(data stored in SCRATCH zone)

HOGENOMDNA: SHEB5_2

ID   SHEB5_2; SV 1; empty ; DNA; empty ; PRO; 74000 BP.
XX
AC   NC_009036;
XX
PR   Project: 58259;
XX
DE   Shewanella baltica OS155 plasmid pSbal02, complete sequence.
XX
OS   Shewanella baltica OS155
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-74000
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Sims,D.R.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Brettar,I.,
RA   Klappenbach,J., Konstantinidis,K., Rodrigues,J., Tiedje,J. and
RA   Richardson,P.;
RT   "Complete sequence of plasmid pSbal02 of Shewanella baltica OS155";
RL   Unpublished
XX
RN   [2]
RP   1-74000
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-FEB-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-74000
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Sims,D.R.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Brettar,I.,
RA   Klappenbach,J., Konstantinidis,K., Rodrigues,J., Tiedje,J. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (12-FEB-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000565.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634605
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..74000
FT                   /strain="OS155"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella baltica OS155"
FT                   /plasmid="pSbal02"
FT                   /db_xref="taxon:325240"
FT   gene            10..3195
FT                   /db_xref="GeneID:4841315"
FT                   /locus_tag="Sbal_4384"
FT   CDS_pept        10..3195
FT                   /locus_tag="Sbal_4384"
FT                   /gene_family="HOG000002425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HsdR family type I site-specific
FT                   deoxyribonuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: shn:Shewana3_4164 type I site-specific
FT                   deoxyribonuclease, HsdR family; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM: type
FT                   III restriction enzyme, res subunit; protein of unknown
FT                   function DUF450; SMART: DEAD-like helicases-like"
FT                   /db_xref="GI:126090237"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="REBASE:SbaOSORF4458P"
FT                   /db_xref="GeneID:4841315"
FT                   /translation="MNTFKKEADFEQAFVEALTNKGWESAVLKNKTEADLLQNWANILF
FT                   ENNRQRDRLNDVALTASEMQQIIEQIKELRTPLKLNGLINGKTVAIKRDNPDDKEHFGK
FT                   EVSLKIYDRQEIAAGQSRYQIAQQPLFERGSPLRNDRRGDVLLLINGMPVIHVELKRSG
FT                   IPVSQAVNQIEKYTKEGIFTGLFSLIQVFVAMQPDETKYFANPGMEGKFNPDYQFNWAD
FT                   FNNEPVNHWKDITATLLSIPMAHQLIGFYTVADDTDGVLKVMRSYQYYAANAISDKVAK
FT                   TNWQQMGSNANNTDRLGGYVWHTTGSGKTMTSFKSAQLIAQSKDADKVIFLMDRIELGT
FT                   QSLTEYRGFAGDGEDVQATENTHILITKLKSSTPSETLIVSSIQKMSNIFEEVDDTGTA
FT                   TNSADIEKIRAKRLVFIIDEAHRSTFGDMLIAIKATFPRALFFGFTGTPIQEENEKKGN
FT                   TTTTVFGNELHRYSIADGIRDGNVLGFDPYRVSTFKDKDIRQAVALEQAKADSVADALS
FT                   TPAKKKKFNYFMNDVAMAGHKNATGKHIKGIEDHVPKSQYLTDEHQKQVVKDILDNWEV
FT                   LSQANKFHAILATNSISEAIDYYRRLKDAMPTLKVSALFDPNIDNDGTGNRGPSFKGDG
FT                   LDEIMTDYNVRYGQDFDFAKHAKFKKDLAARLAHKKPYERIHTEPAKQLDLLIVVDQML
FT                   TGFDSKWLNTLYLDKVIKYQNIIQAFSRTNRLFGPDKPHGTIRYYRYPHTMEQHIKDAV
FT                   KLYSGDKPIGLFVDRLESNLKAMNELVADITELFVNAGVQYFDKLPEDTAACAKFADLF
FT                   KLLNQHLEAAKIQGFNWNELVYSFEENETKHDVTLAIDQQIFLSLVLRYKELVTKVPSD
FT                   GGGDTPPYDISGNITEMDTGKINADYMNSRFDKYLKELNQHQDHTTIEGTLNELHSSFS
FT                   SLTQSEQKYAKLFLNDLQRGDALLTDGHNFRDYINDYKNRAENTQLNIVVNALGLDVSL
FT                   LTRLMNDNVNEKNINNFGRFDALKNTVDKTKAKAYFEKVEGMVISPFKLNIRIDQFLQT
FT                   YIVGRADALLSDD"
FT                   /protein_id="YP_001041692.1"
FT   misc_feature    19..3159
FT                   /note="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases
FT                   [Defense mechanisms]; Region: COG0610"
FT                   /db_xref="CDD:30955"
FT                   /locus_tag="Sbal_4384"
FT   misc_feature    364..627
FT                   /note="Type I restriction enzyme R protein N terminus
FT                   (HSDR_N); Region: HSDR_N; cl01057"
FT                   /db_xref="CDD:154173"
FT                   /locus_tag="Sbal_4384"
FT   misc_feature    910..1353
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal_4384"
FT   misc_feature    925..939
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal_4384"
FT   misc_feature    1261..1272
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Sbal_4384"
FT   misc_feature    2296..3039
FT                   /note="Type I restriction and modification enzyme - subunit
FT                   R C terminal; Region: EcoR124_C; pfam12008"
FT                   /db_xref="CDD:152443"
FT                   /locus_tag="Sbal_4384"
FT   gene            complement(3498..3842)
FT                   /db_xref="GeneID:4841299"
FT                   /locus_tag="Sbal_4385"
FT   CDS_pept        complement(3498..3842)
FT                   /locus_tag="Sbal_4385"
FT                   /gene_family="HOG000221926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn5 dimerisation subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn5, dimerisation domain protein;
FT                   KEGG: vvy:VV0556 putative Tn5 transposase"
FT                   /db_xref="GI:126090238"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="GeneID:4841299"
FT                   /translation="MLQLREAITIPYYLRKKGLVEEAKAVEGQSCDTVLEEDEWKVLMR
FT                   FNKPRGDKGNGAPSLKWAYQSIAKLGGFTDTKRTGIASWTAVWEGWSTLQSHVVGYRVA
FT                   KEMIADGESL"
FT                   /protein_id="YP_001041693.1"
FT   misc_feature    complement(3501..3827)
FT                   /note="Transposase Tn5 dimerization domain; Region:
FT                   Transposase_Tn5; pfam02281"
FT                   /db_xref="CDD:145436"
FT                   /locus_tag="Sbal_4385"
FT   gene            complement(3891..4208)
FT                   /db_xref="GeneID:4841312"
FT                   /locus_tag="Sbal_4386"
FT   CDS_pept        complement(3891..4208)
FT                   /locus_tag="Sbal_4386"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: plu:plu3294 regulatory protein recX (oraA
FT                   protein)"
FT                   /db_xref="GI:126090239"
FT                   /db_xref="GeneID:4841312"
FT                   /translation="MNAQELYDHAVSLLAKRDYSSGELSRTLLRMTENSECVDSALQRL
FT                   IVSGYLDDERLVIHLVDKHIRKKHGPTRIRQEVRQKGFWLYASLRGITNFCKLQWLSTM
FT                   T"
FT                   /protein_id="YP_001041694.1"
FT   misc_feature    complement(<3963..4187)
FT                   /note="RecX family; Region: RecX; cl00936"
FT                   /db_xref="CDD:174469"
FT                   /locus_tag="Sbal_4386"
FT   gene            complement(4205..5590)
FT                   /db_xref="GeneID:4841328"
FT                   /locus_tag="Sbal_4387"
FT   CDS_pept        complement(4205..5590)
FT                   /locus_tag="Sbal_4387"
FT                   /gene_family="HOG000245276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: plu:plu3295 hypothetical protein"
FT                   /db_xref="GI:126090240"
FT                   /db_xref="GeneID:4841328"
FT                   /translation="MVKLTKKQTEQLSGMSHEALLTALHDLIQDNKQAKDALINGYLSS
FT                   TSDRLKAIEKEYARRAKSKRFYDYYDADSLFDELTRSIAKPLEKLANTLPEQVEGLAVK
FT                   IMLEFEDFTGNVDTSSGSWMDYYQVLFDAWMKSLAAQKKSEPVFIAKKIFTVIEREFYF
FT                   SFEIFQHYRQLLGTDILRAVRDMYYQKKHIQESLGISVIIKDINFIKTTYKKGEFSHPD
FT                   HYFDYARLLLEEVRADEAIELLSGMDKRYTNNSKWNELFVSALLEDGRKEEAKEHAIKA
FT                   FAFFYTVSLYQLYKKASGNDGDNIQAFLDIAKNKGLIVYIRFAIEVERFDLIDDCVTST
FT                   PKEQLVNAFESMSGSSVRTLSSELYKYGYALSATLLRRFLVEENILQSKSKYYSYAASD
FT                   MKKAIDYSEGLEESLLLPGTQRYLRTLFETHKRKVSLWPLMVAKIAGLSIQSGVIYYNG
FT                   SQE"
FT                   /protein_id="YP_001041695.1"
FT   gene            complement(5862..6011)
FT                   /db_xref="GeneID:4841295"
FT                   /locus_tag="Sbal_4388"
FT                   /pseudo
FT   gene            complement(6244..6633)
FT                   /db_xref="GeneID:4841321"
FT                   /locus_tag="Sbal_4389"
FT   CDS_pept        complement(6244..6633)
FT                   /locus_tag="Sbal_4389"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090241"
FT                   /db_xref="GeneID:4841321"
FT                   /translation="MSNTDKRIKRAKNKAKQARLKKQKTQERSNQEQVVCVPPDVAEMF
FT                   QTLPSVSSEYEAVPYLKKHVLSGAVLPHDVEMSVAILYVMYGNWRVLDSDAMYLSDLLM
FT                   VAEQITEHPKFIEQFYQENGLLAQA"
FT                   /protein_id="YP_001041696.1"
FT   gene            complement(6626..6892)
FT                   /db_xref="GeneID:4841337"
FT                   /locus_tag="Sbal_4390"
FT   CDS_pept        complement(6626..6892)
FT                   /locus_tag="Sbal_4390"
FT                   /gene_family="HOG000219995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="addiction module antitoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: bhe:BH07080
FT                   hypothetical genomic island protein"
FT                   /db_xref="GI:126090242"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR012753"
FT                   /db_xref="GeneID:4841337"
FT                   /translation="MAWTIDYSERALKSLKKMDKQNAKRILDFLEQRIAILDDPRTSGK
FT                   PLKGDLGIFWRYRVGDYRVLCEIQDSKLVILTALIGHRKEIYE"
FT                   /protein_id="YP_001041697.1"
FT   misc_feature    complement(6632..6892)
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Sbal_4390"
FT   gene            complement(6876..7100)
FT                   /db_xref="GeneID:4841317"
FT                   /locus_tag="Sbal_4391"
FT   CDS_pept        complement(6876..7100)
FT                   /locus_tag="Sbal_4391"
FT                   /gene_family="HOG000151636" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix protein, CopG"
FT                   /transl_table="11"
FT                   /note="KEGG: rru:Rru_A3195 helix-turn-helix protein, CopG"
FT                   /db_xref="GI:126090243"
FT                   /db_xref="GeneID:4841317"
FT                   /translation="MLAIRLPDDIETRLAALADQTGRTKTFYAREAILTHLEDLEDYYL
FT                   AAQIVSDIRKGAEKTYSSEDVRASLGLDN"
FT                   /protein_id="YP_001041698.1"
FT   misc_feature    complement(6879..7094)
FT                   /note="Predicted DNA-binding protein with an HTH domain
FT                   [General function prediction only]; Region: COG4710"
FT                   /db_xref="CDD:34326"
FT                   /locus_tag="Sbal_4391"
FT   gene            7178..7405
FT                   /db_xref="GeneID:4841314"
FT                   /locus_tag="Sbal_4392"
FT                   /pseudo
FT   gene            complement(7813..8265)
FT                   /db_xref="GeneID:4841326"
FT                   /locus_tag="Sbal_4393"
FT   CDS_pept        complement(7813..8265)
FT                   /locus_tag="Sbal_4393"
FT                   /gene_family="HOG000245277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090244"
FT                   /db_xref="GeneID:4841326"
FT                   /translation="MLKKVPRWLQAVLKAATYLNMLHVLLQREGHSSIGFYAFISKITF
FT                   PMSENIPSIEGERLEAMLALQRMYTSVHRCDGCHCETPKRYCVSGKCVTCQATGVINTT
FT                   DRHNYRNPGYHDLKAFNEAKGVNLILQVFNRLQRLRNLKGKHQLNE"
FT                   /protein_id="YP_001041699.1"
FT   gene            complement(8335..8961)
FT                   /db_xref="GeneID:4841302"
FT                   /locus_tag="Sbal_4394"
FT   CDS_pept        complement(8335..8961)
FT                   /locus_tag="Sbal_4394"
FT                   /gene_family="HOG000245278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psp:PSPPH_A0040 hypothetical protein"
FT                   /db_xref="GI:126090245"
FT                   /db_xref="GeneID:4841302"
FT                   /translation="MAQKKLALPPGVSVIRQGKAYVIFRDGHEAIGGVIVSETTQGNTQ
FT                   LQPYMNVDASDNKAVIAFVAQQMTDALLQHQAQKPLNEQLPIFTENVPDNVQVIENKSF
FT                   PCSRCNSIIAKLIFVPEAATASALLAMAQKLELDAFVSPYPVWLIGAPDSQNDDIAQHL
FT                   TLQIAPVKGEVYWQHPDHMNQRLIELDIEHRCTHHHGVNLKKDLH"
FT                   /protein_id="YP_001041700.1"
FT   gene            complement(9513..9881)
FT                   /db_xref="GeneID:4841301"
FT                   /locus_tag="Sbal_4395"
FT   CDS_pept        complement(9513..9881)
FT                   /locus_tag="Sbal_4395"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090246"
FT                   /db_xref="GeneID:4841301"
FT                   /translation="MYKLYWNQHQHLPKAFRFTTGEQILNELTKCIRYSVQANLYGKSP
FT                   EGILRALDLLLELSALLETVQSLLMLAWELKFLPHGALVTLTEQLGHVSRQATGWRKWF
FT                   QGKALEVNLPVSSPSGCA"
FT                   /protein_id="YP_001041701.1"
FT   gene            9909..11213
FT                   /db_xref="GeneID:4841293"
FT                   /locus_tag="Sbal_4396"
FT   CDS_pept        9909..11213
FT                   /locus_tag="Sbal_4396"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cph:Cpha266_0459 conserved hypothetical
FT                   protein"
FT                   /db_xref="GI:126090247"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="GeneID:4841293"
FT                   /translation="MTKLFIQNSNLKYHHQLAAELLQCVKASGSSQQKSANALKFPKLC
FT                   HELSTEILTNTYQPYSYHHFAITEPKLREIYAPAFRDRIAQMWIALQMAPIMENQFIDD
FT                   TYANRKGKGTLAAIAKVQKLMRQPRHTWGLQLDIYSYFNSINKKELLTQLYNLIYNSNL
FT                   SALRQYCLANLIEKIIEQDATKLQNERTGDQYLLNQIPLHKKLQFNNTQQVGLPIGSVT
FT                   SQLFGNFYLNNLDHEIKHTLKVKGYVRYMDDLFILSDSPEKLQQWKEHIEWYLTSHLQL
FT                   KLHPTKVHLAPIEEGFDYLGFRVFPHYKHIRKTTISSLKERLRYFNSILDSGATSVFLK
FT                   SRPSRGRWSKNGIHYAPFYTQLKAMQSTINSYYGLLSQANHCQLRKQIYHKNFGELKRY
FT                   LLPNNGYYNHFTIKKGLHFNKMAPDTLCWPETQDA"
FT                   /protein_id="YP_001041702.1"
FT   misc_feature    10314..10853
FT                   /note="RT_Bac_retron_I: Reverse transcriptases (RTs) in
FT                   bacterial retrotransposons or retrons. The polymerase
FT                   reaction of this enzyme leads to the production of a unique
FT                   RNA-DNA complex called msDNA (multicopy single-stranded
FT                   (ss)DNA) in which a small ssDNA...; Region:
FT                   RT_Bac_retron_I; cd01646"
FT                   /db_xref="CDD:73153"
FT                   /locus_tag="Sbal_4396"
FT   misc_feature    order(10317..10334,10560..10565,10656..10658,10662..10667,
FT                   10806..10811)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73153"
FT                   /locus_tag="Sbal_4396"
FT   misc_feature    order(10317..10334,10560..10562,10662..10664)
FT                   /note="putative NTP binding site; other site"
FT                   /db_xref="CDD:73153"
FT                   /locus_tag="Sbal_4396"
FT   misc_feature    10563..10565
FT                   /note="putative nucleic acid binding site; other site"
FT                   /db_xref="CDD:73153"
FT                   /locus_tag="Sbal_4396"
FT   gene            complement(11514..12041)
FT                   /db_xref="GeneID:4841331"
FT                   /locus_tag="Sbal_4397"
FT   CDS_pept        complement(11514..12041)
FT                   /locus_tag="Sbal_4397"
FT                   /gene_family="HOG000245279" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090248"
FT                   /db_xref="GeneID:4841331"
FT                   /translation="MKCQSYIWHFLEGREANIEAKLALVENSQRIVGIKEGIFVRFYEQ
FT                   SLFGWQQWASKQDQLPTLKVLKKKVKKLNGREVLYGGLPIESLKQAGIDVGTEAVIALE
FT                   TIIDFSGWESWRQEQCAQMDDTEEKTSCNEELLNRRYVRLFLPEAIVNKVMTTKASSSS
FT                   LDWLLIAVKQAI"
FT                   /protein_id="YP_001041703.1"
FT   gene            complement(12086..16036)
FT                   /db_xref="GeneID:4841307"
FT                   /locus_tag="Sbal_4398"
FT   CDS_pept        complement(12086..16036)
FT                   /locus_tag="Sbal_4398"
FT                   /gene_family="HOG000245280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ig domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Ig domain protein, group 2 domain protein;
FT                   KEGG: lil:LA3075 surface protein Lk90-like protein"
FT                   /db_xref="GI:126090249"
FT                   /db_xref="InterPro:IPR000437"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="GeneID:4841307"
FT                   /translation="MTKVFKYFVSIIVLPLLMLLTGCDSGGDFTAKLERIDISASPLTT
FT                   LGVSQLTLAAGNKQAFEAVGYYSDGSSHALTDLSVSDWHTSDQDVGYFNDPGVLIGGDT
FT                   PGIVTVYASKDGITSNVVSVTVTDAVITAIQVTPSPVVVPKGEYQALQAIATYSDGSSA
FT                   NVTRVVTWTPTDTAVAVVTDGVLRGVGVGDTELTASRGDITSDTVAVTVTDAVITAIQV
FT                   TPSPVVVPKGEYQALQAIATYSDGSSANVTSVVTWTPTDTAVAVVTDGVLRGVGVGDTE
FT                   LTASRGDITSDTVAVTVTDAVITAIQVTPSPVVVPKGEYQALQAIATYSDGSSANVTRV
FT                   VTWTSADTAVAVVTPDGFLSGVEVGSTTVTATKDGITSNVVAVTVTDAVITAIQVTPSP
FT                   VVVPKGEYQALQAIATYSDGSSANVTRVVTWTSADTAVAVVTPDGFLSGVEVGSTTVTA
FT                   TKDGITSNVVAVTVTDAVITAIQVTPLPVVVPKGEYQALQAIATYSDGSSANVTSVVTW
FT                   TSADTAVAVVTPDGFLSGVEVGSTTVTATKDGITSNVVAVTVTDAVITAIQVTPATVNV
FT                   AKGQTAQLVATATYSDTTSSDVTSSVAWTVGATATATVSPAGLLSGVEVGSTTVTATKD
FT                   GITSNVVAVTVTDAVITAIQVTPSPVVVPKGEYQALQAIATYSDGSSANVTSVVTWTPT
FT                   DTAVAVVTPDGFLSGVEVGSTTVTATKDGITSNVVAVTVTDAVITAIQVTPSPVVVPKG
FT                   EYQALQAIATYSDGSSANVTRVVTWTSADTAVAVVTPDGFLSGVEVGSTTVTATKDGIT
FT                   SNVVAVTVTDAVITAIQVTPLPVVVPKGEYQALQAIATYSDGSSANVTRVVTWTSADTA
FT                   VAVVTPDGFLSGVEVGSTTVTATKDGITSNVVAVTVTDAVITAIQVTPATVNVAKGQTA
FT                   QLVATATYSDTTSSDVTSSVAWTVGATATATVSPAGLLSGVEVGSTTVTATKDGITSNV
FT                   VAVTVTDAVITAIQVTPSPVVVPKGEYQALQAIATYSDGSSANVTSVVTWTPTDTAVAV
FT                   VTPDGFLSGVEVGSTTVTATKDGITSNVVAVTVTADAVITAIQVTPSPVVVPKGEYQAL
FT                   QAIATYSDGSSANVTRVVTWTSADTAVAVVTPDGFLSGVEVGSTTVTATKDVITSNTVN
FT                   VTVCSSLAGACIDIFDTGGGKLFTSSPSVAYLDSIDGSATNNTNTENGTYGPAGNFYLF
FT                   DWTNAKTLCNTYNTLHLGERTNWRLATKDELKKELFGTYNNMFSARGWPANTYYWSVTP
FT                   DGSGYYGVDLSNGYVSSNGPGDTYYASCVSNP"
FT                   /protein_id="YP_001041704.1"
FT   sig_peptide     complement(15956..16036)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.774) with cleavage site probability 0.691 at
FT                   residue 27"
FT                   /locus_tag="Sbal_4398"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(12098..>12292)
FT                   /note="Salmonella repeat of unknown function (DUF823);
FT                   Region: DUF823; pfam05689"
FT                   /db_xref="CDD:147700"
FT                   /locus_tag="Sbal_4398"
FT   gene            complement(16033..17034)
FT                   /db_xref="GeneID:4841323"
FT                   /locus_tag="Sbal_4399"
FT   CDS_pept        complement(16033..17034)
FT                   /locus_tag="Sbal_4399"
FT                   /gene_family="HOG000245281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="OmpA/MotB domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; OmpA/MotB domain protein; KEGG:
FT                   vpa:VP0764 outer membrane protein OmpA"
FT                   /db_xref="GI:126090250"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR001035"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="GeneID:4841323"
FT                   /translation="MKKYLLPVYILLAPAWASTESPLFFIEAKGGYQWASDDSYKHSNP
FT                   KGAIFGVSSGLQFSPAWSWDVGYQYHDDLKADATSVNVKAGLIESALRYDWYLQDNLSV
FT                   YGRLGVAYWDMEKTHLSSDKLDATGLSPLGEVGVNYNFTPNVRLSAGYQYIDSIGESNT
FT                   GKYDSHGFLVGLTYAFGHAAQPTLIKELSTPATKTVIVETSPQTLTFSSKSMNVIWGFD
FT                   ATKLSHDFIEQLAEVVEVLNTYPQARVAVLAVGHADSIGSEAYNQALSEKRAQTVANKL
FT                   LELGVSPAQIEVQGEGESHPVANNQTADGRAKNRRVEVSIPSFQYQKQAVLS"
FT                   /protein_id="YP_001041705.1"
FT   sig_peptide     complement(16981..17034)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.888 at
FT                   residue 18"
FT                   /locus_tag="Sbal_4399"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(16495..16965)
FT                   /note="Surface antigen; Region: Surface_Ag_2; cl01155"
FT                   /db_xref="CDD:174558"
FT                   /locus_tag="Sbal_4399"
FT   misc_feature    complement(16072..16653)
FT                   /note="Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)proteins [Cell envelope
FT                   biogenesis, outer membrane]; Region: OmpA; COG2885"
FT                   /db_xref="CDD:32711"
FT                   /locus_tag="Sbal_4399"
FT   misc_feature    complement(16072..16374)
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Sbal_4399"
FT   misc_feature    complement(order(16090..16092,16102..16104,16228..16230,
FT                   16237..16242,16252..16254,16261..16266,16369..16374))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Sbal_4399"
FT   gene            17176..18123
FT                   /db_xref="GeneID:4841306"
FT                   /locus_tag="Sbal_4400"
FT   CDS_pept        17176..18123
FT                   /locus_tag="Sbal_4400"
FT                   /gene_family="HOG000114768" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sdn:Sden_2262 integrase, catalytic region"
FT                   /db_xref="GI:126090251"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="GeneID:4841306"
FT                   /translation="MNYQQLTEGQRYQIALLYKENCSCREIGQRIGVSKSTISRELRRN
FT                   GTTAGYVAQSAQRQCEHRRVVAAKRAVSQSTIEFVEFALEWKWSPEQISAVAKLIGLSV
FT                   SHEWIYQYVFADKSRGGVLYEHLRQGKRRYRKGYGQKRGGITDAVSIALRPAIVDERGR
FT                   LGDWEADLVLGKQGTGAIVTLAERKSRIYLTKKVFSKDAVEVSKAIISMLSDYKDACHT
FT                   ITFDNGREFSEHKAIAKALEADMYFAHPYSSQERGLNENTNGLLRQFIPKGTDLRTVSE
FT                   EDLQRYQGALNSRPRKCLGFRQPSVVFAELRKAA"
FT                   /protein_id="YP_001041706.1"
FT   misc_feature    17176..18108
FT                   /note="Transposase and inactivated derivatives, IS30 family
FT                   [DNA replication, recombination, and repair]; Region: Tra8;
FT                   COG2826"
FT                   /db_xref="CDD:32654"
FT                   /locus_tag="Sbal_4400"
FT   misc_feature    17665..17985
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal_4400"
FT   gene            18231..18366
FT                   /db_xref="GeneID:4841305"
FT                   /locus_tag="Sbal_4401"
FT                   /pseudo
FT   gene            18805..19446
FT                   /db_xref="GeneID:4841310"
FT                   /locus_tag="Sbal_4402"
FT   CDS_pept        18805..19446
FT                   /locus_tag="Sbal_4402"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase, N-terminal domain; KEGG:
FT                   ppr:PBPRC0052 putative site-specific recombinase"
FT                   /db_xref="GI:126090252"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="GeneID:4841310"
FT                   /translation="MFIRAYLRASTEDQFADRAKEMLEQFVQERGHKIASYYRENISGT
FT                   KLDRPELGRLLMDSHRNDILLVEQIDRLTRLSESDWMTLKKQIEQHELRIVSLDVPTSW
FT                   QALSDKDPSQADPITRAVITAINNMLIDLMAAMSHKDWLSRRQRQKQGIERAHTLGKYR
FT                   GKQADHERHQKVIYYRQVKKLSIRETADATGYSASQVCRIQVLYKDSVSD"
FT                   /protein_id="YP_001041707.1"
FT   misc_feature    18811..19260
FT                   /note="Serine recombinase (SR) family, Partitioning
FT                   (par)-Resolvase subfamily, catalytic domain; Serine
FT                   recombinases catalyze site-specific recombination of DNA
FT                   molecules by a concerted, four-strand cleavage and
FT                   rejoining mechanism which involves a transient...; Region:
FT                   SR_Res_par; cd03767"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal_4402"
FT   misc_feature    order(18826..18828,18832..18834,19015..19020,19027..19029)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal_4402"
FT   misc_feature    18832..18834
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal_4402"
FT   gene            complement(19498..20148)
FT                   /db_xref="GeneID:4841277"
FT                   /locus_tag="Sbal_4403"
FT   CDS_pept        complement(19498..20148)
FT                   /locus_tag="Sbal_4403"
FT                   /gene_family="HOG000245282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   rru:Rru_A0597 protein of unknown function DUF1526"
FT                   /db_xref="GI:126090253"
FT                   /db_xref="InterPro:IPR011091"
FT                   /db_xref="GeneID:4841277"
FT                   /translation="MPHKAIEQTLSFSRFATYRNAVVAHTGEDCVYTALNLYEWNAKLA
FT                   AGFFVPLHIYEVTLRNAISDAISQRYGVDWPTNDYFLNSLTSKNKRAITSLYRDHGYQG
FT                   VGKILPEVKLFFWEEMLTKRHDGRIWRPYVNTVFPNTAHLSVEQIRTQLKDACFTIRKL
FT                   RNRIAHHEPIFNQATLPDIYSLIASTIAMRCNETHEWLNQLETVNELLSNKVI"
FT                   /protein_id="YP_001041708.1"
FT   misc_feature    complement(19624..20139)
FT                   /note="Abi-like protein; Region: Abi_2; cl01988"
FT                   /db_xref="CDD:154694"
FT                   /locus_tag="Sbal_4403"
FT   gene            complement(20297..20563)
FT                   /db_xref="GeneID:4841330"
FT                   /locus_tag="Sbal_4404"
FT   CDS_pept        complement(20297..20563)
FT                   /locus_tag="Sbal_4404"
FT                   /gene_family="HOG000041049" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative plasmid-related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eca:ECA0588 putative plasmid-related protein"
FT                   /db_xref="GI:126090254"
FT                   /db_xref="GeneID:4841330"
FT                   /translation="MRVSAVQKDILFVLYQLELRGFLKPIPATDILTMLNKSRATEVFG
FT                   TNFRVSCHKLNENGLVHMHRSLQTLRLSFTLTELGREKASMMC"
FT                   /protein_id="YP_001041709.1"
FT   gene            complement(20817..21323)
FT                   /db_xref="GeneID:4841298"
FT                   /locus_tag="Sbal_4405"
FT   CDS_pept        complement(20817..21323)
FT                   /locus_tag="Sbal_4405"
FT                   /gene_family="HOG000245277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090255"
FT                   /db_xref="GeneID:4841298"
FT                   /translation="MPLKKTEYLQLSIIIIIGMLKKVPRWLQAVLKAATYLNMPHALSQ
FT                   RKGHSSIGFYAFISKIKFPMSENIPSIEGERLEAMLALQRMYTSVHRCDGCHCETPKRY
FT                   SVSGKCVTCQATGVINTTDRHNYRNPGYHDLKAFNEAKGVNLILQVFNRLQRLRNLKGK
FT                   HQLNE"
FT                   /protein_id="YP_001041710.1"
FT   gene            complement(21339..21965)
FT                   /db_xref="GeneID:4841296"
FT                   /locus_tag="Sbal_4406"
FT   CDS_pept        complement(21339..21965)
FT                   /locus_tag="Sbal_4406"
FT                   /gene_family="HOG000245278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090256"
FT                   /db_xref="GeneID:4841296"
FT                   /translation="MAQKKLALPPGVSVIRQGKAYVIFRDGHEAIGGVIVSETTQGNTQ
FT                   LQPYMNVDASDNKAVIAFVAQQMTDALLQHQAQKPLNEQLPIFTENVPDNVQVIENKSF
FT                   PCSRCNSIIAKLIFVPEAATASAMLAMAQKFELDVFVSPYPVWLIGAPDSQNDDIAQHL
FT                   TLQIAPVKGEVYWQHPDHMNQRLIELDIEHRCTHHHGTNPKQDLH"
FT                   /protein_id="YP_001041711.1"
FT   gene            complement(21980..22243)
FT                   /db_xref="GeneID:4841333"
FT                   /locus_tag="Sbal_4407"
FT   CDS_pept        complement(21980..22243)
FT                   /locus_tag="Sbal_4407"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090257"
FT                   /db_xref="GeneID:4841333"
FT                   /translation="MTVFKSGTEGQRKFATVIRAQVLKMHPWGLNANTADKVTFRLEGM
FT                   KSPLFFIKYKEALVAGEVVQSLALYDEENYQRRAKFVQARAK"
FT                   /protein_id="YP_001041712.1"
FT   gene            complement(22280..23179)
FT                   /db_xref="GeneID:4841261"
FT                   /locus_tag="Sbal_4408"
FT   CDS_pept        complement(22280..23179)
FT                   /locus_tag="Sbal_4408"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090258"
FT                   /db_xref="GeneID:4841261"
FT                   /translation="MSQVKRKYDHFFQIFSSHLKGFYFNQYKKCLINTVLDGLAPDIPS
FT                   DHLAEWYFSDDLTDELAFCYPISESETIGEYFLRKRGWREGAMARLYFSAVLAAPTAIW
FT                   EMIEVIKGSTAYVKQVNVDMAPIMVAIPKCSLVDLDKQPFFVGKVLSLEPMGLCGLTIS
FT                   LGSVPLPRNAVERVIERVDALTSKEALTPLQSQYQLQRQALMEKHVDKVQQGKEFDDGI
FT                   DDDLIALYQLGDIYQAGLQAFRLDQAEQVNPYSGEEGECWSQGWQDGQQIATQNELGQP
FT                   FKLSDVFPLKFANKLHIT"
FT                   /protein_id="YP_001041713.1"
FT   gene            complement(23745..24476)
FT                   /db_xref="GeneID:4841288"
FT                   /locus_tag="Sbal_4409"
FT   CDS_pept        complement(23745..24476)
FT                   /locus_tag="Sbal_4409"
FT                   /gene_family="HOG000245283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SOA0058 hypothetical protein"
FT                   /db_xref="GI:126090259"
FT                   /db_xref="GeneID:4841288"
FT                   /translation="MIKSKADKARIKQQKLRSAKQAALHVKTHKTAVGANAYKASLEGF
FT                   KALKSRLPRYFDEVINNARKLIYSRKFEIDEGGISRQMSELTKRKLFEIIVTLMTSCDF
FT                   MSGQIGKAKNNGMDTTSHDALMLAHAKRWGYAMPSSTWYRYIGMLKQAGVFVVEEVKIA
FT                   GETEKTIRSVAAYKWLSTQFLQAIGAYTDTIRAQIKQAYQKAVNNGLSFTWRVFKRQLP
FT                   VKQRFTADMFFSQSTNPPQTH"
FT                   /protein_id="YP_001041714.1"
FT   gene            complement(24485..25132)
FT                   /db_xref="GeneID:4841325"
FT                   /locus_tag="Sbal_4410"
FT   CDS_pept        complement(24485..25132)
FT                   /locus_tag="Sbal_4410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: net:Neut_0119 conserved hypothetical protein"
FT                   /db_xref="GI:126090260"
FT                   /db_xref="GeneID:4841325"
FT                   /translation="MMKKNNNKVGMLRSDASIALHASDSVALWHGRKGKIQGLPGFFTH
FT                   TAELETSAAKDDPYADYGLILIENSLNEAFLTINQLSTGLMANERRRRVTSSECASLKP
FT                   VEKALFVTSRFGWRMVALIEEFDLFMVDLLDAQFKARMSRQEFERQRHEAGHCVRKVLE
FT                   MSQTTQHSGISRNDVSANNPKAQSAKEKFGRIPMEVMEGVVRAEFAPEIKQR"
FT                   /protein_id="YP_001041715.1"
FT   misc_feature    complement(24488..25117)
FT                   /note="Domain of unknown function (DUF1845); Region:
FT                   DUF1845; cl07481"
FT                   /db_xref="CDD:164098"
FT                   /locus_tag="Sbal_4410"
FT   gene            complement(25643..26569)
FT                   /db_xref="GeneID:4841304"
FT                   /locus_tag="Sbal_4411"
FT   CDS_pept        complement(25643..26569)
FT                   /locus_tag="Sbal_4411"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A1173 hypothetical protein"
FT                   /db_xref="GI:126090261"
FT                   /db_xref="GeneID:4841304"
FT                   /translation="MCKPIADLIRTTLLDRGISGVPSSNTKLFNELQQHNIIRPNEQGL
FT                   AVWSIKVTLTDVNWYQKFTCLCIHLPTFAPELALNSLPGFIDILPPEDEKPLAEAISSV
FT                   GFAVEEQEPVPESVNTETIETDDTYVTREVIVQDDLLISMIPGMEALMSPIIEATPSKN
FT                   DINESADVLGPELLVTPFNKLTDHQIGILFWNWIEAGLLAGELSINTAEAFIHKVNGQV
FT                   FIVSPTAMKVFCKKYQQGCDADSYLAVQSGFQSLGLHLKTTEGRNIHSVKVTASGKRLN
FT                   GFFIKLTTTLAALALPDNSALSSEGGE"
FT                   /protein_id="YP_001041716.1"
FT   misc_feature    complement(26429..>26563)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Sbal_4411"
FT   misc_feature    complement(25661..25954)
FT                   /note="Protein of unknown function (DUF1528); Region:
FT                   DUF1528; pfam07515"
FT                   /db_xref="CDD:148878"
FT                   /locus_tag="Sbal_4411"
FT   gene            26664..28166
FT                   /db_xref="GeneID:4841266"
FT                   /locus_tag="Sbal_4412"
FT   CDS_pept        26664..28166
FT                   /locus_tag="Sbal_4412"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mlo:mll6233
FT                   transposase"
FT                   /db_xref="GI:126090262"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4841266"
FT                   /translation="MPGHRITDQQIRLFMSKRKDHLQVTAASKAGISERSARRIESGQR
FT                   QLGPSKPRNYRTRTDPLELVWDPVVLPLLQLSDTITPVGVFDYLCEEYSDVFAVTLRRT
FT                   LERRIQKWRQINGQDKEVIFRQVKEFGQLGIMDFTWADFIVTIRGTTLKHRFFNYRLPA
FT                   SGWSYVQVVYGGESFVAVATGLQNAFEQSNGVPQEVRTDSLSAAYKNHSNETLFTERFS
FT                   ELSIHYGFKPSKNNTGIAHENGAIESANNHLKNQIRQALAIRGSSDFDSIDEYETFIDD
FT                   VVQRRNRRIMALLIDEQRQLQPLPKFESVNYEIYPVKVSSTSTFQLKRVTYSVPSRLVG
FT                   ATLRVHLFDKKLDIYCHGVHTATLTRVHASANNRGHQINYRHLIGALMKKPRAFRGGQW
FT                   RDQLLPNEDYRQIWKNVDALLSADEASLYMVRLLNIASKSDREEAVGRFVLEGINLGQR
FT                   PNIVDCEERFLKDEEWEFNPKVQQHSLASYQQILDEVNEYVS"
FT                   /protein_id="YP_001041717.1"
FT   misc_feature    27069..27434
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal_4412"
FT   gene            28156..28902
FT                   /db_xref="GeneID:4841276"
FT                   /locus_tag="Sbal_4413"
FT   CDS_pept        28156..28902
FT                   /locus_tag="Sbal_4413"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:ebA270 transposition helper
FT                   protein"
FT                   /db_xref="GI:126090263"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4841276"
FT                   /translation="MSVETLPIILKELRLVSLLPHWQPLAEKAREQHWPVERYLAELCQ
FT                   LELSCREQKRLHRGLKEATLPIGKYLDTYDFSEVEGLSKKQVWHLADNAEWLKTGDNIL
FT                   LFGASGLGKTHIAAGLGYRLVEQGHRVKFMSASLLVQHLQKAKEELRLPEALVKLDRFA
FT                   VLILDDLGYVQKSTEETSVLFELIAHRYERYSLIITSNQSFEDWDKLFSDTVMTVAAID
FT                   RLIHHAKILQCKGESYRRKEAQNKLN"
FT                   /protein_id="YP_001041718.1"
FT   misc_feature    28171..28884
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Sbal_4413"
FT   misc_feature    28432..28773
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4413"
FT   misc_feature    28474..28497
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4413"
FT   misc_feature    order(28477..28500,28657..28659,28756..28758)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4413"
FT   misc_feature    28645..28662
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4413"
FT   gene            28993..29205
FT                   /db_xref="GeneID:4841322"
FT                   /locus_tag="Sbal_4414"
FT                   /pseudo
FT   gene            30766..31335
FT                   /db_xref="GeneID:4841285"
FT                   /locus_tag="Sbal_4415"
FT   CDS_pept        30766..31335
FT                   /locus_tag="Sbal_4415"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome partitioning ATPase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vfi:VFB13 hypothetical protein"
FT                   /db_xref="GI:126090264"
FT                   /db_xref="GeneID:4841285"
FT                   /translation="MKVISVWNEKGGVGKSTISYNLAGAAVTKGLSVLLIDDDPQGSCA
FT                   WLSSDGFAPFEVVKHWPTNKPNVDLVIVDMTPSTTDTPNGVVILPYQPTRLAYGVVPKH
FT                   LPKLKQAGLRVVQVISMADMRKTEHREFAKTKMREDKTIQLVPNRAIYERTTGLGRTVF
FT                   DPELKGMYGLRDAQKDMNKLLDEVLK"
FT                   /protein_id="YP_001041719.1"
FT   misc_feature    30766..31332
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Sbal_4415"
FT   misc_feature    30772..31095
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal_4415"
FT   misc_feature    30793..30813
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal_4415"
FT   misc_feature    order(30811..30813,30985..30987)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Sbal_4415"
FT   gene            31332..31697
FT                   /db_xref="GeneID:4841280"
FT                   /locus_tag="Sbal_4416"
FT   CDS_pept        31332..31697
FT                   /locus_tag="Sbal_4416"
FT                   /gene_family="HOG000245284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090265"
FT                   /db_xref="GeneID:4841280"
FT                   /translation="MSQGPAWLATAENNTQGNEVGTAAVIDNKTPRGKPGPKKSLVKRK
FT                   VIGLNFSDNQNKKLDELEMRLKLAGIDLPRGRSEAAELAINTLLFILTQSPSDSDRWIK
FT                   RLLENLVGEEEKQHETS"
FT                   /protein_id="YP_001041720.1"
FT   gene            complement(32872..33606)
FT                   /db_xref="GeneID:4841283"
FT                   /locus_tag="Sbal_4417"
FT   CDS_pept        complement(32872..33606)
FT                   /locus_tag="Sbal_4417"
FT                   /gene_family="HOG000245283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SOA0058 hypothetical protein"
FT                   /db_xref="GI:126090266"
FT                   /db_xref="GeneID:4841283"
FT                   /translation="MQKSKADKARIKRQKLRSAKREAALHVKTHKTAVGANAYKASLEG
FT                   FKALKSRLPRYFSEVINNARKLIYSRKFEIDEGGISRQMSELTKRKLFEIIVTLITSCD
FT                   FMSGQIGKAKNIGMDTTSHDALMLAHAKRWGYAMPSSTWYRYINMLKQAGVFVVQEVKI
FT                   AGVSEKTIRSVAAYKWLSTHFLQAIGAYTDTIRAQIKQAYQKAVNNGLSFTWRVFKRLL
FT                   PVKQRFTADMFFSQSTNPPQTH"
FT                   /protein_id="YP_001041721.1"
FT   gene            complement(34066..34707)
FT                   /db_xref="GeneID:4841269"
FT                   /locus_tag="Sbal_4418"
FT   CDS_pept        complement(34066..34707)
FT                   /locus_tag="Sbal_4418"
FT                   /gene_family="HOG000127685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative phage repressor"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase
FT                   S24, S26A and S26B; KEGG: vfi:VFB18 DNA-binding protein
FT                   RDGA"
FT                   /db_xref="GI:126090267"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR006198"
FT                   /db_xref="GeneID:4841269"
FT                   /translation="MKKIGHRIKTRRKLKGLTQEALGLAVGVSKVSVSSWELGKNSMHP
FT                   ELLNKVAGVLGVDAHWLLTGESFATLEDEKDSVFWAPKYKNIKAAAGAGCCHDDCLDED
FT                   EDEVPIPIKFVKNQTNKDQIFCVCVSGDSMEPVLSDGSIIAMNSSDTIIKDGKMYLVKQ
FT                   DDLLRVKVIHLLPKDMVLKSYNPNFKDETYNIKKDNIQILGRVFWFTSGR"
FT                   /protein_id="YP_001041722.1"
FT   misc_feature    complement(34522..34695)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal_4418"
FT   misc_feature    complement(order(34594..34596,34669..34671,34681..34683))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal_4418"
FT   misc_feature    complement(34084..34674)
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2932"
FT                   /db_xref="CDD:32756"
FT                   /locus_tag="Sbal_4418"
FT   misc_feature    complement(order(34597..34599,34672..34674))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal_4418"
FT   misc_feature    complement(order(34591..34596,34606..34608,34615..34617,
FT                   34648..34653))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Sbal_4418"
FT   misc_feature    complement(34090..34335)
FT                   /note="Peptidase S24 LexA-like proteins are involved in the
FT                   SOS response leading to the repair of single-stranded DNA
FT                   within the bacterial cell. This family includes: the lambda
FT                   repressor CI/C2 family and related bacterial prophage
FT                   repressor proteins; LexA...; Region: S24_LexA-like;
FT                   cd06529"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Sbal_4418"
FT   misc_feature    complement(order(34198..34200,34309..34311))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:119397"
FT                   /locus_tag="Sbal_4418"
FT   gene            complement(35050..35640)
FT                   /db_xref="GeneID:4841264"
FT                   /locus_tag="Sbal_4419"
FT   CDS_pept        complement(35050..35640)
FT                   /locus_tag="Sbal_4419"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: plu:plu3296
FT                   hypothetical protein"
FT                   /db_xref="GI:126090268"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="GeneID:4841264"
FT                   /translation="MSRVFAYCRVSTLEQTTENQRREIEEAGFAVKPQRLFEEQISGSV
FT                   TAGERPGFTKLLDRMENGDVLIVTKLDRLGRNAMDIRKTVEQLAGSGIRVHCLALGGVD
FT                   LTSPAGKMTMQVISAVAEFERDLLLERTHSGIARAKAAGKRFGRPPVLNEEQKQRVLER
FT                   IQSGVSISAIAREFRTTRQTILRVKVKQQIPAV"
FT                   /protein_id="YP_001041723.1"
FT   misc_feature    complement(35056..35634)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(35236..35631)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35413..35415,35422..35427,35608..35610,
FT                   35614..35616))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(35608..35610)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35269..35271,35281..35286,35290..35295,
FT                   35428..35430))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35263..35265,35272..35274,35281..35286,
FT                   35293..35298,35305..35307,35392..35397,35410..35412))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35248..35250,35260..35262,35269..35271,
FT                   35281..35283,35290..35295,35302..35307,35332..35340))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35248..35250,35260..35262,35269..35271,
FT                   35281..35283,35290..35292,35338..35340))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35245..35250,35266..35268))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(35080..35196)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Sbal_4419"
FT   misc_feature    complement(order(35080..35088,35092..35097,35191..35196))
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Sbal_4419"
FT   gene            35801..38785
FT                   /db_xref="GeneID:4841332"
FT                   /locus_tag="Sbal_4420"
FT   CDS_pept        35801..38785
FT                   /locus_tag="Sbal_4420"
FT                   /gene_family="HOG000098781" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase Tn3 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   neu:NE0835 transposase Tn3 family"
FT                   /db_xref="GI:126090269"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="GeneID:4841332"
FT                   /translation="MPRRQILSSEEQKRLLVIPDDEIILTRMCFLNERDIALINKHRRP
FT                   ANRLGFAVLLCYLRGSGFIPDKNTSPHCGVVSRVASRLKLQPDLWHEYASREQTRWEHL
FT                   TELYRYLKLSPFSRTLQKDCIRHLHPYAMRTDKGFMLAEEMLSWLHNNNVIFPSVDVIE
FT                   RTIAEIVTLSDRAVFSALTAQLENHHKSALDSLLISESDQPSRLAWLLQPSGKINGKNV
FT                   LQHIDRLNSITALGLPDGIALSVHQNRLLNLAREGRKMSSRDLAKFTDVRRYATMICII
FT                   TEARATLTDEVIDLHERILGSLFSRAKRTQSERLQQTGKLIQSKLKQYVTVGQALLNAR
FT                   ESGEDPWTAIEDVLPWQEFINSVEETRVLSRKGNFDPLHLITEKYSTLRKYAPRMLSAL
FT                   QFTAAPAAQMLSDALDTITEMYRKQLRQVPPAAPTGFIPESWRKLVLTPSGIDRKYYEF
FT                   CVLNELKGALRSGDIWVKGSRRYRNFDDYLITAAEFEKFRHNDQLQLAVQTDCRAYLQA
FT                   RMTLLASRLEEVNAMALAGDLPDVDISDKGVKITPLENSVPSGVSPFADLVYGMLPHPK
FT                   ITEILEEVDNWTGFTRHFTHLKNNNVRPKDGRPLLTTILADGINLGLTKMAESCPGATK
FT                   STLEGIQAWYIRDETYSAALVELVNAQKARPLAAFWGDGTTSSSDGQNFRVGSHGRYAG
FT                   QVNLKYGQEPGVQIYTHISDQYSPYYAKVITRVRDSTHVLDGLLYHESDLEITEHYTDT
FT                   AGFTEHVFALMHLLGFTFAPRIRDLHDKRLFIQGNNWDYPGLQSVISTTRLNLKDIEAH
FT                   WDEVLRLATSIKQGTVTASLMMKKLASYPKQNGLAKALREIGRIERTLFMLDWFRDPGL
FT                   RQRVQAGLNKGEARNALARAVFMHRLGEIRDRGLENQSYRASGLTLLTAAITLWNTVYI
FT                   ERAIESLKRKGVPINEQLVAHLSPLGWEHINLSGDYVWRHNVKLGSGKYRPLRTVNTEL
FT                   YKKQS"
FT                   /protein_id="YP_001041724.1"
FT   misc_feature    35801..38698
FT                   /note="Transposase; Region: Transposase_7; pfam01526"
FT                   /db_xref="CDD:110523"
FT                   /locus_tag="Sbal_4420"
FT   misc_feature    35807..36697
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Sbal_4420"
FT   misc_feature    37673..38620
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="Sbal_4420"
FT   gene            complement(39280..39618)
FT                   /db_xref="GeneID:4841297"
FT                   /locus_tag="Sbal_4421"
FT   CDS_pept        complement(39280..39618)
FT                   /locus_tag="Sbal_4421"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pfa:PF11_0207 hypothetical protein"
FT                   /db_xref="GI:126090270"
FT                   /db_xref="GeneID:4841297"
FT                   /translation="MSDNETLTQKDVLQLLLNASQHSVTREELTSARQELKQDISVLRI
FT                   ELKQDIAEVKQEISELRTELKQDISEVKTEIKSVVKTLSNLQWLIVAAVVSFYLKDSVL
FT                   AWLSALAK"
FT                   /protein_id="YP_001041725.1"
FT   misc_feature    complement(39349..>39543)
FT                   /note="Protein of unknown function (DUF1640); Region:
FT                   DUF1640; pfam07798"
FT                   /db_xref="CDD:149068"
FT                   /locus_tag="Sbal_4421"
FT   gene            complement(40115..40501)
FT                   /db_xref="GeneID:4841271"
FT                   /locus_tag="Sbal_4422"
FT   CDS_pept        complement(40115..40501)
FT                   /locus_tag="Sbal_4422"
FT                   /gene_family="HOG000072185" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="death-on-curing family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   Death-on-curing protein; KEGG: vch:VCA0475 doc protein"
FT                   /db_xref="GI:126090271"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="GeneID:4841271"
FT                   /translation="MNFIQFPAERVVEINQAILLNEPGFRGEYDIGRLSGALSRIDNAI
FT                   AYEGLDDVFLIAAKYATSVAMAHAFSDANKRTGLALCLEYLSLNDYEINTEYDELSDAM
FT                   VDLVVGTLSEIEFADVLYSMWRSM"
FT                   /protein_id="YP_001041726.1"
FT   misc_feature    complement(40154..40498)
FT                   /note="Fic/DOC family; Region: Fic; cl00960"
FT                   /db_xref="CDD:174482"
FT                   /locus_tag="Sbal_4422"
FT   gene            complement(40501..40671)
FT                   /db_xref="GeneID:4841284"
FT                   /locus_tag="Sbal_4423"
FT   CDS_pept        complement(40501..40671)
FT                   /locus_tag="Sbal_4423"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase, putative"
FT                   /transl_table="11"
FT                   /note="KEGG: vch:VCA0474 acetyltransferase, putative"
FT                   /db_xref="GI:126090272"
FT                   /db_xref="GeneID:4841284"
FT                   /translation="MLNETKKYGVNIVERPHVKANKKLDLTGGCGKQIVHSETKLVLRT
FT                   HKNTFRKLADM"
FT                   /protein_id="YP_001041727.1"
FT   gene            complement(40805..41236)
FT                   /db_xref="GeneID:4841327"
FT                   /locus_tag="Sbal_4424"
FT   CDS_pept        complement(40805..41236)
FT                   /locus_tag="Sbal_4424"
FT                   /gene_family="HOG000219439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pfl:PFL_4684 hypothetical protein"
FT                   /db_xref="GI:126090273"
FT                   /db_xref="GeneID:4841327"
FT                   /translation="MTQTTQNTHFDLHITGFGFFNRIRKVELRKGQPYWAVTIAACRGD
FT                   EGQKTYFDCSVVGTEAKALFDTHLSSVNKDDTVTASFKLGDLYPETFVHGSGEKQGQTG
FT                   VCLKARLLKITYLKVNGNIVFQSSPQAADVPAQPVQTAA"
FT                   /protein_id="YP_001041728.1"
FT   misc_feature    complement(40829..41236)
FT                   /note="Protein of unknown function (DUF3577); Region:
FT                   DUF3577; pfam12101"
FT                   /db_xref="CDD:152536"
FT                   /locus_tag="Sbal_4424"
FT   gene            complement(41541..43664)
FT                   /db_xref="GeneID:4841320"
FT                   /locus_tag="Sbal_4425"
FT   CDS_pept        complement(41541..43664)
FT                   /locus_tag="Sbal_4425"
FT                   /gene_family="HOG000086848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: psb:Psyr_1473 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; SMART: DNA
FT                   topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="GI:126090274"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006154"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="GeneID:4841320"
FT                   /translation="MRLFLCEKPSQAKDIASVLGCKRGDGVFTGDGIAVTFCVGHVLQQ
FT                   AEPENYNPDFETWNIVDLPIIPTVWKMLVSPKTKAQFAIVKKQLAKATEVIIATDADRE
FT                   GEVIAREVLEYVNYKGPIQRLWLSALDDASIKKALASLRPNHETAKLYDAGLGRSRGDW
FT                   LIGMNMTRLCTLLSREYGYQGAFSVGRVQTPTLRLVVDRDSQVEQFEPQSYYDITGLFN
FT                   ATIPFKAKWQVPDNLGDEQGRCLQVTTVDHVLSQCRDQPGTVTQFDTKRQKSKHPPLFF
FT                   LGSLQKAMSAKFGYGAKEVLDIAQSLYEKYKVTTYPRTDCPYLPLSQKEEVGSILDKLK
FT                   VVPAFAAWCSAADVNETSACWNDKKITAHHGIIPLPVTPKLHEMNEKELNLYHAIVQRY
FT                   LAQFYPVAEDDATTIELMVGSQSVKATGKVERVKGWRLVTGKDSEDETTDDSANLPLLS
FT                   IGQTLTAQFQREDKRTKPPGRFTEGTLIDAMSNIAKFESDPKLKSILKETSGIGTEATR
FT                   ANIIDTLKARGFVTVTGKQLISSEAGRSLIDALPDVLTRPAMTALWEQALDEIALGNGS
FT                   LDDFMARQSTFITQLVSMFKQGQYTLKLPKVLAVTLPCPVCQKSMKQLSGKNGKFWVCE
FT                   DKEQCGLLLNDERGKLPKTTPCTCKKGVLVRKKAKTKGKFWWGCSAYQSGCQRRLFDNE
FT                   GKPGKEMESNNQT"
FT                   /transl_table="11"
FT                   /protein_id="YP_001041729.1"
FT   misc_feature    complement(41745..43664)
FT                   /note="DNA topoisomerase III; Validated; Region: PRK08174"
FT                   /db_xref="CDD:169254"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(43239..43664)
FT                   /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
FT                   (TORPIM) domain found in members of the type IA family of
FT                   DNA topoisomerases (Topo IA) similar to topoisomerase III.
FT                   Type IA DNA topoisomerases remove (relax) negative
FT                   supercoils in the DNA by...; Region: TOPRIM_TopoIA_TopoIII;
FT                   cd03362"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(43353..43355,43359..43361,43365..43367,
FT                   43632..43634,43641..43646))
FT                   /note="active site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(43323..43328,43332..43337,43356..43358,
FT                   43362..43364,43623..43625))
FT                   /note="putative interdomain interaction site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(43359..43361,43365..43367))
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(43356..43358)
FT                   /note="putative nucleotide binding site; other site"
FT                   /db_xref="CDD:173782"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(41889..43217)
FT                   /note="DNA Topoisomerase, subtype IA; DNA-binding,
FT                   ATP-binding and catalytic domain of bacterial DNA
FT                   topoisomerases I and III, and eukaryotic DNA topoisomerase
FT                   III and eubacterial and archael reverse gyrases.
FT                   Topoisomerases clevage single or double stranded...;
FT                   Region: TOP1Ac; cd00186"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(43047..43109,43137..43217))
FT                   /note="domain I; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(42084..42089,42099..42101,42105..42110,
FT                   42117..42122,42711..42713,42738..42740,42750..42752,
FT                   43155..43157,43167..43169,43179..43181,43188..43193))
FT                   /note="DNA binding groove"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(42012..42014,43062..43064,43074..43076))
FT                   /note="phosphate binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(42240..42272,42348..42404,42408..42452,
FT                   42840..42887,43014..43034))
FT                   /note="domain II; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(42453..42515,42537..42563,42645..42731,
FT                   42735..42815,42819..42839))
FT                   /note="domain III; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(42054..42056,42120..42122,42126..42128,
FT                   42474..42476,42486..42488,42495..42497,42558..42560,
FT                   42786..42794,42804..42806))
FT                   /note="nucleotide binding site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(42558..42560,42711..42713,42717..42719))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(order(41889..42005,42012..42056,42066..42146,
FT                   42198..42239))
FT                   /note="domain IV; other site"
FT                   /db_xref="CDD:73184"
FT                   /locus_tag="Sbal_4425"
FT   misc_feature    complement(<41619..41849)
FT                   /note="Zn-finger domain associated with topoisomerase type
FT                   I [DNA replication, recombination, and repair]; Region:
FT                   TopA; COG0551"
FT                   /db_xref="CDD:30897"
FT                   /locus_tag="Sbal_4425"
FT   gene            complement(43674..43985)
FT                   /db_xref="GeneID:4841309"
FT                   /locus_tag="Sbal_4426"
FT   CDS_pept        complement(43674..43985)
FT                   /locus_tag="Sbal_4426"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090275"
FT                   /db_xref="GeneID:4841309"
FT                   /translation="MEKLSTKPRRSLTNAIAALRTRAWAMHQKDASLLIQARRDVDLQQ
FT                   PYVAQVQQALMGNTEGKTIANVTPTWVNQRLKALGAVVSTYEQTTASVLTKACPYINM"
FT                   /protein_id="YP_001041730.1"
FT   sig_peptide     complement(43908..43985)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.721) with cleavage site probability 0.716 at
FT                   residue 26"
FT                   /locus_tag="Sbal_4426"
FT                   /product="hypothetical protein"
FT   gene            complement(43988..44437)
FT                   /db_xref="GeneID:4841303"
FT                   /locus_tag="Sbal_4427"
FT   CDS_pept        complement(43988..44437)
FT                   /locus_tag="Sbal_4427"
FT                   /gene_family="HOG000224972" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-strand DNA-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCV2288 single-strand DNA-binding protein"
FT                   /db_xref="GI:126090276"
FT                   /db_xref="InterPro:IPR010913"
FT                   /db_xref="GeneID:4841303"
FT                   /translation="MYRGTITLEGNIGQAPAITFLEGNERSRGEKRPILKLNVKYDRLV
FT                   NGPNNEGLIDKGGVWIAVDYWKKDGPALAQLLQKGMRILVIGEPRAEPWENDQGVMEPG
FT                   FCITAESISILPRRIASITLEEKAPYQPHAAQVPYQDDSSYEPRY"
FT                   /protein_id="YP_001041731.1"
FT   misc_feature    complement(44093..44422)
FT                   /note="SSB_OBF: A subfamily of OB folds similar to the OB
FT                   fold of ssDNA-binding protein (SSB). SSBs bind with high
FT                   affinity to ssDNA. They bind to and protect ssDNA
FT                   intermediates during DNA metabolic pathways. All bacterial
FT                   and eukaryotic SSBs studied to date...; Region: SSB_OBF;
FT                   cd04496"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Sbal_4427"
FT   misc_feature    complement(order(44123..44125,44132..44134,44165..44167,
FT                   44192..44194,44255..44257,44261..44263,44309..44317,
FT                   44411..44422))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Sbal_4427"
FT   misc_feature    complement(order(44114..44116,44120..44122,44159..44164,
FT                   44168..44170,44174..44176,44198..44203,44240..44242,
FT                   44246..44248,44252..44254,44258..44260,44264..44269,
FT                   44306..44311,44330..44332,44381..44383,44399..44407))
FT                   /note="ssDNA binding site; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Sbal_4427"
FT   misc_feature    complement(order(44099..44101,44180..44182,44186..44188,
FT                   44192..44194))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:72968"
FT                   /locus_tag="Sbal_4427"
FT   gene            complement(44486..44986)
FT                   /db_xref="GeneID:4841273"
FT                   /locus_tag="Sbal_4428"
FT   CDS_pept        complement(44486..44986)
FT                   /locus_tag="Sbal_4428"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090277"
FT                   /db_xref="GeneID:4841273"
FT                   /translation="MGNQVAKNFSFSAVDLTAFKTALLGEQWQSQQTHFEQIHCQFLRI
FT                   VLGAMGELNEPVSLSSVSFRLENDERLFDDFCAHLVATVSLQPALDLSKIEQIHNSLGD
FT                   ASVHRAHLNKRTQALISFFEHQSCTNTIFLVLVHFLELDPRYRRLLCIDAQKEVKHYLQ
FT                   QRC"
FT                   /protein_id="YP_001041732.1"
FT   gene            45194..45670
FT                   /db_xref="GeneID:4841313"
FT                   /locus_tag="Sbal_4429"
FT   CDS_pept        45194..45670
FT                   /locus_tag="Sbal_4429"
FT                   /gene_family="HOG000282453" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF417; KEGG:
FT                   vch:VC1587 hypothetical protein"
FT                   /db_xref="GI:126090278"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="GeneID:4841313"
FT                   /translation="MQHRNLESKLENIGYILSVVGMALILAWIGIYKFTPTEAALIEPL
FT                   VANHPLMGWLYSFLSVQAVSNIIGATEIIVAVGLIAGFKNAKIGYISGIASAVIFATTL
FT                   TFLITTPNTWKFSDGVLITNFFLLKDLLFIAASLSIIAKNKTTLRLIAEANNKR"
FT                   /protein_id="YP_001041733.1"
FT   misc_feature    45215..45628
FT                   /note="Protein of unknown function, DUF417; Region: DUF417;
FT                   cl01162"
FT                   /db_xref="CDD:120438"
FT                   /locus_tag="Sbal_4429"
FT   gene            complement(45768..46349)
FT                   /db_xref="GeneID:4841319"
FT                   /locus_tag="Sbal_4430"
FT   CDS_pept        complement(45768..46349)
FT                   /locus_tag="Sbal_4430"
FT                   /gene_family="HOG000245285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRC0031 hypothetical protein"
FT                   /db_xref="GI:126090279"
FT                   /db_xref="GeneID:4841319"
FT                   /translation="MTVKLTYYQMVSSVVTNALIHLYLTVADTPGHVTIAKRNEILVKF
FT                   IKPIHKDHRFKFIRNETRKILSIGRQKGASLELKLIEIGSLITKNTEEVTDAQKLFDLL
FT                   ELVRVKHDIESRFILDGEARKSKFIYLLRSHVEYGFAETGEQIAPVSVFYESPEFDKLE
FT                   AILKGEALFNVEVAQVNPDCQQIHLILHPL"
FT                   /protein_id="YP_001041734.1"
FT   misc_feature    complement(45849..46334)
FT                   /note="Protein of unknown function (DUF2913); Region:
FT                   DUF2913; pfam11140"
FT                   /db_xref="CDD:151584"
FT                   /locus_tag="Sbal_4430"
FT   gene            complement(46346..46624)
FT                   /db_xref="GeneID:4841289"
FT                   /locus_tag="Sbal_4431"
FT   CDS_pept        complement(46346..46624)
FT                   /locus_tag="Sbal_4431"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090280"
FT                   /db_xref="GeneID:4841289"
FT                   /translation="MRTGLKRDHAVIKAMPWSKNEDGSEYVLIEEGVLTLRTITAKQLE
FT                   SMATFVMRFDYTQTQKSFSGTDIMQIKKEALDWAMQYISENDMPGAI"
FT                   /protein_id="YP_001041735.1"
FT   gene            47430..48371
FT                   /db_xref="GeneID:4841279"
FT                   /locus_tag="Sbal_4432"
FT   CDS_pept        47430..48371
FT                   /locus_tag="Sbal_4432"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="GI:126090281"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4841279"
FT                   /translation="MSLIMKSKLQKKLTQQAERLFMNNFNGIGKAKTKTSELLHGRRSI
FT                   KEQARIVGKAASDLNLKNLKLLTPIMAQEYLTTCRDKGLCQKYLSTIKCSLQRALFKHE
FT                   NNTLTRVIAFDRKKIPLTDKNRAYTNEQIRLIMTSMNDKAKLSTLIAVNAGLRVEELLT
FT                   IRRLDEATVSSSRSWSSKRFIGREEGVRYILTGKTGLRREILISKDIAELMENTRLTQP
FT                   KTIIDRKHSFVINYDLLGGKRLSDAFSRASIKTLGWSNGAHGLRFTYAQNRMDNELINF
FT                   TDSEAKLIISQELGHFREEITDRYLEPYSKRT"
FT                   /protein_id="YP_001041736.1"
FT   misc_feature    47805..48344
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="Sbal_4432"
FT   misc_feature    47826..48347
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal_4432"
FT   misc_feature    order(47898..47903,48018..48020,48213..48218,48342..48344)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal_4432"
FT   misc_feature    order(47898..47900,48018..48020,48216..48218,48225..48227,
FT                   48315..48317,48342..48344)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal_4432"
FT   misc_feature    order(47898..47900,48216..48218,48225..48227,48315..48317,
FT                   48342..48344)
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal_4432"
FT   misc_feature    order(47898..47900,48225..48227,48342..48344)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="Sbal_4432"
FT   gene            complement(49213..49467)
FT                   /db_xref="GeneID:4841324"
FT                   /locus_tag="Sbal_4433"
FT   CDS_pept        complement(49213..49467)
FT                   /locus_tag="Sbal_4433"
FT                   /gene_family="HOG000216470" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="addiction module antitoxin"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin, Txe/YoeB; KEGG: yps:pYptb0009
FT                   hypothetical protein"
FT                   /db_xref="GI:126090282"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="GeneID:4841324"
FT                   /translation="MKILFSSNAWDDYLYWQQQDKKTLKRVNLLIKECQRAPFEGIGKP
FT                   ERLKENLSGYWSRRITDEHRLVYKASQDTLTIVALRYHY"
FT                   /protein_id="YP_001041737.1"
FT   misc_feature    complement(49216..49455)
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="Sbal_4433"
FT   gene            complement(49464..49715)
FT                   /db_xref="GeneID:4841294"
FT                   /locus_tag="Sbal_4434"
FT   CDS_pept        complement(49464..49715)
FT                   /locus_tag="Sbal_4434"
FT                   /gene_family="HOG000216358" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prevent-host-death family protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: ppr:PBPRB0955
FT                   hypothetical protein"
FT                   /db_xref="GI:126090283"
FT                   /db_xref="InterPro:IPR003756"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="GeneID:4841294"
FT                   /translation="MAIYSFTEVRSNFKSICDTVVNDCEPVVIHRRGNENVVLFSESEF
FT                   NSWKETLYLLSNPANAKRLLESIKQVNDGHASEHELSE"
FT                   /protein_id="YP_001041738.1"
FT   misc_feature    complement(49494..49715)
FT                   /note="Phd_YefM; Region: PhdYeFM; cl09153"
FT                   /db_xref="CDD:175019"
FT                   /locus_tag="Sbal_4434"
FT   gene            49979..50428
FT                   /db_xref="GeneID:4841275"
FT                   /locus_tag="Sbal_4435"
FT   CDS_pept        49979..50428
FT                   /locus_tag="Sbal_4435"
FT                   /gene_family="HOG000004560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: mca:MCA2639 hypothetical protein"
FT                   /db_xref="GI:126090284"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="GeneID:4841275"
FT                   /translation="MNMTTLPNAEEIAMARLGSQELSAVIESNGEAQQISVIDKQGQSH
FT                   DVTLPSSVLKMMIEVLTQLGQGNSVNITPIHAEMTTQQGADFLNMSRPTFIKLLDSREI
FT                   PFTRVGNRRKVPFSAVIKYKQQLEIQRLSTLDELSRLDQELGMGY"
FT                   /protein_id="YP_001041739.1"
FT   misc_feature    50213..50356
FT                   /note="Helix-Turn-Helix DNA binding domain of transcription
FT                   regulators from the MerR superfamily; Region: HTH_MerR-SF;
FT                   cl02600"
FT                   /db_xref="CDD:155005"
FT                   /locus_tag="Sbal_4435"
FT   gene            50428..50997
FT                   /db_xref="GeneID:4841282"
FT                   /locus_tag="Sbal_4436"
FT   CDS_pept        50428..50997
FT                   /locus_tag="Sbal_4436"
FT                   /gene_family="HOG000004549" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mgm:Mmc1_0694 hypothetical protein"
FT                   /db_xref="GI:126090285"
FT                   /db_xref="GeneID:4841282"
FT                   /translation="MASYTVVFDACVMYPAPLRSYLMYLANAGLFRARWTEQIHDEWMR
FT                   NVLLNNPRITEAMLERTKQLINENVPDCLIEGYEPLIKGLTLPDMNDRHVVAAALKGHA
FT                   EAIITFNLKDFPASELNILELSAIHPDEFLCDMFELDLSSCIKAAQQQRSSLKNPPMTT
FT                   SEYLNCLQKQRLPVFVSKLRPFELML"
FT                   /protein_id="YP_001041740.1"
FT   gene            complement(51060..52229)
FT                   /db_xref="GeneID:4841334"
FT                   /locus_tag="Sbal_4437"
FT   CDS_pept        complement(51060..52229)
FT                   /locus_tag="Sbal_4437"
FT                   /gene_family="HOG000103025" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, mutator type"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase, mutator type; KEGG: son:SO4497
FT                   ISSod5, transposase"
FT                   /db_xref="GI:126090286"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:4841334"
FT                   /translation="MTTPTFDINAAIQALREGKDLTGKDGILTPLIKQLTEAALAAELD
FT                   GHLASTEGANRKNGKTTKTVKSPIGNFEPQLVKKHQTQLTDEMERKIIGLFSLGSSYQD
FT                   IRAHIEDMYGMSVSNGTVNAITDKLLPELQAWRERELEPLYPVIWLDAIHYKIKENGRF
FT                   ISKAVYTILALNVEGKKELLGLYLSDNEGAHHWLSVLTDLYNRGVKDILIACVDGLKGF
FT                   PEAIETIYPQTEVQLCVIHQIRNSMKYVASKHQKAFMADLKCVYKAATLNAAEMALDEL
FT                   ETKWGDKYPVVIKSWRNKWALLSVYFKYPDYVRTAIYTTNAVEAVHRQFRKLTKTKGGF
FT                   ANENSLLKLLYAGILKASERWTHPIQNWNLTLSQLSIHFEGRLENHIDL"
FT                   /protein_id="YP_001041741.1"
FT   misc_feature    complement(51144..52229)
FT                   /note="Transposase, Mutator family; Region:
FT                   Transposase_mut; pfam00872"
FT                   /db_xref="CDD:109910"
FT                   /locus_tag="Sbal_4437"
FT   misc_feature    complement(51495..51758)
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="Sbal_4437"
FT   gene            complement(52450..55449)
FT                   /db_xref="GeneID:4841292"
FT                   /locus_tag="Sbal_4438"
FT   CDS_pept        complement(52450..55449)
FT                   /locus_tag="Sbal_4438"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090287"
FT                   /db_xref="GeneID:4841292"
FT                   /translation="MPPVTASVSLIKMSSLSSEAPKEQLTDLNSRIKSVRNIDDESVRN
FT                   KCKLPELNKKSNDDSSWMTRIKKLDLKIKSKKNYKSLQANVGEQKKLKRDGQVYYTAEQ
FT                   IEKRNYLESLAKPLPEKMICFCFQDQKLVNDLVTKVTDPVEWGLKNEKPGIKPNRLGGR
FT                   GLYVAKPSGLEQASRYAGRIKKSGGNPGLLTVHINKGAKFLDLTDKTLLGKLASKWKCS
FT                   HEEAEHLASYLEPSAVCKFSGKDWLVIKTLENVELKHPHNDDFKIIKISESGKFDSVAK
FT                   ELIDSFKTVSYSSERSKEKSLGGKIKSAYINNNNYRRTESLNNENEDKFNATSKMVEYL
FT                   EMYGDNDGFSLYVAEEINNFFSKKYQGNNVFDKLTSRVRKQNVSRYINGRKLNVYRPKH
FT                   ALAHGVRQGALSKDIVELISDKKYDGEMADWARGKLNNDCNFLKKIEFMSCFMRTGRKS
FT                   EAATESRFYSSFLRRDANNFEKAARKTNLFSENEIITFKMALQPTQDGEINYDAKKLKL
FT                   ITKTAHRLDLRRLPHFDKERVQLLVASSLYGKEINHFNEMTATQLNGLNELWSKSGSYL
FT                   QATGDRDLDIKGRNNFQNEFFTQAKNPIELVKAVNEVRSRFQETKSVRIKASLNKNLSE
FT                   LESKRTLDYYGIDVSPLSKDQIKRMLDQYGIDDNRKTLAVGKSVGHVDVLAMKGRPVSE
FT                   AGLYISKQGINQYGDFDFVTKKTAKSYHVEDSFRVAFTGQHLDKLQKTYKKTPVTGFLK
FT                   KFINKVDGAEHRNYLQNKALCDYLPPVDLNSNGHLIYPNPTYITKEYFTHPENLKNTKN
FT                   GIQLLTWAVHPRNAAPLINEITAGEFHSLHKESSPSRFGLYTTSQLETERKTGLKSLTT
FT                   ILDLTKEDLPQLIALRKASHDQLVSKYNVDLNKDKVNMFFHFPVSIETATLHLHVFVNK
FT                   GNLPLNEQRSFSIDEVINYLESGKSVKELILNRNDGVYYFPKKNIKAMPGMPHLQSDKT
FT                   IDNLLLDIDN"
FT                   /protein_id="YP_001041742.1"
FT   misc_feature    complement(<53860..54411)
FT                   /note="Dot/Icm substrate protein; Region: SidE; pfam12252"
FT                   /db_xref="CDD:152687"
FT                   /locus_tag="Sbal_4438"
FT   misc_feature    complement(52651..>52851)
FT                   /note="HIT family: HIT (Histidine triad) proteins, named
FT                   for a motif related to the sequence HxHxH/Qxx (x, a
FT                   hydrophobic amino acid), are a superfamily of nucleotide
FT                   hydrolases and transferases, which act on the
FT                   alpha-phosphate of ribonucleotides. On the...; Region:
FT                   HIT_like; cl00228"
FT                   /db_xref="CDD:174049"
FT                   /locus_tag="Sbal_4438"
FT   gene            55730..56245
FT                   /db_xref="GeneID:4841290"
FT                   /locus_tag="Sbal_4439"
FT   CDS_pept        55730..56245
FT                   /locus_tag="Sbal_4439"
FT                   /gene_family="HOG000231492" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shm:Shewmr7_3098 transposase, IS4 family
FT                   protein"
FT                   /db_xref="GI:126090288"
FT                   /db_xref="GeneID:4841290"
FT                   /translation="MSKPRYKTTHWKQYNQALINRGSLTFWIDEDAITKWKAKVEQPKK
FT                   GRPQVFSDLAITTALMVKRIFSMPLRALQGFINSVFKLGDIPLSCPHYTCISKRAKTVN
FT                   IAFKTKTRGAIKHLAIDSTGLKVYGEGEWKVKKHGTDGKRRVWRKLHIAVDTHSHEIIA
FT                   AELSLSGV"
FT                   /protein_id="YP_001041743.1"
FT   misc_feature    56063..>56230
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Sbal_4439"
FT   gene            complement(56303..57049)
FT                   /db_xref="GeneID:4841270"
FT                   /locus_tag="Sbal_4440"
FT   CDS_pept        complement(56303..57049)
FT                   /locus_tag="Sbal_4440"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IstB ATP binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:ebA270 transposition helper
FT                   protein"
FT                   /db_xref="GI:126090289"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4841270"
FT                   /translation="MSVETLPIILKELRLVSLLPHWQPLAEKAREQHWPVERYLAELCQ
FT                   LELSCREQKRLHRGLKEATLPIGKYLDTYDFSEVEGLSKKQVWHLADNAEWLKTGDNIL
FT                   LFGASGLGKTHIAAGLGYRLVEQGHRVKFMSASLLVQHLQKAKEELRLPEALVKLDRFA
FT                   VLILDDLGYVQKSTEETSVLFELIAHRYERYSLIITSNQSFEDWDKLFSDTVMTVAAID
FT                   RLIHHAKILQCKGESYRRKEAQNKLN"
FT                   /protein_id="YP_001041744.1"
FT   misc_feature    complement(56321..57034)
FT                   /note="transposase; Validated; Region: PRK08181"
FT                   /db_xref="CDD:136670"
FT                   /locus_tag="Sbal_4440"
FT   misc_feature    complement(56432..56773)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4440"
FT   misc_feature    complement(56708..56731)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4440"
FT   misc_feature    complement(order(56447..56449,56546..56548,56705..56728))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4440"
FT   misc_feature    complement(56543..56560)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Sbal_4440"
FT   gene            complement(57039..57761)
FT                   /db_xref="GeneID:4841265"
FT                   /locus_tag="Sbal_4441"
FT   CDS_pept        complement(57039..57761)
FT                   /locus_tag="Sbal_4441"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pha:PSHAa0412 hypothetical protein"
FT                   /db_xref="GI:126090290"
FT                   /db_xref="GeneID:4841265"
FT                   /translation="MAIRGSSDFDSIDEYETFIDDVVQRRNRRIMALLIDEQRQLQPLP
FT                   KFESVNYEIYPVKVSSTSTFQLKRVTYSVPSRLVGATLRVHLFDKKLDIYCHGVHTATL
FT                   TRVHASANNRGHQINYRHLIGALMKKPRAFRGGQWRDQLLPNEDYRQIWKNVDALLSAD
FT                   EASLYMVRLLNIASKSDREEAVGRFVLEGINLGQRPNIVDCEERFLKDEEWEFNPKVQQ
FT                   HSLASYQQILDEVNEYVS"
FT                   /protein_id="YP_001041745.1"
FT   gene            57901..58401
FT                   /db_xref="GeneID:4841272"
FT                   /locus_tag="Sbal_4442"
FT   CDS_pept        57901..58401
FT                   /locus_tag="Sbal_4442"
FT                   /gene_family="HOG000152669" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   sdn:Sden_2169 hypothetical protein"
FT                   /db_xref="GI:126090291"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4841272"
FT                   /translation="MARYSPERKEAILKKLLPPHNLTVAEVAREEGIAVQTLYHWRDIA
FT                   RKEGRPVPGKTLTADDWSAEAKFAVLIETAPLSEAEISQYCREKGLYREQVQQWKLECL
FT                   SGFQTSEVQTKTIKQQAKADKAEIKSLQRELRYKEKALAEAAALLVLRKKLNVLWGDDS
FT                   EES"
FT                   /protein_id="YP_001041746.1"
FT   misc_feature    57907..58077
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Sbal_4442"
FT   gene            58407..59456
FT                   /db_xref="GeneID:4841281"
FT                   /locus_tag="Sbal_4443"
FT   CDS_pept        58407..59456
FT                   /locus_tag="Sbal_4443"
FT                   /gene_family="HOG000076046" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sdn:Sden_2168 integrase, catalytic region"
FT                   /db_xref="GI:126090292"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4841281"
FT                   /translation="MPERIALIALIQEAYTQGARLYKACAETGLSKRTYRRWYREGQVQ
FT                   ADLRPTAARPEPANKLEEHERQQILSVCNQAEYASLPPSQIVPTLLDNGIYIASESSFY
FT                   RVLNAHGQLNHRGRTQATVNRSKPLSYRADGPNQVWSWDITYLASTVKGQFYYLYLFED
FT                   IYSRKIVGYEVHEQENGEYAAALIQRSLLREQCFNTPLVLHSDNGAPMKSLTMKAKLEE
FT                   LGITASLSRPRVSNDNPFSESLFKTLKYRPQWPASGFSCLATAREWVEKFVSWYNDEHK
FT                   HSQLNFVSPGQRHALQDGAILAKRKKVLEAAKERKPMRWSTEIRNCEAVGAVTLNPDKA
FT                   PVEGVINAA"
FT                   /protein_id="YP_001041747.1"
FT   misc_feature    58593..59291
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: Tra5;
FT                   COG2801"
FT                   /db_xref="CDD:32633"
FT                   /locus_tag="Sbal_4443"
FT   misc_feature    58800..59159
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal_4443"
FT   gene            complement(59478..60215)
FT                   /db_xref="GeneID:4841286"
FT                   /locus_tag="Sbal_4444"
FT   CDS_pept        complement(59478..60215)
FT                   /locus_tag="Sbal_4444"
FT                   /gene_family="HOG000139033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="KEGG: mlo:mll6233 transposase"
FT                   /db_xref="GI:126090293"
FT                   /db_xref="GeneID:4841286"
FT                   /translation="MPGHRITDQQIRLFMSKRKDHLQVTAASKAGISERSARRIESGQR
FT                   QLGPSKPRNYRTRTDPLELVWDPVVLPLLQLSDTITPVGVFDYLCEEYSDVFAVTLRRT
FT                   LERRIQKWRQINGQDKEVIFRQVKEFGQLGIMDFTWADFIVTIRGTTLKHRFFNYRLPA
FT                   SGWSYVQVVYGGESFVAVATGLQNAFEQSNGVPQEVRTDSLSAAYKNHSNETLFTERFS
FT                   ELSIHYGFKPSKNNTGIARCFSR"
FT                   /protein_id="YP_001041748.1"
FT   misc_feature    complement(59493..60164)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="Sbal_4444"
FT   gene            60296..60727
FT                   /db_xref="GeneID:4841268"
FT                   /locus_tag="Sbal_4445"
FT   CDS_pept        60296..60727
FT                   /locus_tag="Sbal_4445"
FT                   /gene_family="HOG000231492" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS4 family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shm:Shewmr7_3098 transposase, IS4 family
FT                   protein"
FT                   /db_xref="GI:126090294"
FT                   /db_xref="GeneID:4841268"
FT                   /translation="MSRNTGVTDAEVMPNLLKQTHRKIRNISGDGAYDTKACHEAVRRK
FT                   RALVLIPPREDAALWEQGHPRNLAVSWQQLHGSNKQWKKRYGYHRRSISETAMYRIKQL
FT                   LGGTLSMRNYNAQVGETYAMIRALNKLTGLGMPETHYVA"
FT                   /protein_id="YP_001041749.1"
FT   misc_feature    <60314..60682
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="Sbal_4445"
FT   gene            complement(60798..61718)
FT                   /db_xref="GeneID:4841278"
FT                   /locus_tag="Sbal_4446"
FT   CDS_pept        complement(60798..61718)
FT                   /locus_tag="Sbal_4446"
FT                   /gene_family="HOG000233526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bma:BMAA1940 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="GI:126090295"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:4841278"
FT                   /translation="MNALPKLNQLRNLRAIIQHGNISAAAQMLHQTQSTLTRSIQELEK
FT                   TLGVTLLDRGMNSTVLTKAGMMFEPRMNLILNELERAVDELRQIEKLSDGKIAFGCSHF
FT                   PATSIVPDVIKKFQERHNSTRITIIEGQLSELLSSLRMGKLDFFIGVVSSDLMLNEFVE
FT                   ERLTSCSFSVVARKGHPLANSTSLAELQAAKWYIPAASHGYYSDLETVIFPNGVKSCGS
FT                   VIFGDSSAIARKLVLNEDYLFVGPRPMFLAPHHKDLISIIPIKDKLPEGHYSLISPRNK
FT                   KLTPAALNLVNEIRFAYFDFIKSHS"
FT                   /protein_id="YP_001041750.1"
FT   misc_feature    complement(60834..61709)
FT                   /note="DNA-binding transcriptional activator TdcA;
FT                   Provisional; Region: PRK10341"
FT                   /db_xref="CDD:137831"
FT                   /locus_tag="Sbal_4446"
FT   misc_feature    complement(61524..61700)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Sbal_4446"
FT   misc_feature    complement(60834..61433)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Sbal_4446"
FT   misc_feature    complement(order(61005..61010,61014..61019,61035..61043,
FT                   61047..61055,61329..61349,61353..61355,61365..61367,
FT                   61374..61379,61383..61388))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="Sbal_4446"
FT   gene            62163..62378
FT                   /db_xref="GeneID:4841267"
FT                   /locus_tag="Sbal_4447"
FT   CDS_pept        62163..62378
FT                   /locus_tag="Sbal_4447"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   son:SOA0146 ISSod1, transposase OrfA"
FT                   /db_xref="GI:126090296"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4841267"
FT                   /translation="MSLKKSHKSYPQTFKNEAVLMVLEQGNSVADAAESLGVSTSQLYN
FT                   WKVKHEALQQGIILEESEHDNLKQCR"
FT                   /protein_id="YP_001041751.1"
FT   misc_feature    62172..62375
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Sbal_4447"
FT   gene            62531..63074
FT                   /db_xref="GeneID:4841338"
FT                   /locus_tag="Sbal_4448"
FT                   /pseudo
FT   gene            complement(63082..63891)
FT                   /db_xref="GeneID:4841274"
FT                   /locus_tag="Sbal_4449"
FT   CDS_pept        complement(63082..63891)
FT                   /locus_tag="Sbal_4449"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sdn:Sden_3021 integrase, catalytic region"
FT                   /db_xref="GI:126090297"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4841274"
FT                   /translation="MSVSKSGYYDWHKRPANVISLETLKLYRLVRQLFKQSRGSLGNRE
FT                   MVKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNPVS
FT                   ANEVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALIKAYNLRQP
FT                   ARGLVFHSDRGSQYTSKQFGRLLLSYGIRASMGDVGACWDNAVVERFFGSLKHDWIFKV
FT                   NQPTREFMKQDVTAYMKYYNLERLHSANGDLSPVEFENSQLKVSSLG"
FT                   /protein_id="YP_001041752.1"
FT   misc_feature    complement(63094..63891)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="Sbal_4449"
FT   misc_feature    complement(63238..63576)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal_4449"
FT   gene            complement(63951..64241)
FT                   /db_xref="GeneID:4841329"
FT                   /locus_tag="Sbal_4450"
FT   CDS_pept        complement(63951..64241)
FT                   /locus_tag="Sbal_4450"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   son:SOA0146 ISSod1, transposase OrfA"
FT                   /db_xref="GI:126090298"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4841329"
FT                   /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLYN
FT                   WKEKHEALKQGITLEESERDELKRLRRENKELRMEKEILKKASAFFAREMK"
FT                   /protein_id="YP_001041753.1"
FT   misc_feature    complement(<64086..64232)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Sbal_4450"
FT   gene            64290..64565
FT                   /db_xref="GeneID:4841335"
FT                   /locus_tag="Sbal_4451"
FT                   /pseudo
FT   gene            complement(64567..64809)
FT                   /db_xref="GeneID:4841308"
FT                   /locus_tag="Sbal_4452"
FT                   /pseudo
FT   gene            65513..65836
FT                   /db_xref="GeneID:4841262"
FT                   /locus_tag="Sbal_4453"
FT   CDS_pept        65513..65836
FT                   /locus_tag="Sbal_4453"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vfi:VF1228 conserved hypothetical protein"
FT                   /db_xref="GI:126090299"
FT                   /db_xref="GeneID:4841262"
FT                   /translation="MDFTIRKQSRKRLTILCKPVHVQISDKIKIIYQEKFGIFGGGLID
FT                   VTDFEAFQLEPIEGLYFRGFGRAYNFTSDSYDVIHLKEPHKPKTGNTMAKILKKSLKDK
FT                   IDA"
FT                   /protein_id="YP_001041754.1"
FT   gene            65879..66514
FT                   /db_xref="GeneID:4841263"
FT                   /locus_tag="Sbal_4454"
FT   CDS_pept        65879..66514
FT                   /locus_tag="Sbal_4454"
FT                   /gene_family="HOG000262435" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppr:PBPRB1864 conserved hypothetical protein"
FT                   /db_xref="GI:126090300"
FT                   /db_xref="GeneID:4841263"
FT                   /translation="MKTVVIWGAASGLGAAMVEYFYKQSFNIVGIVRTPSKCNCLTELG
FT                   IKILTCDATNAAQVNQTVKKLPVDAWVISTMGTYGAANIPVDYIGHRNLIDALEYQNIN
FT                   RFLLVTSLGCGDSWQYLSKQSKQNFGSAVREKSLAEVWLKSSRLDYTILRPAGLKDGEI
FT                   THRGELSQKIEVHGLINRNEVTRLTHLLLNDPNSIGQIYQCVDKTLTY"
FT                   /protein_id="YP_001041755.1"
FT   misc_feature    65882..66502
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Sbal_4454"
FT   gene            66778..67389
FT                   /db_xref="GeneID:4841318"
FT                   /locus_tag="Sbal_4455"
FT   CDS_pept        66778..67389
FT                   /locus_tag="Sbal_4455"
FT                   /gene_family="HOG000275579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase, N-terminal domain; KEGG:
FT                   son:SOA0026 site-specific recombinase, resolvase family"
FT                   /db_xref="GI:126090301"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="GeneID:4841318"
FT                   /translation="MFIRAYLRASTDEQDANRAKNELVQFSENKNIRIASFYTETQSGA
FT                   KIERPELGRLIMDSHPGDVLLIEKVDRLSRLPFEQWKILKTKLVKANIHIVVVDQPMTH
FT                   GILNGTEEHTMIAKVLTEFMIDLAAAMARDDYETRRKRQAQGIEKAKTLGKYLGRQPDH
FT                   GLRQNIRLLLNEGKSWSQVQSLLKCSRSTIAKTAKLSELG"
FT                   /protein_id="YP_001041756.1"
FT   misc_feature    66784..67362
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:172040"
FT                   /locus_tag="Sbal_4455"
FT   misc_feature    66784..67215
FT                   /note="Serine recombinase (SR) family, Partitioning
FT                   (par)-Resolvase subfamily, catalytic domain; Serine
FT                   recombinases catalyze site-specific recombination of DNA
FT                   molecules by a concerted, four-strand cleavage and
FT                   rejoining mechanism which involves a transient...; Region:
FT                   SR_Res_par; cd03767"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal_4455"
FT   misc_feature    order(66799..66801,66805..66807,66988..66993,67000..67002)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal_4455"
FT   misc_feature    66805..66807
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58116"
FT                   /locus_tag="Sbal_4455"
FT   gene            67607..68017
FT                   /db_xref="GeneID:4841311"
FT                   /locus_tag="Sbal_4456"
FT   CDS_pept        67607..68017
FT                   /locus_tag="Sbal_4456"
FT                   /gene_family="HOG000002436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /transl_table="11"
FT                   /note="KEGG: shn:Shewana3_4160 S-adenosylhomocysteine
FT                   hydrolase"
FT                   /db_xref="GI:126090302"
FT                   /db_xref="GeneID:4841311"
FT                   /translation="MAAVDSIFQKIKRSRRYVFERKDFDGIASYDQIGRSLNQLMDRGE
FT                   IMKLGYGLYTKARVNSLTGRLMPTCPGGSDALMREILKMKDIDFEIDNLSLQSLSGKNT
FT                   QIPSSVHYSWDQKQFNRKLVVGNRLLTPASRP"
FT                   /protein_id="YP_001041757.1"
FT   gene            68014..68955
FT                   /db_xref="GeneID:4841291"
FT                   /locus_tag="Sbal_4457"
FT   CDS_pept        68014..68955
FT                   /locus_tag="Sbal_4457"
FT                   /gene_family="HOG000002449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shn:Shewana3_4161 conserved hypothetical
FT                   protein"
FT                   /db_xref="GI:126090303"
FT                   /db_xref="GeneID:4841291"
FT                   /translation="MKKLKQQFLEVSDALALGNPAIIEKDYWVVALLSELEQLTFETHQ
FT                   MVFSGGTALAKSNVKILRMSEDVDIKLIPTPQFQHLSRGRKKQYRKALAVQIETALIAS
FT                   NKFSIEARLVQDEYRYVEYELKYPQQFSQAPCLRPIIKLELMETIPLLALETRGIQSLV
FT                   AELYKLPQEVNVFICVSVNTTLVEKVLSMLRRTMSVKRDAARNDDVTLVRHIYDVHCIH
FT                   AAQALDNELLAPLFLAILAEDIARFGNQHAEFVMDPANELRLGLQEIESNPLFRQRFND
FT                   FVKPMVFNSQSPNFDTCFMSFKHIATSLILTI"
FT                   /protein_id="YP_001041758.1"
FT   misc_feature    68134..68739
FT                   /note="Domain of unknown function (DUF1814); Region:
FT                   DUF1814; cl00973"
FT                   /db_xref="CDD:154118"
FT                   /locus_tag="Sbal_4457"
FT   gene            68963..71554
FT                   /db_xref="GeneID:4841287"
FT                   /locus_tag="Sbal_4458"
FT   CDS_pept        68963..71554
FT                   /locus_tag="Sbal_4458"
FT                   /gene_family="HOG000239472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; KEGG: yps:YPTB0537
FT                   putative type I restriction-modification system,
FT                   methyltransferase subunit (N-6 DNA methylase)"
FT                   /db_xref="GI:126090304"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="GeneID:4841287"
FT                   /translation="MNKQQLAAKIWESANQMRSKIEANEYKDYILGFIFYKYLSDQLVQ
FT                   FLTNQGMTPEDIKALDEDDAETREYVQSNLGYFIAYDNLFSTWIDPKSDFDESNVRDAL
FT                   SAFSRLIHTNHKKLFDGIFTTLETGLSKLGESPSKRTKAISDLLHLIKSIPMNSNQGYD
FT                   VLGYIYEYLIEKFAANAGKKAGEFYTPHEVSLLMSHITAHELQHKENIEIYDPTSGSGS
FT                   LLINIGQALAQYADKADNITYYAQELKANTYNLTRMNLIMRGIKATNIKTRNGDTLEDD
FT                   WPYFDESDPKETYNALYVDAVVSNPPYSQSWDPTHKESDPRYSRFGLAPKTKADFAFLL
FT                   HDLYHLKPDGIMTIVLPHGVLFRGGEEGKIRTQLIENNHIDTIIGLPANIFFGTGIPTV
FT                   ILVLKQKRQNTDVLIVDASKHFIKEGKNNKLQASDIKRITDAVINRQSCPKFSQLVEKS
FT                   TIREHGYNLNIPRYVDSSAAAQSWDLYATMLGGIPDSEIANLQHYWQALPQLHSALFTP
FT                   KSTSYSELTIAKDAVNTTITQHAQVVTFITAYNQAFNGFDAYLNTHLIQAWATVNRNQQ
FT                   EAELSRELFTRLAPIALIDKYQAYQYLNNQWQIISADLEMMQTEGFAATKLVDPNMVIK
FT                   KKDGKEVEVQDGWKGHILPFDLVQSTHLNDELQDLGQQETRLAEIAAALEELFESLSEE
FT                   EKEADTVKESKDGFANAEVNKAAKAYLKEQKDTKTKFAQDSIEAKLINVSALLDEEKAL
FT                   KKAVKEAATALHLKTKTTIEGLTIDQVNELLHLKWIAPLSLELAAMPSAVITQLTSKVQ
FT                   ALADKYAVTYSQVANEIETTEQELADMMGQLTGNEFDLQGLSELTNLLKGE"
FT                   /protein_id="YP_001041759.1"
FT   misc_feature    68978..>69076
FT                   /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
FT                   /db_xref="CDD:152596"
FT                   /locus_tag="Sbal_4458"
FT   misc_feature    69440..70393
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="Sbal_4458"
FT   misc_feature    69860..70183
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Sbal_4458"
FT   gene            71574..71738
FT                   /db_xref="GeneID:4841300"
FT                   /locus_tag="Sbal_4459"
FT                   /pseudo
FT   gene            complement(71746..72555)
FT                   /db_xref="GeneID:4841316"
FT                   /locus_tag="Sbal_4460"
FT   CDS_pept        complement(71746..72555)
FT                   /locus_tag="Sbal_4460"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sdn:Sden_3021 integrase, catalytic region"
FT                   /db_xref="GI:126090305"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:4841316"
FT                   /translation="MSVSKSGYYDWHKRPANVISLETLKLYRLVRQLFKQSRGSLGNRE
FT                   MVKKLRKEGYQVGRYLVRKIMHRLRLKATQRRAYKVTTQRKHSDAVADNLLNMNFNPVS
FT                   ANEVWAGDVTYLKTGEGWMYLAVVMDLYSRRIVGWHIDKRMTTDLISKALIKAYNLRQP
FT                   ARGLVFHSDRGSQYTSKQFGRLLLSYGIRASMGDVGACWDNAVVERFFGSLKHDWIFKV
FT                   NQPTREFMKQDVTAYMKYYNLERLHSANGDLSPVEFENSQLKVSSLG"
FT                   /protein_id="YP_001041760.1"
FT   misc_feature    complement(71758..72555)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="Sbal_4460"
FT   misc_feature    complement(71902..72240)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="Sbal_4460"
FT   gene            complement(72615..72905)
FT                   /db_xref="GeneID:4841336"
FT                   /locus_tag="Sbal_4461"
FT   CDS_pept        complement(72615..72905)
FT                   /locus_tag="Sbal_4461"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   son:SOA0146 ISSod1, transposase OrfA"
FT                   /db_xref="GI:126090306"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="GeneID:4841336"
FT                   /translation="MSLKKSHKSYPQAFKDEAVLMVLEQGYSVADAAKSLGVSTSLLYN
FT                   WKEKHEALKQGITLEESERDELKRLRRENKELRMEKEILKKASAFFAREMK"
FT                   /protein_id="YP_001041761.1"
FT   misc_feature    complement(<72750..72896)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="Sbal_4461"
FT   gene            72947..73996
FT                   /db_xref="GeneID:4841339"
FT                   /locus_tag="Sbal_4462"
FT   CDS_pept        72947..73996
FT                   /locus_tag="Sbal_4462"
FT                   /gene_family="HOG000239585" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="restriction modification system DNA specificity
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: stl:stu0708 type I
FT                   restriction-modification system specificty subunit"
FT                   /db_xref="GI:126090307"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="GeneID:4841339"
FT                   /translation="MSDGIRPEQINRKTEIFINDEFYHKQSDKWLREGDIVMVQSGHVG
FT                   HTAVIPPELNNIAAHALIMFTDPKEEVSPYFLNFQFQTENIKTKLSEITTGNTIKHILS
FT                   SEMKDFEMFFTDFEEQTAIGNTFQKLDSLINQHQQKHDKLSNIKKAMLEKMFPKQGETI
FT                   PEIRFKGFSGEWEEKELGSVTQITMGQSPSGENYTNNSNDFILVQGNADLKNGFVVPRV
FT                   WTSEVTKTATQGALIFSVRAPVGEVGKTNYDVVLGRGVAAINANEFIFQQLKKLKSDNY
FT                   WHKVSAGSTFDAISSTELDSTLIWVSSDSEQTAIGNYFQKLDTLINQHQQQITKLNNIK
FT                   QACLSKMFV"
FT                   /protein_id="YP_001041762.1"
FT   misc_feature    72986..73990
FT                   /note="Restriction endonuclease S subunits [Defense
FT                   mechanisms]; Region: HsdS; COG0732"
FT                   /db_xref="CDD:31076"
FT                   /locus_tag="Sbal_4462"
FT   misc_feature    73466..73957
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="Sbal_4462"
SQ   Sequence 74000 BP; 21633 A; 16444 C; 14945 G; 20978 T; 0 other;
     GATGCCGTCA TGAACACCTT TAAAAAAGAA GCGGATTTTG AACAAGCCTT TGTAGAGGCA        60
     CTAACCAATA AAGGCTGGGA AAGCGCCGTT TTAAAAAATA AAACTGAAGC TGATTTACTG       120
     CAAAACTGGG CCAATATTTT ATTTGAAAAC AATCGCCAGC GAGACCGATT AAACGATGTT       180
     GCGCTTACCG CCAGTGAAAT GCAGCAAATT ATTGAGCAAA TAAAAGAACT CAGAACCCCA       240
     TTAAAACTCA ATGGCTTAAT CAACGGTAAA ACCGTGGCCA TTAAGCGCGA CAATCCCGAC       300
     GATAAAGAGC ACTTTGGTAA AGAAGTCAGC CTCAAAATTT ACGACCGCCA AGAAATAGCC       360
     GCTGGCCAAA GCCGCTACCA AATTGCGCAA CAACCCCTAT TTGAACGGGG CAGCCCATTG       420
     CGTAATGACC GGCGCGGCGA TGTGCTCTTA TTAATTAACG GCATGCCTGT TATCCATGTG       480
     GAGCTTAAGC GCAGCGGTAT TCCTGTTAGT CAGGCCGTTA ATCAAATCGA AAAATACACC       540
     AAAGAAGGTA TTTTTACCGG CCTATTTTCA CTTATCCAAG TCTTTGTCGC TATGCAGCCG       600
     GATGAGACGA AGTATTTTGC CAACCCCGGG ATGGAGGGTA AATTTAACCC CGATTATCAA       660
     TTTAACTGGG CGGATTTTAA TAACGAACCA GTCAATCACT GGAAAGACAT TACAGCAACG       720
     CTGCTGTCCA TCCCCATGGC GCACCAGCTC ATTGGTTTTT ATACCGTCGC CGACGATACT       780
     GATGGCGTGT TAAAGGTGAT GCGCAGTTAC CAATATTACG CCGCCAATGC CATCTCCGAT       840
     AAAGTGGCTA AAACTAACTG GCAGCAAATG GGCAGTAACG CAAATAACAC TGACCGTTTA       900
     GGTGGTTATG TTTGGCATAC CACTGGCTCG GGTAAAACCA TGACCAGCTT TAAATCGGCG       960
     CAACTCATTG CTCAATCGAA AGATGCCGAT AAAGTCATTT TCTTAATGGA TCGCATTGAG      1020
     CTTGGCACTC AGTCTCTCAC CGAATACCGC GGCTTTGCCG GTGATGGTGA AGATGTGCAA      1080
     GCAACTGAAA ATACCCATAT ATTAATCACT AAACTCAAAA GCAGTACCCC ATCAGAGACG      1140
     TTGATTGTGA GTTCGATTCA AAAAATGAGT AATATTTTTG AAGAGGTTGA CGATACGGGT      1200
     ACTGCGACTA ATTCAGCTGA TATCGAAAAA ATTCGTGCCA AGCGCTTAGT GTTTATTATT      1260
     GATGAAGCAC ATCGTTCAAC CTTCGGCGAT ATGCTTATCG CCATTAAAGC AACCTTCCCC      1320
     CGCGCATTGT TTTTTGGTTT CACTGGCACG CCCATTCAAG AAGAAAACGA AAAAAAGGGC      1380
     AACACCACCA CTACGGTATT TGGTAATGAG TTACATCGCT ATAGTATTGC TGACGGTATT      1440
     CGCGATGGTA ACGTACTGGG ATTTGACCCT TATAGAGTCA GCACATTTAA AGACAAGGAT      1500
     ATAAGGCAAG CCGTCGCTCT TGAACAAGCC AAAGCCGATT CGGTGGCCGA TGCACTATCA      1560
     ACCCCCGCTA AAAAGAAAAA GTTTAATTAC TTTATGAATG ACGTCGCTAT GGCAGGTCAT      1620
     AAAAATGCTA CCGGAAAGCA CATCAAAGGC ATAGAAGACC ATGTGCCTAA ATCGCAATAC      1680
     CTAACCGATG AGCATCAAAA ACAAGTCGTG AAAGATATTC TGGACAACTG GGAGGTACTC      1740
     AGCCAGGCCA ATAAATTTCA TGCCATTTTA GCCACTAATA GCATTAGCGA GGCCATTGAC      1800
     TACTATCGCC GCTTAAAAGA TGCTATGCCA ACACTGAAAG TCTCTGCATT ATTTGACCCA      1860
     AACATTGACA ACGATGGCAC TGGCAATCGA GGGCCCAGCT TTAAAGGTGA TGGCCTAGAC      1920
     GAAATAATGA CTGATTATAA CGTGCGCTAT GGCCAAGATT TCGACTTTGC TAAACACGCT      1980
     AAATTTAAAA AAGATTTAGC CGCACGACTT GCCCATAAAA AACCTTACGA GCGTATACAC      2040
     ACCGAACCTG CAAAGCAGCT AGATTTACTG ATTGTAGTAG ACCAAATGCT GACCGGCTTT      2100
     GACTCCAAAT GGCTTAATAC CCTGTATTTA GACAAAGTGA TTAAGTACCA AAATATTATT      2160
     CAGGCATTTT CACGCACCAA TCGCTTATTT GGACCAGACA AACCTCACGG AACGATACGT      2220
     TACTATCGCT ACCCACACAC GATGGAGCAG CATATCAAAG ACGCGGTAAA ACTCTATTCT      2280
     GGCGATAAAC CCATCGGCTT ATTTGTGGAT AGGCTTGAAA GTAACCTTAA AGCAATGAAT      2340
     GAGTTAGTTG CAGATATCAC TGAGTTGTTT GTAAACGCTG GTGTGCAATA TTTTGACAAA      2400
     TTACCAGAAG ACACCGCAGC CTGCGCTAAA TTTGCCGACT TATTTAAATT GTTGAATCAA      2460
     CATCTTGAAG CCGCCAAGAT ACAAGGCTTT AACTGGAATG AACTTGTTTA TTCATTTGAG      2520
     GAAAATGAGA CGAAACATGA CGTAACACTG GCTATTGATC AACAAATCTT TTTAAGCCTG      2580
     GTTCTACGTT ACAAAGAACT CGTTACCAAA GTCCCCAGTG ACGGTGGTGG GGATACGCCA      2640
     CCATATGATA TTAGCGGCAA CATCACCGAA ATGGATACTG GAAAAATCAA TGCAGACTAT      2700
     ATGAATAGCC GCTTTGATAA ATATTTAAAA GAGCTAAATC AACACCAAGA CCATACAACC      2760
     ATTGAAGGTA CGCTTAACGA GCTGCATAGT TCATTTTCAT CTCTCACCCA AAGCGAGCAA      2820
     AAATACGCCA AACTTTTTTT GAATGATCTA CAGCGTGGTG ATGCTCTACT CACAGATGGG      2880
     CATAATTTTA GAGATTATAT TAATGACTAT AAAAATCGTG CAGAAAACAC CCAATTAAAT      2940
     ATCGTTGTTA ACGCATTAGG TTTAGATGTC AGTCTGCTTA CCCGATTAAT GAACGATAAT      3000
     GTGAACGAGA AGAACATTAA CAATTTTGGT CGATTTGATG CGCTTAAAAA CACTGTAGAT      3060
     AAAACAAAGG CGAAAGCTTA CTTTGAGAAA GTGGAAGGCA TGGTCATCTC CCCCTTTAAG      3120
     CTGAACATAC GTATAGATCA ATTTCTTCAA ACGTATATTG TTGGACGAGC AGATGCTCTT      3180
     TTGAGCGATG ATTAAGCAGA CTTATTTTAC CGTAACGTTA ACCCAACAAA ACTTACAGGC      3240
     ATAAGTTAAA TACCGTGAAT CAGTTCTCTA GAAATTTGAT TCATTTTAGG GCAAAAAACC      3300
     GCCCCAGAAT AGCCGCAAAA AGGCGTGAGG GCGGGTTTTA GCGGATAAAA TACAGTCTGG      3360
     GGGCAGAGTG ATTCACGAAT GAGTTTCTAA CTAAACGACT ATGAGGTGCC ACTACAGAAA      3420
     TCTAGCGCTA ACGCCACCGA GCATGCGCGC GAACCGGTGA GCGTCGCAAG GGATAGAACC      3480
     TGTCTCTTGA TCAGATCTCA TAGGCTCTCG CCATCAGCAA TCATTTCTTT CGCCACTCGG      3540
     TAGCCTACAA CATGAGACTG TAATGTACTC CAACCTTCCC AAACGGCTGT CCAGCTTGCG      3600
     ATACCTGTTC GTTTTGTATC GGTAAAACCA CCCAGTTTTG CAATTGATTG ATACGCCCAT      3660
     TTCAGGCTGG GTGCTCCATT ACCTTTATCC CCTCTAGGCT TATTAAATCG CATTAACACC      3720
     TTCCATTCAT CTTCTTCGAG TACTGTGTCA CAACTTTGAC CCTCTACGGC TTTAGCTTCC      3780
     TCAACCAGCC CTTTCTTACG TAAATAATAA GGGATGGTGA TAGCTTCTCT GAGTTGGAGC      3840
     AAACGGACTC CAATGAATCA GAGCGAGAAC CGAACATGAG AATACCTTTT TTAAGTCATT      3900
     GTTGAAAGCC ACTGAAGTTT ACAGAAATTA GTGATTCCAC GCAAAGACGC GTAGAGCCAA      3960
     AATCCCTTCT GCCGGACTTC CTGTCTGATT CGTGTCGGAC CATGTTTTTT TCTGATGTGC      4020
     TTATCAACCA GATGTATGAC CAGACGCTCA TCATCCAGAT AGCCGCTCAC GATTAACCGC      4080
     TGCAATGCGC TATCAACACA CTCACTGTTT TCCGTCATTC TGAGCAATGT TCTGCTCAAC      4140
     TCCCCCGATG AGTAATCGCG TTTTGCCAGT AATGACACTG CATGGTCATA CAGTTCCTGT      4200
     GCGTTCATTC CTGACTCCCG TTGTAATAAA TGACACCGCT TTGGATAGAA AGTCCTGCAA      4260
     TTTTAGCGAC CATCAAAGGC CAGAGTGATA CTTTCCGCTT ATGTGTTTCA AATAACGTCC      4320
     TGAGGTAACG CTGTGTTCCC GGTAGCAACA GGCTTTCTTC CAGCCCCTCG CTGTAATCAA      4380
     TGGCTTTTTT CATATCCGAG GCGGCATAGC TGTAATATTT ACTTTTCGAT TGCAGGATAT      4440
     TTTCCTCAAC CAAAAAACGC CGCAGCAGGG TGGCTGACAG TGCGTAGCCA TATTTATATA      4500
     ACTCGCTGGA TAATGTTCGC ACAGATGAAC CTGACATCGA TTCAAAGGCG TTTACGAGTT      4560
     GTTCTTTTGG TGTTGATGTT ACGCAATCAT CAATTAAATC AAATCTTTCC ACTTCTATTG      4620
     CAAAACGAAT ATAAACAATC AGCCCTTTAT TTTTGGCTAT ATCCAGAAAT GCCTGGATAT      4680
     TATCGCCATC ATTCCCGCTG GCTTTTTTGT ATAGTTGATA CAAGGAGACT GTGTAGAAAA      4740
     AAGCGAACGC TTTAATTGCA TGTTCTTTGG CTTCCTCTTT CCGTCCATCC TCTAGCAGAG      4800
     CACTAACAAA TAATTCATTC CACTTACTGT TATTGGTGTA ACGCTTATCC ATACCAGATA      4860
     ATAACTCAAT GGCTTCGTCA GCTCTCACTT CCTCTAACAG TAATCGGGCA TAATCAAAAT      4920
     AATGGTCAGG GTGGCTGAAC TCCCCTTTTT TATAGGTTGT TTTTATAAAG TTGATATCTT      4980
     TGATAATTAC GCTGATACCC AACGATTCTT GAATATGTTT CTTTTGATAG TACATATCCC      5040
     GTACAGCACG TAAAATATCG GTACCTAACA ACTGACGATA GTGTTGAAAA ATTTCAAAGC      5100
     TGAAATAAAA CTCACGCTCG ATGACCGTAA ATATTTTTTT TGCAATGAAG ACTGGTTCAC      5160
     TTTTTTTTTG TGCCGCCAGT GATTTCATCC ACGCATCAAA CAGCACCTGG TAGTAATCCA      5220
     TCCAGCTTCC ACTTGAGGTA TCAACGTTCC CCGTGAAGTC TTCAAACTCC AGCATGATTT      5280
     TGACTGCTAG CCCTTCGACT TGCTCAGGCA ATGTGTTAGC CAGTTTCTCA AGGGGCTTCG      5340
     CTATACTGCG TGTTAGCTCA TCAAACAGCG AATCTGCGTC GTAGTAATCA TAAAAGCGTT      5400
     TACTTTTTGC TCGTCTGGCA TACTCTTTCT CGATGGCTTT GAGTCTGTCT GAGGTGGATG      5460
     ATAAATACCC GTTTATCAGT GCGTCTTTCG CTTGCTTGTT GTCTTGTATC AGGTCATGGA      5520
     GTGCAGTGAG CAACGCTTCG TGACTCATTC CTGAAAGTTG TTCTGTCTGT TTTTTGGTTA      5580
     ATTTGACCAT TGGATACCCC TTTAAATCAT CCTGTGTTCC GTCATTCGCC GTTTTATCTT      5640
     AATGGGTAAT ACTCGCTCAC TTCTCCTCCG GCTTACCAGA ACGCGCTGTA AGCGATTTTT      5700
     AGTTCGTGGA ACTACCTCCC CCTCGCTACG CGCCATAACG TATTAAGAGC CAACGTTATG      5760
     GAAAGGAGGA GGCTTCCACG GTTACCGAAA GAATGAGCTT TTCAAGCTCA CGCTATGCTT      5820
     ACCCTGCCAT AAATAACAGG GTTTGGCATG AACGCTAATT GATCAAACAC GAGCCAATAT      5880
     TTATGAGTCG GCCCATTGTG TTGAATGTAG CGAGATTTAA CCGCCTTTTT AGCCGCAATG      5940
     ATGCTCAAAC CATTAGATAA ATCGTCTGAA TAATAGGGTT TCTTGGGTAA ACGCTGTTCG      6000
     AAAAGGTTTA ATTGATGGGC TGCATTCAAA AAACACCGCT CAAATGGCGG CTATTTTGTT      6060
     GTTTTTTTAT GATCATGTGG TAGTATTTCC CTAGGATTAT TCCTGAACCC TGAACTCTCA      6120
     AGCCTCCCGC CAAGTTGGAA TGAGATTCGG GGTTTTTGTT TTTATGCCCG TAGCTTACGC      6180
     GATTTTTAAT ACTCAATCCA CGATCATTTT TTAGCTACTG GACCAAGCGC TTAACCAGCG      6240
     TTATTAGGCC TGAGCTAACA AGCCATTTTC CTGATAGAAC TGCTCAATGA ATTTGGGATG      6300
     TTCTGTGATC TGCTCTGCTA CCATCAGCAA ATCAGAAAGG TACATGGCAT CACTATCTAA      6360
     AACCCTCCAA TTGCCATACA TGACATAGAG AATAGCTACG CTCATTTCAA CATCGTGAGG      6420
     CAATACAGCG CCAGATAACA CATGCTTTTT AAGATACGGG ACGGCTTCAT ATTCAGAACT      6480
     AACACTGGGG AGAGTTTGAA ACATCTCAGC GACATCTGGC GGAACGCAAA CCACTTGTTC      6540
     TTGGTTAGAT CTTTCTTGTG TTTTTTGCTT TTTTAAACGG GCTTGCTTAG CTTTATTTTT      6600
     TGCCCTTTTT ATTCTTTTGT CGGTATTACT CATAGATCTC TTTCCTGTGC CCTATCAAAG      6660
     CAGTCAGAAT GACTAATTTG CTATCTTGAA TTTCACAAAG CACTCGATAG TCACCGACTC      6720
     GATAACGCCA AAAAATACCC AAATCCCCCT TCAGGGGCTT TCCTGACGTT CTCGGGTCGT      6780
     CCAATATCGC TATGCGCTGT TCCAAAAAAT CCAGAATGCG TTTAGCGTTC TGCTTATCCA      6840
     TTTTTTTTAG TGATTTTAGC GCTCGTTCTG AGTAATCAAT TGTCCAAGCC AAGAGACGCC      6900
     CTCACATCTT CGCTACTGTA GGTTTTTTCA GCCCCTTTAC GAATATCAGA GACAATCTGA      6960
     GCCGCAAGAT AGTAATCCTC CAGATCCTCT AAATGAGTCA AAATAGCTTC TCTGGCGTAA      7020
     AAGGTTTTTG TTCTACCGGT TTGATCTGCC AAAGCAGCCA GACGGGTTTC AATATCATCA      7080
     GGTAACCGTA TTGCTAACAT AATTAAATCC TCCATTGCTA TACACGTATA GCATACGCCA      7140
     TTTATCGATT TAATCCACGA TCATTTGATC AATTAGCGTG TACTTTGCCA AACCCTATCA      7200
     TTCATGGGAA CGCGGGTTAA ATGAGAATAC TAATGGCTTG CTTCGCCGGC TGTTTCCAAA      7260
     GGGAATGTGT TTTTCGTCAC TGACAAAAAA ATGCATAGAG CAAGCGCAAT TTTTGATCAA      7320
     CATGAGGCCG AGAAAAGCGT TAAACTATCT CAGCCCGTAC GAATTTTTAA CTGGCAAGCG      7380
     TGTGTCGCTT ATTGCTGCGA TCTAGCAGAT ACCCTAAAGT TTGTCCCAAA GACCTCTGTT      7440
     GCTCGACTTT TATTCAACAT AGTAAGGATA TCTGTCGCAG GTATAGGTTT TAAAAAACCA      7500
     CGAAGCTCTA GCTGGTATAG CACAAATAGG ATATCTTTTT GGACTGCTGA AATTCTCATC      7560
     AAACATCACT CTTATTCATG TGTGATATGA TTAAGATATC AAATTTAAGG GTAAAATAAA      7620
     ATGAAGTTGG CTACCTCCCT GGCATTATCA AGTCTGTTGT TTACGCCGAT CACACTTGCC      7680
     CAGGACTTAT TTGCAGAAAG CACTAAATCA ACGTTCAATG ATGCGTTAGC GAGCCCATTT      7740
     ACAGGATATG TGGTGGGCGC GTTTACCGCA ATTATCATCA TTGCTTTAAT TGTGTACGCG      7800
     CTCAAAGACT AATCACTCAT TAAGCTGGTG TTTACCCTTC AAATTACGCA AGCGCTGTAA      7860
     CCGATTGAAT ACCTGCAAAA TAAGATTGAC GCCCTTAGCC TCATTAAACG CTTTTAAATC      7920
     ATGATAACCC GGGTTCCTGT AATTATGCCT ATCCGTGGTA TTTATCACCC CCGTCGCCTG      7980
     GCATGTAACG CACTTACCAC TGACACAGTA ACGCTTAGGC GTCTCACAAT GACAGCCGTC      8040
     GCAGCGATGA ACAGATGTGT ACATTCGCTG AAGTGCCAGC ATTGCCTCAA GGCGTTCACC      8100
     TTCAATTGAA GGAATATTTT CAGACATAGG AAATGTTATC TTAGAAATAA ACGCGTAAAA      8160
     CCCAATCGAC GAATGCCCTT CCCGTTGTAA CAGGACGTGA AGCATATTCA AGTACGTTGC      8220
     GGCCTTCAAA ACGGCCTGTA ACCAACGTGG CACCTTTTTC AACATGCCAA TAATGATTAT      8280
     TATGCTTAGC TGTAAATATT CCGTTTTCTT CAATGGCAAT AATATCTAGC GAGTTCAATG      8340
     TAGGTCCTTT TTTAGGTTGA CACCATGATG ATGCGTACAA CGATGTTCAA TATCAAGCTC      8400
     AATCAACCGC TGATTCATAT GGTCTGGGTG TTGCCAGTAT ACCTCACCCT TCACCGGTGC      8460
     GATTTGTAAT GTTAAATGCT GAGCAATATC ATCATTTTGG CTATCCGGTG CCCCGATTAA      8520
     CCACACAGGG TAAGGACTCA CAAACGCATC TAGTTCCAAC TTTTGCGCCA TTGCCAACAG      8580
     AGCTGATGCA GTTGCCGCCT CAGGGACAAA AATCAGTTTT GCAATGATGC TATTGCATCT      8640
     TGAACAGGGA AAGGATTTAT TTTCAATGAC CTGAACATTA TCTGGCACGT TTTCAGTGAA      8700
     AATAGGAAGT TGTTCATTCA ATGGCTTTTG AGCTTGATGT TGTAATAATG CATCCGTCAT      8760
     TTGCTGCGCA ACAAACGCAA TGACAGCCTT GTTATCACTC GCATCCACAT TCATGTAAGG      8820
     CTGAAGCTGC GTATTTCCTT GGGTGGTTTC ACTGACTATC ACCCCACCGA TGGCCTCATG      8880
     ACCATCGCGA AAAATCACGT AAGCCTTACC TTGTCTTATC ACCGATACCC CTGGAGGAAG      8940
     GGCTAATTTT TTTTGTGCCA TTGATGATTT TCCCACTATT TTGCACGTGC CTGGACGAAC      9000
     TTAGCGCGGC GCTGGTAGTT CTCTTCATCA TAGGGGTGCG CTTGGAATTC GGAAATTATC      9060
     CCACGCTAAG CGATCTTTTC TTTGTCCGAA ACCGAACAAT TACGGACAGA TACATAATTT      9120
     CATGTACGAA AGCAAGCTAC ATTACTTTCG TACACAGCAT GCATTACGTA CATCTATTTC      9180
     GGTCAGTACC TTTAGTTATT AAGCTAATTT GAGGTGTTCG AGAAAGCCAA AGCCCTGTCA      9240
     CTACTACGAT TTAAAGTTCT TAACGTGGGA TAATTTCCCT TTTCCAAGCG CACCCCTACC      9300
     ATTGCCAAAG CAGCTAAGTT GAATGAGCTA AAAACCGATG AATAAATTAT CTAAAGATTT      9360
     GATTCATTCT AAGGCAATAA TAAATGCCCC GTTGGAAGGA ATATACGGGG TGAAATGGGT      9420
     CAGTTTTATG GCTCGCGTCA ATCAGTCTGG TCTAGAGTTA TTCACTAGCT CATTTTTGGA      9480
     CAGAAACATT TCAATCTGCC AGCAGCCCTA ATCTAAGCAC ATCCACTTGG AGAAGAAACA      9540
     GGTAGATTTA CTTCGAGAGC TTTTCCTTGG AACCATTTTC GCCATCCTGT AGCTTGTCTT      9600
     GATACATGCC CAAGTTGTTC AGTCAAAGTA ACCAGAGCGC CATGAGGTAA GAATTTTAAT      9660
     TCCCAAGCTA ACATTAATAA ACTTTGTACG GTTTCTAAAA GCGCACTAAG TTCTAGTAAT      9720
     AAATCTAGAG CTCGCAATAT TCCTTCCGGA GATTTTCCGT ACAAATTAGC TTGAACAGAA      9780
     TAACGAATAC ACTTCGTGAG TTCGTTGAGG ATTTGCTCTC CGGTTGTAAA GCGAAATGCT      9840
     TTGGGCAAGT GTTGATGTTG GTTCCAATAC AGTTTGTACA ACTTTTGTAA ATCATAGTAG      9900
     AGACGATTAT GACGAAACTC TTTATTCAAA ATTCAAACCT TAAATATCAC CATCAACTCG      9960
     CAGCAGAGTT GCTGCAATGT GTAAAAGCTT CGGGAAGCAG TCAACAAAAA TCTGCTAACG     10020
     CTTTAAAATT CCCCAAACTA TGCCATGAGC TGTCAACCGA AATCTTAACT AATACATATC     10080
     AACCTTACTC TTATCATCAC TTTGCAATCA CGGAACCTAA ACTTAGAGAA ATATATGCCC     10140
     CCGCATTTAG AGATCGCATA GCTCAAATGT GGATTGCACT ACAAATGGCA CCTATTATGG     10200
     AAAATCAATT CATTGATGAC ACCTATGCCA ATAGAAAAGG TAAAGGAACT CTTGCTGCTA     10260
     TTGCAAAAGT TCAAAAACTA ATGCGCCAAC CAAGACACAC TTGGGGGCTA CAGCTCGACA     10320
     TTTACAGTTA TTTCAACAGC ATTAATAAAA AAGAGCTTCT GACGCAACTA TACAATCTCA     10380
     TTTACAATTC AAATTTAAGC GCATTGCGCC AATATTGCCT AGCAAATCTG ATAGAAAAGA     10440
     TCATAGAACA GGATGCCACG AAGCTACAAA ACGAGCGAAC TGGAGACCAA TACTTACTTA     10500
     ACCAAATCCC GCTCCATAAG AAACTACAGT TTAACAATAC GCAACAGGTT GGGTTGCCAA     10560
     TCGGTAGCGT TACTAGCCAA CTCTTCGGTA ATTTTTACCT TAACAACCTT GACCACGAAA     10620
     TAAAACACAC ACTGAAGGTT AAGGGGTACG TTCGATATAT GGATGATTTA TTTATCCTAT     10680
     CTGATTCGCC TGAAAAATTG CAACAATGGA AAGAGCATAT TGAATGGTAT CTCACTTCAC     10740
     ACCTGCAATT AAAATTACAT CCTACAAAGG TGCATTTAGC ACCTATTGAG GAGGGTTTTG     10800
     ATTACTTGGG ATTCCGTGTA TTTCCCCATT ATAAACATAT TCGCAAAACC ACTATTTCAT     10860
     CACTAAAAGA GCGTTTGCGC TACTTTAATT CGATTCTAGA CTCTGGTGCG ACAAGCGTCT     10920
     TTTTAAAATC TAGACCAAGT CGGGGGAGAT GGAGTAAGAA TGGCATCCAT TACGCGCCAT     10980
     TTTATACCCA ACTAAAAGCC ATGCAATCAA CAATCAATAG CTATTACGGA CTACTTAGTC     11040
     AAGCCAATCA TTGTCAATTG AGAAAGCAAA TATATCATAA GAATTTTGGC GAACTGAAAC     11100
     GTTATTTATT ACCCAATAAC GGTTATTACA ATCACTTCAC AATAAAGAAA GGTCTTCACT     11160
     TTAATAAGAT GGCTCCGGAT ACTTTATGTT GGCCTGAGAC GCAGGATGCG TAGTTCGTGT     11220
     TGCTCGGATT GTTGCTGTTG ACGTTACCAT TGTTGAGGTT CACGTTGTAA TAGTTAGAAC     11280
     CATCAGGTGT CACCGACCAA TAGTTGTTGT TGGTCGGCCA ACCGCGCGCG TTTGCATTTA     11340
     TTGTTTAACT CGAAGTGTTG CCTTTCGACT TACTTCCCTT GAATACCCAT AAGGTCATAA     11400
     ATGCCGATAA CATACCAGGG CCCACATGTT AACATCGTAA CGTTAACATT CTCTGAGCAC     11460
     GACATTGTCG CTATGTACCC TGTTAATTTT CCGAGAACCA TCTTATTAAA ACGTTATATC     11520
     GCTTGCTTAA CAGCAATCAA CAACCAATCT AATGAAGAAC TTGAAGCTTT CGTCGTCATC     11580
     ACTTTATTGA CTATTGCTTC GGGTAAAAAC AATCGAACAT ATCGACGATT TAACAGTTCT     11640
     TCATTACAAG ATGTCTTCTC TTCAGTATCG TCCATTTGAG CACACTGCTC TTGCCTCCAA     11700
     GACTCCCACC CAGAAAAGTC GATGATTGTT TCCAATGCAA TAACAGCCTC AGTACCTACA     11760
     TCGATTCCGG CTTGCTTTAA TGATTCAATA GGGAGCCCGC CATACAAAAC CTCTCTTCCA     11820
     TTCAATTTCT TAACCTTTTT CTTTAACACC TTCAATGTCG GTAATTGGTC CTGTTTAGAT     11880
     GCCCACTGCT GCCAACCAAA GAGTGATTGC TCGTAGAAAC GTACAAAGAT CCCCTCCTTT     11940
     ATGCCAACAA TACGTTGACT GTTTTCAACC AATGCTAATT TAGCCTCAAT ATTCGCTTCT     12000
     CTTCCCTCTA AAAAGTGCCA GATGTAACTC TGGCACTTCA AAACTAAAAT TAAAAATTAA     12060
     AACGTTAAAC TCTAAACGCT CAACTTTAAG GATTTGAGAC GCAGGATGCG TAGTACGTGT     12120
     CGCCCGGACC GTTGCTGCTG ACGTAACCAT TGCTGAGGTC CACGCCGTAA TAGCCAGAAC     12180
     CATCAGGTGT CACCGACCAA TAGTAGGTGT TGGCCGGCCA ACCGCGCGCG CTAAACATAT     12240
     TGTTGTATGT ACCGAACAGT TCCTTTTTTA ACTCGTCTTT TGTTGCTAAG CGCCAGTTAG     12300
     TTCGTTCGCC GAGATGAAGG GTGTTGTAGG TATTGCACAG TGTCTTTGCA TTAGTCCAGT     12360
     CGAATAGGTA AAAATTACCA GCTGGGCCGT AAGTTCCATT TTCAGTATTA GTATTATTTG     12420
     TTGCACTGCC ATCAATGCTG TCTAAATAGG CGACTGAGGG TGAGCTGGTA AACAACTTAC     12480
     CACCACCAGT ATCGAAGATG TCAATACATG CACCAGCTAA AGAAGAACAT ACAGTGACAT     12540
     TCACCGTATT ACTGGTGATA ACGTCCTTGG TGGCGGTTAC TGTGGTACTG CCCACTTCAA     12600
     CACCAGACAA AAAACCATCA GGGGTCACGA CCGCGACCGC AGTATCGGCG GAAGTCCATG     12660
     TCACTACGCG CGTCACATTT GCACTGCTGC CGTCACTGTA TGTCGCGATG GCTTGCAAGG     12720
     CTTGGTATTC GCCCTTAGGC ACCACCACAG GTGAAGGCGT CACTTGAATT GCCGTAATCA     12780
     CCGCATCTGC TGTTACCGTC ACTGCCACCA CATTACTGGT GATACCGTCC TTGGTGGCGG     12840
     TTACTGTGGT ACTGCCCACT TCAACACCAG ACAAAAAACC ATCAGGGGTC ACGACCGCGA     12900
     CCGCAGTATC GGTGGGAGTC CATGTCACTA CGCTCGTCAC ATTTGCACTG CTGCCGTCAC     12960
     TGTATGTCGC GATGGCTTGC AAGGCTTGGT ATTCGCCCTT AGGCACCACC ACAGGTGAAG     13020
     GCGTCACTTG AATTGCCGTA ATCACCGCAT CTGTTACCGT CACTGCCACC ACATTACTGG     13080
     TGATACCGTC CTTGGTGGCG GTTACTGTGG TACTGCCCAC TTCAACACCA GATAATAAGC     13140
     CTGCAGGCGA CACAGTGGCC GTCGCGGTAG CGCCTACCGT CCACGCCACT GAGCTGGTGA     13200
     CATCAGATGA AGTCGTATCA CTGTATGTCG CCGTAGCAAC TAACTGCGCG GTCTGACCTT     13260
     TGGCTACATT GACTGTCGCT GGGGTTACTT GAATAGCCGT AATCACCGCA TCTGTTACCG     13320
     TCACTGCCAC CACATTACTG GTGATACCGT CCTTGGTGGC GGTTACTGTG GTACTGCCCA     13380
     CTTCAACACC AGACAAAAAA CCATCAGGGG TCACGACCGC GACCGCAGTA TCGGCGGAAG     13440
     TCCATGTCAC TACGCGCGTC ACATTTGCAC TGCTGCCGTC ACTGTATGTC GCGATGGCTT     13500
     GCAAGGCTTG GTATTCGCCC TTAGGCACCA CCACAGGTAA AGGCGTCACT TGAATTGCCG     13560
     TAATCACCGC ATCTGTTACC GTCACTGCCA CCACATTACT GGTGATACCG TCCTTGGTGG     13620
     CGGTTACTGT GGTACTGCCC ACTTCAACAC CAGACAAAAA ACCATCAGGG GTCACGACCG     13680
     CGACCGCAGT ATCGGCGGAA GTCCATGTCA CTACGCGCGT CACATTTGCA CTGCTGCCGT     13740
     CACTGTATGT CGCGATGGCT TGCAAGGCTT GGTATTCGCC CTTAGGCACC ACCACAGGTG     13800
     AAGGCGTCAC TTGAATTGCC GTAATCACCG CATCTGTTAC CGTCACTGCC ACCACATTAC     13860
     TGGTGATACC GTCCTTGGTG GCGGTTACTG TGGTACTGCC CACTTCAACA CCAGACAAAA     13920
     AACCATCAGG GGTCACGACC GCGACCGCAG TATCGGTGGG AGTCCATGTC ACTACGCTCG     13980
     TCACATTTGC ACTGCTGCCG TCACTGTATG TCGCGATGGC TTGCAAGGCT TGGTATTCGC     14040
     CCTTAGGCAC CACCACAGGT GAAGGCGTCA CTTGAATTGC CGTAATCACC GCATCTGTTA     14100
     CCGTCACTGC CACCACATTA CTGGTGATAC CGTCCTTGGT GGCGGTTACT GTGGTACTGC     14160
     CCACTTCAAC ACCAGATAAT AAGCCTGCAG GCGACACAGT GGCCGTCGCG GTAGCGCCTA     14220
     CCGTCCACGC CACTGAGCTG GTGACATCAG ATGAAGTCGT ATCACTGTAT GTCGCCGTAG     14280
     CAACTAACTG CGCGGTCTGA CCTTTGGCTA CATTGACTGT CGCTGGGGTT ACTTGAATAG     14340
     CCGTAATCAC CGCATCTGTT ACCGTCACTG CCACCACATT ACTGGTGATA CCGTCCTTGG     14400
     TGGCGGTTAC TGTGGTACTG CCCACTTCAA CACCAGACAA AAAACCATCA GGGGTCACGA     14460
     CCGCGACCGC AGTATCGGCG GAAGTCCATG TCACTACGCT CGTCACATTT GCACTGCTGC     14520
     CGTCACTGTA TGTCGCGATG GCTTGCAAGG CTTGGTATTC GCCCTTAGGC ACCACCACAG     14580
     GTAAAGGCGT CACTTGAATT GCCGTAATCA CCGCATCTGT TACCGTCACT GCCACCACAT     14640
     TACTGGTGAT ACCGTCCTTG GTGGCGGTTA CTGTGGTACT GCCCACTTCA ACACCAGACA     14700
     AAAAACCATC AGGGGTCACG ACCGCGACCG CAGTATCGGC GGAAGTCCAT GTCACTACGC     14760
     GCGTCACATT TGCACTGCTG CCGTCACTGT ATGTCGCGAT GGCTTGCAAG GCTTGGTATT     14820
     CGCCCTTAGG CACCACCACA GGTGAAGGCG TCACTTGAAT TGCCGTAATC ACCGCATCTG     14880
     TTACCGTCAC TGCCACCACA TTACTGGTGA TACCGTCCTT GGTGGCGGTT ACTGTGGTAC     14940
     TGCCCACTTC AACACCAGAC AAAAAACCAT CAGGGGTCAC GACCGCGACC GCAGTATCGG     15000
     CGGAAGTCCA TGTCACTACG CGCGTCACAT TTGCACTGCT GCCGTCACTG TATGTCGCGA     15060
     TGGCTTGCAA GGCTTGGTAT TCGCCCTTAG GCACCACCAC AGGTGAAGGC GTCACTTGAA     15120
     TTGCCGTAAT CACCGCATCT GTTACCGTCA CTGCCACGGT ATCGCTGGTA ATATCACCAC     15180
     GACTTGCCGT CAGCTCCGTA TCACCCACGC CCACGCCACG CAACACACCA TCGGTCACGA     15240
     CCGCGACCGC AGTATCGGTG GGAGTCCATG TCACTACGCT CGTCACATTT GCACTGCTGC     15300
     CGTCACTGTA TGTCGCGATG GCTTGCAAGG CTTGGTATTC GCCCTTAGGC ACCACCACAG     15360
     GTGAAGGCGT CACTTGAATT GCCGTAATCA CCGCATCTGT TACCGTCACT GCCACGGTAT     15420
     CGCTGGTAAT ATCACCACGA CTTGCCGTCA GCTCCGTATC ACCCACGCCC ACGCCACGCA     15480
     ACACACCATC GGTCACGACC GCGACCGCAG TATCGGTGGG AGTCCATGTC ACTACGCGCG     15540
     TCACATTTGC ACTGCTGCCG TCACTGTATG TCGCGATGGC TTGCAAGGCT TGGTATTCGC     15600
     CCTTAGGCAC CACCACAGGT GAAGGCGTCA CTTGAATCGC CGTAATCACC GCATCTGTTA     15660
     CCGTCACTGA CACCACATTA CTGGTGATAC CGTCCTTCGA GGCATATACA GTCACGATTC     15720
     CTGGTGTATC ACCTCCAATC AAAACTCCTG GGTCGTTAAA ATAACCAACA TCTTGGTCAC     15780
     TTGTATGCCA ATCACTGACA CTTAAATCCG TTAATGCGTG AGATGAACCG TCAGAGTAGT     15840
     AACCGACTGC TTCGAAAGCT TGCTTATTGC CTGCCGCCAG TGTCAACTGA CTCACTCCTA     15900
     GCGTTGTTAG CGGCGATGCA CTGATATCTA TGCGCTCTAA TTTTGCCGTA AAATCTCCTC     15960
     CGGAATCACA GCCTGTTAAG AGCATTAATA GAGGTAATAC TATTATTGAA ACAAAATACT     16020
     TAAAAACTTT AGTCATGATA ATACGGCCTG TTTCTGATAT TGAAAGCTAG GAATGGAGAC     16080
     TTCAACTCTG CGATTTTTAG CTCGTCCATC TGCAGTTTGG TTATTAGCAA CGGGGTGCGA     16140
     CTCTCCCTCT CCTTGAACTT CAATTTGCGC TGGGCTCACC CCTAATTCAA GAAGCTTATT     16200
     CGCTACCGTT TGAGCGCGTT TCTCTGAAAG TGCTTGGTTA TAAGCCTCTG AGCCTATTGA     16260
     ATCAGCATGG CCTACAGCAA GCACTGCCAC TCTAGCTTGT GGGTAAGTAT TTAACACTTC     16320
     GACGACTTCC GCCAACTGCT CGATAAAATC ATGGCTGAGT TTGGTAGCGT CAAAACCCCA     16380
     AATGACATTC ATACTTTTCG ACGAAAAGGT AAGTGTTTGA GGTGACGTTT CAACAATGAC     16440
     AGTCTTAGTA GCAGGAGTTG ATAACTCTTT AATCAACGTT GGTTGAGCTG CATGACCAAA     16500
     GGCATAGGTA AGCCCTACCA AAAAGCCATG GCTATCATAT TTACCTGTAT TTGATTCACC     16560
     AATACTGTCG ATGTATTGAT AACCAGCGGA TAAACGAACA TTAGGTGTAA AGTTATAGTT     16620
     AACCCCTACT TCACCAAGAG GAGAAAGGCC GGTCGCATCT AGTTTATCTG AAGAAAGGTG     16680
     CGTTTTTTCC ATATCCCAAT AAGCAACGCC CAATCGACCG TATACACTCA GGTTGTCTTG     16740
     TAGATACCAA TCGTAACGTA GTGCACTTTC AATCAACCCC GCTTTAACAT TAACCGATGT     16800
     GGCATCCGCC TTTAAATCAT CGTGATATTG ATAGCCGACA TCCCAACTCC AAGCTGGAGA     16860
     AAACTGTAAT CCACTAGAAA CACCGAAGAT AGCGCCTTTG GGATTTGAGT GTTTATAACT     16920
     GTCGTCCGAA GCCCATTGAT ATCCACCCTT TGCTTCAATA AAAAACAGAG GGGACTCGGT     16980
     GCTGGCCCAC GCAGGAGCAA GTAATATATA GACTGGTAAA AGATATTTTT TCATCACGTT     17040
     CCACAAAGAT AGTAGTCGTT AATAAACATA GTCGCGCGAA TTCAGATAAT AAGTGCAACG     17100
     CTCGGTCATA ATGGTGAGGA GGGAGTTAGC TGCTGATAAG CTATCCCTCT TCCGACAAAA     17160
     GATGAGCGAG TAACAATGAA CTACCAGCAG CTAACTGAGG GGCAACGATA CCAGATTGCC     17220
     CTGCTATATA AAGAGAATTG TAGTTGTCGT GAGATTGGGC AGCGGATTGG GGTCAGTAAA     17280
     TCTACGATTT CCCGTGAACT CAGGCGCAAT GGTACAACAG CGGGTTATGT TGCGCAGAGT     17340
     GCTCAGCGTC AGTGTGAGCA CCGACGTGTT GTGGCGGCAA AGCGGGCTGT AAGCCAAAGT     17400
     ACTATTGAGT TTGTTGAGTT TGCTCTGGAG TGGAAGTGGA GCCCTGAGCA GATAAGCGCT     17460
     GTGGCAAAAT TGATTGGTCT GTCGGTCAGT CATGAGTGGA TTTATCAGTA TGTTTTTGCG     17520
     GATAAATCTC GTGGTGGCGT TCTGTATGAA CATCTTAGGC AGGGTAAGCG TCGTTATCGC     17580
     AAAGGGTATG GGCAGAAGCG AGGCGGTATC ACTGACGCTG TTTCCATAGC GCTACGCCCT     17640
     GCTATTGTTG ATGAGCGTGG TCGCCTTGGG GACTGGGAGG CCGACCTTGT GCTGGGTAAA     17700
     CAGGGAACCG GTGCAATCGT CACGCTGGCT GAGCGTAAGA GTCGAATTTA TCTGACAAAA     17760
     AAGGTTTTTT CAAAGGATGC GGTTGAGGTC AGCAAAGCGA TTATCTCAAT GCTGAGTGAC     17820
     TACAAGGATG CGTGCCATAC AATAACCTTC GACAATGGTC GTGAGTTCAG CGAGCACAAG     17880
     GCGATAGCGA AGGCGCTGGA GGCAGATATG TATTTTGCCC ATCCCTACTC GTCGCAGGAG     17940
     CGTGGACTGA ACGAGAACAC AAATGGACTT CTGAGGCAGT TTATCCCGAA GGGGACGGAC     18000
     CTGAGAACGG TATCAGAAGA GGACTTACAG CGCTATCAGG GTGCACTGAA CAGTAGGCCA     18060
     CGCAAGTGCC TTGGGTTTAG ACAACCTTCG GTGGTGTTTG CAGAGCTAAG AAAGGCGGCC     18120
     TAGCGTTGCA CTTCGGACTT GAATTCGCCT CGTTAATAAA CATAGTCGTT AATAAACATA     18180
     GTAGTCATTA AAAACTTTAT CTAAATGTAA ACTACAAGAT ATGTGTACAT ATTGATGTCA     18240
     TCATTCAGTG TGTCCGCAGG TATCTTGCCT ATGCACTTGA GCCTACGCGA CCTAGAGGAA     18300
     ATGATGGCTG AACACGGCAT CCTTGTTGCT CATTCTGCCT TTTATAGCTG GAGCATCAGG     18360
     CTTATTGCTG ATGAACTAAC TTATACACAT TAGCTAAGTT TAATGAAAAA ATAGTGTGAG     18420
     TACAAAACAA AACAGCAAAT TATGGCACCG ATTATTAACT GAGCGGTAAT CACATTACCA     18480
     ACAACAACAT CAGCACCAAG TAGGCACAAC AAAAAACAAG AAATATACAC AACAAAATCA     18540
     ATTCCGGCAC AAATGATGAT ATCTGCATCA CCACAGAAAG AGTGATTTGA CCAAGCTTAA     18600
     CGGCTCAATA AACCAGGGTA GGTAATCGTT TTAGGGGGAA ACTTGGATAT CGAAAATTAT     18660
     TGTACGATAG GGATTCTGAT GTAACCTCTC TCATTTTGGC GTACCCCAGT GCAAAAGCAA     18720
     AAATGTGATG AAATTATATA AATGACACAA CCTATATGCT ATACAATAAA TGCAACAACC     18780
     TAAATGCAAT AGTGTGGTGT AAAAATGTTC ATTAGAGCTT ATTTGAGGGC ATCGACGGAA     18840
     GATCAGTTCG CCGATCGGGC AAAAGAGATG CTGGAGCAGT TCGTTCAGGA GCGAGGGCAT     18900
     AAAATAGCCA GTTACTACCG GGAGAATATC AGCGGAACAA AACTTGACCG TCCGGAACTG     18960
     GGGCGTTTAT TGATGGACAG CCACCGTAAT GACATTTTAC TAGTCGAGCA GATAGACCGC     19020
     CTAACTCGCC TTAGCGAAAG CGACTGGATG ACACTGAAAA AACAGATTGA ACAACACGAA     19080
     TTGCGAATTG TTAGCCTAGA TGTGCCCACA TCATGGCAGG CACTGTCAGA TAAAGACCCT     19140
     TCGCAAGCTG ATCCGATCAC CCGCGCGGTA ATAACCGCCA TCAATAATAT GCTTATCGAC     19200
     CTGATGGCCG CCATGTCGCA CAAGGACTGG CTGAGTCGGC GCCAGCGGCA AAAACAAGGG     19260
     ATTGAAAGAG CGCATACACT GGGAAAATAT AGGGGGAAAC AGGCGGATCA TGAACGACAC     19320
     CAGAAAGTCA TATATTATCG GCAGGTAAAA AAACTTAGCA TCCGCGAAAC GGCAGATGCA     19380
     ACGGGCTACA GTGCTTCGCA GGTTTGTCGC ATTCAGGTTC TTTATAAAGA TTCGGTTTCA     19440
     GATTGAAAAA GAGTCTTAAT CGGAAAGTTT TGGTTTTCGT CTTGTTTGAT AGTAATGTCA     19500
     TATAACTTTA TTCGAGAGGA GCTCATTAAC CGTTTCTAGC TGATTTAACC ATTCATGCGT     19560
     TTCATTGCAT CGCATGGCAA TAGTAGAGGC GATTAACGAG TATATATCAG GTAAAGTTGC     19620
     TTGGTTAAAA ATTGGTTCGT GGTGAGCTAT TCGATTGCGT AACTTCCTAA TAGTAAAACA     19680
     AGCATCTTTT AACTGAGTTC GGATCTGTTC TACAGACAAG TGAGCGGTGT TAGGAAATAC     19740
     TGTATTAACA TATGGCCTCC AGATTCGGCC ATCGTGTCTT TTCGTGAGCA TCTCTTCCCA     19800
     GAAAAAAAGC TTAACTTCAG GTAGGATCTT CCCTACACCT TGATAACCAT GGTCTCTATA     19860
     CAATGAGGTA ATAGCTCGTT TATTTTTGCT TGTTAAGCTA TTAAGAAAAT AATCGTTTGT     19920
     AGGCCAATCT ACACCATACC TTTGGCTAAT CGCATCACTT ATAGCGTTAC GCAATGTAAC     19980
     TTCATAAATA TGTAAAGGAA CAAAGAAACC TGCGGCTAAC TTTGCATTCC ATTCATATAG     20040
     ATTTAGCGCT GTATAAACAC AATCTTCCCC AGTGTGAGCT ACAACGGCAT TACGATAAGT     20100
     AGCAAAGCGA CTGAACGATA GTGTTTGCTC TATGGCTTTA TGCGGCATTA ACAGACCTTA     20160
     TTTCGATTTA TATTGACGAA CTCGTCATAA TTGTTCTAGT ATTTACTCGT AAGCTTTGGA     20220
     TATTCCTGCT TCGGCAGCCC ACCAAAGATA TAAGATAAAG ATTAAGCCCA CTACTTTGTA     20280
     GTGGGCTTTT TCGCTTCTAA CACATCATAC TCGCTTTCTC TCGCCCCAGT TCAGTCAACG     20340
     TAAACGAAAG CCTTAACGTC TGCAGGGAGC GATGCATATG GACCAAACCA TTCTCATTGA     20400
     GTTTGTGGCA AGATACCCTA AAGTTTGTCC CAAAGACCTC TGTTGCTCGA CTTTTATTCA     20460
     ACATAGTAAG GATATCTGTC GCAGGTATAG GTTTTAAAAA ACCACGAAGC TCTAGCTGGT     20520
     ATAGCACAAA TAGGATATCT TTTTGGACTG CTGAAACTCT CATTAAACAT CACTCTTATT     20580
     CATGTGTGAT ATGATTAAGA TATCAAATTT AAGGGTAAAA TAAAATGAAG TTGGCTACCT     20640
     CCCTGGCATT ATCAAGTCTG TTGTTTACGC CGATCACACT TGCCCAGGAC TTATTTGCAG     20700
     AAAGCACTAA ATCAACGCTC AATGATGCGG TAGCGAGCCC GTTTACAGGA TATGTGGTGG     20760
     GCGCGTTTAC CGCGATTATC ATCATTGCTT TAATTGTGTA CGCGCTCAAA GACTAATCAC     20820
     TCATTAAGCT GGTGTTTACC CTTCAAATTA CGCAAGCGCT GTAACCGATT GAATACCTGC     20880
     AAAATAAGAT TGACGCCCTT AGCCTCATTA AACGCTTTTA AATCATGATA ACCCGGGTTC     20940
     CTGTAATTAT GCCTATCCGT GGTATTTATC ACCCCCGTCG CCTGGCATGT AACGCACTTA     21000
     CCACTGACAC TGTAACGCTT AGGCGTCTCA CAATGACAGC CGTCGCAGCG ATGAACAGAG     21060
     GTGTACATTC GCTGAAGTGC CAGCATTGCC TCAAGGCGTT CACCTTCAAT TGAAGGAATA     21120
     TTTTCAGACA TAGGAAATTT TATCTTAGAA ATAAACGCGT AAAACCCAAT CGACGAATGC     21180
     CCTTTTCGTT GTGACAGGGC GTGAGGCATA TTCAAGTACG TTGCGGCCTT CAAAACGGCC     21240
     TGTAACCAAC GTGGCACCTT TTTCAACATG CCAATAATGA TTATTATGCT TAGCTGTAAA     21300
     TATTCCGTTT TCTTCAATGG CAATAATATC TAGCGAGTTC AATGTAGGTC CTGTTTTGGA     21360
     TTGGTGCCAT GATGATGCGT ACAACGATGT TCAATATCAA GCTCAATCAA CCGCTGATTC     21420
     ATATGGTCTG GGTGTTGCCA GTATACCTCA CCCTTCACCG GTGCGATTTG TAATGTTAAA     21480
     TGCTGAGCAA TATCATCATT TTGGCTATCC GGTGCCCCGA TTAACCACAC AGGATAAGGG     21540
     CTAACAAAAA CGTCTAGTTC AAATTTTTGC GCCATAGCCA GCATAGCTGA TGCCGTTGCC     21600
     GCCTCTGGGA CAAAAATCAG TTTTGCAATG ATGCTATTGC ATCTTGAACA GGGAAAGGAT     21660
     TTATTTTCAA TGACCTGAAC ATTATCTGGC ACGTTTTCAG TGAAAATAGG AAGTTGTTCA     21720
     TTCAATGGCT TTTGAGCTTG ATGTTGTAAT AATGCATCCG TCATTTGCTG CGCAACAAAC     21780
     GCAATGACAG CCTTGTTATC ACTCGCATCC ACATTCATGT AAGGCTGAAG CTGCGTATTT     21840
     CCTTGGGTGG TTTCACTGAC TATCACCCCA CCGATGGCCT CATGACCATC GCGAAAAATC     21900
     ACGTAAGCCT TACCTTGTCT TATCACCGAT ACCCCTGGAG GAAGGGCTAA TTTTTTTTGT     21960
     GCCATTGATG ATTTTCCCAC TATTTTGCAC GTGCCTGGAC GAACTTAGCG CGGCGCTGGT     22020
     AGTTCTCTTC ATCATAGAGC GCTAAGGATT GCACCACCTC GCCGGCTACT AGCGCCTCTT     22080
     TATATTTAAT AAAAAAGAGT GGGGACTTCA TACCCTCTAA CCGGAAAGTG ACTTTATCCG     22140
     CAGTATTGGC ATTAAGGCCC CAAGGGTGCA TTTTTAACAC CTGAGCACGA ATAACTGTCG     22200
     CAAATTTCCG CTGGCCTTCG GTGCCACTTT TAAATACCGT CATAAATCAT CAACCTAATC     22260
     AATGTTTAAG ATAGTATTTT TACGTTATGT GGAGTTTATT TGCAAATTTT AAGGGGAATA     22320
     CATCCGATAA TTTGAACGGT TGACCAAGCT CATTTTGGGT GGCGATTTGT TGTCCATCTT     22380
     GCCAACCTTG AGACCAACAT TCGCCTTCCT CCCCAGAGTA AGGGTTGACT TGCTCAGCCT     22440
     GGTCCAAGCG AAAAGCTTGT AAGCCCGCTT GGTATATATC ACCAAGCTGA TAAAGAGCAA     22500
     TAAGGTCATC ATCGATACCA TCATCAAACT CTTTACCCTG CTGCACTTTA TCAACATGCT     22560
     TTTCCATGAG CGCTTGCCGC TGTAACTGGT ATTGTGATTG AAGTGGGGTT AACGCTTCTT     22620
     TCGACGTTAA CGCATCAACC CGTTCAATGA CACGCTCTAC TGCATTTCGC GGTAACGGAA     22680
     CGCTACCCAA TGATATTGTT AACCCACAAA GACCCATTGG CTCAAGGGAA AGTACCTTAC     22740
     CCACAAAAAA GGGTTGTTTA TCCAAATCAA CTAGGGAACA CTTCGGTATG GCCACCATGA     22800
     TGGGCGCCAT ATCAACGTTA ACTTGTTTGA CGTAAGCCGT ACTGCCCTTT ATGACCTCAA     22860
     TCATTTCCCA AATCGCCGTT GGTGCTGCGA GCACTGCAGA AAAATATAAT CGTGCCATTG     22920
     CCCCTTCGCG CCAACCTCTC TTACGCAAAA AATATTCACC AATCGTTTCA GACTCAGATA     22980
     TCGGGTAACA AAAAGCCAAC TCATCCGTTA AATCATCCGA AAAATACCAT TCTGCAAGGT     23040
     GGTCAGAAGG AATATCAGGG GCTAATCCGT CGAGAACAGT GTTAATAAGG CATTTTTTAT     23100
     ATTGATTGAA ATAGAATCCT TTTAAGTGAC TCGAAAAAAT TTGAAAAAAA TGGTCGTATT     23160
     TACGCTTAAC CTGACTCATA AACACCTCAC TATATAATTA AAAACAGTAA CTTAATCATA     23220
     AGTAGTATAG CACATTAAGT ACTGTATTAA AAAACAGTGT AATGCTTTTT TATACGAATA     23280
     AATAGATCGG CAGGCGTCTT ACAACCCACA GACGGGTATG ATTTTTGCTT TTCCTTCTGC     23340
     TAGACGTTTT TCTTTAGCTG CTGACGTTCA GCACGTTTGC AGTAAAACGG TCGTATGACA     23400
     AACTTTACTT TCAGCGGTGC TTTTAGCTCT CGCCCCTGCC TACGGCAGGA AATGGCGAGG     23460
     CATTCTTGCT CTTAGGTGGA TTTATCCACC GTTGTTTGTG CCTTTTAATA AGTTATCTTT     23520
     TACTAATAAT TAAGCTTTAC TTGAAAAGAA AGAGCTTTAG GACTCCCATT GCTTACTCCT     23580
     TTTTCTTACT CCCATTTATG GCTTGATATA CAAGCCTTAT CCACAACCAA CCGGAAAACT     23640
     GAAACGATAA GGGAGAAGTT AGGCAAAAAA AGTAGGGGGA TAGGGAGTTT ATCGACTGAT     23700
     TAGGCAAAGT CCCCGCCAAT CAAGACGGTC GCTTAAAATG TTGCTCAGTG GGTTTGAGGT     23760
     GGGTTCGTGC TTTGTGAGAA AAACATATCC GCGGTGAACC GCTGCTTTAC TGGAAGCTGG     23820
     CGCTTGAACA CTCGCCAAGT GAATGACAGG CCGTTATTGA CGGCCTTTTG ATAGGCTTGC     23880
     TTTATCTGTG CGCGGATTGT ATCGGTGTAT GCACCAATTG CTTGTAAGAA TTGAGTAGAA     23940
     AGCCATTTAT AAGCCGCGAC AGAGCGGATG GTTTTTTCTG TCTCGCCTGC TATTTTGACT     24000
     TCTTCAACAA CAAACACACC CGCTTGCTTG AGCATACCAA TGTATCGATA CCAAGTAGAG     24060
     CTCGGCATTG CATAACCCCA GCGCTTAGCA TGAGCGAGCA TCAGCGCATC ATGACTGGTG     24120
     GTGTCCATCC CGTTATTCTT CGCTTTCCCA ATTTGGCCAC TCATAAAATC ACATGATGTC     24180
     ATTAAGGTTA CGATGATTTC AAACAGCTTG CGCTTAGTCA GTTCTGACAT TTGCCTTGAT     24240
     ATGCCGCCTT CGTCTATTTC AAACTTTCTG CTGTAAATCA ATTTACGCGC ATTATTAATG     24300
     ACCTCGTCAA AATAACGGGG TAAACGTGAC TTTAAGGCTT TAAACCCTTC GAGACTGGCT     24360
     TTATAAGCAT TAGCCCCAAC AGCGGTTTTA TGGGTTTTGA CATGTAATGC CGCCTGCTTT     24420
     GCAGAACGTA GCTTTTGTTG TTTGATGCGA GCTTTGTCGG CTTTAGACTT AATCACAATA     24480
     GCCTCTAACG CTGCTTAATT TCAGGCGCAA ATTCAGCACG AACCACCCCT TCCATCACTT     24540
     CCATCGGAAT ACGACCGAAT TTCTCCTTCG CACTCTGTGC CTTAGGGTTA TTGGCACTTA     24600
     CATCATTACG GCTTATACCT GAATGCTGTG TAGTTTGACT CATTTCCAAT ACCTTACGAA     24660
     CACAATGACC CGCTTCATGG CGCTGTCGCT CAAATTCTTG TCTGCTCATA CGTGCTTTAA     24720
     ATTGTGCATC CAACAGATCA ACCATGAATA AATCAAACTC TTCAATCAGC GCGACCATAC     24780
     GCCAACCAAA TCGACTCGTT ACAAACAACG CCTTTTCAAC CGGTTTTAAT GAAGCGCACT     24840
     CAGATGACGT CACACGGCGA CGACGTTCAT TTGCCATTAA CCCTGTGCTT AACTGATTAA     24900
     TGGTTAAGAA CGCTTCATTT AAACTGTTTT CAATCAAAAT AAGCCCATAA TCTGCGTATG     24960
     GATCATCTTT CGCAGCAGAG GTTTCTAATT CCGCAGTATG TGTAAAGAAC CCAGGTAATC     25020
     CCTGAATTTT GCCTTTGCGA CCGTGCCACA ACGCCACAGA ATCACTGGCA TGAAGTGCAA     25080
     TTGACGCATC GCTACGCAAC ATACCCACTT TGTTATTATT TTTTTTCATC ATCATTTCCT     25140
     TTTTTGATAT CAGCCCAAAT AGCACCAATA CTCACGGTAT GCTGCTTGGC CAAGACGAGT     25200
     AATTCTTCTG CAGTGGGGTA AAGCGGATTA GGCAATTTCT CTATGTCAGA CCAAAGCGCC     25260
     AAATGGCAAT CAGCAGGGAT AGAGCGCTGT CGATAATCAG AATGCGTATC AACAAACCGA     25320
     CGCCACTCTG TGCATGATTT CAAACTCACA TTAAGTAACT CCCGCATCGC CGAATTTGAC     25380
     GCTCCATACT TTATGTAATC CACACACAAC CGCGGTATAT TCATTTGAGC TAGGCAACGT     25440
     GAGAAATAAT CACCATTTAT TGCTATAAAA TGATGCCCTA ATTCTTTCGA AAATAATTCC     25500
     AACTGAGCCA CAGTCATTGA TGTCAGCAGC TCGACTTGCG AATGCGGTAA GCCATATTTT     25560
     TGTAATTCTT TATGATCACC CCGATGCGCG GAAATGCAGA TTTGGTTTAA TAATATGAAA     25620
     TTAATACTAA ATGCACTGTT CATCACTCAC CTCCTTCGCT AGAGAGTGCG CTATTGTCAG     25680
     GGAGGGCCAA TGCTGCAAGC GTCGTGGTTA ACTTAATGAA AAAGCCATTC AAACGTTTGC     25740
     CACTTGCTGT CACTTTAACC GAGTGAATAT TCCTACCTTC TGTAGTTTTA AGATGAAGCC     25800
     CTAAAGACTG AAAACCGGAT TGAACCGCTA AATAACTGTC GGCATCACAA CCCTGTTGGT     25860
     ACTTTTTACA AAAGACCTTC ATAGCCGTGG GTGACACGAT GAAGACCTGC CCATTCACCT     25920
     TGTGAATAAA AGCCTCTGCT GTATTAATGG ACAATTCACC AGCTAATAGT CCAGCTTCAA     25980
     TCCAGTTCCA AAACAAGATC CCAATTTGAT GATCTGTTAG TTTGTTAAAC GGCGTTACCA     26040
     GTAGCTCTGG GCCCAGAACG TCTGCAGACT CATTTATGTC ATTTTTTGAT GGAGTTGCCT     26100
     CAATTATTGG GGACATGAGC GCTTCCATTC CAGGGATCAT GCTTATCAGT AAATCGTCTT     26160
     GAACGATGAC TTCTCGCGTC ACATAGGTAT CGTCTGTTTC AATAGTTTCA GTATTAACAG     26220
     ACTCTGGGAC TGGCTCCTGT TCTTCCACCG CAAATCCAAC TGATGATATT GCTTCAGCTA     26280
     AGGGCTTTTC ATCTTCTGGC GGCAATATAT CGATGAATCC AGGTAATGAG TTGAGCGCAA     26340
     GCTCTGGCGC AAATGTTGGC AAGTGAATAC ACAAACACGT AAATTTTTGG TACCAGTTCA     26400
     CGTCAGTTAA TGTCACTTTA ATCGACCAAA CCGCTAAACC CTGCTCGTTA GGGCGGATAA     26460
     TGTTGTGCTG CTGCAATTCA TTAAACAGCT TTGTGTTTGA GGACGGTACG CCAGAGATCC     26520
     CCCTGTCTAA CAACGTGGTT CGGATGAGAT CAGCAATCGG CTTACACACT TATTGCGCGA     26580
     CAATTACCCT GACCGGTTCA GCGACAATTA GAATGGCCGG TTGATCTGAT ACATTCTGGA     26640
     CAAAGATTCT AAGGGAGTTC TTTGTGCCAG GTCATCGAAT TACAGATCAA CAAATAAGGC     26700
     TATTTATGTC TAAACGAAAA GATCACCTTC AAGTTACTGC GGCGAGCAAA GCTGGCATTT     26760
     CGGAACGCTC TGCAAGACGA ATTGAATCCG GCCAGCGACA ATTAGGCCCA TCAAAACCTC     26820
     GAAACTACCG TACTCGTACC GACCCCCTAG AACTTGTATG GGACCCCGTC GTTTTACCAC     26880
     TCCTACAACT TTCTGACACT ATTACTCCTG TTGGCGTGTT TGATTATCTT TGCGAAGAAT     26940
     ATTCAGATGT TTTCGCTGTA ACGCTAAGGC GAACCCTTGA ACGACGTATT CAAAAATGGC     27000
     GACAGATAAA TGGCCAAGAT AAAGAGGTTA TTTTTCGCCA AGTTAAAGAA TTCGGTCAGT     27060
     TGGGGATCAT GGATTTCACT TGGGCGGATT TCATTGTCAC GATTAGAGGA ACAACTCTTA     27120
     AGCATCGATT TTTTAACTAT CGATTACCTG CAAGTGGTTG GAGTTACGTT CAAGTCGTAT     27180
     ACGGCGGAGA AAGCTTCGTA GCTGTTGCTA CAGGCTTACA AAATGCCTTT GAACAATCAA     27240
     ATGGTGTTCC ACAGGAAGTC AGAACGGATA GCTTGAGCGC TGCTTATAAA AACCATTCCA     27300
     ACGAAACATT ATTTACTGAA CGATTTTCAG AATTATCGAT TCATTATGGT TTCAAACCTT     27360
     CTAAAAATAA CACCGGCATT GCCCATGAAA ATGGTGCCAT TGAAAGCGCC AACAATCATC     27420
     TAAAAAACCA AATCCGACAA GCTTTGGCTA TTCGTGGTTC AAGTGACTTT GATAGCATTG     27480
     ACGAGTATGA AACATTTATT GATGACGTCG TCCAAAGACG TAATCGCCGT ATTATGGCAC     27540
     TTCTCATCGA TGAGCAACGA CAATTACAAC CCTTACCTAA ATTTGAAAGT GTTAATTACG     27600
     AAATTTACCC AGTAAAAGTA TCGAGCACCA GTACGTTTCA GTTAAAACGA GTGACTTATT     27660
     CAGTACCATC CAGACTCGTC GGTGCAACAT TGCGCGTGCA TCTTTTCGAT AAAAAATTAG     27720
     ATATCTATTG CCATGGAGTG CACACCGCCA CGCTCACTCG CGTACATGCG TCAGCAAATA     27780
     ATCGCGGTCA TCAAATTAAT TATCGTCACT TAATCGGTGC ACTGATGAAA AAACCTCGAG     27840
     CATTCAGGGG GGGCCAATGG CGAGACCAAC TGCTTCCAAA TGAAGACTAT CGCCAAATAT     27900
     GGAAGAATGT CGATGCTCTA CTAAGTGCTG ATGAAGCAAG TCTTTATATG GTTAGGTTAC     27960
     TCAATATCGC CAGTAAATCA GATCGTGAAG AAGCGGTAGG AAGATTCGTT CTCGAAGGGA     28020
     TAAATCTAGG GCAACGGCCA AACATAGTTG ACTGTGAAGA ACGTTTTTTA AAAGACGAAG     28080
     AGTGGGAATT TAACCCTAAA GTACAACAAC ATAGCTTAGC GTCTTATCAG CAAATTCTTG     28140
     ACGAGGTGAA TGAATATGTC AGTTGAAACG TTGCCTATTA TTCTCAAAGA GCTTCGACTA     28200
     GTGAGCTTAC TTCCACATTG GCAACCGTTG GCTGAGAAAG CACGAGAGCA GCATTGGCCG     28260
     GTGGAGCGTT ACTTAGCTGA ATTATGCCAA TTAGAACTCA GTTGCAGAGA ACAAAAGCGA     28320
     TTGCACCGAG GCTTAAAAGA AGCAACGTTA CCAATAGGTA AATATCTTGA CACCTATGAT     28380
     TTTAGCGAAG TTGAAGGCTT ATCCAAGAAG CAAGTCTGGC ATTTAGCCGA TAATGCTGAG     28440
     TGGTTGAAAA CAGGAGATAA TATCTTGCTG TTCGGTGCCA GTGGTTTAGG TAAAACACAT     28500
     ATTGCCGCTG GACTTGGTTA TCGTCTTGTA GAGCAAGGGC ATAGAGTTAA ATTTATGAGT     28560
     GCGAGCCTAC TTGTGCAGCA CCTGCAAAAA GCGAAAGAAG AGCTGAGATT GCCAGAAGCC     28620
     CTAGTCAAAT TGGACAGATT TGCAGTGTTA ATCTTAGACG ATCTAGGCTA CGTGCAAAAA     28680
     AGTACAGAAG AAACTAGCGT CTTGTTCGAG CTTATCGCGC ATCGTTATGA AAGATATAGC     28740
     CTAATAATAA CCTCAAACCA ATCATTCGAA GATTGGGATA AGTTATTCAG TGACACAGTG     28800
     ATGACCGTAG CTGCAATCGA TAGGCTGATC CACCACGCGA AAATTTTGCA ATGCAAAGGA     28860
     GAAAGCTACA GGCGAAAAGA AGCCCAAAAC AAACTAAATT AAACCGAGTC TCAACCGGCC     28920
     AAGTTAATTG TCGCTGGATC GGCCAAGCTA ATTGACGCGC TATACACGTT ACTGACAGCG     28980
     GCGATCACGT TATGGAACAC GGTATATATA GAAAGAGCCA TTGAGTCACT GAAACGAAAA     29040
     GGTGTCCCTA TTAATGAACA ACTAGTTGCT CATCTTTCTC CCCTGGGCTG GGAACATATT     29100
     AATCTGAGTG GCGATTACGT TTGGCGCCAT AATGTAAAGC TGGGGTCCGG AAAATATCGG     29160
     CCATTACGTA CAGTCAATAC TGAATTGTAC AAAAAACAGT CTTAGCGTGG GATATTTTCC     29220
     GTTTTCCAAG CGGACCCCAA AGTGGTGAAA TTGACCAATT ATTGAGTTCT TATTTTTCGT     29280
     GATTTTAGGG GCTGTAAACC TGTGATTTTG AGGCGTTAGA TAGTGATATT GATTGAGTGG     29340
     TCATAACGCG ATGCGCACAA TATACTAAAT GTTAAATACG AGCTGTTTTG TGACATTTAT     29400
     CTCTGCTTTG GTTTGTCAAA AAAACAGCCT AAAGGGGGCT GTTTTTTTAC ACATAATGCG     29460
     CATTGTGCGC ACTTGTGGGG TAATGAACGG TTATAGGTAT GTCTTGTACC CATCCATTAT     29520
     ATAGGATGAC CCATTTGACT GCATTATCTG AAAAACGTCC CAATTTGCAA GATTTCTGTT     29580
     CCCGGGTTGA ATAAAATATC CTTCAGGGCA TGTTAGTCCT TTTTCATCAA ATACGGACTG     29640
     TTGAACCTTA AAAGTCATAA AATAACGGCG ATTAGGCAAA ATGACTTGCC CCCATTGCCC     29700
     TTCAATGGTC ACATAATTAT CATTTTCATC CAAAAGCCAT TCCCAATCGC TTCCATCGGG     29760
     CAGACCACAG TAGACATAGG TTGAGGTATC AGCAAACGAT TGGGTATTAA ATGTTAATGC     29820
     GAACACCGCA ATTAATTGGC TCAGCTTCAT AATGTTTTCA CCATGTTATT TTAAGTAAAC     29880
     AACTTAATTA ATTAAAGTTT GCAATATTAT GCTTTTTTGA GGTGAAGTCA ATATGCTTTT     29940
     TTGAGGTGAA GTCAATATGC TTTTTTGAGG TGAAGTCAAT GAAAAATATA CATAAAGCGT     30000
     TCAGTTTGGT ATTTATTGTT CTCATAATGC GATTAAAGTG TCCTACATGT ACACTGCAAG     30060
     CTACTACATT CTTTATGCGT ACAATAACCA TAATGGTAAA TAGACCGCGA AAATGAACAT     30120
     TTAGCGCTTT TCTTGTAAAG GGGGTTCTGT GCCAGAACCG CCGAAATTTC CGGCATTACA     30180
     AATTAGTCGT TTTTTGAGGC ATGTTTGGTA TGTGCTGACG TGTACGTTTA TGGTGCCGTG     30240
     AATGAGAATT TATCCGTACC AGCTATGTGA GACGTTGTAA TCAGTGATTT TCCGATCCAA     30300
     ACGGCTATTT CTTTGCTGTC CGGTTGACGA CGGTCTTACG TACAGGCCGC CGAATACCAA     30360
     AACTTATGCC TCACGGAAAT TTCGGCGGTT CCGGCGTACA CCCCCTAAAG AAAAAATGAA     30420
     AAAACTTATT GAGCGCGGAG CGCAAACTTA CGACCACCGC AAATGTTAAT CTGGCTGATT     30480
     ATGGTAAAGC TGGGGTCCGG AAAATATCGA CCATTACGTA CAGTCAACAC TGAGTTGTAC     30540
     AAAAAACAGT CTTAGCGTGG GATATTTTCC GTTTTCCAAG CGGCCCCCCT TTTCCACATG     30600
     AGGGCTATTA TGGGATTAAA TCGGGCTTAC CTATATCAAT CAACTCAATT AATGCAATTA     30660
     ACCAGATTAA TCAAATTAAC CCAATTAATC AAATTAACCC AACTAATTTG ATTAACTTGA     30720
     TTAACTTGAT TATAATTAAG CAATAATTAA ACGCGAGGTG ACGTAATGAA AGTGATAAGC     30780
     GTATGGAATG AAAAAGGCGG GGTAGGTAAA TCGACTATCA GTTATAACCT AGCAGGTGCG     30840
     GCTGTAACAA AGGGACTCAG TGTATTGCTA ATCGATGACG ATCCTCAAGG ATCATGCGCT     30900
     TGGTTAAGTA GCGATGGTTT TGCCCCATTT GAAGTGGTCA AACACTGGCC CACAAATAAA     30960
     CCCAATGTAG ATCTAGTGAT TGTTGACATG ACACCCAGCA CCACAGACAC ACCTAACGGT     31020
     GTGGTGATAT TACCCTACCA GCCAACAAGA CTAGCATATG GTGTAGTGCC AAAACATTTA     31080
     CCTAAACTAA AGCAAGCGGG CTTACGAGTG GTGCAAGTAA TCAGCATGGC CGATATGCGA     31140
     AAAACTGAAC ACAGAGAGTT TGCTAAAACG AAAATGCGCG AAGACAAAAC GATTCAATTA     31200
     GTACCCAATC GTGCCATTTA CGAACGCACA ACAGGCTTAG GTCGAACCGT ATTTGACCCC     31260
     GAATTAAAAG GAATGTACGG GCTTAGGGAT GCACAAAAAG ACATGAATAA ATTATTAGAT     31320
     GAGGTACTCA AATGAGTCAG GGGCCAGCTT GGTTAGCCAC CGCAGAAAAC AACACTCAAG     31380
     GCAATGAAGT CGGTACCGCG GCGGTTATCG ATAACAAAAC ACCGCGAGGT AAACCTGGGC     31440
     CTAAAAAATC GCTGGTTAAA CGCAAAGTAA TTGGACTGAA CTTTAGTGAT AATCAGAACA     31500
     AAAAGCTAGA TGAATTAGAA ATGCGGTTAA AACTAGCAGG GATAGATTTG CCACGCGGCA     31560
     GAAGTGAAGC GGCTGAACTG GCAATCAATA CCCTGTTATT TATTCTAACT CAATCACCTA     31620
     GTGATAGTGA CCGCTGGATA AAGCGGCTAT TAGAAAACTT AGTAGGTGAG GAAGAAAAAC     31680
     AACATGAAAC AAGTTAACCC AATTAATCCA ATTAAGCCAA TTAAGCCAAT TAAGCCAATT     31740
     AAGGAGTCTG ATGCTCAGTG GAACTGAAAA CTCACGTTAA GCAATTTTAT TCCTATGAGG     31800
     GGTTTTGTGC CCATCCCCTC GAAATTAACC TTAAGGCTAA ATTTGCCCAA CGCGCCAAAA     31860
     ATGTAAAGTT TGGATATCGA AAATTATTAA AGGCTAAAGT CGGGTGCTCT CGCAAAGTCA     31920
     CCATCACAAT CCAAAAATAG GGAAGGGTTC GAAATCCTCC CCTAGGTTCG TTAGCCTCTT     31980
     ACTTCGTAGG CAAGAACAAC GTTAAGCAAC ATAGCACCGT TACGGTACTC TACTTTACAC     32040
     AAATCATCTC TAATGAGTGC CAGTGCAGCT AAGAGTGTGA AACACACAAT AGCGAGACTT     32100
     AAAGTAGTTG TTTTTCTTTT CGGCATATCT TGCCTCCTAA AAGTAAAGAG GCTACTATTT     32160
     GTATTGCTAA GTACATTGTA GGCCTCGTTT GAATTTATAG TTCATTCGGG GCTTTCAACT     32220
     TTCTAGCAAG TTACATAACA GCATTTCCAT GCTCTTGCTA AAAAGCCAAG AGCACCCGCT     32280
     TGAAGTTTAC CACTTGTACG CACATTCCCG TCAACGCTTT ATCTTTAAAA AATGGTGTAA     32340
     CCATTTAATC TATTAGCTTT ATTTGAATTT GAAACAAAAT CAAAAGTCAC AATTGGCATC     32400
     CTGCTTGCAA TTCCTTTCTG CTAGACGCTT TTTTCTTTAG CTGCTGACGT TCAGCACGTT     32460
     TGTAGCTTAA CGGTCGTATG ACAAAATTCA CTTTCAGCGG TGTTTTTAGT TCTCGCCCCT     32520
     GCCAACGGCA GGAAATGGCG AGGCATTATT GCTCTTAGGT GGATTTATCC ACCGTTGCTT     32580
     GTGCCTTTTA ATAAGTTATC TTTTACTACT AATTAAGCTT TACTTGAAAA GAAAGAGCTT     32640
     TTGGACTCCC ACTTCTTACT CCTTTTTCTT ACTCCCATTT ATGCCTTAAT ATACAAGCCT     32700
     TATCCACAAC CCACGGTTAA AGTGAACAAC GAACCTAGAA GTCTGGTAAA CAAAGAGAGA     32760
     GAAATGGCGC TTTACAGATT GATTAGGTCG CTTTAAAGCA TGATTTAAGC GACTAAAAAC     32820
     GTCCAGACGT GCAAAGTCCC CGCCAATCAA GACGGTAGCT TAAGATGTGG TTCAGTGTGT     32880
     TTGAGGTGGG TTCGTGCTTT GTGAGAAAAA CATATCCGCG GTGAACCGCT GTTTAACTGG     32940
     GAGCAGGCGC TTGAACACTC GCCAAGTGAA TGATAAACCG TTATTGACGG CCTTTTGATA     33000
     GGCTTGCTTT ATCTGTGCTC GTATCGTGTC TGTGTATGCT CCGATAGCTT GCAAGAAGTG     33060
     AGTAGAAAGC CATTTATAAG CCGCGACAGA GCGGATTGTT TTTTCTGACA CGCCCGCTAT     33120
     TTTGACTTCT TGAACAACAA ACACACCCGC TTGTTTAAGC ATATTAATAT AACGATACCA     33180
     AGTAGAACTC GGCATTGCAT AACCCCAGCG CTTAGCATGA GCGAGCATCA GAGCATCGTG     33240
     ACTGGTGGTG TCCATCCCGA TATTTTTAGC TTTACCGATT TGGCCGCTCA TAAAATCACA     33300
     CGAGGTAATT AAAGTTACGA TGATTTCAAA CAGCTTGCGC TTAGTCAGTT CTGACATTTG     33360
     CCTTGATATG CCGCCTTCGT CTATTTCAAA CTTTCTGCTG TAAATCAATT TACGCGCGTT     33420
     ATTAATGACC TCGCTAAAAT AACGTGGTAG ACGTGACTTT AAGGCTTTAA AGCCTTCAAG     33480
     ACTGGCTTTA TAGGCATTAG CACCAACGGC GGTTTTATGG GTTTTGACAT GCAGAGCCGC     33540
     TTCGCGCTTT GCTGAGCGCA ACTTTTGGCG TTTGATGCGG GCTTTGTCGG CTTTAGACTT     33600
     CTGCATGACA CACGCCCGCA CTGCTACAGC TCAGTAAAGA AGATCGAAAG ATCAACGACT     33660
     GATTAAAGCA ACGAGGATTG ATGTGTCTAG GGTATAAATG CTGCAAAGGG CAGCCATTGA     33720
     AAAAGTTAGG CATTTGTTTG ATTCTCAGGT TGATTGGGCT GCTTGGTTTC CACACCAAAC     33780
     ATTGCGGATC ACTGTAAATG AAACGATCGC AAAGATCAAC GATCTTTCAT CTCATTTAAT     33840
     TTTAGGCACA AAAAAGCCGA CCCCTGAGAA AGTCGGCTTT TTTGTCGAAT GCTATATAGT     33900
     CAGATTGGAG GTCTAACACA TTCTAAGTTT TGAAAAATAC ACTACATAGA AAACTATGTA     33960
     GTAGCGTGCT ATGTAATGCA CTTTTTGCTT CAAAACTCTA AGTAAATTAT TAATCTTTTA     34020
     CAGTTGACAT GCAAGTTGAT TTTTCTTTAC TTTAACGTTG ATAACCTATC TTCCTGATGT     34080
     GAACCAAAAA ACACGCCCCA AAATTTGGAT ATTATCTTTC TTTATATTAT AGGTTTCATC     34140
     TTTAAAATTC GGATTGTAAC TCTTTAGCAC CATGTCTTTG GGTAACAAAT GTATAACCTT     34200
     CACTCGTAAC AAATCATCCT GTTTAACTAG ATACATTTTC CCATCTTTTA TGATGGTATC     34260
     GCTACTATTC ATGGCAATAA TAGAGCCATC TGATAAAACT GGTTCCATTG AATCACCTGA     34320
     TACACACACG CAAAATATTT GATCTTTATT TGTTTGGTTT TTAACAAACT TTATTGGAAT     34380
     AGGAACCTCA TCCTCATCCT CATCCAAACA ATCATCATGG CAACAACCTG CACCCGCTGC     34440
     GGCTTTTATG TTTTTATACT TCGGAGCCCA AAATACACTA TCTTTTTCAT CTTCTAATGT     34500
     TGCAAATGAC TCTCCAGTCA ATAGCCAATG AGCATCAACA CCTAGCACTC CAGCAACTTT     34560
     GTTTAGCAAT TCAGGATGCA TTGAATTCTT GCCTAGCTCC CAGCTAGACA CAGAAACTTT     34620
     ACTTACGCCT ACAGCCAAAC CTAGGGCTTC TTGTGTAAGC CCTTTTAGTT TGCGTCTCGT     34680
     TTTTATTCTA TGACCTATTT TTTTCATTCT CTAATTGTAA TTTTTCCAAA AACTTTCGCA     34740
     CCATTACAGA CGATTACAAG CTAACTAATA ATCATTACTG AACCTTACTT TTCTTTACTT     34800
     AATGTAAGAT ACAGCTTATG ATCTTGTTTT AATTACTCAC CCAGTGCTTC CAGCGAGTCC     34860
     ACATGTCGCA AACCAAGAAA AAAACAACGG TATCTATCAA CTTAGAAATG AGTGCAGAAA     34920
     CCAATCAAGG CGTGACGTTG GCGGCAAAAG CAGCGAAACG CAGCAAGCAC ATAGAAGCTG     34980
     CGCTTCGGCT TGAAGACCAC GTTGGGGTCC GCTTGGAAAA CGGAAAATAT CCCACGCTAA     35040
     GACCATTTTT TAAACAGCAG GTATTTGCTG TTTTACTTTA ACTCTCAGAA TTGTTTGCCG     35100
     TGTGGTTCTG AATTCCCGGG CAATAGCACT TATACTTACA CCAGACTGAA TTCGTTCGAG     35160
     TACCCTCTGT TTTTGTTCTT CATTTAACAC CGGCGGACGC CCGAAGCGTT TTCCTGCTGC     35220
     CTTTGCCCTT GCAATACCAG AATGAGTGCG TTCAAGAAGC AGGTCCCGTT CAAACTCCGC     35280
     AACCGCAGAA ATCACCTGCA TCGTCATTTT TCCTGCAGGA CTAGTCAAAT CAACACCACC     35340
     CAATGCCAAG CAATGCACTC GAATACCTGA TCCGGCCAGT TGCTCCACTG TTTTTCTGAT     35400
     ATCCATCGCA TTACGACCAA GACGATCCAA TTTTGTGACA ATCAGTACAT CGCCGTTTTC     35460
     CATGCGGTCA AGTAGCTTAG TGAACCCCGG ACGCTCACCG GCAGTTACTG AACCGCTGAT     35520
     CTGTTCTTCG AATAGTCGCT GGGGTTTGAC AGCAAAACCT GCCTCTTCAA TTTCACGGCG     35580
     CTGATTTTCG GTGGTCTGCT CTAGAGTGGA TACACGGCAA TAAGCAAAAA CTCGTGACAT     35640
     AGCTAAATGT TTCGTACGAA AAGGGTGTAC TAATTATAAG CCATGTACGA AATTATTTTA     35700
     ACTAATATTC GTACATATTT AGAATAGGGT GTCCAAAACC GGTCAGTTTC GGTCAAAGTT     35760
     AACCACTAAC AAATTGAAAC TATACGCGAG GGAAGCATTT ATGCCACGGC GACAGATACT     35820
     AAGCAGTGAA GAACAGAAGC GCTTACTGGT TATACCAGAT GATGAAATTA TTCTGACCCG     35880
     AATGTGTTTT TTGAATGAGC GTGATATTGC GCTCATAAAT AAGCACAGAC GGCCAGCGAA     35940
     TCGCCTGGGC TTTGCCGTTT TACTCTGCTA TCTGCGTGGC TCCGGATTTA TTCCGGACAA     36000
     AAATACCTCG CCTCACTGTG GCGTCGTATC CAGAGTCGCT TCCCGATTGA AACTTCAGCC     36060
     TGATTTATGG CATGAATATG CATCCAGAGA GCAAACTCGC TGGGAACATC TGACCGAACT     36120
     TTATCGTTAC CTGAAATTAT CCCCATTCAG CCGAACACTG CAAAAAGACT GCATCCGGCA     36180
     TCTGCACCCC TATGCCATGC GAACTGACAA AGGGTTTATG TTGGCGGAAG AAATGCTCAG     36240
     CTGGCTACAT AACAATAATG TTATTTTCCC TTCTGTTGAT GTGATCGAGC GGACGATTGC     36300
     CGAAATCGTC ACGCTGTCTG ACAGAGCCGT ATTTTCGGCA CTTACCGCGC AACTGGAAAA     36360
     TCATCATAAA TCAGCACTCG ACAGCCTGCT CATATCAGAG AGTGACCAAC CTTCCCGTCT     36420
     GGCGTGGTTA CTTCAGCCAT CGGGTAAAAT CAACGGTAAA AATGTGCTGC AACATATCGA     36480
     CCGGCTTAAT TCCATTACTG CGCTGGGATT GCCTGATGGT ATTGCGCTTT CCGTTCACCA     36540
     GAACAGGTTG CTTAATCTAG CGCGTGAGGG ACGAAAAATG AGCAGCAGAG ATCTGGCAAA     36600
     ATTCACCGAT GTCAGACGTT ACGCTACGAT GATTTGTATA ATAACAGAGG CCCGGGCCAC     36660
     CCTAACAGAC GAAGTGATTG ATCTACACGA GCGTATTCTG GGCAGTCTGT TCAGCAGGGC     36720
     AAAACGAACG CAGTCCGAAC GACTCCAGCA AACGGGAAAG CTTATTCAGA GCAAGCTAAA     36780
     GCAGTACGTT ACCGTCGGTC AGGCGTTACT TAACGCCAGA GAATCCGGCG AAGATCCCTG     36840
     GACCGCAATA GAAGACGTCC TTCCATGGCA GGAATTCATC AACAGTGTGG AGGAAACGCG     36900
     GGTTCTGTCC CGTAAGGGCA ATTTCGACCC ACTTCACCTG ATCACCGAAA AATACAGCAC     36960
     GCTGCGTAAA TACGCCCCGC GTATGCTGTC AGCATTGCAG TTCACGGCGG CGCCTGCAGC     37020
     TCAGATGCTC AGCGATGCAC TGGACACCAT AACTGAAATG TACCGTAAGC AACTTCGTCA     37080
     AGTTCCGCCG GCAGCGCCAA CAGGATTTAT CCCTGAAAGC TGGCGAAAAC TGGTGCTCAC     37140
     ACCATCCGGG ATCGACCGCA AATACTACGA GTTTTGCGTA CTGAATGAAC TCAAAGGGGC     37200
     GTTACGTTCC GGTGATATCT GGGTAAAAGG ATCACGTCGC TACAGAAATT TTGATGATTA     37260
     TCTCATCACG GCTGCTGAGT TTGAGAAATT CCGCCATAAT GATCAGTTAC AGTTGGCCGT     37320
     TCAGACCGAT TGCCGGGCAT ACCTTCAGGC TCGTATGACC CTTCTTGCAT CGCGTCTGGA     37380
     AGAAGTTAAC GCGATGGCGC TTGCTGGTGA TTTGCCCGAT GTTGATATCT CAGATAAAGG     37440
     CGTAAAAATA ACCCCGTTGG AGAACAGCGT TCCTTCGGGT GTCTCGCCCT TTGCCGATTT     37500
     GGTTTATGGC ATGCTTCCCC ATCCGAAAAT TACGGAGATA CTGGAAGAAG TGGATAACTG     37560
     GACTGGGTTT ACGCGTCACT TCACGCACCT CAAAAATAAT AACGTCAGAC CAAAAGACGG     37620
     AAGACCGTTG CTGACCACCA TTTTGGCTGA CGGCATCAAT CTGGGGCTGA CAAAAATGGC     37680
     GGAGTCCTGC CCGGGGGCAA CAAAATCGAC ACTCGAAGGT ATTCAGGCAT GGTACATCAG     37740
     AGATGAAACT TATTCAGCAG CACTTGTTGA GTTGGTCAAT GCCCAGAAAG CGCGCCCGCT     37800
     AGCCGCATTC TGGGGTGATG GTACAACATC GTCGTCAGAC GGACAGAACT TTCGGGTAGG     37860
     CAGTCACGGA CGTTATGCCG GTCAGGTCAA TCTTAAATAT GGTCAAGAAC CGGGCGTGCA     37920
     GATTTATACG CATATCTCAG ATCAATACAG TCCGTACTAC GCCAAAGTGA TCACTCGGGT     37980
     GCGCGACTCA ACTCACGTGC TTGATGGCCT TCTGTACCAT GAAAGCGACT TGGAAATTAC     38040
     CGAGCATTAC ACCGATACAG CAGGCTTTAC AGAACATGTT TTTGCCCTGA TGCATCTGCT     38100
     GGGATTCACT TTTGCGCCAA GGATCCGGGA TCTTCATGAC AAGCGGTTGT TTATTCAAGG     38160
     AAATAACTGG GATTATCCGG GGCTTCAGTC CGTTATATCA ACAACCCGCC TGAATCTCAA     38220
     AGACATTGAG GCGCACTGGG ATGAAGTATT ACGGCTAGCA ACTTCGATAA AGCAGGGGAC     38280
     AGTCACCGCA TCGCTGATGA TGAAAAAGTT AGCCAGTTAT CCAAAACAGA ACGGACTTGC     38340
     CAAAGCGCTG AGAGAGATAG GTCGAATAGA GCGGACACTG TTTATGCTGG ACTGGTTTCG     38400
     AGATCCGGGT CTGCGGCAAC GGGTACAGGC TGGGCTGAAT AAGGGTGAGG CCCGTAATGC     38460
     CCTTGCGCGT GCGGTTTTTA TGCATCGTCT GGGTGAAATC AGAGATCGGG GGCTGGAAAA     38520
     TCAGAGTTAC CGTGCCAGCG GACTGACGTT ACTGACAGCG GCGATCACGT TATGGAACAC     38580
     GGTATATATA GAAAGAGCCA TTGAGTCACT GAAACGAAAA GGTGTCCCTA TTAATGAACA     38640
     ACTAGTTGCT CATCTTTCTC CCCTGGGCTG GGAACATATT AATCTGAGTG GCGATTACGT     38700
     TTGGCGCCAT AATGTAAAGC TGGGGTCCGG AAAATATCGG CCATTACGTA CAGTCAATAC     38760
     TGAATTGTAC AAAAAACAGT CTTAGCGTGG GATATTTTCC GTTTTCCAAG CGGACCCCTA     38820
     GACGATTTCC TCAGTTTTAA AATGTGAGGA AACGGTACAG AAAAGATTTT GAAAAGTACT     38880
     GATTAGAAAC GCCGAAAAAA GATTTTTCTA AACGACGTTT TATTTTTTTA GATTTGCTAT     38940
     GATGTAAGGT TTAGAAAAAA CGAAAGTCAC ATCCGTGAAA CGTCTCACCC CTTAACGTTT     39000
     GCGTTAACCC GTTTGATCAG CGCTTTAGGC AAGACGATTT TTTTACACAC ACTTGAAAAA     39060
     TAACTGGGGA CGCAATAATC CTCACTGAAA ACAAAGAGAA CCTTTGGGCA CTCATTTCTT     39120
     TTCATAGCCG CCCATCCCTC ATCATTTGTA TTTCTGACAA TGACAACATC GCCGTTCACT     39180
     TGCTCTGCGT TCGCCTCAAA GAACGTAAGA ATAGTTAATA AAAAAAGCCT TCACCGCAAT     39240
     GGCAAAGGCT TTCGTTGTTT GAGTACTGGT TAGGTCAGAT TATTTAGCTA AAGCACTAAG     39300
     CCAAGCAAGC ACGCTATCTT TTAGATAAAA ACTTACCACC GCAGCAACAA TTAACCACTG     39360
     CAGATTACTC AGTGTTTTAA CGACTGATTT AATTTCAGTT TTTACCTCAG AAATATCCTG     39420
     TTTAAGTTCA GTTCTTAGCT CAGAGATCTC TTGCTTCACT TCAGCAATAT CTTGCTTGAG     39480
     TTCAATTCTT AAAACAGATA TATCCTGCTT TAGTTCTTGA CGAGCAGACG TAAGCTCTTC     39540
     TCGCGTAACA GAATGTTGTG ACGCATTCAG CAAAAGTTGC AGTACATCTT TTTGAGTTAA     39600
     TGTCTCGTTA TCGCTCATCG ATGCCATCCT TTGTTCTCCC ATATTTGCAG TATAACAAAA     39660
     CAGGAGTACC AAACCAAATG GCAGGATAGC TCCTGCCATT GAAAAGTTAA CCGTTAATCA     39720
     AGCCCTAATT CAAAAATGCG TACATCACAT TGACCATAAT TAAACGCAGT TCGTAAATAT     39780
     TTCGGCATTG CCGATAGCTG ATGAGTTATG TCATCGATAA TAGTGAGCAA CTTTTTGTGA     39840
     TTACATTCAA AGTAACACGC AAAATCACTC AACACATTGT CGAATTTCAT ACCTGCATAA     39900
     AACGAATCAC TCCATGCTGT ATTTGCAATA TCTTCGTCAT CCTCACAATC TATCAAGGCA     39960
     AACTTCGCTT TTGCAACGGC AAGTGTGAGT TCTATTTCAC TTAATGCAAT TAACATCTCG     40020
     GTTGACGTTT TCATACTCAT TCCTCTCAAA ACCACAAAGA GGAACGCCAC TCGGGGACGA     40080
     ATCCCCGGTG GGTTAGTTAA CAAATATTAA ATGGTTACAT TGATCGCCAC ATTGAATACA     40140
     GAACATCTGC AAATTCGATT TCGCTTAGTG TACCAACAAC TAAATCAACC ATTGCATCCG     40200
     ATAATTCATC ATACTCAGTG TTTATTTCGT AATCATTGAG TGACAAATAC TCTAAACACA     40260
     AGGCAAGCCC TGTGCGCTTG TTTGCATCTG AAAAAGCGTG TGCCATAGCG ACTGAAGTCG     40320
     CATATTTAGC CGCAATTAAA AACACATCAT CCAAGCCTTC ATAAGCAATA GCATTGTCGA     40380
     TCCGCGATAA CGCACCCGAC AATCTGCCGA TATCATATTC ACCGCGAAAA CCTGGTTCAT     40440
     TCAACAGAAT GGCCTGATTG ATTTCAACGA CTCGTTCAGC AGGAAACTGA ATGAAATTCA     40500
     TTACATATCA GCCAGTTTGC GAAAAGTATT TTTATGCGTT CGTAAAACAA GTTTTGTTTC     40560
     GCTATGCACA ATCTGCTTAC CGCAACCACC AGTCAAATCA AGCTTTTTAT TGGCTTTCAC     40620
     ATGTGGACGC TCTACGATGT TTACACCGTA TTTCTTTGTT TCATTTAACA TTTTAATAGT     40680
     CCTCGCGTTA ACACTCACCT TGATTTTATA AGCTAAATAT AAATCACTTA TAAAACAAAA     40740
     ACAAAGTGCC ACAAAGGTCC TTAGTAAAAA GCCCTATCAC TCGAAAGTAA AAGGGCTCAG     40800
     TTTATTACGC AGCGGTTTGT ACCGGCTGTG CCGGTACATC TGCTGCTTGC GGTGAAGATT     40860
     GGAAGACGAT GTTACCATTT ACCTTAAGGT AAGTGATTTT CAACAATCGT GCTTTCAAAC     40920
     AAACGCCAGT TTGGCCTTGT TTTTCTCCAC TGCCGTGAAC GAATGTCTCT GGGTACAGAT     40980
     CACCAAGTTT AAAGCTTGCT GTTACCGTAT CATCTTTATT CACAGAAGAA AGATGGGTAT     41040
     CAAACAACGC TTTGGCTTCA GTGCCAACAA CAGAACAATC GAAGTAAGTT TTTTGACCTT     41100
     CATCACCACG ACAAGCAGCA ATAGTGACGG CCCAATAAGG CTGACCTTTG CGTAACTCGA     41160
     CTTTACGGAT ACGGTTAAAG AAACCGAAGC CAGTGATATG TAAGTCAAAA TGTGTATTTT     41220
     GTGTAGTCTG AGTCATGATA ATTCTCCAAA TAATAGGCGA GAAAAATCAC GACCCTAATG     41280
     GGAGATGATT TATCCCATTA GGTAGATAAC AACAAACGTT AAGGCCAGTG AATACACACT     41340
     GGTGCTTCTA TCAAAGAGAA GCTAAGTTTA GGATACCCCA ATCAGCCTAA GCTGAACGCG     41400
     ACACATCTCA TGGAGCCATT TAAGGCGTAT TGCCGTGTGC TTCACACTGT AAGTCAGTGA     41460
     GCAACTATAA AACTCTTTCA GGGTAACAGA GAGATTTTAC GAAATAAAGC CTCTTCTCTA     41520
     TAATTTTTAC ATCAACAAAT CTATGTTTGG TTATTGCTCT CCATCTCCTT ACCAGGCTTA     41580
     CCCTCATTAT CAAACAATCG TCGCTGGCAA CCTGATTGAT ATGCCGAGCA TCCCCACCAG     41640
     AACTTACCTT TCGTTTTGGC TTTTTTTCTA ACAAGCACCC CTTTCTTACA TGTACAAGGT     41700
     GTTGTTTTAG GCAATTTCCC GCGCTCATCA TTAAGCAATA GACCACATTG TTCTTTGTCC     41760
     TCGCATACCC AGAACTTACC GTTTTTCCCC GACAATTGTT TCATCGATTT TTGACATACT     41820
     GGGCACGGGA GTGTCACAGC CAAAACCTTT GGCAGCTTTA ATGTGTATTG CCCTTGTTTG     41880
     AACATAGAGA CTAATTGCGT GATAAATGTA CTTTGCCTTG CCATGAAATC ATCCAGTGAA     41940
     CCATTACCCA ATGCAATCTC ATCGAGTGCT TGTTCCCACA ATGCTGTCAT AGCGGGTCTG     42000
     GTGAGCACAT CTGGCAACGC ATCGATGAGT GATCTTCCGG CTTCTGAGCT TATCAACTGC     42060
     TTCCCCGTAA CAGTGACAAA TCCCCGCGCT TTGAGCGTAT CGATAATGTT TGCTCGGGTT     42120
     GCTTCAGTAC CAATGCCTGA GGTTTCTTTT AAAATGGATT TGAGTTTGGG ATCACTTTCA     42180
     AATTTAGCGA TATTTGACAT TGCATCAATC AGCGTTCCTT CCGTAAAACG TCCAGGTGGC     42240
     TTTGTTCGCT TATCTTCTCG CTGAAACTGT GCTGTTAAGG TTTGTCCGAT GCTCAACAGC     42300
     GGCAAATTAG CACTGTCATC GGTAGTTTCA TCCTCACTGT CTTTACCTGT CACCAAGCGC     42360
     CAGCCTTTCA CTCGCTCAAC CTTGCCCGTC GCTTTAACAC TTTGGCTTCC AACCATCAGT     42420
     TCAATTGTTG TGGCATCGTC TTCCGCTACT GGGTAAAACT GAGCGAGATA TCGCTGCACA     42480
     ATAGCATGAT AAAGATTCAG CTCCTTTTCG TTCATTTCAT GCAATTTCGG TGTCACCGGT     42540
     AATGGAATAA TCCCGTGGTG AGCCGTAATT TTCTTATCAT TCCAACAGGC ACTTGTTTCA     42600
     TTTACATCTG CAGCGCTACA CCATGCAGCA AATGCTGGCA CAACCTTGAG TTTATCGAGG     42660
     ATTGAGCCAA CCTCCTCCTT CTGAGATAAG GGCAAATAAG GACAATCTGT TCGGGGGTAA     42720
     GTCGTGACCT TATATTTCTC ATATAAAGAT TGCGCAATAT CGAGTACTTC TTTAGCGCCA     42780
     TAGCCAAACT TAGCAGACAT GGCCTTTTGC AAAGAACCTA AGAAAAATAA CGGTGGGTGT     42840
     TTAGATTTTT GCCGCTTGGT ATCGAATTGC GTGACTGTAC CAGGTTGGTC ACGACATTGA     42900
     GACAAGACAT GATCAACAGT CGTCACTTGT AAGCAGCGGC CTTGCTCATC CCCAAGATTA     42960
     TCAGGCACTT GCCATTTGGC TTTAAACGGG ATCGTTGCAT TAAATAAGCC AGTGATATCG     43020
     TAATACGACT GTGGTTCAAA CTGCTCAACT TGGCTATCTC TATCGACCAC AAGCCGTAAT     43080
     GTTGGCGTCT GCACTCTTCC GACTGAGAAT GCACCTTGAT AACCGTATTC ACGGCTCAGT     43140
     AAGGTGCATA ATCGCGTCAT ATTCATTCCA ATAAGCCAGT CTCCCCGACT TCGGCCTAAC     43200
     CCTGCATCGT AAAGCTTGGC AGTTTCATGG TTAGGTCGCA AAGACGCCAA CGCTTTCTTA     43260
     ATGCTGGCGT CATCCAACGC ACTTAGCCAC AACCGTTGAA TGGGCCCTTT ATAGTTAACG     43320
     TATTCAAGCA CCTCACGGGC GATAACTTCA CCTTCGCGGT CTGCATCCGT TGCAATAATA     43380
     ACCTCAGTGG CCTTGGCCAA TTGCTTTTTT ACAATCGCAA ATTGCGCTTT CGTTTTTGGA     43440
     CTGACTAACA TTTTCCAAAC TGTTGGAATA ATGGGTAAAT CAACGATATT CCACGTCTCA     43500
     AAATCAGGGT TATAGTTTTC AGGTTCTGCT TGTTGTAAAA CATGACCAAC GCAAAACGTC     43560
     ACCGCAATAC CGTCACCAGT AAAAACACCA TCTCCACGCT TACAACCAAG GACACTCGCA     43620
     ATATCTTTTG CCTGTGACGG TTTTTCGCAT AAAAAGAGTC TCATAATAAC CGCCTACATA     43680
     TTGATGTACG GGCATGCTTT AGTTAATACG GAAGCCGTCG TTTGCTCATA GGTGCTCACA     43740
     ACAGCACCTA GCGCCTTTAA ACGTTGATTA ACCCATGTGG GAGTCACATT AGCGATCGTT     43800
     TTCCCCTCTG TGTTGCCCAT TAATGCTTGT TGCACTTGGG CAACATAAGG TTGTTGTAAA     43860
     TCAACATCTC GCCTTGCCTG AATTAATAAA GAAGCATCTT TTTGATGCAT CGCCCAAGCA     43920
     CGAGTTCTGA GCGCTGCGAT CGCGTTCGTT AAACTTCGTC TTGGCTTGGT ACTCAGCTTC     43980
     TCCATTGTTA ATACCTCGGC TCATATGAAC TGTCATCTTG ATAAGGCACT TGCGCGGCAT     44040
     GAGGTTGGTA AGGGGCTTTC TCCTCCAACG TTATCGAGGC AATACGTCTC GGTAATATCG     44100
     AAATGGATTC AGCCGTAATA CAAAAGCCTG GCTCCATCAC ACCTTGGTCA TTTTCCCAGG     44160
     GCTCTGCGCG AGGCTCACCA ATCACCAAAA TTCGCATCCC TTTTTGCAGC AGTTGCGCTA     44220
     ATGCCGGGCC ATCTTTTTTC CAATAATCAA CAGCGATCCA AACCCCCCCC TTATCAATCA     44280
     GCCCTTCATT ATTAGGGCCA TTCACCAAGC GATCGTATTT AACATTCAAT TTTAATATCG     44340
     GTCGTTTCTC GCCTCGGCTG CGCTCATTAC CTTCTAGAAA AGTAATTGCC GGTGCCTGAC     44400
     CAATATTGCC TTCTAAAGTT ATTGTTCCTC TATACATAAT CATGTTCCTT GCTGGTTTAA     44460
     TGGATGGATT AATGACTTTC GGTATTTAAC AGCGTTGTTG TAAGTAATGT TTTACCTCCT     44520
     TCTGGGCATC AATACACAGA AGCCGGCGAT AACGTGGATC AAGTTCTAAG AAGTGCACTA     44580
     GCACGAGAAA AATGGTGTTA GTGCAAGATT GATGTTCAAA AAAAGAAATG AGCGCCTGAG     44640
     TGCGCTTATT TAAATGAGCT CTATGTACTG AGGCATCCCC CAGAGAATTG TGGATTTGTT     44700
     CAATTTTAGA CAGGTCTAGT GCAGGCTGTA ACGACACTGT TGCGACCAAA TGGGCACAAA     44760
     AATCATCAAA CAATCGCTCA TCATTTTCTA ATCGGAATGA CACGCTGCTT AACGACACAG     44820
     GCTCATTTAG CTCACCCATT GCGCCCAAGA CAATCCGCAA AAATTGACAA TGAATTTGCT     44880
     CAAAATGCGT TTGCTGGCTT TGCCATTGTT CGCCTAATAA AGCTGTTTTA AATGCCGTTA     44940
     AATCAACTGC ACTAAAACTA AAATTTTTTG CAACTTGATT TCCCATGACC ACTCCCTAAA     45000
     TGACGCACAT AGGAAAACGG TACAGAAAAA AATTTGAAAA GTACTGATTA GAAACGCCGA     45060
     AAAAAGATTT TTCTAAACGA CGTTTTATTT TTTTAGATAT GATATATTAA AAAGTTATCG     45120
     ATTATTTATT GTGCATTTCG CAATAAAAAC ATCTGCTCTC CGGTCATATG TGCACACATT     45180
     GAAGGAGATG CAAATGCAAC ATCGAAATCT AGAAAGCAAA CTCGAAAATA TTGGCTACAT     45240
     ACTTAGCGTG GTTGGAATGG CGCTTATTCT TGCCTGGATT GGGATCTACA AATTCACCCC     45300
     AACAGAAGCC GCACTAATAG AACCATTAGT TGCAAACCAC CCTCTGATGG GATGGCTTTA     45360
     TTCATTTCTG TCTGTACAAG CTGTTTCGAA CATTATCGGC GCAACAGAAA TCATCGTTGC     45420
     GGTGGGATTA ATCGCAGGTT TTAAAAATGC AAAAATTGGG TATATCTCAG GGATAGCCTC     45480
     TGCTGTTATT TTTGCGACGA CATTAACATT CCTCATCACT ACACCTAATA CATGGAAATT     45540
     CTCAGATGGC GTATTGATAA CAAATTTCTT TCTATTAAAA GACCTCTTAT TTATTGCGGC     45600
     ATCACTCAGT ATTATTGCAA AAAACAAAAC TACCCTTAGA TTGATAGCCG AAGCTAACAA     45660
     CAAACGTTAA CGCTTACATC AAAAAAAAAT GATGCTGCTT AATGAGTGTT GGCGCTTGCG     45720
     ACAACGCGAA CTTAAGCAGC CATTCTCTTT CTCCCATAAC AACACCGTTA TAAAGGATGT     45780
     AATATTAGGT GAATTTGTTG GCAATCAGGA TTCACTTGAG CAACTTCCAC GTTAAATAAC     45840
     GCCTCCCCCT TTAGTATTGC TTCCAATTTA TCAAACTCTG GCGATTCATA AAAAACTGAT     45900
     ACCGGAGCAA TCTGTTCACC GGTCTCCGCA AACCCATACT CAACATGAGA ACGCAGCAAG     45960
     TAAATAAACT TAGACTTACG TGCCTCACCA TCAAGAATAA ACCGCGACTC AATATCATGC     46020
     TTTACTCGCA CAAGCTCCAG TAAATCAAAT AACTTTTGTG CATCAGTTAC CTCTTCAGTA     46080
     TTCTTTGTTA TTAAACTGCC TATCTCTATT AGTTTAAGCT CAAGGCTAGC GCCTTTTTGA     46140
     CGCCCAATGC TGAGTATTTT TCTTGTTTCA TTTCTAATAA ACTTAAACCT ATGATCCTTG     46200
     TGAATTGGCT TGATGAACTT GACCAATATT TCATTTCTCT TAGCAATGGT GACATGCCCT     46260
     GGAGTATCAG CTACCGTTAA ATAAAGATGG ATCAATGCAT TGGTTACCAC CGAGGAAACC     46320
     ATTTGATAAT ATGTTAGTTT AACGGTCATA TCGCACCTGG CATGTCATTT TCACTAATAT     46380
     ATTGCATTGC CCAATCCAGT GCTTCTTTTT TAATTTGCAT AATATCGGTT CCACTAAAAC     46440
     TTTTTTGTGT CTGTGTATAA TCAAAACGCA TAACAAAAGT GGCCATTGAC TCTAACTGCT     46500
     TTGCTGTAAT CGTCCTTAAT GTCAGTACAC CTTCTTCAAT CAATACATAT TCACTGCCAT     46560
     CTTCGTTTTT GCTCCACGGC ATTGCTTTTA TCACTGCATG GTCCCTTTTA AGTCCAGTCC     46620
     TCATTCAACC CCTTTATTAT TAATAAATGC ATTCACGACA TATTATACCG ACAACCGCTA     46680
     TAAGCTAGAA CACATTGCAG CCATTTTCTT CATCATTTTG ATGCACAACA TCACCATTAT     46740
     TAAAAGCAAT AGCCAATTTG CGCCATTTTT ATTCATTTTG AAAAGATAGG TGCGCTCAAT     46800
     GTTGATGCAG AAACAACTGC TCTCCCTCAG GGTCGCATAA GAGCACTCAA CCCTGAGGGA     46860
     GAGCAAAAAG CCCATTGTGC CAGCTTTTCG CCTGTTCTAA ATAGCATTGT ACAGTAACTT     46920
     TTCCAAAATT TTACTGTACA ATGCTATTTA GAACGCATAA TAGAGGCTTC ACTTTTGAAA     46980
     ACCTTAAAGC AAAAGCTCGC GATAGATATT GCATCATTAG ACCTCAAACG CAGGAAACCA     47040
     TCAAAAATCA GTCCTTACAA GGACCAACTT TTGATTTTAA GCAAATTTAT GAGTTATCGC     47100
     GAACTTGCTG CATGGCTCAA GAATGATAAG GAGATAACCA TATCTCCTTC ATCAATTCAT     47160
     CACATGCTAA AGAAGTGGGA AAATGAAAAA ACTTAATTTA GCGCAAGTCA TTGAAAAAAG     47220
     CTTGCCAATT GCATCAGAAC CTATCAAACA AACAAGAAAA CAAAGACGGT TCACGTCTAA     47280
     GCTTGAACCA TATCGGCTAG AAATCTTAAC GCTGTATAAT GAACTTAATC AAAGTGGCGC     47340
     AGTTATTCAG CAATGGCTTA TAAAAAATAA TGACCTGCAT GTATCTATAA GTACAATTTA     47400
     CAAAAGAATA TACTACTGGC ATAGTTTAAA TGAGTTTAAT AATGAAAAGC AAACTACAGA     47460
     AAAAACTCAC ACAACAAGCT GAACGACTCT TTATGAACAA TTTCAATGGA ATTGGGAAGG     47520
     CAAAGACAAA AACGTCTGAA CTATTGCATG GGAGGCGTTC TATAAAGGAA CAAGCAAGGA     47580
     TAGTTGGTAA AGCTGCAAGC GATTTAAACT TAAAGAACCT TAAACTCCTT ACCCCTATTA     47640
     TGGCGCAGGA ATATTTGACA ACTTGCAGAG ACAAGGGGCT TTGCCAGAAA TATTTATCCA     47700
     CTATAAAATG CTCTCTTCAA CGAGCATTAT TTAAACATGA AAATAATACA CTCACGAGAG     47760
     TGATTGCCTT TGATAGAAAA AAGATCCCGT TAACCGACAA AAATAGAGCT TACACTAACG     47820
     AACAGATCCG ATTAATTATG ACAAGCATGA ATGACAAAGC TAAATTATCG ACTCTAATTG     47880
     CAGTTAATGC TGGGTTACGA GTTGAAGAGT TATTAACGAT TAGGCGATTA GATGAAGCCA     47940
     CAGTTTCATC AAGTCGCTCA TGGAGTAGCA AGCGGTTTAT AGGTAGAGAG GAAGGTGTGC     48000
     GGTATATTTT AACGGGGAAA ACGGGACTTC GCAGAGAAAT ATTAATCAGT AAAGATATTG     48060
     CTGAGTTAAT GGAAAATACG CGACTTACCC AACCAAAAAC AATTATTGAT AGAAAACACT     48120
     CGTTCGTCAT AAACTATGAT TTATTAGGGG GTAAACGTCT TAGTGATGCA TTTTCAAGAG     48180
     CATCAATAAA AACGCTTGGG TGGAGTAATG GCGCTCATGG TCTTCGATTT ACTTATGCTC     48240
     AAAATCGAAT GGATAATGAG TTAATTAACT TCACTGATAG TGAAGCAAAA CTGATCATCA     48300
     GCCAAGAGTT AGGTCACTTC AGAGAAGAGA TCACTGACCG CTATCTTGAA CCCTATAGTA     48360
     AGCGCACTTA ACAACATTCA TAACTTTTAA GTTTTCGCCT CTAACTAAAA AATTAGTGAC     48420
     GCGTCGCAAT GACGTTTAAC AGTTGGCCTG TTTCTGCCTT GCTTCACCCG CAGGTATGCA     48480
     ATCGTTCTTT TTGTCTATGT TCTCCTTTAA TTAAAGTGTT AATGGGTTAA GTTTTGTTAG     48540
     TCACGATTGA GTTACAAAAT AAGTAAACAC CCAGGTAGGG TGAAGTTAAA AGTCTAATGA     48600
     CTTGCATGGT TCGCAGTGAA ATACATCAAG AAAACCACTG GTTAAGCCGA TGAATACACA     48660
     TCGGGGCTTC TATCAAAGAG AAGCTAAGTT TAGGATACCC CAATCAGCCT AAGCTGAACG     48720
     CGACACATCT CATGGAGCCA TTTAAGGCGT GCTGCCGTGT GCTTCACACT ATAAGTCAGT     48780
     GAGCAACTAT GGAACACTGT CATTTTAAGC AGAGCAGCTT AAAACGTCAA ACACTGCTTA     48840
     TCCACAAAAT CTGTGCATAA GTCGCGGGAT AGGGCTGTAT AATCTTTAAT CGCTCGAGCA     48900
     TCAGCCACTA TTTTAGCGCT GGTCAATTTT TAGCCTGTGA AATAATCTTT TCAATTTCTG     48960
     CCCAGGACAA AATAGTGTCC TGGCCACTTG AACTGTGAAT ACGTGAACTG AACCCTCTAA     49020
     GCCTGGGCAA CTTGAGCCAA ATAAACTCTT CATCATCGAT GCCGGAAGAA CGATAAAAAG     49080
     CGATCAATTC TGCATCAAAA CATTCGCCTT TTTTCCCACA CAAACCACAA GTACCTGTAT     49140
     CAGCAAGAAA ATAGTTCTTT ATTGGTAGGC AGTTTTCGCA AACATTGGGG TTATTCATTG     49200
     CTACATCGCT GTTTAATAAT GATATCGGAG CGCTACGATC GTCAACGTAT CTTGACTAGC     49260
     CTTATAGACT AATCGATGTT CATCGGTGAT CCTGCGAGAC CAATACCCCG ATAAATTTTC     49320
     TTTTAATCTT TCCGGTTTAC CAATACCTTC AAATGGGGCC CTTTGGCATT CTTTAATCAG     49380
     GAGATTAACT CGTTTCAACG TTTTTTTATC CTGCTGTTGC CAGTAAAGGT AGTCATCCCA     49440
     GGCGTTGGAA GAAAAAAGAA TTTTCATTCT GATAGCTCAT GCTCAGAAGC ATGTCCATCA     49500
     TTGACTTGCT TTATGGATTC TAATAAACGT TTAGCATTAG CAGGGTTCGA CAATAAATAT     49560
     AGCGTCTCCT TCCAACTATT AAATTCAGAT TCTGAAAATA ACACTACATT CTCGTTACCC     49620
     CGACGGTGTA TTACCACGGG CTCACAATCA TTGACGACAG TGTCGCAAAT AGACTTAAAG     49680
     TTACTTCTAA CTTCTGTGAA ACTGTAAATA GCCATTATGA CTCCAAAAAA ATTACGTACC     49740
     AGTATTGGTA CAGTTTAAAC TTAACCAATT ACAAGTACAA CATTAAGTAC AAGTATTCTT     49800
     CTCTTATCGA GAACACTTAG GGTATACCCT AAGTAAGCCG GTGAATCACT CTACACAAGA     49860
     TTGATTCAAC TGTAGTAGCA ATCCTGTGTA GTTGCGAATA TTTCGAATGT TGACATTTTT     49920
     CGAATAATGC GGATAATGCA GGTTGAAACA AATTTTTCCA ATATTTGAGA GATGAATTAT     49980
     GAACATGACT ACTTTGCCGA ACGCCGAAGA AATCGCAATG GCTCGGTTGG GCAGCCAGGA     50040
     GTTATCTGCT GTTATTGAAA GTAATGGTGA GGCTCAACAA ATAAGTGTAA TTGATAAACA     50100
     AGGTCAATCG CATGATGTCA CTTTACCTTC TAGCGTATTG AAAATGATGA TTGAAGTGTT     50160
     GACGCAATTG GGGCAGGGTA ATTCTGTTAA TATCACCCCC ATCCATGCCG AAATGACCAC     50220
     GCAACAAGGC GCTGACTTTT TGAATATGTC ACGGCCAACA TTTATCAAGT TATTAGATTC     50280
     ACGTGAAATA CCATTTACTC GAGTCGGTAA TCGAAGAAAA GTGCCATTTT CTGCGGTGAT     50340
     AAAATATAAG CAGCAACTGG AAATCCAGCG TTTGTCAACA CTTGATGAGC TTTCCAGATT     50400
     AGATCAGGAA TTGGGTATGG GTTACTAATG GCTTCGTATA CTGTTGTTTT TGATGCGTGT     50460
     GTCATGTATC CCGCACCACT TCGTAGTTAT TTGATGTATT TAGCCAATGC GGGCTTATTT     50520
     AGGGCTCGTT GGACTGAGCA GATCCATGAT GAATGGATGC GTAATGTATT GTTGAATAAT     50580
     CCTCGCATCA CAGAAGCAAT GTTAGAACGT ACGAAACAAC TGATTAATGA AAATGTACCT     50640
     GATTGCCTTA TCGAAGGATA TGAGCCGTTA ATTAAAGGAT TAACACTGCC TGATATGAAT     50700
     GATAGGCATG TGGTTGCTGC GGCTTTAAAA GGGCATGCAG AGGCCATCAT AACGTTTAAT     50760
     CTTAAAGATT TTCCTGCATC AGAGCTCAAT ATACTTGAAC TATCAGCTAT CCATCCAGAT     50820
     GAGTTTTTGT GCGACATGTT TGAGTTAGAT CTAAGCTCTT GTATCAAAGC TGCTCAACAG     50880
     CAAAGAAGTA GCTTAAAGAA TCCCCCGATG ACAACATCAG AGTATTTAAA TTGCTTACAA     50940
     AAGCAAAGGT TACCGGTTTT TGTTTCGAAG CTGAGGCCAT TTGAATTAAT GCTATAGCCC     51000
     ATACCCGTGC GATGAATCAG ACTTACCGAG GCTGTTCATA ATTCTGTGTC AGGTTAATTT     51060
     CACAGATCGA TATGGTTTTC TAAGCGCCCC TCAAAATGGA TTGAGAGCTG TGATAGTGTC     51120
     AAATTCCAAT TTTGGATGGG GTGGGTCCAG CGCTCAGAGG CCTTCAATAT ACCCGCGTAA     51180
     AGCAGCTTGA GTAAACTGTT CTCGTTAGCA AAACCGCCCT TCGTTTTGGT TAACTTCCTG     51240
     AATTGTCGAT GTACCGCTTC AACCGCATTG GTGGTGTAGA TAGCGGTGCG AACGTAGTCA     51300
     GGGTATTTGA AATAAACCGA TAGCAGCGCC CATTTGTTAC GCCATGATTT AATCACCACG     51360
     GGGTATTTAT CGCCCCATTT TGTCTCGAGC TCATCCAGTG CCATCTCGGC CGCATTCAAG     51420
     GTGGCTGCCT TATAAACGCA CTTTAAATCC GCCATGAAGG CCTTTTGATG CTTTGAAGCA     51480
     ACATACTTCA TTGAGTTGCG AATTTGGTGG ATGACACACA GTTGTACTTC CGTCTGCGGG     51540
     TAAATGGTTT CAATCGCTTC AGGAAAGCCT TTAAGGCCAT CAACGCAGGC AATGAGGATG     51600
     TCTTTGACGC CACGGTTATA CAGGTCGGTC AGCACGCTTA GCCAATGGTG AGCGCCTTCA     51660
     TTATCAGACA GATATAAGCC TAATAGCTCT TTTTTACCTT CGACATTAAG CGCCAAAATA     51720
     GTATAAACCG CTTTGCTGAT AAAGCGGCCA TTCTCTTTGA TTTTATAGTG AATGGCATCG     51780
     AGCCATATGA CGGGGTAAAG CGGCTCTAGC TCGCGTTCAC GCCATGCTTG AAGCTCAGGT     51840
     AGTAACTTGT CTGTAATGGC GTTCACCGTG CCGTTGGACA CCGACATGCC GTACATGTCT     51900
     TCGATATGCG CGCGAATATC TTGGTAGCTG GAGCCTAATG AAAATAAGCC TATGATTTTA     51960
     CGCTCCATTT CATCGGTAAG TTGGGTTTGG TGCTTTTTGA CTAATTGAGG CTCGAAGTTG     52020
     CCAATGGGGC TTTTAACCGT TTTAGTGGTT TTACCGTTTT TACGATTGGC ACCTTCAGTG     52080
     CTCGCCAAAT GGCCGTCCAA CTCTGCCGCT AAGGCCGCTT CAGTGAGTTG CTTAATCAAA     52140
     GGGGTTAAGA TGCCATCCTT GCCGGTGAGG TCTTTACCTT CACGTAGTGC TTGAATGGCA     52200
     GCATTGATAT CAAAAGTAGG TGTGGTCATA AATCATCTCT TTTTGGTATA GCTTAAAGAA     52260
     ATGACACAGA AATTTGAACA CTACCAAGCA AAGTAATAAC GAAGCGCCAG CATGATGATA     52320
     TCTGATGGAT AATGCCGTCT CGAAAAATTG AGTGTCATGC AGGGGATGCT CCAAATTCAT     52380
     ATTCGAAGAT CATCCACACT TAAACTCTTA TCGTCAACTT TGCTACAGAA CCCACCAGGC     52440
     TAACTATATT TAATTATCAA TATCCAACAA AAGATTATCT ATTGTTTTGT CACTTTGCAA     52500
     GTGTGGCATT CCAGGCATAG CTTTTATATT CTTTTTTGGA AAATAATATA CACCATCATT     52560
     ACGATTCAAA ATTAGTTCTT TAACACTTTT ACCTGACTCC AAGTAATTAA TAACTTCATC     52620
     TATAGAGAAA GACCTTTGCT CATTCAATGG GAGATTGCCC TTATTTACAA AAACATGCAA     52680
     GTGTAATGTT GCGGTCTCTA TTGATACCGG GAAGTGGAAA AACATATTCA CCTTATCTTT     52740
     ATTTAGATCA ACATTATATT TAGAAACTAG TTGGTCATGT GAAGCTTTTC TCAGTGCTAT     52800
     AAGTTGTGGC AAATCTTCTT TTGTTAAGTC TAAAATTGTT GTTAATGACT TTAACCCTGT     52860
     TTTTCTTTCT GTTTCTAGTT GAGATGTTGT ATACAAACCA AATCTTGATG GAGAGCTTTC     52920
     TTTATGTAAT GAGTGAAACT CACCAGCTGT AATCTCGTTA ATAAGTGGCG CAGCATTTCT     52980
     AGGGTGTACC GCCCATGTCA ATAGTTGAAT ACCATTTTTA GTATTTTTTA AATTTTCTGG     53040
     ATGGGTAAAG TATTCTTTGG TTATATAAGT CGGATTGGGA TAGATTAGAT GCCCATTTGA     53100
     GTTTAAATCT ACTGGAGGTA AGTAGTCACA TAGCGCTTTA TTTTGCAGAT AATTACGGTG     53160
     TTCTGCACCA TCAACTTTAT TGATAAACTT TTTCAAAAAA CCAGTTACAG GCGTCTTTTT     53220
     ATATGTTTTC TGTAGCTTGT CTAAATGCTG ACCTGTAAAT GCAACTCTGA ATGAATCTTC     53280
     CACGTGGTAG CTTTTTGCTG TCTTTTTCGT GACAAAATCA AAATCACCGT ATTGATTTAT     53340
     ACCTTGCTTA GATATATATA AACCAGCTTC ACTGACAGGT CGCCCCTTCA TAGCTAATAC     53400
     ATCAACATGA CCGACACTTT TTCCCACGGC CAATGTTTTT CTATTATCAT CGATGCCATA     53460
     TTGATCAAGC ATTCTTTTAA TCTGATCTTT ACTCAATGGG CTCACATCAA TTCCGTAATA     53520
     ATCTAAAGTT CGCTTACTTT CAAGTTCGCT CAAATTCTTG TTTAGTGAAG CCTTGATCCT     53580
     TACAGATTTA GTCTCTTGAA AACGAGATCT AACTTCATTA ACAGCCTTAA CTAGCTCAAT     53640
     AGGATTTTTG GCCTGAGTAA AAAATTCATT TTGAAAGTTA TTTCTACCTT TAATATCCAA     53700
     ATCTCTATCG CCAGTTGCCT GTAAGTAACT TCCTGACTTA GACCATAACT CATTCAATCC     53760
     ATTTAACTGT GTAGCTGTCA TCTCATTGAA ATGATTAATT TCTTTTCCAT ATAATGAAGA     53820
     TGCGACCAAA AGCTGAACCC TCTCTTTATC AAAATGAGGG AGCCTTCTTA AATCGAGTCT     53880
     GTGTGCAGTT TTTGTGATTA GTTTCAATTT TTTAGCATCA TAATTAATCT CCCCATCCTG     53940
     AGTCGGCTGT AAGGCCATTT TGAATGTTAT TATTTCATTT TCACTAAAAA GATTGGTCTT     54000
     TCGAGCTGCC TTTTCAAAGT TGTTAGCATC ACGTCGCAAA AAACTAGAAT AAAAACGACT     54060
     CTCAGTAGCT GCTTCACTTT TACGTCCGGT TCTCATGAAG CAAGACATGA ATTCAATTTT     54120
     CTTTAAGAAA TTGCAGTCAT TATTTAGTTT ACCTCGTGCC CAATCAGCCA TCTCCCCGTC     54180
     ATACTTTTTA TCCGATATAA GCTCGACAAT ATCTTTAGAT AATGCACCTT GCCTTACTCC     54240
     ATGAGCTAAA GCGTGTTTAG GTCTATAGAC ATTTAATTTA CGCCCATTAA TATATCGAGA     54300
     TACATTTTGC TTTCTTACTC TGGAAGTCAG CTTGTCAAAA ACATTATTTC CTTGATACTT     54360
     TTTGCTAAAA AAATTGTTTA TCTCTTCTGC AACATACAAG CTAAACCCAT CATTATCACC     54420
     GTACATTTCA AGATATTCTA CCATCTTTGA AGTAGCATTA AACTTGTCCT CATTTTCATT     54480
     ATTTAATGAT TCTGTTCTTC TGTAATTATT ATTATTAATA TATGCGCTCT TTATTTTTCC     54540
     TCCAAGACTT TTTTCCTTAG ATCTTTCACT TGAGTAACTC ACAGTCTTAA ATGAATCTAT     54600
     CAACTCCTTA GCTACAGAAT CAAATTTACC ACTTTCACTG ATCTTTATAA TTTTAAAGTC     54660
     ATCATTATGA GGGTGCTTCA GCTCTACATT TTCAAGAGTT TTAATTACTA GCCAGTCTTT     54720
     ACCAGAAAAC TTACAAACTG CGCTAGGTTC CAAGTATGAA GCTAAATGTT CAGCTTCTTC     54780
     ATGGGAGCAT TTCCATTTAC TAGCCAATTT ACCCAATAGC GTTTTATCAG TCAAATCAAG     54840
     AAACTTTGCC CCCTTATTTA TATGCACTGT TAATAAACCT GGATTTCCTC CTGACTTTTT     54900
     TATTCTGCCA GCATATCGAC TTGCTTGCTC TAAGCCTGAA GGTTTCGCGA CATATAATCC     54960
     TCTGCCTCCT AATCTGTTAG GCTTTATACC AGGCTTTTCA TTTTTTAACC CCCACTCAAC     55020
     TGGATCTGTT ACCTTAGTGA CCAAGTCATT TACGAGTTTC TGATCTTGAA AGCAAAAACA     55080
     TATCATTTTT TCTGGCAGTG GTTTTGCTAA GCTTTCAAGA TAATTACGTT TTTCAATTTG     55140
     CTCAGCCGTA TAATAGACTT GACCATCACG CTTTAATTTT TTTTGTTCGC CGACGTTAGC     55200
     TTGTAACGAC TTATAATTTT TTTTAGACTT TATTTTTAAA TCAAGTTTTT TTATCCGAGT     55260
     CATCCATGAA CTATCATCAT TAGATTTTTT ATTTAACTCA GGTAATTTAC ATTTATTCCT     55320
     AACTGATTCA TCATCAATAT TACGAACACT TTTAATTCTA GAATTTAAAT CCGTGAGTTG     55380
     TTCTTTTGGC GCTTCGCTCG ATAAAGAACT CATCTTTATC AAAGATACTG AAGCTGTAAC     55440
     AGGAGGCATT GTCACCCTTC CTTTTTATGT TAGTTAAATG TAAAAAATTA GCGGCCGATT     55500
     AAATCTCATA AACCACAATT AAAAACTGCT CGAACACGTT GATTATCGAT GGCTCATGTA     55560
     AAATTTCCAT GTGAAATAAT ATGATAATAT CTACCTTGTC ACTCTTGGAA ATTATGCTAG     55620
     GATAATAAAA CTAATTTCAA AACCAAACTG GCTTTGTTTC CTAAATAGGT TGAACTAAAA     55680
     CCGTAGCCGC TGTTCTGATC GGCATCGCCT ATCAACTTAC CCATCAACCG TGTCAAAACC     55740
     TCGCTATAAA ACAACCCACT GGAAGCAATA CAACCAAGCC TTAATCAACC GCGGTTCACT     55800
     TACCTTCTGG ATCGATGAGG ATGCAATTAC TAAGTGGAAA GCCAAGGTCG AGCAGCCCAA     55860
     GAAAGGTCGC CCTCAAGTGT TTAGCGACTT AGCCATTACC ACTGCGTTGA TGGTTAAGCG     55920
     TATTTTCTCT ATGCCACTGC GAGCCTTACA AGGCTTCATC AATTCGGTGT TTAAACTGGG     55980
     TGACATCCCA TTATCTTGCC CGCATTACAC CTGCATCAGT AAACGCGCGA AAACGGTCAA     56040
     TATTGCTTTT AAAACCAAGA CTCGCGGCGC CATTAAGCAC TTAGCTATCG ACTCAACAGG     56100
     CTTGAAGGTC TATGGCGAAG GTGAGTGGAA AGTGAAGAAA CATGGAACAG ATGGAAAGCG     56160
     CCGAGTGTGG CGTAAACTGC ATATTGCCGT AGATACACAT AGCCATGAAA TTATTGCCGC     56220
     AGAACTCAGT TTATCAGGTG TATAGCGCGT CAATTAGCTT GGCCGATCCA GCGACAATTA     56280
     ACTTGGCCGG TTGAGACTCG GTTTAATTTA GTTTGTTTTG GGCTTCTTTT CGCCTGTAGC     56340
     TTTCTCCTTT GCATTGCAAA ATTTTCGCGT GGTGGATCAG CCTATCGATT GCAGCTACGG     56400
     TCATCACTGT GTCACTGAAT AACTTATCCC AATCTTCGAA TGATTGGTTT GAGGTTATTA     56460
     TTAGGCTATA TCTTTCATAA CGATGCGCGA TAAGCTCGAA CAAGACGCTA GTTTCTTCTG     56520
     TACTTTTTTG CACGTAGCCT AGATCGTCTA AGATTAACAC TGCAAATCTG TCCAATTTGA     56580
     CTAGGGCTTC TGGCAATCTC AGCTCTTCTT TCGCTTTTTG CAGGTGCTGC ACAAGTAGGC     56640
     TCGCACTCAT AAATTTAACT CTATGCCCTT GCTCTACAAG ACGATAACCA AGTCCAGCGG     56700
     CAATATGTGT TTTACCTAAA CCACTGGCAC CGAACAGCAA GATATTATCT CCTGTTTTCA     56760
     ACCACTCAGC ATTATCGGCT AAATGCCAGA CTTGCTTCTT GGATAAGCCT TCAACTTCGC     56820
     TAAAATCATA GGTGTCAAGA TATTTACCTA TTGGTAACGT TGCTTCTTTT AAGCCTCGGT     56880
     GCAATCGCTT TTGTTCTCTG CAACTGAGTT CTAATTGGCA TAATTCAGCT AAGTAACGCT     56940
     CCACCGGCCA ATGCTGCTCT CGTGCTTTCT CAGCCAACGG TTGCCAATGT GGAAGTAAGC     57000
     TCACTAGTCG AAGCTCTTTG AGAATAATAG GCAACGTTTC AACTGACATA TTCATTCACC     57060
     TCGTCAAGAA TTTGCTGATA AGACGCTAAG CTATGTTGTT GTACTTTAGG GTTAAATTCC     57120
     CACTCTTCGT CTTTTAAAAA ACGTTCTTCA CAGTCAACTA TGTTTGGCCG TTGCCCTAGA     57180
     TTTATCCCTT CGAGAACGAA TCTTCCTACC GCTTCTTCAC GATCTGATTT ACTGGCGATA     57240
     TTGAGTAACC TAACCATATA AAGACTTGCT TCATCAGCAC TTAGTAGAGC ATCGACATTC     57300
     TTCCATATTT GGCGATAGTC TTCATTTGGA AGCAGTTGGT CTCGCCATTG GCCCCCCCTG     57360
     AATGCTCGAG GTTTTTTCAT CAGTGCACCG ATTAAGTGAC GATAATTAAT TTGATGACCG     57420
     CGATTATTTG CTGACGCATG TACGCGAGTG AGCGTGGCGG TGTGCACTCC ATGGCAATAG     57480
     ATATCTAATT TTTTATCGAA AAGATGCACG CGCAATGTTG CACCGACGAG TCTGGATGGT     57540
     ACTGAATAAG TCACTCGTTT TAACTGAAAC GTACTGGTGC TCGATACTTT TACTGGGTAA     57600
     ATTTCGTAAT TAACACTTTC AAATTTAGGT AAGGGTTGTA ATTGTCGTTG CTCATCGATG     57660
     AGAAGTGCCA TAATACGGCG ATTACGTCTT TGGACGACGT CATCAATAAA TGTTTCATAC     57720
     TCGTCAATGC TATCAAAGTC ACTTGAACCA CGAATAGCCA AAGCTTGTCG GATTTGGTTT     57780
     TTTAGATGAT TGTTGGCGCT TTCAATGGCA CCATTTTCAT GGGCACCCCC TGTGTCAGGA     57840
     TTGTTGTCAC CCCTAAATAA TCATTATTTT TAAAGACAGG GTGCGGCAAA AGAGAATGAT     57900
     ATGGCTCGGT ATTCACCAGA ACGTAAAGAG GCGATCCTTA AAAAATTATT ACCTCCTCAC     57960
     AACTTAACGG TCGCAGAGGT AGCTCGGGAA GAAGGCATAG CGGTGCAAAC CTTGTATCAT     58020
     TGGCGAGATA TAGCCAGAAA AGAAGGTCGC CCCGTGCCAG GAAAAACATT AACAGCCGAT     58080
     GATTGGTCTG CAGAAGCTAA GTTTGCGGTA CTCATTGAAA CTGCTCCGCT ATCAGAAGCA     58140
     GAAATAAGCC AGTATTGCCG TGAAAAAGGT TTGTACCGCG AACAAGTACA ACAGTGGAAG     58200
     TTGGAGTGCT TGTCTGGTTT TCAAACCTCA GAAGTACAAA CTAAAACCAT TAAACAGCAG     58260
     GCCAAGGCTG ACAAAGCCGA AATCAAATCG CTGCAACGGG AATTACGCTA CAAGGAGAAA     58320
     GCGTTGGCAG AAGCTGCCGC ATTACTGGTG CTCAGAAAAA AGCTCAATGT GCTCTGGGGG     58380
     GACGACAGCG AGGAGAGCTA ACCCCTTTGC CTGAGCGCAT AGCATTGATT GCCTTAATTC     58440
     AAGAGGCGTA TACCCAGGGT GCTCGCCTTT ATAAGGCTTG TGCTGAAACG GGCCTCAGTA     58500
     AGCGTACCTA TCGACGTTGG TATCGAGAAG GTCAAGTGCA AGCTGATTTA AGGCCAACAG     58560
     CAGCTCGTCC AGAGCCGGCC AATAAACTCG AAGAACATGA GCGACAACAG ATATTAAGTG     58620
     TGTGTAATCA AGCGGAGTAC GCCAGCTTAC CCCCGTCGCA AATTGTGCCA ACATTATTAG     58680
     ATAACGGGAT TTATATCGCC TCGGAATCCA GCTTCTACAG AGTGTTAAAT GCTCATGGTC     58740
     AACTTAACCA TCGTGGCCGC ACTCAGGCTA CGGTCAATCG AAGCAAACCG TTGAGTTATC     58800
     GGGCAGATGG GCCGAATCAA GTGTGGTCAT GGGACATCAC TTATTTGGCC TCAACCGTTA     58860
     AAGGCCAGTT CTACTATCTG TACCTGTTTG AAGATATTTA CAGTAGAAAA ATAGTGGGTT     58920
     ACGAAGTTCA TGAGCAAGAA AATGGGGAAT ATGCAGCCGC ACTAATCCAA CGCAGTCTGT     58980
     TACGCGAGCA ATGCTTTAAC ACGCCATTAG TGCTGCATTC TGATAATGGG GCGCCGATGA     59040
     AGTCACTGAC CATGAAAGCC AAGCTGGAAG AGCTCGGTAT TACGGCATCA TTAAGTCGGC     59100
     CACGAGTGAG TAACGATAAT CCGTTTTCAG AGTCGTTATT TAAAACATTA AAATACCGTC     59160
     CACAGTGGCC GGCATCAGGT TTTAGCTGCT TAGCAACAGC AAGAGAATGG GTGGAAAAGT     59220
     TTGTAAGCTG GTACAACGAT GAGCATAAAC ACAGCCAGCT AAATTTTGTC TCACCAGGGC     59280
     AACGTCATGC ACTGCAAGAT GGCGCTATTT TAGCCAAGCG CAAGAAAGTG CTTGAGGCAG     59340
     CGAAGGAAAG AAAACCGATG CGTTGGTCTA CTGAGATTAG AAATTGTGAA GCGGTTGGCG     59400
     CTGTAACACT CAACCCAGAT AAGGCACCAG TAGAAGGCGT AATAAATGCA GCTTGATTTT     59460
     TAAACAAAGA GTGACAACTA TCTTGAAAAA CACCGGGCAA TGCCGGTGTT ATTTTTAGAA     59520
     GGTTTGAAAC CATAATGAAT CGATAATTCT GAAAATCGTT CAGTAAATAA TGTTTCGTTG     59580
     GAATGGTTTT TATAAGCAGC GCTCAAGCTA TCCGTTCTGA CTTCCTGTGG AACACCATTT     59640
     GATTGTTCAA AGGCATTTTG TAAGCCTGTA GCAACAGCTA CGAAGCTTTC TCCGCCGTAT     59700
     ACGACTTGAA CGTAACTCCA ACCACTTGCA GGTAATCGAT AGTTAAAAAA TCGATGCTTA     59760
     AGAGTTGTTC CTCTAATCGT GACAATGAAA TCCGCCCAAG TGAAATCCAT GATCCCCAAC     59820
     TGACCGAATT CTTTAACTTG GCGAAAAATA ACCTCTTTAT CTTGGCCATT TATCTGTCGC     59880
     CATTTTTGAA TACGTCGTTC AAGGGTTCGC CTTAGCGTTA CAGCGAAAAC ATCTGAATAT     59940
     TCTTCGCAAA GATAATCAAA CACGCCAACA GGAGTAATAG TGTCAGAAAG TTGTAGGAGT     60000
     GGTAAAACGA CGGGGTCCCA TACAAGTTCT AGGGGGTCGG TACGAGTACG GTAGTTTCGA     60060
     GGTTTTGATG GGCCTAATTG TCGCTGGCCG GATTCAATTC GTCTTGCAGA GCGTTCCGAA     60120
     ATGCCAGCTT TGCTCGCCGC AGTAACTTGA AGGTGATCTT TTCGTTTAGA CATAAATAGC     60180
     CTTATTTGTT GATCTGTAAT TCGATGACCT GGCACAAAGA ACTCCCTTAG AATCTTTGTC     60240
     CAGAATGTAT CAGATCAACC GGCCATTCTA ATTGTCGCTG AACCGGTCAG GGTAATTGTC     60300
     GCGCAATACA GGTGTCACAG ACGCTGAAGT GATGCCCAAT TTACTTAAGC AAACCCATCG     60360
     AAAAATCCGC AATATCTCGG GTGATGGTGC TTACGACACG AAAGCCTGTC ACGAAGCCGT     60420
     TCGTCGAAAA CGCGCTTTAG TGCTCATTCC ACCTAGGGAA GATGCTGCGC TATGGGAACA     60480
     AGGGCATCCA CGAAACTTAG CCGTCAGTTG GCAACAGCTT CATGGCTCAA ATAAGCAGTG     60540
     GAAAAAACGG TATGGTTATC ATCGCCGTTC AATCTCAGAA ACCGCCATGT ACAGGATAAA     60600
     ACAACTGCTA GGAGGCACGT TAAGCATGCG GAATTATAAC GCTCAGGTGG GAGAAACTTA     60660
     CGCGATGATT AGGGCTTTGA ACAAGCTTAC TGGGCTAGGT ATGCCTGAAA CCCACTATGT     60720
     AGCTTGATAT TTGAACAATA ATGAAAGTTT TGTTCGCTGA CTCGATTTAG GAAACAAAGC     60780
     CGATTTACCC TACTAAATTA GCTATGCGAT TTTATGAAAT CAAAATATGC AAAGCGAATT     60840
     TCATTAACGA GATTTAATGC AGCTGGAGTT AATTTTTTGT TACGAGGAGA AATCAAGCTA     60900
     TAATGACCCT CAGGAAGCTT ATCCTTAATA GGAATAATTG ATATCAAGTC TTTGTGATGT     60960
     GGAGCTAAAA ACATAGGTCT AGGACCAACA AACAAATAGT CCTCATTTAA TACAAGTTTC     61020
     CGAGCGATGG CACTTGAATC ACCAAAAATT ACCGAACCAC AAGATTTGAC GCCATTAGGA     61080
     AAAATTACTG TTTCTAAATC GCTATAATAT CCATGACTTG CAGCTGGAAT ATACCATTTT     61140
     GCAGCCTGTA GTTCAGCTAG TGAAGTACTA TTAGCAAGAG GATGTCCTTT GCGAGCTACG     61200
     ACCGAAAAAC TACACGATGT CAACCTCTCT TCAACAAACT CATTAAGCAT TAAATCGGAA     61260
     GATACAACGC CAATAAAAAA ATCTAGCTTC CCCATACGTA AAGAGCTTAG TAATTCAGAA     61320
     AGCTGCCCTT CAATAATAGT AATCCGAGTG GAATTATGGC GTTCTTGGAA CTTTTTAATA     61380
     ACATCAGGAA CAATACTAGT AGCTGGGAAA TGAGAGCAAC CAAAAGCTAT TTTTCCATCT     61440
     GATAATTTCT CAATTTGTCG TAATTCATCA ACTGCTCTCT CTAACTCATT CAGGATTAAA     61500
     TTCATTCTAG GCTCAAACAT CATGCCGGCT TTAGTTAATA CAGTGCTATT CATCCCTCTG     61560
     TCTAACAAGG TAACACCCAG CGTCTTTTCA AGCTCCTGGA TACTTCTCGT CAAAGTCGAC     61620
     TGTGTCTGGT GAAGCATTTG TGCAGCAGCA CTAATATTAC CATGTTGAAT AATAGCCCTA     61680
     AGATTTCTAA GTTGATTTAG TTTCGGCAAC GCATTCATTC TATCTCCTAC AATATAATGG     61740
     ACTTTCTTTT TTAGTGCATT TCCATAGCAG GATAGCAGTA GATAGGATCA CTCTGAGTAA     61800
     TAACTGGAAC TAAAAAGCAA TACCTCCATC AGCCAAACAA CACCCAATTA ATAATAGTAA     61860
     TTATTCCTGC TTAAGATAAG AATATTTACT ACTACGTAGT GACTGAGTGA AATTTTATTT     61920
     ATCATACAAC GACTTAGTCG TCGCTAACAT TACTAGTTTT AGCCCATGAG ACCTAATGTG     61980
     TACTGCAACC TCATTCGACT TATAGCAGAA AATATTATCC AGATAAAAAA CCTCTTGATT     62040
     GTAGGAAGAT CTGTTGGCAG AGATCAATCT CAGCAATGAT TTTTTTAAAC AACCTTGTAC     62100
     TTGTCTAATC CGATCGGACG CTTAATTTTG AGACAGTATG GTCAATAAAT TAAGAGGTCT     62160
     ATATGAGTCT GAAGAAATCA CATAAAAGTT ATCCGCAGAC ATTTAAAAAT GAAGCCGTCT     62220
     TGATGGTGCT AGAACAAGGT AATAGCGTTG CTGATGCGGC AGAGTCTCTT GGAGTTAGCA     62280
     CAAGTCAGCT TTACAACTGG AAGGTAAAAC ACGAAGCCTT GCAGCAAGGC ATTATCTTAG     62340
     AAGAGTCTGA ACATGATAAT TTAAAGCAAT GTCGTTGATA AAACAAAGAA TTACGCATGG     62400
     AAAAAGAAAT TCTAAAAATA CCCAAGGGGC ACACCGAGGC CAGCGCCTTC TTTGCGAGAG     62460
     AAATGAAGTA AGATTTCGTT TCATCAAACA GCAATCTCAC CTGTTTCCCA TAACACTGTT     62520
     AGGCCGAGTA ATGAGTGTCA GTAAGTCAGG CAATTACGAT TGGCATAAAC GCCCTGCAAA     62580
     CGTGATAAGC CTTGAAATAC TGAAGCTTTA TCGCCTTGTT CGACAGCTAT TTAAAAAGTC     62640
     GAGGCAGCTT AGGGAATCGT GAAATGGTGA AGAAATTGCG CAAGGAAGGC TACCAGGTTG     62700
     GTCGCTATCT CGTTCGTAAA ATATGCACCG CCTTCGATTC AAAGCAGCCC AGCGACGCGC     62760
     TTACAAGGTG ACTACGCAGC GGAAACACTC AGATGCAGTG GCTGATAACC TGTTAAACAT     62820
     GAACTTTAAT ACAGTATCGG CTAATGAGGT TTGGGCGGGT GACGTGACCT ATTTAAAGAC     62880
     AAGTGAAGGT TGATGTATTT AGCAGTGGTG ATAGATTTAT ATTCACGCAG GGTTGTAAGG     62940
     TGGCACATAG ACAAACGCAT GACCACAGAT TTGATATCGA ATGCATTAAT AAAAGCCTAC     63000
     AACCGGCCAG AGGGTTGGTA TTTCATAGTG ATCGAGGCTC GCAATATACC AGTAAGCAAT     63060
     TCGGTAGGTT GCTTGTACTG GTCAACCCAA ACTGGACACT TTTAGTTGAG AATTTTCAAA     63120
     CTCTACAGGT GACAGATCAC CATTAGCAGA ATGAAGTCGC TCCAAGTTGT AATATTTCAT     63180
     GTAAGCAGTC ACATCTTGCT TCATAAACTC CCTTGTTGGT TGATTAACTT TAAAAATCCA     63240
     ATCGTGTTTT AAGCTGCCAA AGAATCGCTC AACAACGGCA TTATCCCAAC ACGCTCCCAC     63300
     ATCACCCATG CTGGCTCGGA TACCATAGCT CAATAGCAGC CTACCGAATT GCTTACTGGT     63360
     ATATTGCGAG CCTCGATCAC TGTGAAATAC CAGCCCTCTG GCCGGTTGGC GCAGGTTGTA     63420
     GGCTTTTATT AATGCCTTAG ATATCAAATC CGTGGTCATG CGTTTGTCTA TGTGCCATCC     63480
     CACAATCCGG CGTGAATATA AATCCATCAC CACAGCTAAA TACATCCAGC CCTCACCCGT     63540
     CTTTAAATAG GTCACGTCAC CCGCCCAAAC CTCATTAGCC GATACGGGGT TAAAGTTCAT     63600
     GTTTAGCAGG TTATCTGCCA CTGCATCTGA GTGTTTTCGC TGTGTCGTCA CCTTGTAAGC     63660
     GCGTCGCTGG GTTGCTTTGA GTCGAAGGCG GTGCATAATT TTACGAACGA GATAGCGACC     63720
     AACCTGGTAG CCTTCCTTGC GCAATTTCTT CACCATTTCA CGATTTCCTA AGCTGCCTCG     63780
     ACTTTGCTTA AATAGCTGTC TAACAAGGCG ATAAAGCTTC AGTGTTTCAA GGCTTATCAC     63840
     GTTTGCAGGG CGTTTATGCC AATCGTAATA GCCTGACTTA CTGACACTCA TTACTCGGCA     63900
     TAACAGTGTT ATAGGAAACA GGTTAGATTG CTGTTTGATG AAACGAAATC TTACTTCATT     63960
     TCTCTCGCAA AGAAGGCGCT TGCCTTTTTT AGAATTTCTT TCTCCATGCG TAATTCTTTG     64020
     TTTTCTCTAC GCAATCGTTT CAACTCATCA CGCTCAGATT CTTCTAAGGT GATACCTTGT     64080
     TTCAGGGCTT CGTGTTTTTC CTTCCAGTTG TAAAGCAGGC TCGTGCTAAC TCCAAGAGAC     64140
     TTTGCCGCAT CGGCAACGCT ATAACCTTGT TCTAGCACCA TCAAGACGGC TTCATCTTTA     64200
     AATGCCTGCG GATAACTCTT ATGTGATTTC TTCAGACTCA TATAGACCTC TTAATTTATT     64260
     GACCATACTG TCTCAAAATT AAGTGTCCGA TGGGATTAGA CCAGAACAGC TCTCGAGTTA     64320
     TGGTATCCCG AGCCAGCATG GGTGATGTGG GCGCGTGTTG GGATAATGCT GTTGTTGAGC     64380
     GTTTCTTTAG TAGCTTAAAA CACGATTGGA TTTTTACAGT TGCTCAGCCA ACAAGAGAGC     64440
     TTATGAAGCA AGATGCGATG GCTTACATGA AATATTACAA CTTGGAGCGA CGTCATTCGG     64500
     CTAATGACGA TCTGTCACCT GTAGAGTTTG AGAATTCTCA AGTAAAAGTG TCCAGTTTGG     64560
     GTTGACCAGT ACATTAATTA AGTGCGACAT CGAGCGACCA AGTCGGTCTA GACGCCAAAC     64620
     GATTAGCGTA TCTCCAGGTT TTAAGTTCTC TAAGCATTGC TCCAAGCCTG GACGAAATGA     64680
     TTATGATCCC GATACTTGAT CGGTAAATAT TAAAGAGCGA TCGCAGCCTT TCTTTATAAG     64740
     AGCATCGATT TGCATATCGA GGTCCTGATC ACTGGTGCTT ACCCGGGCAT AACCACTTTT     64800
     TTGTCCCATG CCTCTCATTT AATTGATTTT TTATTGGGTT AATTGCATTA TGATAAGCGA     64860
     GATGAGTTTA TAAGACAAAC ACGAGTAGTT ATTACGAAGA TCAACAATGC TTAGAAATAG     64920
     GTCTCATTAA ACGAGTGTTT TTTGATACCT ATTTTGTAAA ACTACATAAT TCAAAACTTT     64980
     CGCTTTTTAG GGAGTTGTTG CAAATAGCAA CAACTCCCCT TAAACCACAC CACTCTACTC     65040
     TACGCAATAT GGTTTTTCTT GATCTAGATC AATACAAGGA AAGTCTTTTT ATTCGATATT     65100
     GACATACATA TCACAGAAAA ATGGAGTTTC TATGCCCGAT ATATATAGCG AAATAATAAA     65160
     TTTAATGAAC AGTTCAGACA CTTTATCCGC ATCAACTTAC GACACCGAAA ATAAACAGCC     65220
     ATTTATCTGT ACGCACCCAA CTTTTTTATG GATGGTAAGT TTCATATCAT ATCAACCAAC     65280
     ATAGCGAAAC AAACAAAATT TTATAAGAAT AAACAACTGT GTTCAATTAT TTGTGTTGGC     65340
     GATGAAACTG TAAAAAACAA CCTGTTTTCA CGTAAAAGAC GGCTTTGTTT CCTAAAAGCA     65400
     CAAATAACTA CAGAGTGCTT CCTGATCGCC AGTATGGCGC TTAAAACCCT TGTTTCATCG     65460
     TCAGTCGTTT ATCTGTAATC AGAATATTAT TTTGATTTAA ACCCGACAAA CATTGGATTT     65520
     CACTATTAGG AAACAAAGCC GTAAAAGACT AACAATTTTA TGCAAGCCGG TTCATGTTCA     65580
     GATCAGCGAT AAAATAAAAA TAATTTATCA AGAAAAGTTT GGTATTTTTG GTGGAGGGCT     65640
     TATTGATGTA ACAGATTTTG AAGCCTTTCA ATTAGAGCCT ATAGAAGGGC TATATTTCAG     65700
     GGGTTTTGGT AGAGCGTATA ATTTCACTTC AGATTCATAT GATGTCATTC ATTTAAAAGA     65760
     GCCGCACAAG CCAAAAACAG GCAACACGAT GGCAAAAATT TTAAAGAAAA GCTTGAAGGA     65820
     CAAGATTGAC GCGTGATCGT CTTTTTATCC TAAAAACTTT ATTTATATGG AGTAAAGAAT     65880
     GAAAACTGTC GTGATATGGG GAGCTGCAAG TGGATTAGGT GCGGCAATGG TTGAGTATTT     65940
     TTACAAACAA AGTTTCAATA TAGTTGGAAT TGTACGAACA CCGAGTAAGT GCAATTGTTT     66000
     AACTGAGTTA GGTATTAAAA TCCTTACTTG TGATGCAACT AACGCAGCAC AAGTAAACCA     66060
     GACAGTAAAA AAATTACCTG TAGATGCATG GGTGATCTCT ACTATGGGAA CCTATGGCGC     66120
     GGCCAATATT CCCGTTGACT ATATTGGACA TCGCAATTTA ATTGATGCTT TGGAATATCA     66180
     AAATATTAAT CGTTTTTTGT TAGTTACTTC GCTTGGCTGT GGTGACTCAT GGCAATATTT     66240
     AAGCAAACAA TCAAAACAAA ATTTTGGTAG TGCAGTACGT GAAAAATCAT TGGCAGAAGT     66300
     TTGGTTGAAA AGCAGCCGCT TAGATTATAC GATCCTTCGC CCTGCAGGTT TAAAAGATGG     66360
     GGAAATTACA CATCGAGGTG AGCTATCACA AAAAATCGAA GTGCATGGGT TAATTAACCG     66420
     AAATGAAGTT ACTCGCCTTA CTCATCTTCT ACTAAATGAT CCAAATAGTA TTGGACAAAT     66480
     TTACCAATGT GTTGATAAAA CGTTAACCTA CTAGGGGTTT TGGCGCACAT CATTTAACCT     66540
     ACGTTTTCGG TCAAGAGGAG TTCAAGCCCC TTAACCACAA GACATAAAAA TGGCTATATC     66600
     GATATTTCCT ATCGAATAGC CATCTTCCCC CTCCACTACT ATTATCCTAA AGTATTTTAG     66660
     GTATACCCCA AGCAAACTAG CTACATCACA TTGCCAATTG GTTCGCTATA TATTGATTTT     66720
     AAACCCTACT CGCACTAGCA TCATAAACCA CACCCTAAAA ACACCAAATG AGGCAAAATG     66780
     TTTATTCGGG CCTACCTGCG TGCATCAACA GATGAACAAG ATGCCAATCG AGCCAAAAAT     66840
     GAGTTGGTTC AGTTTTCAGA AAATAAAAAT ATTCGTATAG CCAGTTTTTA TACCGAGACG     66900
     CAATCAGGGG CGAAAATTGA ACGACCTGAA CTTGGGCGCT TGATCATGGA CTCTCACCCT     66960
     GGCGATGTTT TACTCATTGA AAAAGTCGAT AGGTTGTCTC GCCTCCCCTT CGAACAATGG     67020
     AAGATCTTAA AAACTAAGTT GGTAAAAGCC AATATTCATA TTGTTGTCGT TGACCAGCCA     67080
     ATGACACATG GGATCTTAAA TGGCACAGAA GAACATACCA TGATCGCAAA GGTACTGACT     67140
     GAGTTCATGA TTGATTTGGC CGCTGCAATG GCCAGAGATG ATTACGAGAC AAGAAGAAAG     67200
     CGACAAGCGC AAGGCATCGA AAAGGCCAAA ACCTTAGGCA AATACCTTGG ACGTCAGCCT     67260
     GACCATGGAT TAAGGCAAAA TATTCGGTTA CTACTAAATG AAGGGAAAAG CTGGTCTCAG     67320
     GTGCAGAGCT TACTTAAATG TAGTCGTTCG ACCATTGCTA AAACGGCCAA GTTGAGCGAG     67380
     CTTGGGTAGC AATAATTCGC TTTATGGATG AACGCTGTTG TATTGCAGAC TAGGTGAGAA     67440
     TGGTAGCAAC ATATAGGTGG AGGCGAATAT AGCAAGAATT AAAACTGATT AATCATATGC     67500
     TTAATTTAAT GTTAGCGCCG CATTTAATCT TAATGTAATG CCGTATTTAT TCCTATTATT     67560
     CTCACGTTAA GCTATACTCG CGCTATTGTA GAGTAAGGAG GTTTAAATGG CAGCTGTTGA     67620
     CAGTATCTTT CAAAAAATAA AGCGTTCTAG ACGCTACGTT TTCGAACGCA AAGACTTTGA     67680
     CGGCATTGCT AGCTATGACC AGATTGGCAG ATCGCTTAAC CAGTTAATGG ATAGAGGCGA     67740
     GATAATGAAG CTTGGCTATG GCTTATACAC TAAAGCGCGA GTAAATAGCC TGACAGGACG     67800
     TTTAATGCCG ACCTGTCCAG GTGGTAGCGA TGCACTTATG CGTGAAATAT TGAAAATGAA     67860
     AGACATCGAT TTCGAGATAG ATAATCTGTC CTTACAAAGT CTTTCCGGTA AAAACACCCA     67920
     AATTCCCTCA TCAGTTCATT ACTCATGGGA TCAAAAACAG TTCAATCGAA AATTGGTTGT     67980
     TGGTAACAGA CTGTTGACGC CAGCAAGTAG ACCATGAAAA AACTGAAACA ACAGTTCTTA     68040
     GAGGTTTCCG ATGCATTAGC GCTCGGGAAC CCCGCCATAA TTGAAAAAGA TTATTGGGTG     68100
     GTTGCTCTAC TTTCAGAGCT TGAACAGCTA ACGTTTGAAA CTCATCAAAT GGTGTTTTCC     68160
     GGCGGCACCG CACTTGCTAA GTCCAATGTC AAAATACTTC GAATGTCTGA AGACGTGGAC     68220
     ATAAAGCTGA TCCCCACGCC GCAATTTCAA CACCTTAGTC GTGGCAGGAA AAAACAGTAC     68280
     CGTAAAGCAT TAGCAGTACA AATTGAAACA GCGCTTATTG CATCTAACAA ATTTTCTATC     68340
     GAAGCTAGAT TAGTTCAGGA TGAATATCGC TATGTGGAAT ATGAGCTTAA ATATCCGCAA     68400
     CAATTTAGCC AGGCTCCTTG TCTACGCCCA ATCATCAAGT TAGAACTGAT GGAAACCATT     68460
     CCACTGCTTG CGCTGGAAAC GCGGGGCATT CAATCGTTAG TCGCAGAGCT TTATAAGCTG     68520
     CCACAAGAAG TGAACGTATT CATCTGCGTA TCAGTAAATA CCACCTTGGT AGAGAAAGTG     68580
     CTTTCCATGT TACGCCGCAC AATGTCTGTT AAGCGTGATG CAGCCCGAAA CGATGACGTC     68640
     ACCTTAGTTA GACATATTTA CGACGTACAC TGTATTCATG CAGCACAGGC CCTTGATAAT     68700
     GAATTACTTG CGCCCCTTTT TCTCGCCATA TTAGCAGAAG ATATTGCTCG CTTTGGCAAC     68760
     CAACATGCCG AATTCGTCAT GGACCCAGCT AATGAGTTAC GCCTTGGCTT ACAGGAGATA     68820
     GAAAGCAACC CACTCTTCAG GCAACGCTTT AATGATTTTG TTAAACCCAT GGTGTTTAAC     68880
     TCGCAATCAC CCAATTTTGA TACGTGCTTT ATGTCCTTTA AACATATTGC GACCTCACTC     68940
     ATTCTGACTA TTTAGAGCAA ACATGAACAA ACAACAACTA GCCGCCAAAA TCTGGGAATC     69000
     CGCCAACCAG ATGCGTTCTA AAATCGAAGC TAACGAATAC AAAGATTACA TCTTAGGCTT     69060
     TATTTTTTAC AAATACCTCA GTGACCAATT GGTTCAGTTT CTCACTAATC AAGGGATGAC     69120
     ACCTGAAGAC ATCAAGGCCC TTGACGAAGA TGATGCAGAA ACGCGTGAAT ACGTGCAAAG     69180
     CAACCTCGGT TACTTTATCG CTTACGATAA CTTATTCTCG ACTTGGATAG ATCCAAAGTC     69240
     AGACTTTGAC GAGTCCAATG TGCGCGATGC GTTGTCTGCA TTTAGTCGGT TGATCCACAC     69300
     CAATCACAAA AAACTATTTG ATGGTATTTT CACCACCTTA GAAACAGGGT TAAGTAAACT     69360
     TGGCGAAAGT CCTAGCAAGC GCACCAAAGC CATCAGTGAC TTACTGCACC TCATAAAAAG     69420
     CATCCCGATG AACAGCAATC AGGGTTACGA TGTCTTAGGT TATATTTACG AATACCTTAT     69480
     TGAAAAATTT GCCGCCAATG CAGGTAAAAA AGCCGGAGAG TTCTACACCC CGCATGAAGT     69540
     GTCACTCCTC ATGTCACACA TCACCGCTCA TGAATTACAG CACAAAGAAA ATATTGAAAT     69600
     TTACGACCCT ACCAGTGGCT CAGGTTCGTT ACTGATTAAT ATTGGTCAGG CCTTAGCGCA     69660
     GTATGCTGAC AAGGCAGACA ATATTACCTA CTACGCCCAG GAGCTAAAGG CCAACACCTA     69720
     CAACTTAACT CGTATGAATC TCATCATGCG GGGCATTAAA GCCACCAATA TCAAAACCAG     69780
     AAATGGCGAC ACCTTAGAAG ATGATTGGCC ATATTTTGAT GAAAGCGATC CAAAAGAGAC     69840
     TTACAACGCT TTATATGTTG ACGCCGTAGT CTCCAATCCG CCTTACTCAC AAAGTTGGGA     69900
     CCCAACGCAT AAAGAGAGCG ACCCACGTTA TTCGCGTTTC GGTTTAGCAC CAAAAACCAA     69960
     AGCCGATTTT GCCTTTTTGC TTCACGACCT ATACCACCTA AAGCCCGATG GCATTATGAC     70020
     TATTGTGTTG CCCCACGGCG TATTATTCCG TGGAGGTGAA GAAGGTAAAA TTCGCACTCA     70080
     GCTAATTGAA AACAATCATA TTGATACTAT TATCGGTTTA CCAGCAAATA TCTTCTTTGG     70140
     TACGGGCATT CCAACCGTCA TTTTGGTACT CAAGCAAAAA CGTCAAAACA CCGATGTGTT     70200
     AATCGTTGAT GCCTCAAAAC ATTTTATTAA AGAAGGCAAA AACAACAAGC TACAAGCATC     70260
     CGATATCAAG CGCATTACCG ATGCGGTGAT TAATCGTCAA AGCTGCCCTA AATTTTCACA     70320
     ACTCGTCGAA AAATCCACCA TCCGCGAGCA CGGCTATAAT CTTAATATAC CGCGCTATGT     70380
     TGATTCCTCG GCTGCCGCGC AAAGCTGGGA TTTATACGCA ACGATGTTGG GCGGCATTCC     70440
     CGATAGCGAA ATTGCCAACC TGCAACACTA TTGGCAGGCC TTACCACAAT TGCACAGTGC     70500
     CTTATTTACT CCCAAATCAA CCAGCTACAG CGAGCTTACT ATCGCCAAAG ACGCGGTGAA     70560
     CACAACCATA ACCCAGCATG CCCAAGTGGT TACGTTTATT ACGGCTTACA ACCAAGCCTT     70620
     TAATGGCTTT GACGCATACT TAAATACCCA CCTTATTCAA GCCTGGGCAA CGGTTAACCG     70680
     CAACCAGCAA GAGGCCGAGT TAAGCCGCGA GTTGTTTACC CGCTTGGCGC CCATTGCCTT     70740
     AATCGACAAA TACCAAGCCT ACCAATACCT GAATAACCAA TGGCAAATCA TTAGCGCGGA     70800
     CTTGGAGATG ATGCAAACCG AAGGCTTTGC CGCCACCAAG CTAGTTGATC CAAACATGGT     70860
     GATTAAAAAG AAAGATGGCA AAGAGGTTGA AGTGCAAGAT GGCTGGAAAG GCCACATACT     70920
     GCCGTTCGAC TTAGTGCAAT CGACTCATTT GAATGACGAG CTGCAAGACT TAGGCCAGCA     70980
     AGAAACCCGT TTAGCCGAAA TCGCCGCAGC GCTAGAAGAG CTTTTCGAGT CACTCTCTGA     71040
     AGAAGAAAAA GAAGCTGACA CAGTAAAAGA AAGCAAAGAC GGCTTTGCTA ATGCCGAAGT     71100
     CAACAAGGCT GCCAAAGCCT ATTTGAAAGA GCAAAAAGAC ACCAAAACCA AATTTGCTCA     71160
     AGACAGTATT GAGGCCAAGC TTATTAACGT AAGTGCATTA CTTGATGAAG AAAAAGCCCT     71220
     CAAAAAAGCC GTTAAAGAAG CTGCCACGGC TTTACACCTA AAAACGAAAA CCACTATCGA     71280
     AGGCTTAACC ATTGATCAAG TAAACGAATT GCTGCACTTA AAATGGATAG CGCCATTAAG     71340
     TCTTGAACTC GCCGCCATGC CAAGCGCCGT GATTACTCAG CTCACCAGTA AAGTGCAAGC     71400
     CCTTGCCGAT AAATACGCGG TGACTTATTC GCAAGTAGCG AATGAGATAG AGACCACCGA     71460
     GCAAGAATTG GCCGACATGA TGGGCCAACT TACCGGAAAT GAGTTTGACC TACAAGGCTT     71520
     GAGTGAACTC ACTAACTTAT TGAAAGGCGA ATAAGATGAG TGTTAAAAAC AAAGTGCCGG     71580
     AGATTCGCTT TAAGGGGTTT AGTGGTGAGT GGGAAGAACG AAGCCTTGAT TCGGTTTACA     71640
     GAAAAATACG CAATGCCTTT GTTGGAACAG CAACACCTTA TTATGTAAAA GAAGGCAATT     71700
     TCTATCTTGA ATCAAACAAT GTCAAAGACG GAAAGATTGT ACTGGTCAAC CCAAACTGGA     71760
     CACTTTTAGT TGAGAATTTT CAAACTCTAC AGGTGACAGA TCACCATTAG CAGAATGAAG     71820
     TCGCTCCAAG TTGTAATATT TCATGTAAGC AGTCACATCT TGCTTCATAA ACTCCCTTGT     71880
     TGGTTGATTA ACTTTAAAAA TCCAATCGTG TTTTAAGCTG CCAAAGAATC GCTCAACAAC     71940
     GGCATTATCC CAACACGCTC CCACATCACC CATGCTGGCT CGGATACCAT AGCTCAATAG     72000
     CAGCCTACCG AATTGCTTAC TGGTATATTG CGAGCCTCGG TCACTGTGAA ATACCAGCCC     72060
     TCTGGCCGGT TGGCGCAGGT TGTAGGCTTT TATTAATGCC TTAGATATCA AATCCGTGGT     72120
     CATGCGTTTG TCTATGTGCC ATCCCACAAT CCGGCGTGAA TATAAATCCA TCACCACAGC     72180
     TAAATACATC CAGCCCTCAC CCGTCTTTAA ATAGGTCACG TCACCCGCCC AAACCTCATT     72240
     AGCCGATACG GGGTTAAAGT TCATGTTTAG CAGGTTATCT GCCACTGCAT CTGAGTGTTT     72300
     TCGCTGTGTC GTCACCTTGT AAGCGCGTCG CTGGGTTGCT TTGAGTCGAA GGCGGTGCAT     72360
     AATTTTACGA ACGAGATAGC GACCAACCTG GTAGCCTTCC TTGCGCAATT TCTTCACCAT     72420
     TTCACGATTT CCTAAGCTGC CTCGACTTTG CTTAAATAGC TGTCTAACAA GGCGATAAAG     72480
     CTTCAGTGTT TCAAGGCTTA TCACGTTTGC AGGGCGTTTA TGCCAATCGT AATAGCCTGA     72540
     CTTACTGACA CTCATTACTC GGCATAACAG TGTTATAGGA AACAGGTTAG ATTGCTGTTT     72600
     GATGAAACGA AATCTTACTT CATTTCTCTC GCAAAGAAGG CGCTTGCCTT TTTTAGAATT     72660
     TCTTTCTCCA TGCGTAATTC TTTGTTTTCT CTACGCAATC GTTTCAACTC ATCACGCTCA     72720
     GATTCTTCTA AGGTGATACC TTGTTTCAGG GCTTCGTGTT TTTCCTTCCA GTTGTAAAGC     72780
     AGGCTCGTGC TAACTCCAAG AGACTTTGCC GCATCGGCAA CGCTATAACC TTGTTCTAGC     72840
     ACCATCAAGA CGGCTTCATC TTTAAATGCC TGCGGATAAC TCTTATGTGA TTTCTTCAGA     72900
     CTCATATAGA CCTCTTAATT TATTGACCAT ACTGTCTCAA AATTAAGTGT CCGATGGGAT     72960
     TAGACCAGAA CAGATAAATA GAAAAACTGA AATTTTTATT AATGACGAGT TTTACCATAA     73020
     GCAATCCGAC AAGTGGCTTC GAGAAGGCGA TATCGTCATG GTTCAGTCTG GTCATGTAGG     73080
     TCATACCGCA GTTATACCGC CAGAGCTAAA CAACATTGCA GCACATGCTT TGATTATGTT     73140
     TACTGACCCT AAAGAAGAAG TCAGTCCTTA TTTTCTGAAC TTTCAATTTC AAACAGAAAA     73200
     TATAAAAACA AAATTATCAG AGATTACAAC GGGTAATACG ATTAAACACA TTCTTTCCTC     73260
     TGAAATGAAA GATTTTGAAA TGTTTTTCAC TGATTTTGAA GAACAAACCG CCATCGGCAA     73320
     TACTTTCCAA AAGCTCGACA GCCTAATCAA CCAGCACCAA CAAAAGCATG ACAAGCTAAG     73380
     CAACATTAAA AAAGCCATGC TGGAAAAGAT GTTCCCCAAA CAAGGCGAAA CGATCCCTGA     73440
     AATCCGCTTT AAAGGGTTTA GTGGAGAATG GGAGGAGAAA GAGCTGGGTA GTGTTACTCA     73500
     AATAACTATG GGGCAGTCGC CAAGTGGCGA AAATTATACC AATAATTCTA ATGACTTTAT     73560
     TTTGGTACAA GGTAATGCGG ATTTAAAAAA TGGCTTCGTA GTGCCTAGAG TATGGACTTC     73620
     TGAAGTAACA AAAACTGCTA CACAAGGTGC ATTAATTTTT AGTGTTAGAG CCCCTGTGGG     73680
     TGAAGTTGGA AAAACCAATT ATGATGTTGT CCTTGGGCGG GGTGTTGCAG CAATAAATGC     73740
     CAATGAATTT ATATTTCAAC AACTAAAGAA GCTCAAGTCC GATAACTATT GGCACAAAGT     73800
     TTCCGCTGGT TCAACTTTCG ATGCAATATC ATCAACAGAG TTAGATTCGA CTTTAATATG     73860
     GGTTTCAAGT GATTCAGAAC AAACCGCCAT CGGCAACTAC TTCCAAAAGC TCGATACGCT     73920
     TATCAACCAA CACCAACAGC AAATCACCAA ACTCAATAAC ATCAAGCAAG CCTGCTTGAG     73980
     TAAAATGTTT GTCTAGCAGG                                                 74000
//

If you have problems or comments...

PBIL Back to PBIL home page