTCAATGAGT     46860
     AAAACATCGC CAGGGTGAGA GTCCATGATC AAGCGCCCAA GTTCAGGTCG TTCAATTTTC     46920
     GCCCCTGATT GCGTCTCGGT ATAAAAACTG GCTATACGAA TATTTTTATT TTCTGAAAAC     46980
     TGAACCAACT CATTTTTGGC TCGATTGGCA TCTTGTTCAT CTGTTGATGC ACGCAGGTAG     47040
     GCCCGAATAA ACATTTTGCC TCATTTGGTG TTTTTAGGGT GTGGTTTATG ATGCTAGTGC     47100
     GAGTAGGGTT TAAAATCAAT ATATAGCGAA CCAATTGGCA ATGGGATATG GCTAGTTTGC     47160
     TTGGGGTATA CGTTTTCGCA CCGTTGGATT TCACCCCCGT ATAGCGTTGG CTAAATGTCA     47220
     GAAAGAGATC TTTGTTGCTA CCTAAATCAT TACATAAACT GTATAAAAAC ACTTTTACCC     47280
     AATAGGACAG ATAACAATGA GTTCGATTGA GATTGATGAT ATTAAAATAA AGTATTCTCC     47340
     TTTAAATAAG GAGCTGGTTG TTGATGGTGA GCTACTGAGT ATTTTTATTT ACGAAGGTGA     47400
     CTCGTCTGGG CGTTGGGTTT TAGAAGTCGT GGATGAATGT GGTACATCGA CTGTATGGGA     47460
     CTACCAATTT GAAAGCGACC AAGCGGCTTT TGATGAAGCC CTAAATACAA TTAACGAAGA     47520
     AGGTATCAAA GCCTTTAAAA TTCAACCAGA AGAAAATCTT CACTAAGTAA AACCCTCGTT     47580
     TAGTCACAGC CTGCTGGATG GACTACTCGG TAAAGCCAGA TTAAAATGCC CTGTAGTCAC     47640
     CCACAAGGCT CAATTCTATC ATTAGTTTGT GTTGCTTAGA CTTAGCTGTT TAGCGACTCT     47700
     AGTTTGTACC CACGCAGGCT TTTTCGCTAA CCATTGGTAT AGCTTCCCTG CTGGAAGTTT     47760
     AGGTAAGTCG ATTAGACGGG CTTTCTCTAT TTCAGTATAC TCTTGATGTG ACATATTTAA     47820
     TCCTCATAGA TTGGTTGTGT TACGTTGCAT GGTCTGTAGT AATGGACAGT TGCTACAGAC     47880
     CATGAATTAT TTATCTGAAT TACTTTTAAT TTTCAATTCT TTATATATTT TTTCTCGCTC     47940
     AACCTCTGTA GTTATAGCTA ATAAATAAAG TGCTGCCTGT ATTGCAGAAC TCATGGTTAC     48000
     TCCGTCCACG TCCTCTACCT TGCCAAGATC ATTTAGTGAT CTTGCACTAA AATATACATT     48060
     CCTTCGTTTT CCTTCTGTGT GTGTGATTTT AGATTTTTTG CTTTTATTGT TCTGGGTTTG     48120
     GATATCAATT AATGCTTTTT TCCCAGATGT GGATAAATGT TTCTTTTCAT TTACAGCTCT     48180
     TGTTAACGCA GCAATTGCTG ATTCGTTTGC GTTTTCCTTC ATCATAAGTC CTTAACTCAT     48240
     AGGTGTACAC ACTTGAGTGT GTATTCTGGT GTGTATACAT ACTTGGGTGT GTATACGTAC     48300
     TTGGGTGTGT ATACGTAGTG TTTGCATGAC TACATGCAAC TTTCTAAAAT TTCCATCACA     48360
     AGCATATCCG CTTCATTTTG CGCTCTCTTG GCACTATTTA GTGTCGATTC ATAGCAAGAC     48420
     ATACCCAAAT CCCAGTTTTT CCAGAATGGA TTTAAATCGG TTAAAAAACT GTTTAAGTAA     48480
     CTACCGTTTG ATGCGCTTAT TTGTTGTTTA ACTCTGTCTA TTTGCTGCAA TTGATTTAGG     48540
     GTTGACACTC TTGTCATTAA TATTTTTGTT TTTATATCGG GGAAATGTTC ATTGAGTACG     48600
     TTATGTATTT TCAGTGCTCT ATCGATAGAC TTTTGGCGGC AATCTTTTTC ATTAACAATA     48660
     AATGGAGTTA ATACCATGTC GCTAGAAATC ATAGCATCGT TACTAAATGT TGAATGGGTG     48720
     GCTGCTGTAT CAATTATTGT TAAGTCATAA TTAGCAGCCT CTTTCGATAT ATTTAATCCT     48780
     TGTTGTTCTG CACTTTGTTC GTGACTGTAC TTTTGTATAT CTATTTCTTT ACCCAATCCT     48840
     GCTGTTTTTC TTGCCATTGC CCATTCGTAA GATTCCTCTC TACTGTCGCC GTCTATGATT     48900
     AGGATTTTTT TTAATCCTGC TCGTTGGGCG GCTGCCGCAA TGTTGACAGT TAAAAGTGTT     48960
     TTTCCACATC CGCCTTTCTC TGCGGCGATA GTTAATATAG GCATTTTTTA TTCTCTGCAA     49020
     TTAAGGCTGA CATACATACG TAGGTGTGTA TGCTTACATT GGTGTGTATA CACACTCTAG     49080
     TGTGTACCTT GTTTTTTGTC AATAGCCCTC ATGTGGAAAA GCTAGGACAG AACAGCACTG     49140
     TCCCCAGCTT TACCACAATC AGCCAGATTA ACATTTGCGG TGGTCGTAAG TTTGCGCTCC     49200
     GCGCTCAATA AGTTTTTTCA TTTTTTCTTT ACAAGAAAAG CGCTAAATAT TGATTTTTGC     49260
     GGTCTATTTA CCATTATGGT TATTGTGCGC ATCGCGTTAT GACCACTCAA TCAATATCAC     49320
     TATCTAACGC CTCAAAATCA CAGGTTTACA GCCCCTAAAA TCACGAAAAA TAAGAACTCA     49380
     ATAATTGGTC AATTTCACCA CTTTGGTCGT TCAGCTAAAA ATAGCCCTCA AAGGCTCAAA     49440
     ATGGTAAAAT GGCTCACCAT CTCTTACTTT GATATGCACA GCGTGAACTC TAGCTATGAT     49500
     TTTTGTGACG TGCTCGATAA CGCACTCTTA CACCTCTATT TAAGTGTGGC TGAAACAGAA     49560
     CGCTTTACCC CTAAAGCAAA GCGTAATGAG ATATTGCTTC GCTACCTAAA ACCAATGATA     49620
     AAAGATAAGC GCTATCAGCA AGCAAAAAAG GAAGTAAAGT GTTTGGTAGC GCTAGGGCGT     49680
     GTTGCGTCAT GTGACTTAGA GTCAAAGCTT ATTGAGCTTA ATGAATTGTC ACAGCGTTAT     49740
     GATTTGCAAG CGACGAAAGC AAAGCAGTTG TTTGACTTGT TGAGGTTCAT TGAAGCTGAG     49800
     TTAACGCTAC CTACCAGATT TTTAAATGTA AGGGACAACG AGCGAAAATT ACCGAACACC     49860
     ATTTACATGT TGCAAGAGCA CATAGAAAAC GGATTTACAG TTTCAGGTGA ACAGGTTGCA     49920
     CCAGTGTCAC TGTTTTTAGA GTCAGATAAG GTAATAGACG TAGTTGATTT AGTGAATGCC     49980
     ACAGGCTGGT TCTTGGCTGA AATACAGCAG CATAATGTTG ACGAAAAACA AGGTCATATT     50040
     TTGCTGCACC CTAAAAAGTA GGCATGTGTG TAATGGCTCA AAATCAGCGA CTTAGCTGAG     50100
     TTATTTTCTG TGTCGAGACC AACGGTCTAT CGAATGCTTT TACGAGGAAA AAAATGATCG     50160
     ATCTAACTGC AGAGCAAAGA CACTTGGCAA AAATAGTTCA TGATTATGCT TGTCGGTTTC     50220
     CTCTGACAGA GGATGGTGAC GCTCAGTTAT TGCAAAGCTG TTATGACTAT ATGGACGCCT     50280
     TTAAGCGGGT GATGGACAGC GCATCAAAAG TCCAGATGGA CTACATCTGT CTGCAATATC     50340
     CGGGGTATTT TCGCTTTGCG AAATGGATGG AGCGTTTAGC ACAGGGTATT GCTGTTGGTG     50400
     TCATTGATAT TCCCAAAGAT CACTAAAAAT AAGTCACAAA ATTTTGGCGG CTTCCCGCTT     50460
     ACAACCCCTG TTAGTTCCCC GTAAAACGCG AAACAAGCGG CGGCTTCGCC GCCCTTTTCC     50520
     GTTTATGGGG TTTTACGCCC ATCCCCTCGA AACTAGTATT AAGAACATGA TCTTGTCAAA     50580
     TTAGGGTCAA AGAGCACTGG ACCCGTCCTA CCTTGGTTAA TTGAAAAGCG AATTAACCAG     50640
     GGGAGATCCC ACCCAACCGA TCACCAGATT TTTAAACGAC AAAAAACTGC AAACACAAAA     50700
     AATTGAAATG GGGCGATTAT ATCCTCTGGA TAGCATTCTT TATTGTCTTT AGTGCTCTGT     50760
     ATTTACTATA ATGTACTTAC AAATGTAACT ACACCGTGAG GCAGTATGGG CACTATTAAT     50820
     ATTCGCATCG ATGACGAGCT TAAGGAGCGT TCTTTTGCTG TGTTGGAAAA ATTAGGCGTT     50880
     AGTCCCTCTG AGGCATTGCG GCAAATGCTT GAGTATGTCG CCACAAGCGG CGCTATGCCA     50940
     TTTAAACCCG TACTGCTAAC AGCAGAGGAT GAAGCCTTGA TCTCCTTGGT TAAAGAGCGT     51000
     TTAGCGAGCC CTCGAAAGGG GATCGAGGTT TCGCTCGATG ATCTATAAGT TAGTATTTGA     51060
     TCCCCGCGCA TTAAAGGAAT GGAACAAGCT TGGAGATCCC ATCAGGCAGC AGTTAAAAAA     51120
     GAAACTGGCC GAGATACTGC AACATCCTCA TATCGGGGCT AACAAACTTA GAGATCTCCC     51180
     TGACTGTTAC AAAATCAAGT TGCGTACATC AGGTTATCGC TTGGTATATC AAGTACAAGA     51240
     TGAACGCATT ACCGTGTTTG TTGTGGCCGT AGGCAAGCGT GAACGATTAG CGGTGTATTC     51300
     AACAGCAGAA AAGCGCCTTT AAATGAGGTA TGAATCAGTT CTCTAGAGAT TTGATTCATT     51360
     TTAGGGCAAA AAAAGCCCCG TTGAAAGGAA GAAACGGGGC GAAATGGGTC TGTTTTAAGG     51420
     CTCGCGTGAA TCAGTCTGGT GTAGAGTGAT TCACTGGCTC ATTTTTGGAC AATTATTGCT     51480
     TAGATATAAA ACTCTTACTT GTTCCATTTT GATTACTTTC TTTAACCATA AGTAGTAACT     51540
     ATCTGGTATC TCATTAAAGA AATTATGCAT AAATATACAA AAGGCAAGGT TGAGACCTTG     51600
     CCTTTATTGT TACCTATACC AGTCATCAGC CAGTACTTCT GCTTGCTCAA GCACTAACTT     51660
     AATCGCAGCT TCTGCGGCGT CAGGTGGATA CTTCCAGCGG CGCAGCAGAC GACGAACTAA     51720
     ATTACGCATA CGTGCTCGAA CACTATCACG CTTTTGCCAG TCTACCGTAG CTGACTTACG     51780
     CAGCTGTTGA GTTAACTCGA TAGCTAAACC ACGCAAACTA TCATCACCCA GTTCTCGCAC     51840
     TGAAGCTTCG TTCATGACCA ATGCTCGATA AAAAGCAATT TCATCAGGAG ATAGATTTAG     51900
     ACCTTCCGCC ATCTCAGCAT CAGCAGCCAT CTCTTTCGCC CATTTGATTA GTTCTTCAAT     51960
     AACCTGAGCC GTTTCAATAC TGCGATTATG ATACTTTTGC AGTGTTGTCA TGATGCGCTC     52020
     AGAATACTTC TTCTCCTGCA CCACATCATT CTTCATCCGC GCTTTCACCT CATCACGCAG     52080
     CAACTTCTCT AGTAACTCAA CGGCAAGGTT CTTCTCTTTC ATGTTCTTCA CATCTTCCAA     52140
     GAACTCCTCA GAGAGTAAAC CAATATTAGG TTTATCTAAC CCCACCATAT TAAAGATGTC     52200
     ATCAACACCA TCAGCAATAA TTGCGTTATC TAATATCTGC TTTAATGCTG TGTTACGTTC     52260
     TTCATCACTG CGTTTTTTAT CAACTGTTGA ATGTTTGATA AAAGCGGTTT TAATCGCAGA     52320
     GTAGAAAGCT ATTTCGTTTT TATAACCTTG GGTTTCATCC ATGGTATTGC ATAGAGAAAA     52380
     CGCTTTAGTC ATTGCCGCCA TTACATCCAA GAAGCGCCGT TTACCATCTC GTACCTCTTC     52440
     ACCTTTACTA TTGCGATGAG ATAAACCTGA TAAATGGTTT ACAGCCCCAG GCAACAGACG     52500
     CAATGCATTC GTTTCAAACT CAGGTCGGTA GTTAAATACG GCACCATCAA CTGGCGTGGC     52560
     AAACATACCT CTCACAATAT CAATTTTTTC CATTAATACT GAAAACGCTT CAGCTGTATC     52620
     AACTGTTGGT TGCCCTTTAC CTTGGCTATT TGTATAGGTT TTAAGGGCAT TTTTTAGCTC     52680
     ATTGGCAATA CCGATATAAT CAACCACTAA ACCGCCCGGC TTATCTTTAA ACACACGATT     52740
     TACGCGTGCA ATAGCCTGCA TCAAATTGTG CCCCTTCATC GGCTTATCGA TATACATGGT     52800
     ATGACAACAT GGCGCATCGA AGCCTGTTAG CCACATATCA CGCACAATCA CCAATTGAAG     52860
     TTCGTCTTGG GTATCTTTAT AGCGTTTTTC AAACAGCTTT TTGGTCTTCT TATCATGAAT     52920
     ATGAGGCTGC ATCTTCTCTT TGTCAGAGGC GCTGCCCGTC ATCACAATTT TGATTGCGCC     52980
     TTTATCGGGA TCGGGGTGAT GCCATTCAGG CTTTATTGCG ACAATAGCAT TGTAAAGATC     53040
     GACACAGATC TCACGGCTCA TCGCTACAAT CATGGCTTTG CCGGGAAACG TCTCGCTGCG     53100
     AGTGCTAAAA TGGTTCACCA AATCGAGAGC GACTTGCTGA ATACGAGGCT CAGCACCAAC     53160
     GAGCTTTTCT AGTGTTGCCC ATTGTGATTT GATTTGTTCA CGGCTAGCTG TCTCTTCTTC     53220
     CTCACCGATT TCATCTTCGA CTTGGTCGTT AAGCTCCTCA ATCTCAGCTT GATTGATATC     53280
     AAGCTTAGCT AAACGAGATT CATAGTAGAT TGGTACTGTG GCACCATCAT CTACCGCATC     53340
     TTGAATATCA TAGACAGAGA CATACTCGCC AAACACACCA CGTGTATCTT TATCATCCAT     53400
     GGCAATCGGA GTGCCTGTGA AGCCAATGAA TGAAGCATTT GGCAGCGCAT CGCGCATGTA     53460
     TTTTGAGTAA CCAAAGACAT ACTTAGAGCC TGTCACATTG CCATTGGCGT CTTTAACCTC     53520
     GACTAACTTC GACTTATTGC CATATTGGCT GCGGTGCGCT TCATCAGACA CCACTACAAT     53580
     GTTGGCACGC GTTGACAGGA TAGGATGCTC AATTTCATCG TCTAATAATG CAAACTTTTG     53640
     AATGGTGGTA AAAATGATCC CACCCGATTG ACGATTTAAC AGTAATTGAC GCAACAAGTC     53700
     TCGACCATCT GCCTGTTGTG GGATCTGCTT TAATGTCTCT TGTGCCATAC CAAAAGTATT     53760
     GTAAAGCTGA CCATCAAGAT CATTACGGTC TGTCACCACC ACAATAGTGG GGTTATTCAT     53820
     TGCAGGCTGT TGCAGCAGCT TACTGGCGTA GCACACCATC GAGATACTCT TACCACTGCC     53880
     CTGAGTATGC CAAACCACTC CAGCCTTACC GCTACCCGCT TTAATCTTAT CTAAGCCTTT     53940
     TGTCGCTTGA ACCTGATATT TGCCTATACT CTCAGCAACC ATAGGTAAAT CGCTATCTGC     54000
     TTGTTTAGCT TTAACGGTCG CTTCTACCGC AGCACGTACA GCATGAAACT GGTGATAGCC     54060
     AGCTATCTTC TTAATGATGT TGTCATTATC GATCTCAAAG AGAATAAAGT AACGAATATA     54120
     ATCAAGTAGC AAATCTGGTT TGAAGAAACC ACGCACCATG GTTTCTAGTT GAAACTCCAG     54180
     TAAGGGTTTA TCGTCTTCGC CAGTTACAGT TTTCCATGGT AGGAAACGCT CTTTATTCGC     54240
     CGTCAATGAG CCAACACGGG CAGTCCAACC ATCGCTAACA ACCAGCGCTT CATTGAAAAT     54300
     AAACAGATCT GAAATTTCAT CTTTGTAGGT TTGAAGTTGA TTAAAGGCAT TCCAAATGTC     54360
     GGCATGCTCA TCGGCTGGAT TTTTCAACTC AATAACAGAG ATGGGCAAGC CGTTAATAAA     54420
     CACCAAAACA TCGGGACGGC GATTCCCTTT TGTACCTGTA ATCGTAAACT GATTCACGAT     54480
     AAGGAATTCA TTGTTATCAG TCGTCGTAAA ATCCATTAAC TGAGCGTGAG TATGCTTAGT     54540
     TTTCGATTCG CCGTCTTCAA CTGCCGTGTA TTCGACAGGC ACCCCTTCAA TCACAAACTT     54600
     GTGGAATACA CGGTTGTTTT TAATAAGAAT TGGCGTATCG GGGGAAGATA CCGTGTTAAC     54660
     CACATCATTC AGTGCCTCTA TCGGAAGCTC TGGATTGATG ATTGCTAATT GATTTAATAG     54720
     CCGTTGTTTT AAAACAACTT GATGATAATC ATCACGCTCT GGAGAATCGC CATCAGGTGC     54780
     GATGTCATAG CCATTTTTAT ACAGATAACC TTGGTCGGTG AACCATCTAA TACATTCTTG     54840
     TTCTAACTGG TCTTCAGTGA TCATGCCTCG GCTCCACCCT CAAAAGTAGT ATTTTTTAAT     54900
     TTATCACTTG CCACTTGAAG TGGAGATTTA AACGCTTTTT CGAGTAAGAT CATGTGCTCG     54960
     ACTAGCCAGT CAATCATCTC TTGCCATTGT TCTCGATCGT ACCCATCAAA CTCTTTTCGT     55020
     AGCTGAACTC TAGATGCTTT TTTATCATCT AACCGCAACC ACTCCAAAGG TTGACCAAAA     55080
     GAGGATTCGA TTGGGCTGAT CTGTTCTAGT AATTGGTCAA ACAAGAACTT ATTTTCTAAA     55140
     CCTCCAGTAC GAGTCATTTC AAGCTGAACT CGAACCTCTC TAACACCAAA GATCAAAGTA     55200
     AACGGACAAG AACGAACACC GGAGCCAGCA CTTAGCCAGT GATCTTTGCT TGGATTGATA     55260
     TTGTTGAACA AATCGCATTG GCTACTCTTC ATGGATTCTA ATGCTCTCTC CCAAAAGGCC     55320
     ATTCGGATTC GGTGTCGATT CTTAAGTTCT GCTTCTGTGT TCTTTTCTTC AGCTTCTTTG     55380
     GCATTCATTC CAATCATCAA TTCCTTAGCT TCAGGAGTCG GAATGATCTG CTCAACGTTA     55440
     AGAAAAAGAT CTTCAGCCAT TGAATAAGGC GTCACTTTAA AGCATTGAAC CTGAATGCCG     55500
     TGATTCAATA ACCACAATGC CGTACTTGTT ACTTCTTTTC TAAAGTTGGC TGCAACTAGC     55560
     ATCAAGCGTT GATTCATACC AGAGTTAAGA ACGACTTCAC TCAAATCAGG AGCATCTAGA     55620
     AATTCACATA ATTGAGATTT TGCATCACCA CCACCGCAAT ACTTAATTAG GTAGCCCTGA     55680
     TAAATATCGA CAATTTGTGA CTTGGTTAGA TTAGAACAAT AAGACGCATA TTTAAGAGCC     55740
     TGCCACATGA CATCACGACC AGTATCATCA AGCTTGTTTT CTATAATGAT AAGGTTCCCG     55800
     TCTTTATCCA TAGCTAATAG ATCAAGACGC TCTCTCGTAT CATCAAACCC ATCGAATTCT     55860
     TTTTGAATGA TAAGTAGCTC TTCGCCTAAG GCGTCTGGTT GGTTCGCTAA CCATTCTTGC     55920
     AGGTGATCAC GTTCTCGAAA ACCAAGATCA CTAAAACGTT TAGTTTCTAT TCTTGAAATT     55980
     CGGTTGGATT CCTTATCAAT TTTAAACACG TCTTATTGTC CTTATTTTAA ACGTCTAACA     56040
     CTTTGTCTAA GTCGATTTCG CCCGAAAGCA ATTTAGGAAG TAGAATGTCA CGCATTTCTG     56100
     AAAGAGACTG ATTCTGGTTA TGGTTATCAG AAATCTTACC CATTAATGGC GAAATTAACT     56160
     CATTAAACTT CTGAAGCAGA TTTTGTGACG GCACAAGTAC TGGAATTGTT CTTAACGTTT     56220
     TCAATGTTAA GTATTGTTGC GTGGTACCAG CCATACGAAC TTCAAGGTAG TTTTTCATTT     56280
     TAAAACTCTG AAGATGCCAG TAAAACAACC ACACAAGTTC TGGTTTCTGC GAGGTTTTAA     56340
     ATAGCCCTAC ATTCTTAATC GCAAATTCTA CAGGATTATC ATAAACAACA ACGACTTCAC     56400
     CTACTGTACC AATCATGGTC AAAAGAATAT CGAATGTATC AACCTTGCTT CTTTGGTTAA     56460
     CCTGTTCGAA ATCTAATTCG CTAATTAAGT AAGCGGATGA AGTATCTATC TTGCCTTTTG     56520
     TGATGTGTTT AGAGGTCACA AGGTAGTAAC CATTCTCAGC CTTTTTAGGG GAGTCATGAG     56580
     TACCATCTCT AACTTCAAAC AAATCTTGAG TGTTATGAAT GTGCCAACCT TCAGGGATTA     56640
     AACCAAGCTC AGACTCAACT AGCTTTTCTG GAAATAGCGA GGCAGTAGCC GCATCCATTC     56700
     CCTCTGGTTG CTCGCCGTTC ATCTTGGCTT TTACTGGATC GAAATCGACA AACCATGATT     56760
     TGAAGATGGC TTGTGCAATA TCTTCAGAAG TCGAATTAAT ATCTTTATTT ACGTTAAGCT     56820
     TTTGAGTAAT AGACTTAATA ATTTCAACTA CATTACGTTG TTCATTAAGA CTAGGAAGCT     56880
     CAATAGGGTA ATAAGCTACA GCATCAAACG TAATTTGAGG GAATGTGCCA GAACGAGAAT     56940
     CGGCAATAAC TTTAAACTCT GCTTCACACT CTTTACTTGT AAGCACTAAA TAAAGGTATT     57000
     CAGGCAACAC AACATCATGA TCACAGGTAA TAACCATAAA TTTAGTTGAT ACCACGTAAT     57060
     CATCGACATC TCCTTCAACA AGCAAGTGTC GTTTATTTCC GGGACGGATC TCACTATAGA     57120
     GTATGTCCCC ATGCTGGATA GCTTTTTTTG CTTGCCCGGG TAAGCCTTTA CTTTGCACAC     57180
     GCTCATTTGT TAAAAAGTGA CCATCAAGAA TGTCACCAGT ATTAATAAAA CAAACTTGTT     57240
     CATTGCCAAC AAAGTTAAAG CGTCTTGATG TATTGGATGC GATCTCCCCT AACGTATAAG     57300
     TCTTAAAACT CATAACCCAA CCCCGCTAGG TTCTTCTTTA TCTCAGCTTC TAATTTGGCC     57360
     GACTCCGTAA ATTGTTCACT AAGCTTGGTA GTTAACATTT CCATTTTCTC AGCAAACGGC     57420
     ACACCATCAT CAATTTCATC GGCGGCGCCA ACATAACGAC CCGGAGTAAG TACAAAATCA     57480
     TGTTTGGCTA TTTCAGCTAA TGTTGCAGAT TTACAGAAAC CGGCTTGGTC TTCATAAGTG     57540
     ACGCCATTAA CTGTTTCACC GGTTTTCCAA GCATGGAATA CGTCAGCCAC TTTTTGAATG     57600
     TCTTCAAAAC TGAAGTCTCG TAGTACACGG TCTTTCATGT AGCCAAGGTT ACGAGCATCA     57660
     ATGAATAGCA CTTCACCTTT ACGCCCTCGC AGCTTACGAC CTGCCTTATC AACTCTTGGG     57720
     TTCTTATTTT TAGTTAAAAA CCAAATACAC GCTGGAATTT GGGTGTTGGT AAACAACTGC     57780
     CCAGGCAAAG CCACCATACA TTCAATGAGG TCATTCTCTA TTAACGCCTG ACGAATGGTA     57840
     CCTTCATTGT TGGTAGTTGA ACTCATTGAG CCATTAGCCA ATAAAAGCGC CTGTGAGCCT     57900
     TCTGGTGCGA GGTGATGCAA CATGTGCTGC ATCCACGCAA AGTTAGCGTT ACCAGATGGT     57960
     GGCTGACCGT ATTTAAAGCG TGGGTCATTA TCATCGACGC CTGTATTCCA CTCTTTCATG     58020
     TTAAAAGGTG GATTGGCCAT AATGAAGTCG GCACGTAAAT CAGGATGCTG AACATTTGTG     58080
     TAGGTGCTGG CTGGCTCTTT ACCAAAATCG TAATCAAGGC CACGAATAGC CATGTTCATT     58140
     GCAGCTAATT GCCATGTGGT GTAATTATAT TCTTGGCCAT AAATCGAGAT TTTGTGCTTT     58200
     TGTGTTAATG CATCTACTTG TTTTTCATGG GCATGACGCT CAATGAATTT CTCTGATTGA     58260
     ACAAAGAAGC CGCCAGAACC CATTGCGGGG TCATATACAC GACCTTCAAA GGGTTCAATC     58320
     ATTTCTACAA TCAACGATAC GATAGACGCT GGCGTGTAGA ACTGACCACC TTTTTTACCC     58380
     TCAGCCAATG CAAACTGACC AAGCATATAT TCGTATACGT GACCTAAGAT GTCTTTACTG     58440
     TTTAGATCAG CATGAACAAA CGGGATGGTA GCGATCAAGT TGATTAGCTC GTTCAGCTTC     58500
     GCTTGGTCAA TCTTCAATGA AGAATATGAC TTGTTCAGTA CGCCTTTCAG TTTCGGGTTA     58560
     TCTCGCTCGA TACCTTCAAG TGCGTTATCA ATTAAATGGC CAACAGAAGT GATCTTCTTA     58620
     GCTTTACCAT TGATATCTAG CTCAGCGCCA CCGATAACCA ATGGGCCGTT ATCTTGCAGG     58680
     AACTGCCAAC GCGATTCAGT AGGTAGCCAG AACACGTTTT TCTCTGTGTA GAAGTCACGC     58740
     TGTTCTAGTT CAATAGCAAT CTCTTCAGCT AGCTCTTCTT CAGAATAATC AGCAGGATCT     58800
     AGGTAGTATT CGTGCTCAGG GTTAGCAATG TCGGCTTTGA TTTCATCCTG ACGCAGCTTA     58860
     AACGCATCAG AGACGTATTT AACGAAGATT AGACCTAACA CTGCATGTTT GTACTGCGCC     58920
     GCGTCTAGCG TTGAGCGTAG CTTGTCTGCG GCATTCCAAA GCTTGCCTTC AAGCTCTTTC     58980
     AAAAACTGTT GTTCTGTTTG ATTCATTAGG AGTTTTCTTG TTATAGAAAT ATTCCGTCAA     59040
     TCATACCACT GGATGCCGCA TTGTCTTTGA TTTCTGCCTT ACTTAAAGAG CATTTTTATG     59100
     AAGTAAGGAG CACATTATGG AAGCTTGGAA TAAAGGAAAA CGTGTAGGTC AGAAGAAAGC     59160
     CTTCAAGCTA GAAGACATTT GGCGCATCCG TATTCGACTT GAATTGGAAG AACGCTTGTT     59220
     TGAGTTGGCA CTGTTCAATC TAGCCATCGA CTGTAAGTTG AGATCCTGTG ATTTACGTAA     59280
     CTTGAAAGTC CAAGATGTCA GTCGCAGTGG TTGTGTTATG TCGAGAACCA TAGTGAAACA     59340
     ACAGAAGACC CAGCAAGAAG TGCACTTCGA GATCACACCC AAGACTCAGC AAACTTTGTC     59400
     ACAATGGATC ATTCAAAATT CATTGGCACC AACAGACTAT CTATTTCCAA GTCCACGCCG     59460
     TGAAGGGCAA CCCATCTCGT ACCATTACTA CACCACAATG GTTAACCGCT GGGTGACTGA     59520
     TATTGGACTA GATAAAACCC AATACGGCAC GCATTCACTG CGCCGAACAA AGGCTTCTTT     59580
     GATCTACGCC AAAACCAAGA ACTTACGTGC TATCCAGTTG CTTCTTGGTC ATGCTAAGTT     59640
     AGAAAGCACG ATTGAATATC TTGGTGTCGA GATTGAGGAT GCGCTGAGAA TTTCAGAGAG     59700
     TTGCGAGACG TGATTAAGTC TCACTCAAAT CTACTAGCCG CAATATCACC CCATGAAACT     59760
     CTACCTCTTT CGGATATGCT CTACTTGGAT ACCTCATCCT GAAAACGTTG CCAAAGAGGT     59820
     TTCAATTGTT TTCTTATGCT CTTTGAATTC ATAATTTTGG CAGCGCGATA TCCGTACGAT     59880
     AGAAAGTTTC TTTGACCACG CGCTGTATAC AGTTTATGGA GCTTTCTTTT ATTTAAAAAA     59940
     GTATTAAATG AAGCATCGTA TAAACATTAT GATTGGTAAG TTTTGGAACC ACAGAAAGTG     60000
     AAAAGCCCCA ATCAAAAGAT TGGGGCTTTT CTCCGATAAA CGGTTGCTTA TGTAGTGGCT     60060
     TGAATCAGTG GTCATCTACA AGCTGATACA TGTATACTAT GCAACATCAG AGCCACTGTC     60120
     AACTAAATCC AAAAGTTCGA GAATGCCAAA TAGAATTACA TACAGCGCCC TTACCAATGT     60180
     GTTGCCATAT CAAAGATTGG CGATGTATGA AAAAGTTTTT GCAACCACAT CACCAGTAGA     60240
     GTTACATGGT GCATATATCT GGTCAGTAAA AGCCGCGGCC AGTTTACAAC CACTGCTTAG     60300
     CACTTTAGAA GTAGCCTTAA GAAACTCAAT CCATAACAGC GCAACAACGC TGATTGCACC     60360
     GGACTGGTAT GACAAACTCA ATACCAAACA AAGAAAGAGT TGGAAGGTTG CTCAACGCGA     60420
     TAAGAACAAC ATTACTTGGC ACAAGTCAGA AGTTGCCAGA GTCAAGAAAA AACTAGCATC     60480
     AAAAATGCCA CCTAAAGGAC TAACTAGGCA TGACTTGCTT GTTGCTAAGA TGGATTTTGG     60540
     ATTCTGGGAT AATCTTCTCA GAGAGTGTTT CTCAATTAAT GGAGATAAAC ACGCCCTATG     60600
     GCCTCAATGC ATCCCTACAA TATTTCCAAA CCTGCCTAAA GGGCATACTA ATGCATCCAT     60660
     TCAGCGTGAA ATATCCTCAC TGAGGGAGCT ACGTAATGAT ATCGCACATA ACTCTCCGAT     60720
     CTGGAAGCAT AAGACCGTTA TAGATCAACA AACTGCCATT CAATACATTA ACCATCAACT     60780
     TGATAAAATA GTTGAGATCA TTAGCTGGCT ATCCTCTGAA AAAGTAGACT GGCTAGAAGT     60840
     GCACATGCTT CAATCTGAAG CTAGGCGCGT CGCATCTATA AAGTATTTGC ACCTGTGCCA     60900
     ACGTAAAAAT ACAAACGAAT TTACGGAACC ACTTTCGAGC TACAAGCGGA GTTTACGCGG     60960
     TAAGTTAAAA CAACTTGATA AAGATGAATT CGATGTCATC GAGACATTTA ACAACCAACT     61020
     CTATTTGGTG GCAAAACTCA CGGTACAATA GATTACAAGA GCATTAAATT CGAGCAATTC     61080
     AGATACTATA ACTTCAATCT GGCAGAAAAA ATTTCAACTT TAACCCTAAG GCGCTTTTGT     61140
     CCCAAAGCGC CTTACCTCTC CGCAATATAA ATGCACCTCT ATCGCATAAC CACCAATATC     61200
     ACCACATTAG TTTTATTTGG GTGAATTTTG AACGATTTGA TGGGGCGATT TGTTCGATAA     61260
     AGCTAATAAT GGGGCAAAAG CAAGTTAGCC CGAGGCCAGC GCAAATGACG AAATTTGGCG     61320
     CGTGAACCAG ACAAGGCAAG CTTGGGTGAT CAAGGTCTGC ATCATTACAA TCTAAAGCAA     61380
     AGCCCGTAGG CCGCTAGTGT CTAATTCGCG CTATTGCGTT TGTCTGGCGC GGGTGATTAC     61440
     TTTAGCTGCG AGGGGTTAAT TTTTTTGGAC GATAAGGAAA TCGCTTAATT CAAAACCTTC     61500
     ATCGATCTCT TTTTTTAACT CTGTCGGCAT ACGGCCTTGG CCTGTCCAAG TCAGCATTTC     61560
     CCCATCAACT TCAATCTGAT ATTTTGCAGG GCGAGGTTCA CGCTTTTTCT TCGGCATTGT     61620
     AACGTGATTT AGGTCTTCTG CACTTAATCC GAGTTCGAGC ATCTTGCGCT TAATCTCATT     61680
     GAGCTGTGCG TTACGTTCAG CGTTAAGATT AACGGCCTCT GCTTCTTCTT TTTCTCTCGT     61740
     GTCGATTAAT GCGAGTAGCT TCTCTTGAAA TGAGTGCAGT TCAGTTAATG CTAATGTTGA     61800
     TACGGCGGCT TTGAATTTAC GGGCGTGAGT TAACGTGCTG ATAAAGTCCG TCATTGAAAA     61860
     GTATCCTTAA TGAGAAGTGT CGGGGAGTAT AAAAAATTAG GCTTAAAGAT CAAGTTTAAA     61920
     TAGCGCGTTA CCTCCGGTCG GGCTTTTCGC TGTGCTCTCG CGATAACGTG ATCCACTCAT     61980
     GGCAAGCAAG CAGTGGCGCT ACGTTCCTGC TTGATAATCT TTGACGGCAA AGCAACTATC     62040
     GTCTGCTGGT AAAAAACACC TGCAGAAGAT AATCCAAGAT AACCACAAAC CATCAAACGT     62100
     AAAAGGCCAA AGCACTGTCC GGTTGCTTGC CGGCTAAAGT GTGCGTAAGC GTGCGCTTCT     62160
     CTATCGCTTG TCATCGTTTC CCTGTCAATA CCGTTCACGT CTGCGCTGTC ACTTCTAATC     62220
     TGTCTCATGT CACAACCTGC CCGCCAAGGG AGGCTTCGCC GCTGCGCGCC CTTGTCTGTC     62280
     AGAACGTGAA ATGAGTCAGG AAGTTAGGCG AAGACGAGAA CGATATTTAA CTGACAGGGA     62340
     AACTAGCAAT GACAAACTCA ATTCAAACGC AAGCAACGCA CACTAAAGCC GCCATTTCAC     62400
     CGACCAGCCA CAAGACTAAA GCAGGCTCAA ACAAGCCCGA TATTCTCCAG AAATCCGTAA     62460
     AGGCGAGCAA TGCTGTGGTG ACGTTGGCCG CTACAGCCAA GCCAGTGTTA ATGCAGTTAC     62520
     CGATTAATCA ATTGGTGCTG TCTGATTTGA ACGTGCGTAA AGGGGATGCG TCTAAAGCTG     62580
     ACGATGAACA GTTGTATGCC TCTATTTTGG CGCATGGCAT TTTACAAAAT TTGTTAGTCG     62640
     AGCCTAAGAA TGCACAGGGT TTATACCCTG TGTTGGGCGG TGGCCGCAGG CTGAAACAAC     62700
     TGATTAAAGC GGTTAAGAAT AATAAGTTGA AACCTACCTC GCTGGTGTCG GTCAAGTTAC     62760
     TGACTGTGGA TGAAGTGGCG AATTTTGCGA CCGAGCTATC TCTGACTGAA AACTTCATGC     62820
     GCGCCAATAT GCACCCAGTC GATGAATTTC ACGCATTTGC TGAGATGGTG AATAAGGGCG     62880
     CGAGCATTGC TGATGTGGCG GCGCGGTTTG GTGTCAAAGC GAAGTTCGTA CAGCAGCGGA     62940
     TGAAGTTAAG CATGGTCGCG CCGGTCGTGC TCGATGCGTA TAAAGCGGGG AACGTGTCAC     63000
     TTGATATCGT AATGGTGTTT ACGATTGCCA GTGTCGAAAA GCAAGCCGAA GTGTGGGAGC     63060
     TGGCAGGTGA TAGACGTTAC AACGAAAACC AGTTCCGCAA TATGCTTAAA GATGCCGCTG     63120
     TGGATGCAGA GCATTATCTG GCTCAGTTCG TAGGCCAAGA GGAATACGAA AAGGCGGGTG     63180
     GGGTTGTGAC CTCAGACTTG TTCAGTGATG AAGTCTACCT TGATGATAGA GCCTTGCTTG     63240
     AGACGTTAGC GACCGCAAAA TTGGAAATCG AAGCAGCAAA GTTAATCGCG CGTGGCTGGA     63300
     AGTGGACACA GATAAAGTTA GTTTCTGAGT ATGATGAACT TGCAGGGTTT GGACGTCTTA     63360
     CCTTAAAAGA GGGTGAGTAT GAACCCGCTG AAATGGCGCT AGCGGGGTGT TTGCTAGTGT     63420
     TAAAAAGTTA TGGTGAGCCT GTCAGTATCT ATATGGGTTT GGTGCATAAA GACGACAAAA     63480
     AGGCACTGGC ACAATTAAAA GCCAGTGTGC AATCTGGCTC ATTGAATGAT GGTGATGTGA     63540
     AAAAAATTGA AGAGAAGGAC GCAAGCGGCT ATTCGGCGGC ACTCAATGAG GACTTACGGG     63600
     CGCAGCGTTT GATTATCACG AAACATGCGT TAATGAGTGC GCCAACGGTG GCGCTTGATA     63660
     CGTTGCATTT CTCTGTCTGT GTAAGCGCGT TCACAGACTC ACGTTATGGC AGCCGTCCAC     63720
     TGCATATCAG CGTTAACGAC ACCACTTGCC ATCCTAAAAC GGGAGCGCTC ACGGATAACA     63780
     AAGCGTTGCA GTTAATTGAA GAGGTGAAGA CCAGCCTAAA TTTAACGTGG GTTGAACTGC     63840
     CAACGGTCGC TGAACGCTTT AACGCTTTTT GCGCCCTCGA TGTAAAAGAG AAAGAAAAGC     63900
     AGGTGGCTTA CGCCACGGCT TCCATGCTTG AGGCATCCAT TGATAATAGC CATGCCGCCG     63960
     CTGAGGCCGT TATTTCGACC CTCGATGTGA AATGGTCTAA CTACTGGCGA CCTACGGCAG     64020
     AAACCTTCTT TAAGCGCGTG AGCTTGTCTT GTTTAATTGA TATGGCTCAG CCTGTCATGG     64080
     GTGAGCAGTG GGCATTACAA GCCGCCGCAC TCAAGAAAAA GGATTTGGCC ATGCAGGTTG     64140
     ATAGCTTAGT CAACGGTGAG CGTAAAGGGC TGGACGATGC TCAAAAATCT TACTTTGATG     64200
     CGCTGATGCC AGCAGGTTTT TAACCCTCAT ACCGATGCTG ATTTACCCTG AGCTATCAGG     64260
     GTAAATCAAC GTCTAAGCAG AATAAAAAAC AAACTAAGTG CAACTGTATT TAGTTGCTAT     64320
     CATGGGGCGG TTTGATATAA TGTACCTATC TTGTCGGGGG GATTATGACT AAAACGGATA     64380
     AATACCTAAT AAAACTCAAA TCGGCCAAAA CGCTGACTTG GAATGAATTA ACGGGTGCCT     64440
     TAAAAGCATT AGGTTATAAG CAAGTTGAGG GTGATGGTTC GCGAGTCAAG TTTGATAACG     64500
     GTGTTCCGAA AGAGTTAATT AATATGCACA AACCTCACCC TAGCAATGAA CTAAAGGCTT     64560
     ACGCATTGCG TCAAGTCAGA GACAAATTAA CCGAATGGGG AAAGCTATGA TGCACAATAC     64620
     AATGACATTT AAAGGGTATC ACGGCTCAGT TGAAATCAGC CCTGATGATG ATATTTTGTT     64680
     TGGGCAGGTG TTATTCATTT CACCATTAAT CAACTATGAG GCCGAAACCG CTAAAGGCTT     64740
     AGAGAAAGCC TTTCAGGATG CCGTTAATGA TTATCTTACT GACTGTGCGC AACAAGACGT     64800
     GACGCCTGAA AAGCCTTGCA AGGGTTCGCT TAACATTCGA TTAGGCCATG ATTTGCATTT     64860
     AGCGGCTTCT GTTGCAGCAT TTCAGGCATC AATGAGCACA AACGATTTTA TCAAGCGTGC     64920
     CGTTCAAAAA AGTGTCGGTT CATAAGCAAT GAGGGGCGCT ATCATGCCAA TCAATAATAT     64980
     CGTTAGTTGT ACCCGTGAAC TTAATCGCGC TGATTTTTCC TTTATGAATC TGTTTGGTGG     65040
     CCATCACTAT CCGGTGACGA TGAGCTTTCT GCCCTCTGGC GCGGTGACTG TGGTTGTCGC     65100
     GGGGGCGCGG TATCGATGCC AAGCAAACCA AGTGCAGCGC GTGCTTGATG AGTCTGGGCT     65160
     TGAGTTTGAG GGCTTTGCTT GTTTTAAATA TTTGATTGAG GCGGGTGAGA TCAATTTTCA     65220
     TATTCCCGAA GATGTTCACG AGCAGCTTAA AGTGCATCCA GAGTTTAAAA AATACAGCAT     65280
     CATCAAATCC GTAGATGAAG ACATGTGAGT GCGGTGATAA TGACCGCAAA CCTAGTCCTC     65340
     AATATTCCCG CAAACGGCGA AACAAGCGGC GGCTACGCCG CCCTTTAGCG TTTATCTGAT     65400
     AATACCCCTT AGCTAGCTTG GAAAAGTGGC GTGGTGGTTA ATCATTTT                  65448
//

If you have problems or comments...

PBIL Back to PBIL home page