(data stored in SCRATCH zone)

HOGENOMDNA: SHEB5_1

ID   SHEB5_1; SV 1; empty ; DNA; empty ; PRO; 116763 BP.
XX
AC   NC_009035;
XX
PR   Project: 58259;
XX
DE   Shewanella baltica OS155 plasmid pSbal01, complete sequence.
XX
OS   Shewanella baltica OS155
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-116763
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Sims,D.R.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Brettar,I.,
RA   Klappenbach,J., Konstantinidis,K., Rodrigues,J., Tiedje,J. and
RA   Richardson,P.;
RT   "Complete sequence of plasmid pSbal01 of Shewanella baltica OS155";
RL   Unpublished
XX
RN   [2]
RP   1-116763
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-FEB-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-116763
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Sims,D.R.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Brettar,I.,
RA   Klappenbach,J., Konstantinidis,K., Rodrigues,J., Tiedje,J. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (12-FEB-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000564.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634605
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..116763
FT                   /strain="OS155"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella baltica OS155"
FT                   /plasmid="pSbal01"
FT                   /db_xref="taxon:325240"
FT   gene            340..1278
FT                   /db_xref="GeneID:4841173"
FT                   /locus_tag="Sbal_4482"
FT   CDS_pept        340..1278
FT                   /locus_tag="Sbal_4482"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090119"
FT                   /db_xref="GeneID:4841173"
FT                   /translation="MMRFKPSLLTLALIAAGASMHSYAADEVTTDKEAKAKEAAIEVIE
FT                   VKGFRTSVIKSLNDKRFGDTVSESISADDLGALPDQSIADALTRLPGVTAVRTGGQASG
FT                   LNIRGLDGDFVFATLNGHEQVTTGGKRAIEFDQYPSELISQAAVYKTPKASLIEGGVAG
FT                   TVELKTADPLKSDKDQSFNINARGSFNDRADEISDAEQYGNRLSLAYQGKFLEDTLGVA
FT                   LGYAHLYQPYVASQFIGLRFNDDKKDVNGDGVAESISEGFELQQKGGDDTRDGYMAAIH
FT                   WQPTDSLSVKGDLFHQNSLPKTLPVAFALSH"
FT                   /protein_id="YP_001041600.1"
FT   misc_feature    541..>1236
FT                   /note="Porin superfamily.  These outer membrane channels
FT                   share a beta-barrel structure that differ in strand and
FT                   shear number.  Classical (gram-negative ) porins are
FT                   non-specific channels for small hydrophillic molecules and
FT                   form 16 beta-stranded barrels (16...; Region: OM_channels;
FT                   cl00284"
FT                   /db_xref="CDD:174088"
FT                   /locus_tag="Sbal_4482"
FT   gene            complement(1626..2921)
FT                   /db_xref="GeneID:4841233"
FT                   /locus_tag="Sbal_4483"
FT   CDS_pept        complement(1626..2921)
FT                   /locus_tag="Sbal_4483"
FT                   /gene_family="HOG000277796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090120"
FT                   /db_xref="GeneID:4841233"
FT                   /translation="MQLPPVIPLFDSFEFIQVGNSVVNQYITQISMKKVADAGLVIEHA
FT                   SDWLFEQKHNENNYKAYRSELTTFLHWCFDVVSMSPIEVTRKDMSHYVDYCQAPPIALI
FT                   GYFNVPQFKFDKMHEERVPNPQWRPFVGKKRLGQIQPYALSDNALKTKMAILSSFYSYL
FT                   TSEEYCERNPAQIWLNHSRFAANRQYQRQSHEDENSLAFTELQWSYIMATVAGLAEAAP
FT                   ELHQRSLFLISLIYCCYLRISDVSARAGYSPVMDQFKHNQQTGIWSFHIPLSKGGKRRS
FT                   VAISKALLDALVKYRQFLGLADYPAPNENHPLFVRHKAAGRGRDAGILNANLGIRHVRD
FT                   EIQSIINLAAESIEADGFAQDGAQMRKLTAHNIRHTGITHDININRRPLSHVQADAGHE
FT                   SIDTTSQYLHTSQIERHESAFNKPIDHLKGIE"
FT                   /protein_id="YP_001041601.1"
FT   misc_feature    complement(1695..2321)
FT                   /note="INT_SG1, DNA breaking-rejoining enzymes,
FT                   integrase/recombinases subgroup 1, C-terminal catalytic
FT                   domain. The CD contains mainly predicted
FT                   integrase/recombinase and site-specific XerD recombinases.
FT                   The members of this CD are found predominantly in...;
FT                   Region: INT_SG1_C; cd01183"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Sbal_4483"
FT   misc_feature    complement(1680..2273)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Sbal_4483"
FT   misc_feature    complement(order(1701..1703,1728..1730,1800..1802,
FT                   1809..1811,2097..2099,2199..2201))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29504"
FT                   /locus_tag="Sbal_4483"
FT   gene            complement(2983..3201)
FT                   /db_xref="GeneID:4841208"
FT                   /locus_tag="Sbal_4484"
FT   CDS_pept        complement(2983..3201)
FT                   /locus_tag="Sbal_4484"
FT                   /gene_family="HOG000245171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090121"
FT                   /db_xref="GeneID:4841208"
FT                   /translation="MSQRINLSISPHKLAQLIQDGHLCAADFRCLDSQSKQQVWQLCLI
FT                   CYQKRITCQQCTFSTCTKNLTYLDADK"
FT                   /protein_id="YP_001041602.1"
FT   gene            3381..4952
FT                   /db_xref="GeneID:4841177"
FT                   /locus_tag="Sbal_4485"
FT   CDS_pept        3381..4952
FT                   /locus_tag="Sbal_4485"
FT                   /gene_family="HOG000266481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090122"
FT                   /db_xref="GeneID:4841177"
FT                   /translation="MLIDLAKKNPLFSGKKHTETTESGIPWKVLVVDDEPDVHTVTKLA
FT                   LSRFKLDGRALTFINAYSAEQAKELLNQERDIAIAFIDVVMESDHAGLELVKWIREELQ
FT                   NKTTRLILRTGQPGQAPEEDVIVNYDINDYKAKAELDSRKLMTSVYSALRSYRDIMEIE
FT                   QARRTQINHRKGLERVLEATSGLFELRTLHKFADGLLTQVATLLNLDSETLLLTCNAID
FT                   AISGHLDPVNIEILAGTGQFSNKNHITQLPEHIDRLLRNALTQKRCLYEDNCFVGYFPT
FT                   KSGLINLLYMDGIDKIDDLDKKLIDIFAINVGVAFENLLLSQEVEDTQSELILRLGDVV
FT                   ESRSKEAANHVKRMAEYCSQLALLAGLPEYEADLLRRASPMHDIGKIAIPDAVLLKPGK
FT                   LDDEEWQVMRQHPTIGHQILANSERPILKAASVIALQHHEKYDGSGYPANLKQDEIHIF
FT                   ARIVAIADVFDALSHARCYKTAWPLEEVLAEMRKGAAKHFDPHLLQLFIDNVDIFVKVK
FT                   DNWKDN"
FT                   /protein_id="YP_001041603.1"
FT   misc_feature    3462..3851
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="Sbal_4485"
FT   misc_feature    3825..4364
FT                   /note="Domain of unknown function (DUF3369); Region:
FT                   DUF3369; pfam11849"
FT                   /db_xref="CDD:152285"
FT                   /locus_tag="Sbal_4485"
FT   misc_feature    4422..4850
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cd00077"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Sbal_4485"
FT   misc_feature    order(4428..4430,4524..4529,4776..4778)
FT                   /note="Zn2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Sbal_4485"
FT   misc_feature    4527..4529
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28958"
FT                   /locus_tag="Sbal_4485"
FT   gene            complement(5019..5504)
FT                   /db_xref="GeneID:4841180"
FT                   /locus_tag="Sbal_4486"
FT   CDS_pept        complement(5019..5504)
FT                   /locus_tag="Sbal_4486"
FT                   /gene_family="HOG000292154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090123"
FT                   /db_xref="GeneID:4841180"
FT                   /translation="MLTYCVVRLIFVLNRPNLYLFIALILFNLTACTEDAKQVTLKSSL
FT                   DPSLCQFSAGDCVKQVGDIKLTVSLSPANAPSEKPLTLTLLASSPITDVQIRLEGRDMF
FT                   MGVIPVNVKQTDEMTYIGQMVYGSCSSGYMVWRGFVSFNVNGETKTAVFDFLADDNG"
FT                   /protein_id="YP_001041604.1"
FT   gene            5730..7166
FT                   /db_xref="GeneID:4841214"
FT                   /locus_tag="Sbal_4487"
FT   CDS_pept        5730..7166
FT                   /locus_tag="Sbal_4487"
FT                   /gene_family="HOG000277908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cbb3-type cytochrome c oxidase subunit I"
FT                   /transl_table="11"
FT                   /note="CcoN; FixN"
FT                   /db_xref="GI:126090124"
FT                   /db_xref="GeneID:4841214"
FT                   /translation="MMNHSQPTGADYNYAIVRQFALTTVLWGIVGMSVGVLIAAQLIWP
FT                   QLNFDTPWLTYSRLRPLHTNAVIFAFGTSALFATSYYVVQRTCQTRLFAPKLAAFTFWG
FT                   WQAIILSAAITLPMGFTQGKEYAELEWPIDIAITIVWVSYAIVFFGTIIKRTTSHIYVA
FT                   NWFFGAFIITVAVLHIVNSMAVPVSLFKSYSLYSGAVDAMVQWWYGHNAVGFLLTAGFL
FT                   GMMYYFVPKQAGRPVYSYRLSIVHFWALIALYIWAGPHHLHYTALPDWTQSLGMVMSLI
FT                   LFAPSWGGMINGIMTLSGAWHKLRTDPVLRFLVVSLSFYGMSTFEGPMMAIKTVNALSH
FT                   YTDWTIGHVHSGALGWVAMVSIGSLYHLIPVLFGHGRMYSIKLVNVHFWLATIGTVLYI
FT                   VSMWISGVMQGLMWRAVNADGTLTYSFVESLEASYPFYFVRFLGGCFFLTGMLIMAYNV
FT                   IRTVKASKDSLPALAEPTAA"
FT                   /protein_id="YP_001041605.1"
FT   misc_feature    5763..7115
FT                   /note="Cytochrome cbb3 oxidase subunit I.  Cytochrome cbb3
FT                   oxidase, the terminal oxidase in the respiratory chains of
FT                   proteobacteria, is a multi-chain transmembrane protein
FT                   located in the cell membrane. Like other cytochrome
FT                   oxidases, it catalyzes the...; Region: cbb3_Oxidase_I;
FT                   cd01661"
FT                   /db_xref="CDD:29932"
FT                   /locus_tag="Sbal_4487"
FT   misc_feature    order(5784..5786,6777..6779,6789..6791,6921..6923,
FT                   7032..7034)
FT                   /note="Low-spin heme binding site; other site"
FT                   /db_xref="CDD:29932"
FT                   /locus_tag="Sbal_4487"
FT   misc_feature    order(6318..6320,6333..6338,6735..6737,6747..6752,
FT                   6966..6968)
FT                   /note="Putative water exit pathway; other site"
FT                   /db_xref="CDD:29932"
FT                   /locus_tag="Sbal_4487"
FT   misc_feature    order(6357..6359,6507..6512,6771..6773)
FT                   /note="Binuclear center (active site); other site"
FT                   /db_xref="CDD:29932"
FT                   /locus_tag="Sbal_4487"
FT   misc_feature    order(6510..6512,6747..6752,6966..6971)
FT                   /note="Putative proton exit pathway; other site"
FT                   /db_xref="CDD:29932"
FT                   /locus_tag="Sbal_4487"
FT   gene            7180..7806
FT                   /db_xref="GeneID:4841193"
FT                   /locus_tag="Sbal_4488"
FT   CDS_pept        7180..7806
FT                   /locus_tag="Sbal_4488"
FT                   /gene_family="HOG000277919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cbb3-type cytochrome c oxidase subunit II"
FT                   /transl_table="11"
FT                   /note="CcoO; FixO"
FT                   /db_xref="GI:126090125"
FT                   /db_xref="GeneID:4841193"
FT                   /translation="MKFNHEIVEKNIGLLAIFTVIAISFGSLVEITPLIFQKDTTEPVE
FT                   GLKPYTALQIEGRDIYVREGCYNCHSQMIRPLRAETERYGHYSVAGESVWDHPFQWGSK
FT                   RTGPDLARVGGRYSDKWHEVHLIDPRAVVPQSNMPGFPWLAENKLDGELTGDKMTILRN
FT                   MHKGGYKGNDLYTDEEIAGAQKAVAGKTELEALIAYLQSLGHALK"
FT                   /protein_id="YP_001041606.1"
FT   misc_feature    7192..7803
FT                   /note="Cytochrome C oxidase, mono-heme subunit/FixO;
FT                   Region: FixO; cl01130"
FT                   /db_xref="CDD:174544"
FT                   /locus_tag="Sbal_4488"
FT   gene            7818..7994
FT                   /db_xref="GeneID:4841195"
FT                   /locus_tag="Sbal_4489"
FT   CDS_pept        7818..7994
FT                   /locus_tag="Sbal_4489"
FT                   /gene_family="HOG000277930" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090126"
FT                   /db_xref="GeneID:4841195"
FT                   /translation="MDYGTLQGILTIIVMLTFVGIFAWAYSSRRQKSFDEAANLVFSDE
FT                   EVSKVSKDSGENK"
FT                   /protein_id="YP_001041607.1"
FT   misc_feature    7818..7952
FT                   /note="Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3
FT                   oxidase, the terminal oxidase in the respiratory chains of
FT                   proteobacteria, is a multi-chain transmembrane protein
FT                   located in the cell membrane. Like other cytochrome
FT                   oxidases, it catalyzes the reduction of...; Region:
FT                   cbb3_Oxidase_CcoQ; cl00282"
FT                   /db_xref="CDD:153652"
FT                   /locus_tag="Sbal_4489"
FT   gene            7994..8962
FT                   /db_xref="GeneID:4841181"
FT                   /locus_tag="Sbal_4490"
FT   CDS_pept        7994..8962
FT                   /locus_tag="Sbal_4490"
FT                   /gene_family="HOG000277942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090127"
FT                   /db_xref="GeneID:4841181"
FT                   /translation="MSSFWSVWITVLSLVVIAGCFLLLRVCSKNTTGVKEGESMGHSFD
FT                   GIEELNNPLPKWWSYMFYITIVFGLIYLALFPGLGNYKGLLGWTSSNQSIGTEQGIKAD
FT                   SAAAIELAAKEGRYVQYDQEVKHAKEKYGPIFAAYLATPLEELVKNQEALKVGGRLFLQ
FT                   NCAQCHGSDARGSKGFPNLTDGDWLYGGDLATIKTTIMGGRHGMMPPKGGLPIDDSEIA
FT                   GLAEYVVKLSGREHDETLAAQGQGSFMKGCFACHGMDAKGNKFMGAPNLTDDVWLYGGS
FT                   RGVIEETIKHGRAGVMPAWKDVLGEEKVHVIAAYVYSLSNK"
FT                   /protein_id="YP_001041608.1"
FT   misc_feature    8078..8959
FT                   /note="cytochrome c oxidase, cbb3-type, subunit III;
FT                   Region: ccoP; TIGR00782"
FT                   /db_xref="CDD:129864"
FT                   /locus_tag="Sbal_4490"
FT   misc_feature    8462..8686
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="Sbal_4490"
FT   misc_feature    8717..8950
FT                   /note="Cytochrome c; Region: Cytochrom_C; cl11414"
FT                   /db_xref="CDD:175244"
FT                   /locus_tag="Sbal_4490"
FT   gene            9073..9552
FT                   /db_xref="GeneID:4841192"
FT                   /locus_tag="Sbal_4491"
FT   CDS_pept        9073..9552
FT                   /locus_tag="Sbal_4491"
FT                   /gene_family="HOG000277953" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090128"
FT                   /db_xref="GeneID:4841192"
FT                   /translation="MNEQQAWYKQFWPWFLIILPLCAVIASFTTLKIALTNSDSLVAED
FT                   YYKEGKAINMDLSKVKYAKHIGMNFSLEQANNEILLTQQGGPASQAALKVEFYHPTIAD
FT                   RDIKLTATADASNVYRITVPATLTGPWEVRLESYDGKWRIHQRVELKDHVQLWLN"
FT                   /protein_id="YP_001041609.1"
FT   misc_feature    9097..9516
FT                   /note="FixH; Region: FixH; cl01254"
FT                   /db_xref="CDD:154296"
FT                   /locus_tag="Sbal_4491"
FT   gene            9575..11974
FT                   /db_xref="GeneID:4841235"
FT                   /locus_tag="Sbal_4492"
FT   CDS_pept        9575..11974
FT                   /locus_tag="Sbal_4492"
FT                   /gene_family="HOG000250398" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090129"
FT                   /db_xref="GeneID:4841235"
FT                   /translation="MTHPSCFHCQEPVLTGQQFVTRINDRDELMCCPGCQAVSQTIVDA
FT                   GLLSYYKFRTEPGSKQNALVPEALTQFSAYDLPEVQQDFVHSEDNVESVSLSIDGITCA
FT                   ACAWLIEHKVKQLTGVSQVLVNSTTQRAMISWDKRTVKLSDILGQISRIGYQAAPYQVD
FT                   EQELNNKLNSRKFLLRLGLAGFATMQVMMFALALYTGYFTDLDVQYRDYFRWVSMIFAT
FT                   PVVLYSAQPFYFSAIRTLLSGKLNMDVSVSIAIGGAYVASCFATVNGTGEVYFESVSMF
FT                   TFFLLLGRYFEQKARQKASVSSSNLHKLVPLTAHLVNDNGQEEIPAKKLRLNDVILVKP
FT                   GEMIAADGVVIEGHTSINEAMLTGEQMPIEKTVASQVYAGTINVDQPIKVSVTALGQDQ
FT                   LVAEIIRLQELASNTKPAIALLADKLSRYFSGTILTIATITYLVWHQISPEDAFWVTLS
FT                   VLVATCPCALALATPTAVTCATAIFTRLGIITRKAGVFEKLPQIKHVVFDKTGTLTCGT
FT                   LSIGQTQCMADLTKTQALAIAAALETGSRHPIAAAFAVFADNALVTEEVHHEVGFGVRG
FT                   RIDGTDYLIGNAVFTGASIDTRDPTQKIWLARSCNEQLEVLASFEIQDNIRQDSKATVE
FT                   MLKQQGCRISIASGDSSGHVHQLAKELGIDDVHSGLTPADKLALVTRLQQHTRVAMFGD
FT                   GINDAPVLAGADLSVAMGSGSAIAKNSADLILLGDHLSRFTQAVSVAKLTTQIIRQNLA
FT                   WALGYNALILPLAVTGHVAPYIAAIGMSASSLIVVGNSLRLLRVKV"
FT                   /protein_id="YP_001041610.1"
FT   misc_feature    9587..9844
FT                   /note="Putative metal-binding domain of cation transport
FT                   ATPase; Region: ATPase-cat_bd; pfam12156"
FT                   /db_xref="CDD:152591"
FT                   /locus_tag="Sbal_4492"
FT   misc_feature    9845..11962
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="Sbal_4492"
FT   misc_feature    9857..10048
FT                   /note="Heavy-metal-associated domain (HMA) is a conserved
FT                   domain of approximately 30 amino acid residues found in a
FT                   number of proteins that transport or detoxify heavy metals,
FT                   for example, the CPx-type heavy metal ATPases and copper
FT                   chaperones. HMA domain...; Region: HMA; cd00371"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Sbal_4492"
FT   misc_feature    order(9875..9883,9890..9892)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29471"
FT                   /locus_tag="Sbal_4492"
FT   misc_feature    10412..11068
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Sbal_4492"
FT   misc_feature    11408..11752
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Sbal_4492"
FT   gene            12013..12228
FT                   /db_xref="GeneID:4841221"
FT                   /locus_tag="Sbal_4493"
FT   CDS_pept        12013..12228
FT                   /locus_tag="Sbal_4493"
FT                   /gene_family="HOG000277965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090130"
FT                   /db_xref="GeneID:4841221"
FT                   /translation="MEIIYVLIPIAMIFVAIAVMVFFWAVKSEQFDDLDRQSVSILFDE
FT                   DTVKPNSHTVPEKEQAEAAQEKGMPL"
FT                   /protein_id="YP_001041611.1"
FT   misc_feature    12016..12150
FT                   /note="Cytochrome oxidase maturation protein cbb3-type;
FT                   Region: CcoS; cl01253"
FT                   /db_xref="CDD:154295"
FT                   /locus_tag="Sbal_4493"
FT   gene            12240..12932
FT                   /db_xref="GeneID:4841223"
FT                   /locus_tag="Sbal_4494"
FT   CDS_pept        12240..12932
FT                   /locus_tag="Sbal_4494"
FT                   /gene_family="HOG000277976" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090131"
FT                   /db_xref="GeneID:4841223"
FT                   /translation="MIEYNVTGAFLVGLMGAAHCFGMCGGLVGAFSAQIPNGKTGNLLA
FT                   HQLKYLLSYNLGRILSYTLAGALVGASAAGLGHLFELDTYLIVLRIFAGLMMIATGLYI
FT                   AKIWVGIVQIERVGQWLWQYLKPIAQRLVPIQNPSQAVMAGFIWGWLPCGLVYSTLTWS
FT                   VASGSASQGALIMLAFGLGTLPALLSAGVAAKRLAAWVQKRTVRLLSGLLLIAFGGQTL
FT                   YIALAQLN"
FT                   /protein_id="YP_001041612.1"
FT   misc_feature    12261..12929
FT                   /note="Cytochrome C biogenesis protein transmembrane
FT                   region; Region: DsbD; cl00515"
FT                   /db_xref="CDD:153822"
FT                   /locus_tag="Sbal_4494"
FT   gene            12988..13740
FT                   /db_xref="GeneID:4841222"
FT                   /locus_tag="Sbal_4495"
FT   CDS_pept        12988..13740
FT                   /locus_tag="Sbal_4495"
FT                   /gene_family="HOG000186461" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fumarate/nitrate reduction transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="Global transcription factor that controls the
FT                   expression of over 100 target genes in response to anoxia"
FT                   /db_xref="GI:126090132"
FT                   /db_xref="GeneID:4841222"
FT                   /translation="MTIEQNKNRRPAASGCTIHCHDCSMGTLCIPFTLNASELDQLDDI
FT                   IERKKPIQKGEQIFKSGDALKSLFAIRSGTIKSYTITEQGDEQITGFHLAGDVIGFDGI
FT                   HAQLHQSFAQALETSMVCEIPFNILDELSGTMPKLRQQIMRLMSNEIMSDQEMILLLSK
FT                   KNAEERLAAFISNLANRFGSRGFSPKEFRLTMTRGDIGNYLGLTVETISRLLGRFQKSG
FT                   LIEVKGKYITILDSQELNLLAGNSRIAR"
FT                   /protein_id="YP_001041613.1"
FT   misc_feature    13018..13722
FT                   /note="fumarate/nitrate reduction transcriptional
FT                   regulator; Provisional; Region: PRK11161"
FT                   /db_xref="CDD:170990"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    13087..13419
FT                   /note="effector domain of the CAP family of transcription
FT                   factors; members include CAP (or cAMP receptor protein
FT                   (CRP)), which binds cAMP, FNR (fumarate and nitrate
FT                   reduction), which uses an iron-sulfur cluster to sense
FT                   oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
FT                   cd00038"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    order(13285..13290,13315..13323)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    order(13378..13386,13396..13404)
FT                   /note="flexible hinge region; other site"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    13483..13692
FT                   /note="helix_turn_helix, cAMP Regulatory protein
FT                   C-terminus; DNA binding domain of prokaryotic regulatory
FT                   proteins belonging to the catabolite activator protein
FT                   family; Region: HTH_CRP; cd00092"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    13492..13497
FT                   /note="putative switch regulator; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    order(13567..13569,13573..13581,13606..13608)
FT                   /note="non-specific DNA interactions; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    13606..13626
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    order(13609..13614,13624..13626)
FT                   /note="sequence specific DNA binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Sbal_4495"
FT   misc_feature    13609..13614
FT                   /note="putative cAMP binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Sbal_4495"
FT   gene            13999..14931
FT                   /db_xref="GeneID:4841236"
FT                   /locus_tag="Sbal_4496"
FT   CDS_pept        13999..14931
FT                   /locus_tag="Sbal_4496"
FT                   /gene_family="HOG000277987" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="universal stress protein UspE"
FT                   /transl_table="11"
FT                   /note="with UspC and UspD is involved in resistance to UV
FT                   irradiation"
FT                   /db_xref="GI:126090133"
FT                   /db_xref="GeneID:4841236"
FT                   /translation="MKDYQKILVVVDPTTENQVALARAVTLASKCNAQVTVFLSIFDFS
FT                   YEMTSILSNQEREAMRQGVIDQRLAWIQDLLAAYTHLQLNIDTQVIWHNRPFESIINHA
FT                   ISGQYDLIVKGTHAHDKLKAVIFTPTDWHLMRKAPVPVLMVKAHDWPAAGKILCAVNVA
FT                   TEDTDHQMLNGKIIEHAKDLADKFSAEVHLVNGYPGTPVNLAIELPDFDAQSYNETIRM
FT                   QHEQRVSYLAGAYDIDPNHCHVKEGLPEDVIPELAEKLDAELVILGTVGRTGFSAALIG
FT                   NTAEHVIDSINCDLLAIKPDGYKSPLEEA"
FT                   /protein_id="YP_001041614.1"
FT   misc_feature    14002..14913
FT                   /note="universal stress protein UspE; Provisional; Region:
FT                   PRK11175"
FT                   /db_xref="CDD:171001"
FT                   /locus_tag="Sbal_4496"
FT   misc_feature    14014..14433
FT                   /note="Usp: Universal stress protein family. The universal
FT                   stress protein Usp is a small cytoplasmic bacterial protein
FT                   whose expression is enhanced when the cell is exposed to
FT                   stress agents. Usp enhances the rate of cell survival
FT                   during prolonged exposure to...; Region: USP_Like; cd00293"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Sbal_4496"
FT   misc_feature    order(14026..14034,14116..14118,14338..14343,14347..14352,
FT                   14380..14391)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Sbal_4496"
FT   misc_feature    14461..14892
FT                   /note="Usp: Universal stress protein family. The universal
FT                   stress protein Usp is a small cytoplasmic bacterial protein
FT                   whose expression is enhanced when the cell is exposed to
FT                   stress agents. Usp enhances the rate of cell survival
FT                   during prolonged exposure to...; Region: USP_Like; cd00293"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Sbal_4496"
FT   misc_feature    order(14473..14478,14500..14502,14584..14586,14797..14802,
FT                   14806..14811,14839..14850)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30165"
FT                   /locus_tag="Sbal_4496"
FT   gene            15046..15978
FT                   /db_xref="GeneID:4841249"
FT                   /locus_tag="Sbal_4497"
FT   CDS_pept        15046..15978
FT                   /locus_tag="Sbal_4497"
FT                   /gene_family="HOG000013323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C32 tRNA thiolase"
FT                   /transl_table="11"
FT                   /note="TtcA; YdaO; catalyzes the thiolation of cytosine 32
FT                   in specific tRNAs"
FT                   /db_xref="GI:126090134"
FT                   /db_xref="GeneID:4841249"
FT                   /translation="MSEELSKKHTNRLNKLQKRLRREVGSAIADYNMIEDGDKIMCCLS
FT                   GGKDSYAMLDILMNLQQRAPIQFEIIAVNLDQKQPGFPEHVLPAYLEKLNVPYHILEKD
FT                   TYSIVKDKIPEGKTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFFG
FT                   GKMKAMPPKLLSDDGANVVIRPLAYCREKDLEEYANLKEFPIIPCNLCGSQENLKRAAV
FT                   KDMLNQWDRQYPGRIETIFTAMQNTAPSQGVDREQFDFVSLTRDPDAPMRGDVAEANLP
FT                   AFDFLDIANSGRIDLDAAKRIDIVNTYEV"
FT                   /protein_id="YP_001041615.1"
FT   misc_feature    15160..15687
FT                   /note="This is a subfamily of Adenine nucleotide alpha
FT                   hydrolases superfamily.Adeninosine nucleotide alpha
FT                   hydrolases superfamily  includes N type ATP PPases and ATP
FT                   sulphurylases. It forms a apha/beta/apha fold which  binds
FT                   to Adenosine group.  This...; Region: Alpha_ANH_like_II;
FT                   cd01993"
FT                   /db_xref="CDD:30180"
FT                   /locus_tag="Sbal_4497"
FT   misc_feature    order(15172..15180,15184..15195,15265..15267,15271..15273)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30180"
FT                   /locus_tag="Sbal_4497"
FT   gene            complement(16178..16801)
FT                   /db_xref="GeneID:4841200"
FT                   /locus_tag="Sbal_4498"
FT   CDS_pept        complement(16178..16801)
FT                   /locus_tag="Sbal_4498"
FT                   /gene_family="HOG000292165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090135"
FT                   /db_xref="GeneID:4841200"
FT                   /translation="MYKKLLFSGLCLLATSAAAETVSLEYKGFYDRLKQVNKGGYQLVE
FT                   VAFSVPMQKNCLIQSGSISSEKTSTPLTYTDAQRLFIPLDDDLKDQRALVNLNFAGSAE
FT                   GCAIAMQVRAKQTLAEYDKARLQQIVTEMDTLLGAMQGFPMRYFRESIAGLNFEFQPEQ
FT                   EVYVHLNGREQAVKGSYKLAANELENITTLSFSAQPLVLSPWVK"
FT                   /protein_id="YP_001041616.1"
FT   misc_feature    complement(16325..16753)
FT                   /note="Protein of unknown function (DUF2987); Region:
FT                   DUF2987; pfam11205"
FT                   /db_xref="CDD:151647"
FT                   /locus_tag="Sbal_4498"
FT   gene            complement(16794..17606)
FT                   /db_xref="GeneID:4841225"
FT                   /locus_tag="Sbal_4499"
FT   CDS_pept        complement(16794..17606)
FT                   /locus_tag="Sbal_4499"
FT                   /gene_family="HOG000292186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090136"
FT                   /db_xref="GeneID:4841225"
FT                   /translation="MKTGRIGSFTLALAMVIVAIFALRVWIIPNTNDSSAIATQLVDAV
FT                   DPVTQVPDFSAINDITEKKKAFFDFLRPIVQQQNAIISIEREFVSEMLALVENGKSLSE
FT                   TQLGQLNTLFDKYQYAARNVDAKSLASLLKRVDIVPESMVLIQAANESGWGSSRFAREG
FT                   FNFFGEWCFTAGCGIVPSSRGSGKSHEVKVFSSVDESVSSYMRNLNSNTAYALFRSIRA
FT                   DLRSQELEPTADQLIYGLVNYSERQEAYIDELLDMLRHNEKYLVNVDV"
FT                   /protein_id="YP_001041617.1"
FT   misc_feature    complement(16812..17462)
FT                   /note="Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase; Region: Glucosaminidase;
FT                   cl00743"
FT                   /db_xref="CDD:174371"
FT                   /locus_tag="Sbal_4499"
FT   gene            18160..19098
FT                   /db_xref="GeneID:4841234"
FT                   /locus_tag="Sbal_4500"
FT   CDS_pept        18160..19098
FT                   /locus_tag="Sbal_4500"
FT                   /gene_family="HOG000072686" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090137"
FT                   /db_xref="GeneID:4841234"
FT                   /translation="MQHLMLNQFERVVAIGGGHGLGRVLSSLDFLGSRLTGIVATTDNG
FT                   GSTGRLRAEQDCIAWGDLRNCLSHLANRPSVGSQLFEYRFQGETELSGHNLGNLILLAL
FT                   DQLCVRPLEAVNLIRNLLKIETQLIPMSEQPTHLVALQACGSKVFGEINVDSMDEAPIA
FT                   LCLEPQVDATFEACEAVRHADLVILGPGSFLTSIMPPLLLPKFAKSLAATKAQVIFIDN
FT                   LAEEASPAGRFSIEQRIAWCHQVIGKPIIHKVLRHGEQTLLGPLINYFPLKNRHNPNLH
FT                   DQANLLDALSALLRIKSELTLQSNQPLALSC"
FT                   /protein_id="YP_001041618.1"
FT   misc_feature    18193..19041
FT                   /note="Uncharacterized protein family UPF0052; Region:
FT                   UPF0052; pfam01933"
FT                   /db_xref="CDD:145222"
FT                   /locus_tag="Sbal_4500"
FT   misc_feature    18193..18936
FT                   /note="family of mostly uncharacterized proteins similar to
FT                   B.subtilis YvcK; Region: YvcK_like; cd07187"
FT                   /db_xref="CDD:132873"
FT                   /locus_tag="Sbal_4500"
FT   misc_feature    order(18208..18216,18730..18735,18745..18747,18832..18837)
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:132873"
FT                   /locus_tag="Sbal_4500"
FT   misc_feature    order(18286..18288,18298..18300,18340..18342,18349..18351,
FT                   18451..18453)
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:132873"
FT                   /locus_tag="Sbal_4500"
FT   misc_feature    order(18430..18432,18445..18447,18454..18459,18466..18471,
FT                   18475..18480,18508..18510,18517..18522)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132873"
FT                   /locus_tag="Sbal_4500"
FT   gene            complement(19217..20410)
FT                   /db_xref="GeneID:4841201"
FT                   /locus_tag="Sbal_4501"
FT   CDS_pept        complement(19217..20410)
FT                   /locus_tag="Sbal_4501"
FT                   /gene_family="HOG000185899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aromatic amino acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="catalyzes the formation of L-glutamate and an
FT                   aromatic oxo acid from an aromatic amino acid and
FT                   2-oxoglutarate"
FT                   /db_xref="GI:126090138"
FT                   /db_xref="GeneID:4841201"
FT                   /translation="MIFSQVLLAPADPILGLTDTFKADPRQDKVNLGVGIYKDEAGQTP
FT                   VLASVKKAEAILLEQEKTKNYLGIEGVQAYNHVVQTLLFGEGSELITSGRAATAQAPGG
FT                   TGALRIAAEFLLRNTDSHTIWVSNPTWANHQNIFETAGLTVKEYGYYKAEAHDIDFDTM
FT                   MTDLSHASAGDVVLLHGCSHNPTGIDLTLAQWELVAQLCADKKLVPLFDFAYQGFGAGI
FT                   EEDAAGLRLVASKVPELLVANSFSKNFGLYNERIGAVTVVAEDADAAVRAFSQVKRTIR
FT                   ANYSNPPAHGALIVSTILNDAALKAMWVQEVKEMRERIAEMRTLFVDSLKAEGVTQDFS
FT                   FISRQNGMFSFSGLNKAQVARLKDEFGVYIVGSGRISVAGMTKTNMPVISKAIARVL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041619.1"
FT   misc_feature    complement(19256..20323)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4501"
FT   misc_feature    complement(order(19646..19648,19670..19675,19679..19681,
FT                   19766..19768,19859..19861,20018..20020,20096..20104))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4501"
FT   misc_feature    complement(order(19529..19531,19538..19540,19646..19654,
FT                   19787..19789,19988..19990,20093..20095))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4501"
FT   misc_feature    complement(19670..19672)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4501"
FT   gene            complement(20827..20913)
FT                   /db_xref="GeneID:5075359"
FT                   /locus_tag="Sbal_t01"
FT   tRNA            complement(20827..20913)
FT                   /note="codon recognized: UUA"
FT                   /db_xref="GeneID:5075359"
FT                   /locus_tag="Sbal_t01"
FT                   /product="tRNA-Leu"
FT   gene            complement(20963..21036)
FT                   /db_xref="GeneID:5075354"
FT                   /locus_tag="Sbal_t02"
FT   tRNA            complement(20963..21036)
FT                   /note="codon recognized: UGC"
FT                   /db_xref="GeneID:5075354"
FT                   /locus_tag="Sbal_t02"
FT                   /product="tRNA-Cys"
FT   gene            complement(21060..21135)
FT                   /db_xref="GeneID:5075353"
FT                   /locus_tag="Sbal_t03"
FT   tRNA            complement(21060..21135)
FT                   /note="codon recognized: GGC"
FT                   /db_xref="GeneID:5075353"
FT                   /locus_tag="Sbal_t03"
FT                   /product="tRNA-Gly"
FT   gene            complement(21520..22953)
FT                   /db_xref="GeneID:4841239"
FT                   /locus_tag="Sbal_4502"
FT   CDS_pept        complement(21520..22953)
FT                   /locus_tag="Sbal_4502"
FT                   /gene_family="HOG000071677" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="catalyzes the formation of 3-phospho-D-glyceroyl
FT                   phosphate from D-glyceraldehyde 3-phosphate; involved in
FT                   growth under gluconeogenic conditions and in glycolytic
FT                   activity at high ATP concentrations in Corynebacterium; NAD
FT                   and NADP dependent"
FT                   /db_xref="GI:126090139"
FT                   /db_xref="GeneID:4841239"
FT                   /translation="MSADKHLQSWQERFEMAEAMQPLLGKLYRNQGVEVVVYGKPLLNA
FT                   STIEIIKAHRLVRRHVGEKLRLRESFPFVQALSKLAVKQCKVDIGKLAVNYWRDHTDVS
FT                   EIENYMAKELADAIDHADDVAPRDVVLYGFGRIGRLLARLLIERTGRSNKLRLRAIVLR
FT                   GGKKGDLEKRASLLRRDSVHGPFNGSVEVDEENNAIIANGTYIQVIYANSPDEVDYTKY
FT                   DISDALVVDNTGIWKDEAGLGLHLKSPGASKVLLTAPAKGAIKNIVYGVNEGDITPEDI
FT                   IVSAASCTTNAITPVLKAVNDKYGIENGHVETIHSYTNDQNLIDNYHTADRRGRSAPLN
FT                   MVITETGAAKAVAKALPVLAGKLTGNAIRVPTPNVSMAIISMNLNAETSKDELNEYLKD
FT                   TALQSPLQNQIDYTDSTEIVSSDLVGSRYAGVIDSQATIAEGKRAILYVWYDNEFGYSC
FT                   QVVGVMQTMLGLTTLSLPA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041620.1"
FT   misc_feature    complement(21526..22953)
FT                   /note="glyceraldehyde-3-phosphate dehydrogenase; Reviewed;
FT                   Region: PRK08289"
FT                   /db_xref="CDD:169345"
FT                   /locus_tag="Sbal_4502"
FT   misc_feature    complement(22090..22506)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Sbal_4502"
FT   misc_feature    complement(21604..22077)
FT                   /note="Glyceraldehyde 3-phosphate dehydrogenase, C-terminal
FT                   domain; Region: Gp_dh_C; pfam02800"
FT                   /db_xref="CDD:145777"
FT                   /locus_tag="Sbal_4502"
FT   gene            23157..24056
FT                   /db_xref="GeneID:4841260"
FT                   /locus_tag="Sbal_4503"
FT   CDS_pept        23157..24056
FT                   /locus_tag="Sbal_4503"
FT                   /gene_family="HOG000292187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090140"
FT                   /db_xref="GeneID:4841260"
FT                   /translation="MRQNLVIITSFTLGMSLFGLFGCDNDRNISAICKNNPEICADLHK
FT                   DSWCLAEKTKLIQNRYKLKDNENPTGKQLYLQLTYLEDYSRCIELASGVQHIIHTNRTA
FT                   DRARAFRLSTQNLSLLQEQTRERQDPFMSYYQWTRFGDTAALNRLLEHENAGEVTDSFL
FT                   LAQVATYYSNRNAIKAQQLYLKVFADIQYDDFDVNWLLGLASAYRQQQVFDKAYMLTKA
FT                   NLLLTQQKYSEEKMLALLGGNKTLATELDLKAQALIDALKNGTYSQSPVRQWLDPQAVD
FT                   QAPTTTEAVPPAPVEKTD"
FT                   /protein_id="YP_001041621.1"
FT   misc_feature    23211..23822
FT                   /note="Protein of unknown function (DUF2989); Region:
FT                   DUF2989; pfam11207"
FT                   /db_xref="CDD:151649"
FT                   /locus_tag="Sbal_4503"
FT   gene            24258..25268
FT                   /db_xref="GeneID:4841259"
FT                   /locus_tag="Sbal_4504"
FT   CDS_pept        24258..25268
FT                   /locus_tag="Sbal_4504"
FT                   /gene_family="HOG000071679" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090141"
FT                   /db_xref="GeneID:4841259"
FT                   /translation="MTIRVAINGYGRIGRNVLRALYESEKAYPIKIVAINDLGDASINA
FT                   HLTKYDSVHGRFNAKVDHDAEAIYVNGDKILTFQERDPAKLPWAELQVDVVFECTGIFT
FT                   SKETVQPHLTAGAKKVIISAPGKNVDATVVYGVNNNVLTSDMTVISNASCTTNCLAPFA
FT                   KPLNDEIGIESGLMTTIHAYTNDQRLSDVYHTDLRRARAAALSMIPTKTGAAAAVGLVV
FT                   PELQGKFDGLAVRVPTVNVSLVDLSFIAARDTTVEEVNAIIERAASVAPLSEVLAVNKE
FT                   PLVSIDFNHNAFSSNFDATQTRVNGRLVKVMSWYDNEWGFSNRMLDNAVALMNAK"
FT                   /protein_id="YP_001041622.1"
FT   misc_feature    24264..24719
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Sbal_4504"
FT   misc_feature    24267..25238
FT                   /note="glyceraldehyde-3-phosphate dehydrogenase, type I;
FT                   Region: GAPDH-I; TIGR01534"
FT                   /db_xref="CDD:162405"
FT                   /locus_tag="Sbal_4504"
FT   misc_feature    24732..25202
FT                   /note="Glyceraldehyde 3-phosphate dehydrogenase, C-terminal
FT                   domain; Region: Gp_dh_C; pfam02800"
FT                   /db_xref="CDD:145777"
FT                   /locus_tag="Sbal_4504"
FT   gene            complement(25415..26482)
FT                   /db_xref="GeneID:4841191"
FT                   /locus_tag="Sbal_4505"
FT   CDS_pept        complement(25415..26482)
FT                   /locus_tag="Sbal_4505"
FT                   /gene_family="HOG000222769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="quinolinate synthetase"
FT                   /transl_table="11"
FT                   /note="3 different subfamilies; catalyzes the formation of
FT                   quinolinate from iminoaspartate and dihydroxyacetone
FT                   phosphate"
FT                   /db_xref="GI:126090142"
FT                   /db_xref="GeneID:4841191"
FT                   /translation="MSQFAPSIETIDYPFPPKPVPLSDAQKADYKARIKQLLIEKDAVL
FT                   VAHYYTDPEIQALAEETGGCVSDSLEMARFGRDHPAKTLIVAGVKFMGETAKILSPEKT
FT                   ILMPTLEATCSLDLGCPIDKFSAFCDAHPDHTVVVYANTSAAVKARADWVVTSSIALEI
FT                   VEHLDSEGKKIIWGPDRHLGSYIAKQTGAEMLMWQGDCIVHDEFKSNALRDMKSVYPDA
FT                   AILVHPESPASVVAMADAVGSTSQLIKAAQTMPNERFIVATDRGIFYKMQQAAPGKILI
FT                   EAPTGGNGATCKSCAHCPWMAMNGLQAIEASLADSDKTTHEIFVDEDLRVKALIPLTRM
FT                   LDFAKTLNMKVKGNA"
FT                   /protein_id="YP_001041623.1"
FT   misc_feature    complement(25448..26455)
FT                   /note="Quinolinate synthetase A protein; Region: NadA;
FT                   cl00420"
FT                   /db_xref="CDD:174194"
FT                   /locus_tag="Sbal_4505"
FT   gene            complement(26616..28241)
FT                   /db_xref="GeneID:4841232"
FT                   /locus_tag="Sbal_4506"
FT   CDS_pept        complement(26616..28241)
FT                   /locus_tag="Sbal_4506"
FT                   /gene_family="HOG000281564" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090143"
FT                   /db_xref="GeneID:4841232"
FT                   /translation="MIKDFILPDIGEGVVECELVEWLVKEGDTVVEDQPIADVMTDKAL
FT                   VQIPAPFAGVVTKLYYAKGDIAKVHAPLYAVQIEGAVDIASEESIATEPAATTAKVTEP
FT                   VAATTANTSSSSSVSIEEFLLPDIGEGIVECELVEWLVSEGDWVEEDQPIADVMTDKAL
FT                   VQIPAIKAGKIAKLHYRKGQLAKVHAPLFAIEVEHAASVPAATTNTDTVVNAAPAAQIM
FT                   SAEPARQGKALASPAVRRMARSLDIDLSQVPGTGKHGRVYKEDITRFQQGASNVSAPST
FT                   TQVKEAPAQATQASQTQVPTSTVTQRADTVEPIRGVKAVMARMMVESVSSIPHFTYCEE
FT                   FDLTDLVALRESMKVKYSSDEVKLTMMPFFMKSMSLALSQFPVMNSQVNADCTELTYKA
FT                   RHNICMAVDSKVGLLVPNIKDVQDKSILEVAAEITRLTQAARSGRVAPADLKDGTISIS
FT                   NIGALGGTVATPIINKPEVAIVALGKLQTLPRFNAKGEVEARQIMQVSWSGDHRVIDGG
FT                   TIARFCNLWKQYLEQPQEMLLAMR"
FT                   /protein_id="YP_001041624.1"
FT   misc_feature    complement(26628..28241)
FT                   /note="dihydrolipoamide acetyltransferase; Reviewed;
FT                   Region: PRK11855"
FT                   /db_xref="CDD:171308"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(28023..28235)
FT                   /note="Lipoyl domain of the dihydrolipoyl acyltransferase
FT                   component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
FT                   dehydrogenase multienzyme complexes, like pyruvate
FT                   dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
FT                   and branched-chain 2-oxo acid...; Region: lipoyl_domain;
FT                   cd06849"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(order(28095..28097,28107..28124,28143..28145))
FT                   /note="E3 interaction surface; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(28113..28115)
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(27660..27878)
FT                   /note="Lipoyl domain of the dihydrolipoyl acyltransferase
FT                   component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
FT                   dehydrogenase multienzyme complexes, like pyruvate
FT                   dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
FT                   and branched-chain 2-oxo acid...; Region: lipoyl_domain;
FT                   cd06849"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(order(27741..27743,27753..27770,27789..27791))
FT                   /note="E3 interaction surface; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(27759..27761)
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(27444..27554)
FT                   /note="e3 binding domain; Region: E3_binding; pfam02817"
FT                   /db_xref="CDD:111687"
FT                   /locus_tag="Sbal_4506"
FT   misc_feature    complement(26628..27320)
FT                   /note="2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); Region: 2-oxoacid_dh; cl02008"
FT                   /db_xref="CDD:174698"
FT                   /locus_tag="Sbal_4506"
FT   gene            complement(28251..29228)
FT                   /db_xref="GeneID:4841209"
FT                   /locus_tag="Sbal_4507"
FT   CDS_pept        complement(28251..29228)
FT                   /locus_tag="Sbal_4507"
FT                   /gene_family="HOG000281451" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090144"
FT                   /db_xref="GeneID:4841209"
FT                   /translation="MAEMNMLQAVNEALSIAMQADERMVVFGEDVGHFGGVFRATSGLQ
FT                   EKFGRDRCFNTPLTEQGIAGFANGLASNGMTAVAEIQFADYIFPAFDQIVNESAKFRYR
FT                   SGNEFDVGGLVFRTPYGGGIAGGHYHSQSPEAYFTQTPGLKVVVPRNPEQAKGLLLASI
FT                   RDKNPVIFFEPKRLYRASVGEVPAGDYEIELGKAEVVREGKDITLVAWGAQMEILEKAA
FT                   DMAAKEGISCEIIDLRTLSPWDIDTVADSVKKTGRLLVNHEAPLTGGFAGEIAATIQQE
FT                   CFLYLESPISRVCGLDTPYPLIHEKEYMPDAFKTFEAIKASVTF"
FT                   /protein_id="YP_001041625.1"
FT   misc_feature    complement(28269..29228)
FT                   /note="3-methyl-2-oxobutanate dehydrogenase; Provisional;
FT                   Region: PTZ00182"
FT                   /db_xref="CDD:173465"
FT                   /locus_tag="Sbal_4507"
FT   misc_feature    complement(28704..29207)
FT                   /note="Pyrimidine (PYR) binding domain of the beta subunits
FT                   of the E1 components of human pyruvate dehydrogenase
FT                   complex (E1- PDHc) and related proteins; Region:
FT                   TPP_PYR_E1-PDHc-beta_like; cd07036"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="Sbal_4507"
FT   misc_feature    complement(order(28728..28733,28794..28799,28842..28844,
FT                   28851..28853,28920..28925,28950..28955,28962..28964,
FT                   29019..29027,29031..29036,29043..29060,29064..29066,
FT                   29073..29075,29139..29141,29157..29159,29163..29165))
FT                   /note="alpha subunit interface; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="Sbal_4507"
FT   misc_feature    complement(order(28962..28964,28971..28973,29049..29051,
FT                   29055..29057,29142..29144))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="Sbal_4507"
FT   misc_feature    complement(order(28803..28805,28809..28814,28818..28820,
FT                   28842..28847,28851..28853,28920..28922,28929..28931,
FT                   28941..28943,28956..28958,28962..28967,29049..29060,
FT                   29064..29066,29139..29141))
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="Sbal_4507"
FT   misc_feature    complement(28293..28646)
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="Sbal_4507"
FT   gene            complement(29232..30410)
FT                   /db_xref="GeneID:4841246"
FT                   /locus_tag="Sbal_4508"
FT   CDS_pept        complement(29232..30410)
FT                   /locus_tag="Sbal_4508"
FT                   /gene_family="HOG000281337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090145"
FT                   /db_xref="GeneID:4841246"
FT                   /translation="MSKATLNTDTVHRVGFLDKASLHIPILRILQADGTTYETAVLPVI
FT                   DETLATKIYDTCVFTRVLDERMLGAQRQGRISFYMTCTGEEAAIVGSVAALVQEDVILA
FT                   QYREHAALRYRGFTTEQFMNQMFSNEKDLGKGRQMPIHYGSAALHYQTISSPLATQIPQ
FT                   ATGVGYSLKMQGKRKVAVCYFGEGAASEGDFHAGLNMAAVLKCPVIFFCRNNGYAISTP
FT                   TEEQFAGNGIASRGVGYGMHTIRVDGNDMLAVLAATQQARAYAIEHNAPVLIEAMTYRL
FT                   GAHSSSDDPSGYRSKDEEAKWQQHDPVKRFKLWLINKGWLAEADDVKLHEKYREEVLAA
FT                   VKVAEKIPVPMLDEIIEDVYDKPTPVLRKQLADLKEHIKKYPQAYPKSAGRL"
FT                   /protein_id="YP_001041626.1"
FT   misc_feature    complement(29283..30338)
FT                   /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, alpha
FT                   subunit [Energy production and conversion]; Region: AcoA;
FT                   COG1071"
FT                   /db_xref="CDD:31269"
FT                   /locus_tag="Sbal_4508"
FT   misc_feature    complement(29379..30254)
FT                   /note="TPP-binding module; composed of proteins similar to
FT                   the E1 components of the human pyruvate dehydrogenase
FT                   complex (PDC), the acetoin dehydrogenase complex (ADC) and
FT                   the branched chain alpha-keto acid
FT                   dehydrogenase/2-oxoisovalerate dehydrogenase complex...;
FT                   Region: TPP_E1_PDC_ADC_BCADC; cd02000"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="Sbal_4508"
FT   misc_feature    complement(order(29535..29537,29547..29549,29691..29693,
FT                   29706..29708,29748..29759,29802..29804,29814..29816,
FT                   29826..29828,29835..29846,29850..29852,29943..29948,
FT                   30027..30029,30180..30182))
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="Sbal_4508"
FT   misc_feature    complement(order(29559..29561,29760..29762,29766..29768,
FT                   29847..29858,29940..29942,29946..29948,30090..30095))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="Sbal_4508"
FT   misc_feature    complement(order(29802..29804,29811..29816,29832..29837,
FT                   29892..29894,29901..29906,29910..29915,29922..29927,
FT                   29934..29936,29949..29951,29955..29957,29961..29963))
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="Sbal_4508"
FT   misc_feature    complement(order(29490..29498,29520..29552,29556..29576))
FT                   /note="phosphorylation loop region"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="Sbal_4508"
FT   gene            complement(30573..31607)
FT                   /db_xref="GeneID:4841210"
FT                   /locus_tag="Sbal_4509"
FT   CDS_pept        complement(30573..31607)
FT                   /locus_tag="Sbal_4509"
FT                   /gene_family="HOG000280300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinylglutamate desuccinylase"
FT                   /transl_table="11"
FT                   /note="catalyzes the formation of succinate and glutamate
FT                   from N(2)-succinylglutamate in arginine catabolism"
FT                   /db_xref="GI:126090146"
FT                   /db_xref="GeneID:4841210"
FT                   /translation="MLQALLDSKDFLALTLAHPEQFDGEFSFSLGDHTQVEVWDTGVIV
FT                   FEPAQNEGKDVVLSCGVHGNETAPIELCNGLIKQLLQQKIIAKQRTLFLIGNPLAINNG
FT                   TRIIDENMNRLFSGEHSNPPGLVNPERVRAKKLEAYVDRFYTAVADGRQRIHYDLHTAM
FT                   RASKHEKFAIYPYRPGRAFSGEQIMFLAASGVDTVLFHHEPTTTFSYFSSERYGADAFT
FT                   IELGKVYPMGQNDMTRFIAAHEMFMRLITAKPLELDAFDADKVNLYQVCRVINKHFDDF
FT                   EFTFATDVENFRTFPKGFVLAREGGQEIKVEHEFESVVFPNAKVPIGNRTVICLIPAVN
FT                   ADVR"
FT                   /protein_id="YP_001041627.1"
FT   misc_feature    complement(30597..31580)
FT                   /note="Peptidase M14 Succinylglutamate desuccinylase (ASTE,
FT                   also known as N-succinyl-L-glutamate amidohydrolase,
FT                   N2-succinylglutamate desuccinylase, and SGDS; EC 3.5.1.96)
FT                   belongs to the Succinylglutamate desuccinylase
FT                   (ASTE)/aspartoacylase (ASPA) subfamily...; Region:
FT                   M14_ASTE; cd03855"
FT                   /db_xref="CDD:133067"
FT                   /locus_tag="Sbal_4509"
FT   misc_feature    complement(30594..31454)
FT                   /note="Succinylglutamate desuccinylase / Aspartoacylase
FT                   family; Region: AstE_AspA; pfam04952"
FT                   /db_xref="CDD:147229"
FT                   /locus_tag="Sbal_4509"
FT   misc_feature    complement(order(30936..30938,30978..30980,30990..30992,
FT                   31089..31091,31128..31130,31266..31271,31290..31292,
FT                   31410..31412,31419..31421))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:133067"
FT                   /locus_tag="Sbal_4509"
FT   misc_feature    complement(order(31128..31130,31410..31412,31419..31421))
FT                   /note="Zn-binding site; other site"
FT                   /db_xref="CDD:133067"
FT                   /locus_tag="Sbal_4509"
FT   gene            31950..32429
FT                   /db_xref="GeneID:4841255"
FT                   /locus_tag="Sbal_4510"
FT   CDS_pept        31950..32429
FT                   /locus_tag="Sbal_4510"
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090147"
FT                   /db_xref="GeneID:4841255"
FT                   /translation="MALATFGAGCFWGVEYFFRQVNGVSNATCGYMGGNNSATTYEEVK
FT                   KGKTGHAEVVQVEFDPALVSYEDLLDVFWKNHNPTSLNMQGGDIGTQYRSTIFFHDREQ
FT                   KAAAETSKLAFARSGRWGLRHIVTEIVPLQQFHVAEEYHQNYIDKNNLPSCHIEY"
FT                   /protein_id="YP_001041628.1"
FT   misc_feature    31950..32420
FT                   /note="Peptide methionine sulfoxide reductase; Region:
FT                   PMSR; cl00366"
FT                   /db_xref="CDD:174150"
FT                   /locus_tag="Sbal_4510"
FT   gene            complement(32543..34195)
FT                   /db_xref="GeneID:4841189"
FT                   /locus_tag="Sbal_4511"
FT   CDS_pept        complement(32543..34195)
FT                   /locus_tag="Sbal_4511"
FT                   /gene_family="HOG000268677" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="catalyzes the interconversion of alpha-D-glucose
FT                   1-phosphate to alpha-D-glucose 6-phosphate"
FT                   /db_xref="GI:126090148"
FT                   /db_xref="GeneID:4841189"
FT                   /translation="MAIHQRAGQIANQTDLVNIPKLMSHYYSITPNMDDVQQRVTFGTS
FT                   GHRGCAFNGSFNQQHIWAITQAVVDYRQSVNINGPLILGIDTHALSYAAYLSAIEVLAA
FT                   NKVTVHIQQNDGFTPTPVVSHGVICANREANITGAPLSDGLIITPSHNPPQDGGIKYNP
FT                   PHGGPAEGNITAWIESRANDYLRQALAGVQKLAYAEALASGYVNAIDLITPYVADLENV
FT                   IDMQAIANAKLRIGVDPLGGSGIFYWAPIAARYGLDITLVNDKVDPSFSFMPLDKDGKI
FT                   RMDCSSPYAMAGLLAHKESYDLCLGNDPDYDRHGIVCPGTGLMDPNHYLAVAIDYLLTH
FT                   RPDWSDSLAIGKTLVSSALIDKICAFHGKKLLEVPVGFKWFVDGLAEATIAFGGEESAG
FT                   AAFLRRDGTTWCTDKDGFILGLLAAEILAVTGKTPGQRHQELVEQFGQSFYKRIDSPIS
FT                   LENKAKFALLNAETLNATVLAGEVIENVLTHAPGNNAAIGGIKVTTANGWFAARPSGTE
FT                   ALFKIYGESFISEQHLAEIIKDAQALIDKALNA"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041629.1"
FT   misc_feature    complement(32546..34192)
FT                   /note="phosphoglucomutase; Validated; Region: PRK07564"
FT                   /db_xref="CDD:169009"
FT                   /locus_tag="Sbal_4511"
FT   misc_feature    complement(32564..34138)
FT                   /note="This bacterial PGM-like (phosphoglucomutase-like)
FT                   protein of unknown function belongs to the
FT                   alpha-D-phosphohexomutase superfamily. The
FT                   alpha-D-phosphohexomutases include several related enzymes
FT                   that catalyze a reversible intramolecular phosphoryl...;
FT                   Region: PGM_like3; cd05801"
FT                   /db_xref="CDD:100094"
FT                   /locus_tag="Sbal_4511"
FT   misc_feature    complement(order(32633..32635,32648..32656,32660..32662,
FT                   32999..33001,33005..33007,33011..33013,33062..33070,
FT                   33131..33133,33257..33262,33266..33268,33272..33274,
FT                   33716..33718,33740..33748,34052..34054,34061..34063,
FT                   34067..34069))
FT                   /note="active site"
FT                   /db_xref="CDD:100094"
FT                   /locus_tag="Sbal_4511"
FT   misc_feature    complement(order(32633..32635,32648..32656,32660..32662,
FT                   32999..33001,33005..33007,33011..33013,33062..33064,
FT                   33068..33070,33131..33133,33257..33259,33746..33748,
FT                   34061..34063))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:100094"
FT                   /locus_tag="Sbal_4511"
FT   misc_feature    complement(order(33260..33262,33266..33268,33272..33274,
FT                   33746..33748))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:100094"
FT                   /locus_tag="Sbal_4511"
FT   gene            complement(34278..34820)
FT                   /db_xref="GeneID:4841253"
FT                   /locus_tag="Sbal_4512"
FT   CDS_pept        complement(34278..34820)
FT                   /locus_tag="Sbal_4512"
FT                   /gene_family="HOG000275226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication initiation regulator SeqA"
FT                   /transl_table="11"
FT                   /note="negative modulator of the initiation of chromosome
FT                   replication"
FT                   /db_xref="GI:126090149"
FT                   /db_xref="GeneID:4841253"
FT                   /translation="MKYIEVDEELYRHIASKTERIGESASDILRRLLGLSVDAVEPPQP
FT                   LAISQPSLEAEPIQAVAVQTAPAVNDFSRLVDEHLLSQQKGAVGRFLFLLESLYQLAPE
FT                   QFSQILQIQGRDRLYFARSKEQLLEASASANPKEIGTSGFWVTSNNNTAKKRTILSEVL
FT                   VQFGCDATVAAGIAERV"
FT                   /protein_id="YP_001041630.1"
FT   misc_feature    complement(34281..34820)
FT                   /note="SeqA protein; Region: SeqA; cl11470"
FT                   /db_xref="CDD:175271"
FT                   /locus_tag="Sbal_4512"
FT   gene            35118..35894
FT                   /db_xref="GeneID:4841217"
FT                   /locus_tag="Sbal_4513"
FT   CDS_pept        35118..35894
FT                   /locus_tag="Sbal_4513"
FT                   /gene_family="HOG000028067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090150"
FT                   /db_xref="GeneID:4841217"
FT                   /translation="MNFVSTGQGPAVLLIHGLFGNLDNLKGLGQVLESQYQVIRVDVPN
FT                   HGLSEHWDEMDYPRLATAMVALLDELAIERAHIVGHSMGGKIAMATALAFPERIISMVA
FT                   ADIAPVAYEPRHDLVFAALESLPLEGHTDRRFALNHLIDKGIDEATAQFLLKNLQRTDT
FT                   GFRWKLNLSGLKACYPNIIGWHNQAPNPVQSYSGPSLFIRGGDSNYVTGEHRSAIMAQF
FT                   PAAQAKTLEGCGHWLHAQKPAIFNRIVSEFIDKQAM"
FT                   /protein_id="YP_001041631.1"
FT   misc_feature    35151..35879
FT                   /note="hypothetical protein; Provisional; Region: PRK10673"
FT                   /db_xref="CDD:170621"
FT                   /locus_tag="Sbal_4513"
FT   misc_feature    35223..35864
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Sbal_4513"
FT   gene            35996..36217
FT                   /db_xref="GeneID:4841198"
FT                   /locus_tag="Sbal_4514"
FT   CDS_pept        35996..36217
FT                   /locus_tag="Sbal_4514"
FT                   /gene_family="HOG000275205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090151"
FT                   /db_xref="GeneID:4841198"
FT                   /translation="MLSQYMEQIETIGLNLFFASIFFFIGMAIHDVLKQGNVPKFGRFI
FT                   VWLVLFLGCAGFIVKGIIQITWEGSGIG"
FT                   /protein_id="YP_001041632.1"
FT   misc_feature    36041..36196
FT                   /note="Protein of unknown function (DUF2788); Region:
FT                   DUF2788; pfam10981"
FT                   /db_xref="CDD:151428"
FT                   /locus_tag="Sbal_4514"
FT   gene            36228..36500
FT                   /db_xref="GeneID:4841213"
FT                   /locus_tag="Sbal_4515"
FT   CDS_pept        36228..36500
FT                   /locus_tag="Sbal_4515"
FT                   /gene_family="HOG000275204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LexA regulated protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090152"
FT                   /db_xref="GeneID:4841213"
FT                   /translation="MAKEATDRTTIDLFANEKRRGRPRSNPLSRSQQLKVNKRNQIQRD
FT                   KANGLKRIELKVSQDLYDALNEQALASNISRSQLIELILQQQVEC"
FT                   /protein_id="YP_001041633.1"
FT   misc_feature    36228..36458
FT                   /note="LexA regulated protein; Provisional; Region:
FT                   PRK11675"
FT                   /db_xref="CDD:171242"
FT                   /locus_tag="Sbal_4515"
FT   gene            36555..37082
FT                   /db_xref="GeneID:4841203"
FT                   /locus_tag="Sbal_4516"
FT   CDS_pept        36555..37082
FT                   /locus_tag="Sbal_4516"
FT                   /gene_family="HOG000030543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavodoxin FldA"
FT                   /transl_table="11"
FT                   /note="An electron-transfer protein; flavodoxin binds one
FT                   FMN molecule, which serves as a redox-active prosthetic
FT                   group"
FT                   /db_xref="GI:126090153"
FT                   /db_xref="GeneID:4841203"
FT                   /translation="MATVGLFFGSDTGNTEAVAKMIQKKLGKKMVEVKDIAKSTKEQIA
FT                   EYDLLLFGIPTWYYGEAQCDWDDFFPELEQIDFTDKLVAIFGCGDQEDYAEYFLDAMGM
FT                   VGDIVQARGGIIIGHWPTASYNFEASKGQVDDDHFIGLGIDEDRQPELTEERVDAWVKQ
FT                   IYEEMCLAELED"
FT                   /protein_id="YP_001041634.1"
FT   misc_feature    36555..37064
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Sbal_4516"
FT   gene            37169..38347
FT                   /db_xref="GeneID:4841190"
FT                   /locus_tag="Sbal_4517"
FT   CDS_pept        37169..38347
FT                   /locus_tag="Sbal_4517"
FT                   /gene_family="HOG000258106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090154"
FT                   /db_xref="GeneID:4841190"
FT                   /translation="MTNTPRSTHWDIFCTVVDNYGDIGVTWRLAKQMANEYQIPVNLWV
FT                   DDLASFSHILPTLDPLKTAQSFNGVNIIHWTKPLPIAFVAGEVLIEAFACELPEQVKAQ
FT                   LVYLHQNAPESVPIWLNLEYLSAEDWVEGCHGLPSLQANGLKKYFYFPGFSAKTGGLIC
FT                   EQDLFAERDAWQANSANKLQLFSQLGLKRIEAQDTVISIFSYETEALPALCELWQQSAE
FT                   KIHALIPKGRSLNSLTQLLPCDIAALVPGQQINHGNLTLHILPMTDQQGFDRLLWSCDF
FT                   NIVRGEDSFLRAQWAAKPFIWHIYPQEDDYHLVKLEAFLKLYCDNLPPKIACYWSELNL
FT                   AFNQAQQSAVSLHWQNLNPVNLPLLHHAKQWPINALNAADLATRLVQFVKNS"
FT                   /protein_id="YP_001041635.1"
FT   misc_feature    37196..38341
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2331); Region: DUF2331; cl01823"
FT                   /db_xref="CDD:164000"
FT                   /locus_tag="Sbal_4517"
FT   gene            38393..38953
FT                   /db_xref="GeneID:4841243"
FT                   /locus_tag="Sbal_4518"
FT   CDS_pept        38393..38953
FT                   /locus_tag="Sbal_4518"
FT                   /gene_family="HOG000010047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="elongation factor P"
FT                   /transl_table="11"
FT                   /note="Involved in peptide bond synthesis; alters the
FT                   affinity of the ribosome for aminoacyl-tRNA"
FT                   /db_xref="GI:126090155"
FT                   /db_xref="GeneID:4841243"
FT                   /translation="MKTAHEIRPGNVIMLDGSPWVVQKTETTRSGRNAAIVKLKLKNLL
FT                   LNSGTETTFKGEDKLEDIILDRLDCTYSYFADPMFVFMDAEYNQYDVEAENLGDAAAYI
FT                   VDGMEETCQVTFYDGKAISVEMPTTIVREVIYTEPSARGDTSGKVMKPATITGGGTVTV
FT                   ADFVKVGDKIEIDTRTGEFKKRV"
FT                   /protein_id="YP_001041636.1"
FT   misc_feature    38393..38950
FT                   /note="elongation factor P; Validated; Region: PRK00529"
FT                   /db_xref="CDD:166998"
FT                   /locus_tag="Sbal_4518"
FT   misc_feature    38399..38572
FT                   /note="Elongation factor P (EF-P) KOW-like domain; Region:
FT                   EFP_N; pfam08207"
FT                   /db_xref="CDD:149330"
FT                   /locus_tag="Sbal_4518"
FT   misc_feature    38588..38773
FT                   /note="S1_EF-P_repeat_1: Translation elongation factor P
FT                   (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
FT                   stimulates the peptidyltransferase activity in the
FT                   prokaryotic 70S ribosome. EF-P enhances the synthesis of
FT                   certain dipeptides with N-formylmethionyl-...; Region:
FT                   S1_EF-P_repeat_1; cd04470"
FT                   /db_xref="CDD:88435"
FT                   /locus_tag="Sbal_4518"
FT   misc_feature    order(38654..38656,38735..38737,38750..38755)
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88435"
FT                   /locus_tag="Sbal_4518"
FT   misc_feature    38780..38947
FT                   /note="S1_EF-P_repeat_2: Translation elongation factor P
FT                   (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
FT                   stimulates the peptidyltransferase activity in the
FT                   prokaryotic 70S ribosome. EF-P enhances the synthesis of
FT                   certain dipeptides with N-formylmethionyl-...; Region:
FT                   S1_EF-P_repeat_2; cd05794"
FT                   /db_xref="CDD:88469"
FT                   /locus_tag="Sbal_4518"
FT   misc_feature    order(38867..38869,38918..38920,38933..38938)
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88469"
FT                   /locus_tag="Sbal_4518"
FT   gene            complement(39097..40431)
FT                   /db_xref="GeneID:4841194"
FT                   /locus_tag="Sbal_4519"
FT   CDS_pept        complement(39097..40431)
FT                   /locus_tag="Sbal_4519"
FT                   /gene_family="HOG000005154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090156"
FT                   /db_xref="GeneID:4841194"
FT                   /translation="MDSTLLTAFFQHGTIRDVECLFPDISGYPRGKLMPARSFAKGAEL
FT                   RIAQAISMQAITGEYSYDPIFPDADPDLLLVPDYSTLKMIPWSTVPRAFAIHDCVLLDG
FT                   NLCPFAPRSILKNVLARYQALGLTPVVAPEIEFYLTEANTDPSAPYQAPISKSGRAENG
FT                   QSAFSMNMLNELAPFWDEFNAAIDAIGIKGDTWIHEMGLSQYEINLVHGDPLALADQAF
FT                   MFKYAAKEIAIKHGLNAIFMAKPIAGQPGSSMHLHQSVVDDKGKNIFSHADGSDTEHFH
FT                   HYIGGLQKYLPDLMLLFAPNINSFRRYISGSQAPINLSWGVDNRTTGLRVPLSAPVARR
FT                   VENRIAGADANPYLMIAASLAAGLAGMEEKLSPSAPETGSAYESSHDLAQTFLAALTQM
FT                   RQSDSARRLLGDDFVTGFVSVKEIEFQSYLSEIGAWERRFLGPQC"
FT                   /protein_id="YP_001041637.1"
FT   misc_feature    complement(39112..40410)
FT                   /note="Glutamine synthetase [Amino acid transport and
FT                   metabolism]; Region: GlnA; COG0174"
FT                   /db_xref="CDD:30523"
FT                   /locus_tag="Sbal_4519"
FT   misc_feature    complement(39343..40110)
FT                   /note="Glutamine synthetase, catalytic domain; Region:
FT                   Gln-synt_C; pfam00120"
FT                   /db_xref="CDD:143894"
FT                   /locus_tag="Sbal_4519"
FT   gene            complement(40728..42110)
FT                   /db_xref="GeneID:4841231"
FT                   /locus_tag="Sbal_4520"
FT   CDS_pept        complement(40728..42110)
FT                   /locus_tag="Sbal_4520"
FT                   /gene_family="HOG000276345" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090157"
FT                   /db_xref="GeneID:4841231"
FT                   /translation="MSEPTALSLIPPLVVLVLAIWLRRPILSLIIGAVTGFLLLDPSQV
FT                   LNNFASVSLKVMADETIGWLILVCGGFGALIALLVRTGGALAFGRNALRFAKGPKSSLL
FT                   MTFILGIVIFIDDYLNALTVGETMKRVTDKFKVSREMLAYVVDSTAAPVCVLVPLSTWA
FT                   VFFGGLLVDNGVAAEGQGIAVYMQAIPYMLYAWLAVAMVLLVVLGIVPAIGPMKTAQLR
FT                   AAQGEPAEAQVDFDQVQTSDEYAVKAIEEEFKHADNHGKLHNFLVPIGLLVAFTVYFDI
FT                   DVWKGLLATLVITIPYYAVQRLMPLSEMMDQMIDGFKSMLPAISTVIAAFVFKDVCDQL
FT                   LLPQYVIESLSPFMTPKLLPAVVFLSMAILAFATGSSWGIFAVTIPIVMPLAKSVGADI
FT                   PLVIGALLSASSFGSQACFYSDSTVLAAQGSGCNLVSHAVTQLPYALIAAVLAFIGFIV
FT                   IA"
FT                   /protein_id="YP_001041638.1"
FT   misc_feature    complement(40731..42044)
FT                   /note="Na+/H+ antiporter [Energy production and
FT                   conversion]; Region: NhaC; COG1757"
FT                   /db_xref="CDD:31943"
FT                   /locus_tag="Sbal_4520"
FT   misc_feature    complement(40737..>41318)
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="Sbal_4520"
FT   gene            42886..44100
FT                   /db_xref="GeneID:4841206"
FT                   /locus_tag="Sbal_4521"
FT   CDS_pept        42886..44100
FT                   /locus_tag="Sbal_4521"
FT                   /gene_family="HOG000223042" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase AlaT"
FT                   /EC_number="2.6.1.2"
FT                   /note="broad specificity; family IV; in Corynebacterium
FT                   glutamicum this protein can use glutamate, 2-aminobutyrate,
FT                   and aspartate as amino donors and pyruvate as the acceptor"
FT                   /db_xref="GI:126090158"
FT                   /db_xref="GeneID:4841206"
FT                   /translation="MRPIIKSNKLDSVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAP
FT                   FGFEAPEEIVRDVILNLPSAQGYCESKGLFSARKAIVQHYQAQGIFGVDIEDIYIGNGV
FT                   SELIMMAMQGLLNTDDEILIPSPDYPLWTAAANLAGGKAVHYRCDEEADWFPDLNDIKS
FT                   KISSRTRGIVLINPNNPTGAVYSKELLLQVVELCREHSLILFADEIYDKILYDEAKHVP
FT                   AAGLSDDILTVTFNGLSKAYRAAGFRVGWMMLSGNLKAAKSYIEGLEMLSSMRLCANVP
FT                   NQHAIQTALGGYQSINELILPKGRLTVQRDACYELLNQIPGVSVKKPKGALYAFPKLDM
FT                   KKFNLRDDERLVLDLLREKKILLVHGTAFNWPEPDHLRVVFLPYKEDLKKAFTEFGAFL
FT                   ENYRQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041639.1"
FT   misc_feature    42988..44085
FT                   /note="tyrosine aminotransferase, eukaryotic; Region:
FT                   tyr_amTase_E; TIGR01264"
FT                   /db_xref="CDD:130331"
FT                   /locus_tag="Sbal_4521"
FT   misc_feature    42991..44061
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4521"
FT   misc_feature    order(43192..43200,43270..43272,43420..43422,43513..43515,
FT                   43594..43596,43600..43605,43627..43629)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4521"
FT   misc_feature    order(43201..43203,43300..43302,43492..43494,43621..43629,
FT                   43729..43731,43738..43740)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4521"
FT   misc_feature    43603..43605
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Sbal_4521"
FT   gene            44313..44900
FT                   /db_xref="GeneID:4841212"
FT                   /locus_tag="Sbal_4522"
FT   CDS_pept        44313..44900
FT                   /locus_tag="Sbal_4522"
FT                   /gene_family="HOG000276964" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090159"
FT                   /db_xref="GeneID:4841212"
FT                   /translation="MSHLFAHLARMKLIQRWPLMYNVRTENVQEHSLQVAMVAHALVII
FT                   SNKKFGTTLDPHQATSLAIFHDASEILTGDLPTPVKYFNKEIEAEYKKIEAIAEQRMLD
FT                   MVPEEFKEDYRSLFISDYADPVYKTIVKSADTLCAYLKCLEENRAGNSEFNTARKRLED
FT                   MLATNPDPAVQYFMNCFVPSFTLNLDEINKML"
FT                   /protein_id="YP_001041640.1"
FT   misc_feature    44313..44894
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Sbal_4522"
FT   gene            44926..46275
FT                   /db_xref="GeneID:4841183"
FT                   /locus_tag="Sbal_4523"
FT   CDS_pept        44926..46275
FT                   /locus_tag="Sbal_4523"
FT                   /gene_family="HOG000082148" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /transl_table="11"
FT                   /note="dGTPase family type 2 subfamily; presumably
FT                   hydrolyzes dGTP to deoxyguanosine and triphosphate"
FT                   /db_xref="GI:126090160"
FT                   /db_xref="GeneID:4841183"
FT                   /translation="MTSSVWQERRHGEDKQRRNDHRSPYQRDRARILHSAAFRRLQAKT
FT                   QVLGVGMNDFYRTRLTHSLEVSQIGTGIAAQLRRKYPQHKQLLCSMSLLESLCLAHDIG
FT                   HPPFGHGGEVALNYMMRDHGGFEGNGQTFRILSKLEPYTLDFGMNLCRRTMLGILKYPA
FT                   PHSKLFVAGEHNEITNHRQLKPSQWPPVKGIFDDDNDIFAWVLEPLSEADRSRFTSTQQ
FT                   GSHPALHHYPHLRTQFKSFDCSIMELADDIAYAVHDLEDAIVMGIVTASQWHQDVAPTL
FT                   TNSGDAWIRQELADIGNKLFSHEHHLRKDAIGTLVNGFVTAIVISEDDEFEEPLLRFNA
FT                   TLEPEFAIALNVLKQLVYKYVIRKPEIQMLEYKGQQIVMGLFEAFASDPERLLPLNTQE
FT                   RWRESEQQGLNSHRVLADYISGMTDEFAGRLYQQLFSPKAGSNVELSKEM"
FT                   /protein_id="YP_001041641.1"
FT   misc_feature    44932..46263
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Sbal_4523"
FT   misc_feature    44947..46206
FT                   /note="deoxyguanosinetriphosphate triphosphohydrolase;
FT                   Provisional; Region: dgt; PRK04926"
FT                   /db_xref="CDD:167859"
FT                   /locus_tag="Sbal_4523"
FT   gene            complement(46462..47103)
FT                   /db_xref="GeneID:4841202"
FT                   /locus_tag="Sbal_4524"
FT   CDS_pept        complement(46462..47103)
FT                   /locus_tag="Sbal_4524"
FT                   /gene_family="HOG000233114" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-
FT                   phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="catalyzes the formation of pyruvate and glyoxylate
FT                   from 4-hydroxy-2-oxoglutarate; or pyruvate and
FT                   D-glyceraldehyde 3-phosphate from
FT                   2-dehydro-3-deoxy-D-glyconate 6-phosphate"
FT                   /db_xref="GI:126090161"
FT                   /db_xref="GeneID:4841202"
FT                   /translation="MLENNWSLQPQDIFKRSPIVPVMVINKIEHAVPLARALVAGGISV
FT                   LEVTLRTPCALEAITKIAKEVPEALVGAGTILNEAQLDLAIAAGAQFIITPGATVELLK
FT                   AGMHGPVPLIPGVASISEVMTGMALGYTHFKFFPAEASGGVDALKAFSGPLADIRFCPT
FT                   GGITPSSYKDYLALKNVDCIGGSWIAPTDAMEHGDWDRITQLCKDAIGAL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041642.1"
FT   misc_feature    complement(46465..47097)
FT                   /note="keto-hydroxyglutarate-aldolase/keto-deoxy-
FT                   phosphogluconate aldolase; Provisional; Region: PRK05718"
FT                   /db_xref="CDD:168205"
FT                   /locus_tag="Sbal_4524"
FT   misc_feature    complement(46489..47064)
FT                   /note="KDPG and KHG aldolase. This family belongs to the
FT                   class I adolases whose reaction mechanism involves Schiff
FT                   base formation between a substrate carbonyl and lysine
FT                   residue in the active site.
FT                   2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase,  is
FT                   best...; Region: KDPG_aldolase; cd00452"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="Sbal_4524"
FT   misc_feature    complement(order(46615..46617,46693..46695,46699..46701,
FT                   46879..46881,46951..46953,46963..46965,47038..47040))
FT                   /note="active site"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="Sbal_4524"
FT   misc_feature    complement(order(46639..46644,46654..46656,46690..46695,
FT                   46720..46722,46732..46734,46738..46749,46807..46818,
FT                   46873..46875,46879..46881,46951..46953))
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="Sbal_4524"
FT   misc_feature    complement(46699..46701)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="Sbal_4524"
FT   gene            complement(47124..48950)
FT                   /db_xref="GeneID:4841257"
FT                   /locus_tag="Sbal_4525"
FT   CDS_pept        complement(47124..48950)
FT                   /locus_tag="Sbal_4525"
FT                   /gene_family="HOG000173157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="catalyzes the formation of
FT                   2-dehydro-3-deoxy-6-phospho-D-gluconate from
FT                   6-phospho-D-gluconate"
FT                   /db_xref="GI:126090162"
FT                   /db_xref="GeneID:4841257"
FT                   /translation="MHSVVQAVTDRIIARSKASREGYLAALNDARNHGVHRSSLSCGNL
FT                   AHGFAACNPDDKNALRQLNKANIGIVTAFNDMLSAHQPYESYPELLKKACQEVGSVAQV
FT                   AGGVPAMCDGVTQGQPGMELSLLSREVIAMATAVGLSHNMFDGALLLGICDKIVPGLLI
FT                   GALSFGHLPMLFVPAGPMKSGIPNKEKARIRQQFAQGKVDRAQLLEAEAQSYHSAGTCT
FT                   FYGTANSNQLMLEVMGLQLPGSSFVNPDDPLREALNKMAAKQVCRLTEMGTQYTPIGEV
FT                   VSEKSVVNGIVALLATGGSTNLTMHIVAAARAAGIIVNWDDFSELSDAVPLVARVYPNG
FT                   HADINHFHAAGGMAYLIKELLDAGLLHEDVNTVAGFGLRRYTQEPKLLDGELRWVDGPT
FT                   TSLDTEVLTSVASPFQGNGGLKLLKGNLGRAVIKVSAVQEQHRVVEAPAVVIDDQNKLD
FT                   ALFQAGALDRDCVVVVKGQGPKANGMPELHKLTPLLGTLQDKGFKVALLTDGRMSGASG
FT                   KVPAAIHLTPEALDGGLIAKVKDGDLIRVDALTGELSLLVSEAELATRTAGIVDLHRSR
FT                   YGMGRELFSALRSNLSSPETGARCTDAIDELY"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041643.1"
FT   misc_feature    complement(47142..48950)
FT                   /note="Dehydratase family; Region: ILVD_EDD; cl00340"
FT                   /db_xref="CDD:174127"
FT                   /locus_tag="Sbal_4525"
FT   misc_feature    complement(47151..48947)
FT                   /note="6-phosphogluconate dehydratase; Region: edd;
FT                   TIGR01196"
FT                   /db_xref="CDD:130264"
FT                   /locus_tag="Sbal_4525"
FT   gene            complement(48960..49658)
FT                   /db_xref="GeneID:4841172"
FT                   /locus_tag="Sbal_4526"
FT   CDS_pept        complement(48960..49658)
FT                   /locus_tag="Sbal_4526"
FT                   /gene_family="HOG000256284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090163"
FT                   /db_xref="GeneID:4841172"
FT                   /translation="MIKETVFKSFDTPSALEQQLASKIASQLQEAVDARGKASLVVSGG
FT                   STPLKLFQLLSMKSIDWSDVYITLADERWVEADADASNERLVREHLLQNRASNAKFRGL
FT                   KNMFSTAEAGADMAAESLSNFPRPFDVVVLGMGNDGHTCSWFPCSAELENALTTQALCV
FT                   ATNPTTAPHGRITLSKSAILNSRQIYLHLVGEQKLSVYRQALESDDVHAMPIRAVLAQR
FT                   KTPVDVFWSA"
FT                   /protein_id="YP_001041644.1"
FT   misc_feature    complement(48963..49619)
FT                   /note="6PGL: 6-Phosphogluconolactonase (6PGL) subfamily;
FT                   6PGL catalyzes the second step of the oxidative phase of
FT                   the pentose phosphate pathway, the hydrolyzation of
FT                   6-phosphoglucono-1,5-lactone (delta form) to
FT                   6-phosphogluconate. 6PGL is thought to guard...; Region:
FT                   6PGL; cd01400"
FT                   /db_xref="CDD:73166"
FT                   /locus_tag="Sbal_4526"
FT   misc_feature    complement(order(49068..49070,49137..49139,49236..49238,
FT                   49440..49442,49518..49523))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73166"
FT                   /locus_tag="Sbal_4526"
FT   gene            complement(49668..51140)
FT                   /db_xref="GeneID:4841196"
FT                   /locus_tag="Sbal_4527"
FT   CDS_pept        complement(49668..51140)
FT                   /locus_tag="Sbal_4527"
FT                   /gene_family="HOG000046191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="catalyzes the formation of D-glucono-1,5-lactone
FT                   6-phosphate from D-glucose 6-phosphate"
FT                   /db_xref="GI:126090164"
FT                   /db_xref="GeneID:4841196"
FT                   /translation="MGKTTSGAKACDFVLFGTKGDLARRKLLPSLYQLDKAELLDKDTK
FT                   VIGVAKDEFTQDEFIELVTLALNTFVKEPLCEETLQRFLSRCHYIGTNFTDSAGYSAFH
FT                   ELLKPEERVMVSYFATPPAIFGDICRCLHEQDLIHPDSRVVLEKPIGSDLDSSRVINDQ
FT                   VSAYFKERQVYRIDHYLGKETVQNLIALRFANSLFASKWDNRTIDHVQITVAEEVGIEG
FT                   RWGYFDKAGQMRDMIQNHLLQVLTLVAMDPPVNLDADSIRDEKVKVLKSLRPINSDNVY
FT                   ENTVRGQYSAGFLKGSPVPGYLEEEGANLQSHTETFVAIRVDIDNWRWAGVPFYLRSGK
FT                   RMPFKSSEIVVYFKNPPHNLYRSSYRNLPPNKLTIRLQPHEGVEIQMMNKVPGLEQKQR
FT                   LQTTKLDLSFSDTFKNERIADAYERLLLEAMLGNQALFVRRDEVEQAWTWVDGIIQSWE
FT                   QSNEKPKPYPAGTWGPVASVALITKDGRSWDE"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041645.1"
FT   misc_feature    complement(49671..51119)
FT                   /note="glucose-6-phosphate 1-dehydrogenase; Validated;
FT                   Region: PRK05722"
FT                   /db_xref="CDD:168207"
FT                   /locus_tag="Sbal_4527"
FT   misc_feature    complement(50580..51101)
FT                   /note="Glucose-6-phosphate dehydrogenase, NAD binding
FT                   domain; Region: G6PD_N; pfam00479"
FT                   /db_xref="CDD:144172"
FT                   /locus_tag="Sbal_4527"
FT   misc_feature    complement(49671..50573)
FT                   /note="Glucose-6-phosphate dehydrogenase, C-terminal
FT                   domain; Region: G6PD_C; pfam02781"
FT                   /db_xref="CDD:145765"
FT                   /locus_tag="Sbal_4527"
FT   gene            51453..52307
FT                   /db_xref="GeneID:4841258"
FT                   /locus_tag="Sbal_4528"
FT   CDS_pept        51453..52307
FT                   /locus_tag="Sbal_4528"
FT                   /gene_family="HOG000027158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding transcriptional regulator HexR"
FT                   /transl_table="11"
FT                   /note="Represses the expression of the zwf, eda, glp and
FT                   gap"
FT                   /db_xref="GI:126090165"
FT                   /db_xref="GeneID:4841258"
FT                   /translation="MNTLEKVQKSLTHFSKSERKVAEVILASPQTAIHSSIATLAKMAD
FT                   VSEPTVNRFCRRLDTKGFPDFKLHLAQSLANGTPYVSRHVEEDDSTESYTTKIFESSMA
FT                   SLDTARQSLDISAINKAVDILTQAKTISFFGLGASASVAHDAQNKFFRFNVPVICFDDV
FT                   LMQRMSCINSNEGDVVVLISHTGRTKSLIEIARLARENGAAVIGITARNSPLSMECTLP
FT                   VTMEVPEDTDMYLPMASRLAQLVTIDVLATGFTLRRGPRFRDNLKRVKEVLKESRINKD
FT                   PIL"
FT                   /protein_id="YP_001041646.1"
FT   misc_feature    51453..52304
FT                   /note="DNA-binding transcriptional regulator HexR;
FT                   Provisional; Region: PRK11302"
FT                   /db_xref="CDD:171068"
FT                   /locus_tag="Sbal_4528"
FT   misc_feature    51798..52211
FT                   /note="RpiR-like protein. RpiR contains a SIS (Sugar
FT                   ISomerase) domain, which is found in many phosphosugar
FT                   isomerases and phosphosugar binding proteins. In E. coli,
FT                   rpiR negatively regulates the expression of rpiB gene. Both
FT                   rpiB and rpiA are ribose...; Region: SIS_RpiR; cd05013"
FT                   /db_xref="CDD:88408"
FT                   /locus_tag="Sbal_4528"
FT   misc_feature    order(51867..51869,51999..52001)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:88408"
FT                   /locus_tag="Sbal_4528"
FT   gene            52494..53933
FT                   /db_xref="GeneID:4841244"
FT                   /locus_tag="Sbal_4529"
FT   CDS_pept        52494..53933
FT                   /locus_tag="Sbal_4529"
FT                   /gene_family="HOG000021558" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090166"
FT                   /db_xref="GeneID:4841244"
FT                   /translation="MFRRTKIVTTLGPATDRDDNLRRIIAAGANVVRLNFSHGSPEDHL
FT                   KRATQAREIAKELGVHVAILGDLQGPKIRVSTFKDNKKVQLVLGQAYVLDAELAKGEGD
FT                   ETQVGIDYKQLPDDVTVGDILMLDDGRVQLRVERVEGRKVHTTVTVAGPLSNNKGINKQ
FT                   GGGLSAAALTEKDKADILTAALIQVDYLAVSFPRSGADLDYARDLARQAGCNALIVAKV
FT                   ERAEAVATDAAMDDVILASDVVMVARGDLGVEIGDAALVAVQKKLIARSRQLNKVVITA
FT                   TQMMESMISSPMPTRAEVMDVANAVLDGTDAVMLSAETAAGDFPEETVKAMANVCVGAE
FT                   SHPSVIVSKHRLDVRFTSVEETIALSTMYAANHLEGVKAIIALTESGATPQLMSRISSA
FT                   LPILGLSRHATTLAKMALYRGVLPIYFDSTIHPADELAQKALEALTAAGYLNSGDMVLM
FT                   TKGDAMETIGGTNTCKVLIVA"
FT                   /protein_id="YP_001041647.1"
FT   misc_feature    52494..53921
FT                   /note="pyruvate kinase; Provisional; Region: PRK05826"
FT                   /db_xref="CDD:168262"
FT                   /locus_tag="Sbal_4529"
FT   misc_feature    52497..53927
FT                   /note="Pyruvate kinase (PK):  Large allosteric enzyme that
FT                   regulates glycolysis through binding of the substrate,
FT                   phosphoenolpyruvate, and one or more allosteric effectors.
FT                   Like other allosteric enzymes, PK has a high substrate
FT                   affinity R state and a low...; Region: Pyruvate_Kinase;
FT                   cl10032"
FT                   /db_xref="CDD:176611"
FT                   /locus_tag="Sbal_4529"
FT   misc_feature    order(52503..52508,52674..52676,52680..52682,52704..52715,
FT                   52971..52976,52992..52994,53001..53015,53058..53060,
FT                   53082..53084,53103..53105,53136..53138,53253..53255,
FT                   53307..53312,53322..53324,53418..53420,53424..53426,
FT                   53511..53513,53517..53522,53676..53678,53682..53684,
FT                   53688..53690,53721..53723,53730..53735,53739..53741,
FT                   53745..53753)
FT                   /note="domain interfaces; other site"
FT                   /db_xref="CDD:29370"
FT                   /locus_tag="Sbal_4529"
FT   misc_feature    order(52590..52592,52596..52598,52692..52694,53076..53078,
FT                   53154..53156,53160..53162,53241..53243,53337..53339)
FT                   /note="active site"
FT                   /db_xref="CDD:29370"
FT                   /locus_tag="Sbal_4529"
FT   gene            complement(54191..56470)
FT                   /db_xref="GeneID:4841170"
FT                   /locus_tag="Sbal_4530"
FT   CDS_pept        complement(54191..56470)
FT                   /locus_tag="Sbal_4530"
FT                   /gene_family="HOG000274434" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /transl_table="11"
FT                   /note="functions in fatty acid oxidation; converts acyl-CoA
FT                   and FAD to FADH2 and delta2-enoyl-CoA"
FT                   /db_xref="GI:126090167"
FT                   /db_xref="GeneID:4841170"
FT                   /translation="MLTIIILALIAIVVLFAVKNIRMQFITRPVFSFFKKVLPPLSDTE
FT                   REAMEAGDVWWEGELFRGNPNWNTLHSYGKPTLSAEEKDFIDNQVMTALTMIDDFDIVH
FT                   NRKDLPPELWEYFKKEGFFALIIPKKFGGKAFSAYANSTIVSKLASRSVSAAVTVMVPN
FT                   SLGPGELLTHYGTSEQKERWLPSLAKGDEIPCFALTGPEAGSDAGAIPDVGIVCRDTFN
FT                   GEEMLGLKLTWDKRYITLAPVATVLGLAFQMRDPEGLLGDKKNLGITCALIPTDHPGVV
FT                   IGRRHNPLGMAFMNGTTQGKEVFIPLDWIIGGPEFAGKGWRMLVECLSAGRGISLPALA
FT                   TASGHMATKTTTAYSYVRHQFGMAIGQFEGVQEALARIIANTYQLEAARRLTTTGIDLK
FT                   VKPSVVTAIAKYHMTELGRSVMNDAMDIQSGKGIQLGPKNYLGHPYMSNPISITVEGAN
FT                   ILTRSLMIFGQGATRCHPYVLAEMEAAAMENQHEALERFDALLMGHMGYATRNAFSALF
FT                   SALSGSRFGSAPVSGETKQYYKDMSRISSALALMTDLSMLIMGGDLKRKEMLSARMGDV
FT                   LSQLYLGSATLKLFEDNGRQQDDLPAVRYVMANRLHLAAKALEDTIRNFPSRPVAWLLR
FT                   GLIFPLGNHFNAPSDKMATDLVGGMLKPGPARDRITFLCPEFEGDKGGIAEVEQAFVAQ
FT                   YACKDIYKKLKKAQRAGELPAKVPNLVLFAKALETGVITADEEQKLQHADKLRLAAINV
FT                   NDFEAL"
FT                   /protein_id="YP_001041648.1"
FT   misc_feature    complement(54194..56416)
FT                   /note="acyl-CoA dehydrogenase; Reviewed; Region: PRK13026"
FT                   /db_xref="CDD:171844"
FT                   /locus_tag="Sbal_4530"
FT   misc_feature    complement(55175..56143)
FT                   /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
FT                   /db_xref="CDD:175048"
FT                   /locus_tag="Sbal_4530"
FT   misc_feature    complement(order(55754..55756,55760..55762,55877..55879,
FT                   55883..55885,55976..55978))
FT                   /note="active site"
FT                   /db_xref="CDD:173838"
FT                   /locus_tag="Sbal_4530"
FT   misc_feature    complement(54203..55057)
FT                   /note="Domain of unknown function (DUF1974); Region:
FT                   DUF1974; pfam09317"
FT                   /db_xref="CDD:150096"
FT                   /locus_tag="Sbal_4530"
FT   gene            complement(56487..57170)
FT                   /db_xref="GeneID:4841182"
FT                   /locus_tag="Sbal_4531"
FT   CDS_pept        complement(56487..57170)
FT                   /locus_tag="Sbal_4531"
FT                   /gene_family="HOG000259746" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090168"
FT                   /db_xref="GeneID:4841182"
FT                   /translation="MFNLNECFKLIQGHGMASRSDTKTRILDAAEKLFAERGFSETSLR
FT                   LITSKAEVNLASVNYHFGSKKELIRAVLARYLDVFMPAASNQINRLNAAPAQATLEEIL
FT                   SSLVDPLLDLNALRTEGTTIFLQLLGRGYIESQGHLRWFITTHYGQHLDAFVKAVSASA
FT                   PHIPPAEMFWRLHFTLGTIVFTMASADALNDIAAAEFGEHNDIEAVIRKVIPYMAAGVS
FT                   VPVSS"
FT                   /protein_id="YP_001041649.1"
FT   misc_feature    complement(<56697..57122)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Sbal_4531"
FT   misc_feature    complement(56955..57095)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Sbal_4531"
FT   gene            57346..59211
FT                   /db_xref="GeneID:4841238"
FT                   /locus_tag="Sbal_4532"
FT   CDS_pept        57346..59211
FT                   /locus_tag="Sbal_4532"
FT                   /gene_family="HOG000292210" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090169"
FT                   /db_xref="GeneID:4841238"
FT                   /translation="MVISLNRRSKIALTVALALGLTACNDAQSKTDKSASTEAAVINTA
FT                   PDKTQAIAFINDAEAKMAELSIESNRAEWIYSNFITDDTAALSAAVGEKVSAASVKFAT
FT                   EAAKYANVQLDPVNARKLNILRSALVLPAPLDPAKNAELAQISSELNGLYGKGKYCFTD
FT                   GKCMTQPELSSLMAESRDPATLLEAWKGWREIAKPMRPLFQREVELANEGAKDLGYANL
FT                   SELWRSQYDMKPDDFSQELDRLWGQVKPLYESLHCYVRGELNKEYGDNIAPTTGPIPAH
FT                   LLGNMWAQQWGNVYDLVAPDNADPGYDVTELLAKNGYDEHKMVKQAEGFFTSLGFAPLP
FT                   ESFWARSLFVQPKDRDVVCHASAWDLDNIDDIRIKMCIQKTAEDFSVIHHELGHNFYQR
FT                   AYKQQPFLFKNSANDGFHEAIGDTIALSITPSYLKQIGLLDEVPDASKDIGLLLKQALD
FT                   KIAFLPFGLMIDQWRWKVFSGEITPAQYNQAWWDLREKYQGVKAPTKRSEADFDPGAKY
FT                   HVPGNVPYTRYFLAHILQFQFHQALCETAGDKGPVHRCSIYGNQAAGEKLNKMLELGLS
FT                   KPWPEALKEVTGKETMDAKAVLDYFAPLKTWLDEQNTAANRQCGW"
FT                   /protein_id="YP_001041650.1"
FT   misc_feature    57469..59208
FT                   /note="Angiotensin-converting enzyme; Region: Peptidase_M2;
FT                   pfam01401"
FT                   /db_xref="CDD:144844"
FT                   /locus_tag="Sbal_4532"
FT   misc_feature    57766..59181
FT                   /note="Peptidase family M2 Angiotensin converting enzyme
FT                   (ACE, EC 3.4.15.1) is a membrane-bound, zinc dependent
FT                   dipeptidase that catalyzes the conversion of the
FT                   decapeptide angiotensin I to the potent vasopressor
FT                   ocatapeptide angiotensin II, by removing two C-; Region:
FT                   M2_ACE; cd06461"
FT                   /db_xref="CDD:107217"
FT                   /locus_tag="Sbal_4532"
FT   misc_feature    order(58423..58434,58513..58518,58525..58527,58537..58539,
FT                   58594..58599,58729..58731,58891..58893,58897..58899,
FT                   58918..58920,58927..58929)
FT                   /note="active site"
FT                   /db_xref="CDD:107217"
FT                   /locus_tag="Sbal_4532"
FT   misc_feature    order(58513..58515,58525..58527,58597..58599)
FT                   /note="zinc binding site; other site"
FT                   /db_xref="CDD:107217"
FT                   /locus_tag="Sbal_4532"
FT   gene            complement(59325..59915)
FT                   /db_xref="GeneID:4841252"
FT                   /locus_tag="Sbal_4533"
FT   CDS_pept        complement(59325..59915)
FT                   /locus_tag="Sbal_4533"
FT                   /gene_family="HOG000257489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090170"
FT                   /db_xref="GeneID:4841252"
FT                   /translation="MLDDESALFFEEMAGVVPLKGEMPAVSFAPKALTAEQIHRRDALQ
FT                   REAYLACMPLDLKAFVQQAPDDIVSFKREGVQGGVFKRLRMGQYSIKMELDVHAYRLNQ
FT                   AREAVLNYLLAAQAHGERCVMLIHGKGYQSQPFAGLLKSAVCCWLSQLDMVLAYHSAKT
FT                   EQGGTGALYVMLTKSEQLKLENREANRKGMGLR"
FT                   /protein_id="YP_001041651.1"
FT   misc_feature    complement(59373..59915)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG2840"
FT                   /db_xref="CDD:32668"
FT                   /locus_tag="Sbal_4533"
FT   misc_feature    complement(59391..59633)
FT                   /note="Smr domain; Region: Smr; cl02619"
FT                   /db_xref="CDD:174725"
FT                   /locus_tag="Sbal_4533"
FT   gene            60034..60609
FT                   /db_xref="GeneID:4841250"
FT                   /locus_tag="Sbal_4534"
FT   CDS_pept        60034..60609
FT                   /locus_tag="Sbal_4534"
FT                   /gene_family="HOG000292211" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090171"
FT                   /db_xref="GeneID:4841250"
FT                   /translation="MKFLPLVLMCLLSLPSLANPAKTHTKSTDDQLINANYPLFISAFN
FT                   QLSPEVTREIYADDASYLSESQSKEIYYGRDNIVAIYQKFFDKIRAKKATIDVDFRITK
FT                   RKIIGDGAIDTGYYLVRFYPAKETGEPVSEFAGKFAIGTEKVSATQWKVSLDTNNRAEP
FT                   SYYLNAKPVPNLYYGRQFPPLPAGKKLP"
FT                   /protein_id="YP_001041652.1"
FT   gene            60739..61266
FT                   /db_xref="GeneID:4841245"
FT                   /locus_tag="Sbal_4535"
FT   CDS_pept        60739..61266
FT                   /locus_tag="Sbal_4535"
FT                   /gene_family="HOG000252587" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090172"
FT                   /db_xref="GeneID:4841245"
FT                   /translation="MTTTQQSCPCGSSKRYQDCCNPLHIHVDSGQVVARTPEQLMRSRY
FT                   CAFVLKNFDYILKTHHPEYLNGLTLASLNTGPHPHWLGLEVLSNSETPAHNSQAANQAI
FT                   AEPRHGTVTFKAWYKLEGEIDAIYECSEFIYQTGRWYYSQGQQMTAKLPGRNDACVCHS
FT                   GKKFKQCCLKSL"
FT                   /protein_id="YP_001041653.1"
FT   misc_feature    60754..61251
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG3012"
FT                   /db_xref="CDD:32829"
FT                   /locus_tag="Sbal_4535"
FT   misc_feature    60760..61173
FT                   /note="SEC-C motif; Region: SEC-C; cl12132"
FT                   /db_xref="CDD:175403"
FT                   /locus_tag="Sbal_4535"
FT   misc_feature    61201..61257
FT                   /note="SEC-C motif; Region: SEC-C; cl12132"
FT                   /db_xref="CDD:175403"
FT                   /locus_tag="Sbal_4535"
FT   gene            complement(61518..63701)
FT                   /db_xref="GeneID:4841254"
FT                   /locus_tag="Sbal_4536"
FT   CDS_pept        complement(61518..63701)
FT                   /locus_tag="Sbal_4536"
FT                   /gene_family="HOG000292222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090173"
FT                   /db_xref="GeneID:4841254"
FT                   /translation="MKRRQHQHLLESLVQSAAKQQGDFTKTAELATELLCQNLTVSLVS
FT                   VWTFTADQQTQTLVAQFGSMMLQDIHRPKLLQACPRYVHELKTLRHIDAGNTLTDPRLS
FT                   ELAECYFIPRHINSSLDIAIRINGRLEGVLCIERAQFTPHWHDSEIHLACQMADQLALT
FT                   LATKHSYDKEESLSLFRCATEQSRQISMLINLHTEKVEYVNQAHSEITGMPREQIIGAN
FT                   IRELAFFKQHAQLAEQTLAQIFRGEIAKGEAQFSRADGSRYWLTYLLSQFITDRGNHYA
FT                   LVSSEENTDEHNYKLELERLAWRCGLTGLHNRTHFNRVLERTNKGLLLLVDLVGFKRFN
FT                   DTYGHENGDSLLIEIARRLKHFSEINKATEIARVGSDEFAVLLTDDNAVYDLDYFSTRL
FT                   YQHLAMPILIGREQVEPKPALAVVDIASVASLFAPLTCADIAVQYAKKKKGTAIQVFNS
FT                   TLLSAFKEDAQIERDLHSAIRGRQFELYYQPLRDLEQNTYIGAEALIRWHHPKRGVLFP
FT                   ASFIDIAEQSGMINSIGSWVLEAACRQLNLWQHHNADMTMHVNVSARQFFSGNLFEQVW
FT                   QLLTRYRLKPKTLILEITETELMGDIRHATFLCQELAELGVGLAIDDFGTGYSSMRYLK
FT                   QFPISKLKIDRSFISDLTVSRESREIVSAIIAMASALNISLTAEGVETLEQEAFLAKSF
FT                   CHQAQGYLYSPALREPEFAQFILSAKSPSVLTH"
FT                   /protein_id="YP_001041654.1"
FT   misc_feature    complement(63210..63635)
FT                   /note="GAF domain; Region: GAF; cl00853"
FT                   /db_xref="CDD:154040"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(62847..63107)
FT                   /note="PAS domain; PAS motifs appear in archaea, eubacteria
FT                   and eukarya. Probably the most surprising identification of
FT                   a PAS domain was that in EAG-like K+-channels. PAS domains
FT                   have been found to bind ligands, and to act as sensors for
FT                   light and oxygen in...; Region: PAS; cd00130"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(order(62922..62924,62937..62939,63015..63026,
FT                   63063..63065,63081..63083,63093..63095))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(order(62895..62897,62901..62903,62985..62990,
FT                   62997..62999,63021..63023,63033..63035))
FT                   /note="heme pocket; other site"
FT                   /db_xref="CDD:29035"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(62352..62783)
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(order(62571..62573,62706..62708))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(order(62568..62579,62583..62585,62655..62657,
FT                   62667..62669,62679..62684,62691..62693))
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(order(62508..62510,62595..62597))
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4536"
FT   misc_feature    complement(61569..62288)
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Sbal_4536"
FT   gene            complement(63953..64240)
FT                   /db_xref="GeneID:4841247"
FT                   /locus_tag="Sbal_4537"
FT   CDS_pept        complement(63953..64240)
FT                   /locus_tag="Sbal_4537"
FT                   /gene_family="HOG000270330" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090174"
FT                   /db_xref="GeneID:4841247"
FT                   /translation="MKGIIEAQSPTVNDTCTDCGSFVDIGAVIDEHDTLLTLNFVGDSA
FT                   QTDAESMASHAQARFAEVQTEFVTTAAGIDLLLTFGVSAEKMIFQLENGL"
FT                   /protein_id="YP_001041655.1"
FT   misc_feature    complement(63959..64174)
FT                   /note="Protein of unknown function (DUF406); Region:
FT                   DUF406; cl11449"
FT                   /db_xref="CDD:175261"
FT                   /locus_tag="Sbal_4537"
FT   gene            complement(64451..64939)
FT                   /db_xref="GeneID:4841251"
FT                   /locus_tag="Sbal_4538"
FT   CDS_pept        complement(64451..64939)
FT                   /locus_tag="Sbal_4538"
FT                   /gene_family="HOG000292233" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090175"
FT                   /db_xref="GeneID:4841251"
FT                   /translation="MQIDVPLVNEAQIGTRLNAAIENDRRGEFALLLSLLSVDARDMAQ
FT                   FQWQNELDMAQKLQRQFELPPQQSLMADLSSAEPVVDNSSIFMAQGSRAFQLQQALRPE
FT                   ALVIRGGESVAMAEALSNCDHVTQLRQRGQLSAPKVEIMHFADQLAIQRNLVPLLASA"
FT                   /protein_id="YP_001041656.1"
FT   misc_feature    complement(64457..64939)
FT                   /note="Ribosomal S4P (gammaproteobacterial); Region:
FT                   Ribosomal_S4Pg; pfam11993"
FT                   /db_xref="CDD:152428"
FT                   /locus_tag="Sbal_4538"
FT   gene            65065..65149
FT                   /db_xref="GeneID:5075355"
FT                   /locus_tag="Sbal_t04"
FT   tRNA            65065..65149
FT                   /note="codon recognized: UAC"
FT                   /db_xref="GeneID:5075355"
FT                   /locus_tag="Sbal_t04"
FT                   /product="tRNA-Tyr"
FT   gene            65221..65305
FT                   /db_xref="GeneID:5075358"
FT                   /locus_tag="Sbal_t05"
FT   tRNA            65221..65305
FT                   /note="codon recognized: UAC"
FT                   /db_xref="GeneID:5075358"
FT                   /locus_tag="Sbal_t05"
FT                   /product="tRNA-Tyr"
FT   gene            65390..65474
FT                   /db_xref="GeneID:5075356"
FT                   /locus_tag="Sbal_t06"
FT   tRNA            65390..65474
FT                   /note="codon recognized: UAC"
FT                   /db_xref="GeneID:5075356"
FT                   /locus_tag="Sbal_t06"
FT                   /product="tRNA-Tyr"
FT   gene            65739..66884
FT                   /db_xref="GeneID:4841171"
FT                   /locus_tag="Sbal_4539"
FT   CDS_pept        65739..66884
FT                   /locus_tag="Sbal_4539"
FT                   /gene_family="HOG000247283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090176"
FT                   /db_xref="GeneID:4841171"
FT                   /translation="MIPFEVTMMISNTIQPPVDSHSAHRLCPTWEALAIGKIEADFQRS
FT                   ADTHLIKLELPMLDGIDIYLKDESTHPTGSLKHRLARSLFLYALCNGWIKQGTPIIESS
FT                   SGSTAISEAYFARLLGLPFIAVMPKSTAKKKIEQITFYGGQCHFVDHSSEIYAESARLA
FT                   AELGGHYMDQFTYAERATDWRGNNNIANSIFNQMEREPHTIPRWIVMSPGTGGTSATIG
FT                   RYIRYQRLATQLCVVDPQNSVFFDFYQSGDASLTCCNGSKIEGIGRPRVEPSFIPGVVD
FT                   SMLQIPDAASVATIHWLEQLIGRKTGASTGTNLYGALQLAVQMQARGEQGSIVTLICDS
FT                   GERYLDTYYDADWIAANIGDIAPYQRQLAAFNHFGQLSELD"
FT                   /protein_id="YP_001041657.1"
FT   misc_feature    65850..66779
FT                   /note="Cysteine synthase [Amino acid transport and
FT                   metabolism]; Region: CysK; COG0031"
FT                   /db_xref="CDD:30381"
FT                   /locus_tag="Sbal_4539"
FT   misc_feature    65880..66776
FT                   /note="Tryptophan synthase beta superfamily (fold type II);
FT                   this family of pyridoxal phosphate (PLP)-dependent enzymes
FT                   catalyzes beta-replacement and beta-elimination reactions.
FT                   This CD corresponds to aminocyclopropane-1-carboxylate
FT                   deaminase (ACCD)...; Region: Trp-synth-beta_II; cl00342"
FT                   /db_xref="CDD:176817"
FT                   /locus_tag="Sbal_4539"
FT   misc_feature    order(65964..65969,66057..66059,66375..66389,66663..66665,
FT                   66750..66755)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:107202"
FT                   /locus_tag="Sbal_4539"
FT   misc_feature    65967..65969
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:107202"
FT                   /locus_tag="Sbal_4539"
FT   gene            complement(67004..67672)
FT                   /db_xref="GeneID:4841169"
FT                   /locus_tag="Sbal_4540"
FT   CDS_pept        complement(67004..67672)
FT                   /locus_tag="Sbal_4540"
FT                   /gene_family="HOG000266143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090177"
FT                   /db_xref="GeneID:4841169"
FT                   /translation="MNYPVNEVFETIQGEGVFTGVPAIFVRLQGCPVGCAWCDTKQTWD
FT                   VLEVNKVMPEQVISVDGTIGRWADHTAQSLIAAFHAKGFTARHIVITGGEPCMYDLCEL
FT                   TETLHSQGFATQIETSGTFDINCADDTWVTVSPKVNMKGGYKVLTQALNRANEIKHPIA
FT                   TENHIAELDELLQDIDISAKTICLQPISQKPRATELAMKVCIARNWRLSIQTHKYLNID
FT                   "
FT                   /protein_id="YP_001041658.1"
FT   misc_feature    complement(67007..67672)
FT                   /note="Organic radical activating enzymes
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: NrdG; COG0602"
FT                   /db_xref="CDD:30947"
FT                   /locus_tag="Sbal_4540"
FT   misc_feature    complement(<67259..67663)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="Sbal_4540"
FT   gene            67844..68566
FT                   /db_xref="GeneID:4841241"
FT                   /locus_tag="Sbal_4541"
FT   CDS_pept        67844..68566
FT                   /locus_tag="Sbal_4541"
FT                   /gene_family="HOG000110563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="queuosine biosynthesis protein QueC"
FT                   /transl_table="11"
FT                   /note="YbaX; catalyzes the transformation of GTP to
FT                   7-cyano-7-deazaguanine (preQ0), as one of the early
FT                   reactions of quenosine biosynthesis; quenosine is a
FT                   modified nucleoside that occurs at the wobble position of
FT                   GUN anticodons in tRNAs for Asn, Asp, Tyr, and His"
FT                   /db_xref="GI:126090178"
FT                   /db_xref="GeneID:4841241"
FT                   /translation="MSTSLVSKPLASKAVVVFSGGQDSTTCLIQALTQYDEVHGITFDY
FT                   GQRHREEIEVAKSLAKRLKITSHKVMDVTLLNELAISALTRDAIPVSHELMENGLPNTF
FT                   VPGRNILFLTLAGIYAYQLGAEAIITGVCETDFSGYPDCRNDFVKAMESALVQGMDKQL
FT                   KIITPLMWLNKAQTWALADKYQQLDLVRHHTLTCYNGVIGDGCGDCPACHLRKRGLDEY
FT                   MQDKTAVMASLDASEPKA"
FT                   /protein_id="YP_001041659.1"
FT   misc_feature    67880..68506
FT                   /note="ExsB is a transcription regulator related protein.
FT                   It is a subfamily of a Adenosine nucleotide binding
FT                   superfamily of proteins. This protein family is represented
FT                   by a single member in nearly every completed large (> 1000
FT                   genes) prokaryotic genome. In...; Region: ExsB; cd01995"
FT                   /db_xref="CDD:73293"
FT                   /locus_tag="Sbal_4541"
FT   misc_feature    order(67892..67900,67904..67915,67979..67981,67985..67987)
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:73293"
FT                   /locus_tag="Sbal_4541"
FT   gene            68563..69159
FT                   /db_xref="GeneID:4841199"
FT                   /locus_tag="Sbal_4542"
FT   CDS_pept        68563..69159
FT                   /locus_tag="Sbal_4542"
FT                   /gene_family="HOG000276313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090179"
FT                   /db_xref="GeneID:4841199"
FT                   /translation="MTRSPYWVALIVSLICAGLYVAGLASPAVDNLLAYRRSAIADGEW
FT                   WRLISGNLLHTNQWHLLMNLAGLWVVLFLHHFHYHLKGLSALFLVLCLLEGIGLYLGYP
FT                   QLLGYVGLSGMLHGLFAFGAVQDIVRKLRSGYLLLLGVIIKVGHEQLYGASNDVTAMIG
FT                   ARVATEAHLVGLICGLICALAVFIKLKFRHVKVSA"
FT                   /protein_id="YP_001041660.1"
FT   gene            complement(69235..71241)
FT                   /db_xref="GeneID:4841211"
FT                   /locus_tag="Sbal_4543"
FT   CDS_pept        complement(69235..71241)
FT                   /locus_tag="Sbal_4543"
FT                   /gene_family="HOG000073580" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease ABC subunit B"
FT                   /transl_table="11"
FT                   /note="The UvrABC repair system catalyzes the recognition
FT                   and processing of DNA lesions. The beta-hairpin of the
FT                   Uvr-B subunit is inserted between the strands, where it
FT                   probes for the presence of a lesion"
FT                   /db_xref="GI:126090180"
FT                   /db_xref="GeneID:4841211"
FT                   /translation="MSESVFQLESQFAPAGDQPTAIAKLVDGLEAGLACQTLLGVTGSG
FT                   KTFTIANVIQKLGRPTIIMAPNKTLAAQLYGEMKEFFPHNAVEYFVSYYDYYQPEAYVP
FT                   ASNTFIEKDASVNAHIEQMRLSATKALLERKDVVLIASVSAIYGLGDPDSYLKMLLHLR
FT                   QGDVMGQRDILIRLSELQYKRNDIELQRGTYRVRGEVIDVFPADSERNAIRVELFDDEI
FT                   ERLSEFDPLTGHIIKRIARTTVYPKTHYVTPREKIIAATEFIKEELRERKQYLLDNNKL
FT                   IEAQRIHERVQYDVEMMVELGYCSGIENYSRYLSGRAPGEGPPTLLDYLPADGLLIIDE
FT                   SHVTVPQIGAMYKGDRSRKTTLVEYGFRLPSALDNRPLKFEEFEQLMPQTIYVSATPSV
FT                   YELEKSEGEIAEQVVRPTGLLDPELEVRPVGTQVDDLLSEIAKRVAVNERVLVTTLTKR
FT                   MSEDLTEYLDEHGVKVRYLHSDIDTVERVEIIRDLRLGKFDVLVGINLLREGLDMPEVS
FT                   LVCILDADKEGFLRSERSLIQTIGRAARNVNGKVILYADRITNSMAKAIGETDRRRERQ
FT                   RAHNLKHGITPKGVVKRITDVMDVDDGRDSKAVYGKVAEPKSHYHKADATELSHQIDQL
FT                   EKKMHEHARNLEFEQAAAMRDEVKHLRDLLIKA"
FT                   /protein_id="YP_001041661.1"
FT   misc_feature    complement(69250..71241)
FT                   /note="excinuclease ABC subunit B; Provisional; Region:
FT                   PRK05298"
FT                   /db_xref="CDD:167966"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(<70942..71130)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(71101..71115)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(69580..69948)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(order(69724..69732,69805..69810,69868..69879))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(order(69607..69609,69616..69618,69628..69630,
FT                   69706..69708))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(69454..69585)
FT                   /note="Ultra-violet resistance protein B; Region: UvrB;
FT                   pfam12344"
FT                   /db_xref="CDD:152779"
FT                   /locus_tag="Sbal_4543"
FT   misc_feature    complement(69250..69351)
FT                   /note="UvrB/uvrC motif; Region: UVR; pfam02151"
FT                   /db_xref="CDD:145355"
FT                   /locus_tag="Sbal_4543"
FT   gene            72729..72804
FT                   /db_xref="GeneID:5075350"
FT                   /locus_tag="Sbal_t07"
FT   tRNA            72729..72804
FT                   /note="codon recognized: AAC"
FT                   /db_xref="GeneID:5075350"
FT                   /locus_tag="Sbal_t07"
FT                   /product="tRNA-Asn"
FT   gene            72864..72939
FT                   /db_xref="GeneID:5075357"
FT                   /locus_tag="Sbal_t08"
FT   tRNA            72864..72939
FT                   /note="codon recognized: AAC"
FT                   /db_xref="GeneID:5075357"
FT                   /locus_tag="Sbal_t08"
FT                   /product="tRNA-Asn"
FT   gene            72972..73047
FT                   /db_xref="GeneID:5075352"
FT                   /locus_tag="Sbal_t09"
FT   tRNA            72972..73047
FT                   /note="codon recognized: AAC"
FT                   /db_xref="GeneID:5075352"
FT                   /locus_tag="Sbal_t09"
FT                   /product="tRNA-Asn"
FT   gene            73091..73166
FT                   /db_xref="GeneID:5075351"
FT                   /locus_tag="Sbal_t10"
FT   tRNA            73091..73166
FT                   /note="codon recognized: AAC"
FT                   /db_xref="GeneID:5075351"
FT                   /locus_tag="Sbal_t10"
FT                   /product="tRNA-Asn"
FT   gene            73376..75280
FT                   /db_xref="GeneID:4841186"
FT                   /locus_tag="Sbal_4544"
FT   CDS_pept        73376..75280
FT                   /locus_tag="Sbal_4544"
FT                   /gene_family="HOG000292244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090181"
FT                   /db_xref="GeneID:4841186"
FT                   /translation="MTMSKSYPVFLLIIFLGLFAWVYQSENSQLQVQQQQELDSFKSSL
FT                   SRYQQWQGNGVELFKKLSENYSFQFFQYIDDTDGQLSHTEGSLDSQHPHPLASLFSIEL
FT                   SHTQKLAAGRLQVKLSANQAIDTAISNTQKLGAMLLVTYLILLLVFILLMSKHRAAVRY
FT                   AADYISKIPELGFSAVASSKLTGELTPIGISLEECRLQLKAQIDKLNQENEKLHKAAYQ
FT                   DAVTGFGSRQRFTQKLETISHPDVPQLGLMAMVKATELTLINQKQGRSAGDDYLSSVAN
FT                   CIRKACSQYADAECFRVSSADFAVFIPDVMLKDAPKFLDQLKIYLDEYQQMTSAESVAH
FT                   IGLVPYRQGTEAVNLLTIADTAVSIAQTLGPNSYHIQEKLNGDEQFGDDRWKMAIHDLV
FT                   TRQALKFYQQPIQPCRTDVEVYRELLARFYNSEGKFLPTTTVIAMAERHGMSSELDKLV
FT                   VISALKILKENPTITGNFGINISAFSAHQDMFVAWLKDILGKQKYIASRLVFEINESGM
FT                   QSNLGASYKFVREVHSVGSRVSIERFGMSFTSFKFFSEVRPDFIKLDGSYTSNIDEDSN
FT                   NKFFVRMMVDVARRIGIRVIATSVERQEEKLTLEKLLVDGLQGYYIAQPQAMAITDQI"
FT                   /protein_id="YP_001041662.1"
FT   misc_feature    74036..74500
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4544"
FT   misc_feature    order(74141..74143,74165..74170,74180..74182,74192..74194,
FT                   74264..74266,74270..74281)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4544"
FT   misc_feature    order(74252..74254,74336..74338)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4544"
FT   misc_feature    74276..74278
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Sbal_4544"
FT   misc_feature    74552..75253
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Sbal_4544"
FT   gene            75406..75984
FT                   /db_xref="GeneID:4841197"
FT                   /locus_tag="Sbal_4545"
FT   CDS_pept        75406..75984
FT                   /locus_tag="Sbal_4545"
FT                   /gene_family="HOG000279324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit E"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090182"
FT                   /db_xref="GeneID:4841197"
FT                   /translation="MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMAT
FT                   TFVLTLASILSYLVNQYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALG
FT                   IYLPLITTNCAVLGVALLNVNEKHDFIQSAIYGFGAALGFSLVLILFSAMRERLAAADV
FT                   PLPFKGGAIAMITAGLMSLAFMGFTGLVK"
FT                   /protein_id="YP_001041663.1"
FT   misc_feature    75406..75981
FT                   /note="Rnf-Nqr subunit, membrane protein; Region: Rnf-Nqr;
FT                   cl00597"
FT                   /db_xref="CDD:174301"
FT                   /locus_tag="Sbal_4545"
FT   gene            75986..76585
FT                   /db_xref="GeneID:4841185"
FT                   /locus_tag="Sbal_4546"
FT   CDS_pept        75986..76585
FT                   /locus_tag="Sbal_4546"
FT                   /gene_family="HOG000262938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron transport complex protein RnfB"
FT                   /transl_table="11"
FT                   /note="part of membrane-bound complex thought to be
FT                   involved in electron transport to nitrogen"
FT                   /db_xref="GI:126090183"
FT                   /db_xref="GeneID:4841185"
FT                   /translation="MSGILIAVILLTLLALVFGVLLGFAALKFKVEGNPIVDELEAILP
FT                   QTQCGQCGYPGCRPYAEAIASGDNVNKCPPGGTATMEKLATLMGVEPEPLNAEAQSQVK
FT                   KVAYIREDECIGCTKCIQACPVDAIIGAGKLMHTVLTTDCTGCDLCVEPCPVDCIDMIP
FT                   VTPNLKNWNWRLNAIPVTLIQENSIQETKSEEEKRC"
FT                   /protein_id="YP_001041664.1"
FT   misc_feature    76088..76477
FT                   /note="ferredoxin; Provisional; Region: PRK08764"
FT                   /db_xref="CDD:136963"
FT                   /locus_tag="Sbal_4546"
FT   misc_feature    76112..76213
FT                   /note="Putative Fe-S cluster; Region: FeS; pfam04060"
FT                   /db_xref="CDD:112857"
FT                   /locus_tag="Sbal_4546"
FT   misc_feature    <76319..76477
FT                   /note="RPB11 and RPB3 subunits of RNA polymerase; Region:
FT                   RNAP_RPB11_RPB3; cl11409"
FT                   /db_xref="CDD:175243"
FT                   /locus_tag="Sbal_4546"
FT   gene            76579..79233
FT                   /db_xref="GeneID:4841184"
FT                   /locus_tag="Sbal_4547"
FT   CDS_pept        76579..79233
FT                   /locus_tag="Sbal_4547"
FT                   /gene_family="HOG000279299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron transport complex protein RnfC"
FT                   /transl_table="11"
FT                   /note="part of membrane-bound complex thought to be
FT                   involved in electron transport to nitrogen"
FT                   /db_xref="GI:126090184"
FT                   /db_xref="GeneID:4841184"
FT                   /translation="MLTLLDQLDKGTLWRSPGGIHPPEVKFLSNATPIGQLPLASMYLV
FT                   PVPQVGENCTLAVKVGDSVLKGMPLTQGTSIWHLPVHAPTSGTIVAIEPRASNHASALP
FT                   VNTCVIAADGKDTWCELVQNQLDDLSHQQIVDKVRSAGIAGMGGAAFPTHIKLNPVSEI
FT                   DLVIINGVECEPYISADDRLMREYSQDILAGIGIIHRLLTPKRIVIAIEDNKPEAAKAM
FT                   QTAVSQCGLPAGSIRVTVIPTKYPSGGEKQLIQIITGREVPSGAIPAKLGIVVHNVGTA
FT                   YAIHQAVTQGKPLVERVVTVTGKNVSKPGNYWLPIGTPVDHVLTATEFTPEPDQKVIIG
FT                   GPMMGHALANIQVPILKGTNCILVPSSQEIGNTPEEKACIRCGECATACPALLLPQQLF
FT                   WHAKAEEYDKAASYNLKDCIECGCCSYVCPSDIPLVEYYRIAKSALKQAADEKQQAERA
FT                   KQRFDARLARLEEEKLAREAKAKEASERRQASMTGTDKNAVAEAMARIAAKKAAAAQAV
FT                   TGESITEESSVTTTDTTEVPKGKAAVAAAIARAKAKKAAQANADGTDTNGAETDRAKTD
FT                   NAVNVDANDSISATDAIAQEAPLSQKDKVAAAIARAKAKKAAQQTDTAPLEPTETADST
FT                   SELSAADDKKAKVAAAVARAKAKAKKAAQQAETAASDIEVSNTEVSVSDINDAEAIKKA
FT                   KVAAAVARAKAKKAAQQAETNAENVLNQTTTPAVDSAANVHADVNADAETAVNAAATDI
FT                   EVSNADVSVNDAEAIKKAKVAAAVARAKAKKIAAASAESKTESEIESVDEIQTEANVAS
FT                   PSIAAELETVTTEPEAVLPSVGSTAEPIETAPLSSDELKKARIAATIAKAKAKKAALAK
FT                   EANASSDSSVTND"
FT                   /protein_id="YP_001041665.1"
FT   misc_feature    76615..77919
FT                   /note="C subunit; Region: rnfC; TIGR01945"
FT                   /db_xref="CDD:162617"
FT                   /locus_tag="Sbal_4547"
FT   misc_feature    76990..77436
FT                   /note="Respiratory-chain NADH dehydrogenase 51 Kd subunit;
FT                   Region: Complex1_51K; pfam01512"
FT                   /db_xref="CDD:144926"
FT                   /locus_tag="Sbal_4547"
FT   misc_feature    77470..77613
FT                   /note="endonuclease III; includes endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
FT                   glycosidases (Alka-family) and other DNA glycosidases;
FT                   Region: ENDO3c; cl11430"
FT                   /db_xref="CDD:175252"
FT                   /locus_tag="Sbal_4547"
FT   misc_feature    <77707..>77934
FT                   /note="The HCP family of iron-sulfur proteins includes
FT                   hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
FT                   and carbon monoxide dehydrogenase (CODH), all of which
FT                   contain [Fe4-S4] metal clusters at their active sites.
FT                   These proteins have a conserved alpha-; Region: HCP_like;
FT                   cl00255"
FT                   /db_xref="CDD:174071"
FT                   /locus_tag="Sbal_4547"
FT   gene            79260..80309
FT                   /db_xref="GeneID:4841178"
FT                   /locus_tag="Sbal_4548"