(data stored in SCRATCH zone)

HOGENOMDNA: SHEB5_4

ID   SHEB5_4; SV 1; empty ; DNA; empty ; PRO; 7995 BP.
XX
AC   NC_009038;
XX
PR   Project: 58259;
XX
DE   Shewanella baltica OS155 plasmid pSbal04, complete sequence.
XX
OS   Shewanella baltica OS155
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-7995
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Sims,D.R.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Brettar,I.,
RA   Klappenbach,J., Konstantinidis,K., Rodrigues,J., Tiedje,J. and
RA   Richardson,P.;
RT   "Complete sequence of plasmid pSbal04 of Shewanella baltica OS155";
RL   Unpublished
XX
RN   [2]
RP   1-7995
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-FEB-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-7995
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Sims,D.R.,
RA   Brettin,T., Bruce,D., Han,C., Tapia,R., Brainard,J., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Brettar,I.,
RA   Klappenbach,J., Konstantinidis,K., Rodrigues,J., Tiedje,J. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (12-FEB-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000567.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634605
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..7995
FT                   /strain="OS155"
FT                   /mol_type="genomic DNA"
FT                   /organism="Shewanella baltica OS155"
FT                   /plasmid="pSbal04"
FT                   /db_xref="taxon:325240"
FT   gene            complement(222..440)
FT                   /db_xref="GeneID:4841355"
FT                   /locus_tag="Sbal_4475"
FT   CDS_pept        complement(222..440)
FT                   /locus_tag="Sbal_4475"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090339"
FT                   /db_xref="GeneID:4841355"
FT                   /translation="MAFTVRVTEAQEKQLDELMALTGQATKAGFVLYMIENGKEIMKND
FT                   SKFRRVKALEEEIKLKEKEIAKIKTGK"
FT                   /protein_id="YP_001041775.1"
FT   gene            complement(1132..1314)
FT                   /db_xref="GeneID:4841357"
FT                   /locus_tag="Sbal_4476"
FT   CDS_pept        complement(1132..1314)
FT                   /locus_tag="Sbal_4476"
FT                   /gene_family="HOG000245170" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090340"
FT                   /db_xref="GeneID:4841357"
FT                   /translation="MPTKHINEATWRLVEKETVKAVVETREPVKDTDVLNWLIMRGLRD
FT                   IEKEDYRELKKEEKK"
FT                   /protein_id="YP_001041776.1"
FT   gene            1439..3091
FT                   /db_xref="GeneID:4841358"
FT                   /locus_tag="Sbal_4477"
FT   CDS_pept        1439..3091
FT                   /locus_tag="Sbal_4477"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090341"
FT                   /db_xref="GeneID:4841358"
FT                   /translation="MYDFNGLRIYFKDEHLHTTFTNERVFSYVDIEECARRGLKIVPRD
FT                   MTWHLDGSCDVHDLYHPWESLPSSFTGIAFKLYQASGFREQPCIELKASPAKITQGHNV
FT                   FGSESLELGVRSVFQALVSALPNFAHMLDFDTAEFFRIDSTFSIKLPNSDCLASALDSL
FT                   SRVSNRYLRPSRDGDYETTIYFNKVRGEAGRNTGRSSSLCIYSKLDEVLHQLDELREKA
FT                   KKEKTSRYDSVISALESESLQYFATNRLRFESRICARFFERHQLPTRVIDLLEFVRGYE
FT                   SENGKGSFCRFLWQTAMKDLLDAISGQVITVVHDSKVKKLLHSLYDTIDKNGKLRTAKT
FT                   VRLFGFYRRLCTEGYAKVKRTMGTTGKSSFYNAVNDLLAAGFSKAQLQNLDKKETLPLV
FT                   HLLEFDFNAQRPADYVEPVMPLAALDYREFLAVMSGSAAMQDEALTLDRRLAISLEGFG
FT                   LPASYVEGLKAGRSIRLTGERSLSLALWEDGEFDLVESVAENELQCIRDKLEFRRLSRD
FT                   SALSVEDAQSEMAYLGFNPASRYSYKSNVQGVK"
FT                   /protein_id="YP_001041777.1"
FT   misc_feature    1439..2695
FT                   /note="replication initiation protein; Region: II;
FT                   PHA00360"
FT                   /db_xref="CDD:106905"
FT                   /locus_tag="Sbal_4477"
FT   misc_feature    1439..2287
FT                   /note="Phage replication protein CRI; Region: Phage_CRI;
FT                   pfam05144"
FT                   /db_xref="CDD:147363"
FT                   /locus_tag="Sbal_4477"
FT   misc_feature    2420..2704
FT                   /note="Phage X family; Region: Phage_X; cl11585"
FT                   /db_xref="CDD:175312"
FT                   /locus_tag="Sbal_4477"
FT   gene            3091..3441
FT                   /db_xref="GeneID:4841352"
FT                   /locus_tag="Sbal_4478"
FT   CDS_pept        3091..3441
FT                   /locus_tag="Sbal_4478"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090342"
FT                   /db_xref="GeneID:4841352"
FT                   /translation="MIELEINFAQYGVIEDNGQVWANAQMVTDFVFDLNKAGCMFGTIP
FT                   ILTDNNNAVAKRLVEELKRAGGPIKIIAEQGNKSVKGRISSIIKDFKLVDDFSKSSPVS
FT                   SPASRMIEKPNA"
FT                   /protein_id="YP_001041778.1"
FT   gene            3708..3926
FT                   /db_xref="GeneID:4841356"
FT                   /locus_tag="Sbal_4479"
FT   CDS_pept        3708..3926
FT                   /locus_tag="Sbal_4479"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090343"
FT                   /db_xref="GeneID:4841356"
FT                   /translation="MKLFKAARKYGSKVAVAGSALVAAGAQAADQSAIINAAQADATAN
FT                   QGLVIGAVLAVAVMGFGAYALLKWLGR"
FT                   /protein_id="YP_001041779.1"
FT   gene            4062..5909
FT                   /db_xref="GeneID:4841353"
FT                   /locus_tag="Sbal_4480"
FT   CDS_pept        4062..5909
FT                   /locus_tag="Sbal_4480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090344"
FT                   /db_xref="GeneID:4841353"
FT                   /translation="MRFLYLIFLFLFSLNVNSASITHITYDYNLHGGPPIGTEFVSCAQ
FT                   LASMFKGSDGYKPTGSCSFSATRNSASIGFLDKRPGNFFSIEVSFNLGTTCAMFGTPRS
FT                   MFCGLECNSQGTCSEIAISKCTGNSYLQSFTYKDAANWTFVCGEYDPVNPPDGGDAGSG
FT                   SGVENNFSFKGDKGNKGDKGDRGEKGEQGEQGEKGEKGEKGEIGETGENGVDGVNGLDG
FT                   LNGKDGLNGSTGATGATGATGATGATGATGLQGERGLQGERGQIGLTGERGLTGERGEI
FT                   GLTGLQGLAGLDGQDGVDGVGCEVFRQGEASVLRCGAGSQLTSIDVLDSRYLDVINLQE
FT                   TQIKQMKNSGCTVAAVNESTGDISFACLGDTVLPPVNLKGKQGEQGVAGINGLDGKDGN
FT                   DGKDGIDGINGVDGVDGVDGLAGINGIDGKDGIDGIDGINGIDGKDGKDGKDGAQGIQG
FT                   IQGLQGIAGIAGLDGKDGENVDTAAVVNAIKEASDRLNDNLDSKIDLSPVNVSSEGSFD
FT                   QVFGENSLGVLKTELIERTEELNSLFKDKKAELIASFSINDVNANFADSGFVLHVQGMN
FT                   IPVPSFLKTWSPYFPDLRNLVYLVALLAAFAIYFGGTRK"
FT                   /protein_id="YP_001041780.1"
FT   gene            6337..7704
FT                   /db_xref="GeneID:4841354"
FT                   /locus_tag="Sbal_4481"
FT   CDS_pept        6337..7704
FT                   /locus_tag="Sbal_4481"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:126090345"
FT                   /db_xref="GeneID:4841354"
FT                   /translation="MASSIYHGKPGSYKTSTAVWFHILPALRKGRFVCTNVEGLFSLEE
FT                   IEKILGEKFPETAYLFRVSTLNDIGVNTMAKWFHWLPLGAFIVIDEIQNLYNSKDRTDF
FT                   KVHDTNRSVNTLDRILDFPSLPENVKYLSQQALISVIDDGYTDDMGISERDSNGHVLYP
FT                   VNIKDALMRHRKYNWDIIGCTPEIAHVHTLYRGVSEKAVSHRSFDFVPIPWFQRRPRTH
FT                   EHNPMEKGIRPVKGETVKRPKIPVKVFSLYKSTQTGKNNRSGVNENPFKNRATLFKIFI
FT                   PLSIVLGFLSLPLFYGSDPKGADSKQVGSTSPAANGLVSKAHNTIAGQGVPVSSGDTHN
FT                   PIFNDAPDFLAQLKVEQLFIVGHVQKSKFLGIVKTQNGAESRQTITDYFVFSASSKDAQ
FT                   YTFNSEDLKEMGYTIKKITNCYVQINNVVRTVHSFCNPSLPASEPDSKNESILAGI"
FT                   /protein_id="YP_001041781.1"
FT   misc_feature    6337..7608
FT                   /note="putative assembly protein; Region: PHA00350"
FT                   /db_xref="CDD:164791"
FT                   /locus_tag="Sbal_4481"
FT   misc_feature    6337..>7302
FT                   /note="Zonular occludens toxin (Zot); Region: Zot; cl01706"
FT                   /db_xref="CDD:174664"
FT                   /locus_tag="Sbal_4481"
SQ   Sequence 7995 BP; 2046 A; 1472 C; 1747 G; 2730 T; 0 other;
     TGGGCGAGCT TGCGAGAATC GCTCTAGCTG GTTTTTGCCC GTAACATAAT GTGCGTTGTG        60
     CGAAGTAATT GCGGTATGTC ATTTTTGACG GTAAAAATGA CATACCACCG CGCTATCAAT       120
     AATCAATCCT GGCACGTGTA TTTTGATGTC AAAAAGTGCA ACCGGTGATT GTTTTTTGCT       180
     ATCACTTTCT ATTCCTGGGA CACGTTTATT GCTATCAGAA ATCACTTACC GGTTTTGATT       240
     TTTGCTATCT CTTTCTCTTT GAGCTTTATC TCTTCTTCCA GTGCTTTAAC CCGCCTAAAC       300
     TTGCTGTCGT TCTTCATGAT CTCTTTACCG TTCTCAATCA TGTACAGCAC GAACCCCGCT       360
     TTAGTCGCTT GGCCTGTAAG TGCCATGAGT TCGTCTAGCT GCTTCTCTTG TGCTTCTGTC       420
     ACTCTAACTG TAAATGCCAT TTCTTATACT CCGAAAGTTT CTGATAACCA TTTAACAATG       480
     GCTTTCTTTG CGCCCTTAGA ATCGGGCTCT TTATCTAATT TAACGTCAAT CCATAGCTTA       540
     CAGTTGTAGC TGCGGCCTGT TACCGAGACT TCTCTCGAGA ACCGTTCCCA GTAAAACTCG       600
     ATTCCTTCAT ATTCAACCCA AACACACCAA GCTCCGTTTT CTTTGTAATT CAGTTCTGAC       660
     TGTTTCATAT ATCCGCCTTT GCTATCAATT AACGTTATCT CGATGTGTTA ATGATAGCAA       720
     AACTGGAGAT TAAAGCAAGC AAATGATAGC AAAAACATCG ATGTTTTTGC TATTTTGCTA       780
     TCAATAAATG GTTGCACCAT TTTATTGATG TTCGGGTATA TTATTTAGGG ATTATTAAAC       840
     CGTAGGTTTG ATGGGAGCGT AGCGTGACGC TTGAAAGCGG GGCGCTTTTC CCCGTAGTCC       900
     TTCGTCCTGC TAGACCGCTT TTACTCTTTT AACTTACTTC CAGCGCGTTT ACTGCTTAAC       960
     GGTCGGAGAC AAACCCGATT TTCAGGTTTT GGTGAGTTAG ATAAGCCACA CACTCTAATA      1020
     GTGGCTTATC GTCCAAACTG TGGAATAGTT TAAACACAGC ATATAGTGGG CATATGAATG      1080
     CTAAGGCGCT TTAAAACACT ACATGTTGTG CCTTTGCTGA TTTAAATACC CTTACTTCTT      1140
     TTCTTCTTTT TTTAACTCCC TATAGTCCTC CTTCTCAATG TCTCTCAGTC CTCGCATTAT      1200
     TAGCCAGTTT AAGACGTCTG TATCTTTTAC GGGTTCGCGT GTTTCCACAA CTGCTTTTAC      1260
     CGTCTCTTTT TCTACAAGTC GCCATGTGGC TTCGTTTATG TGCTTGGTTG GCATGATTGC      1320
     TCCTTTGTTT CTAACTAAAT CATAAACTAA TTTCTGAGAA AGCTTGCGAA TTAGATTCTT      1380
     AGTAATTAGA ATCACCCTAG AAACTAATTT CTTAGAAAGT TAGAAACAGG GGTTTTGATT      1440
     GTACGACTTC AACGGATTGC GGATTTACTT CAAAGATGAA CACTTACACA CGACATTCAC      1500
     AAATGAGCGT GTTTTTTCCT ATGTTGACAT CGAAGAATGC GCTCGCCGTG GTCTTAAAAT      1560
     CGTTCCTCGT GATATGACTT GGCACTTGGA CGGCTCGTGT GATGTGCACG ATCTTTATCA      1620
     TCCGTGGGAG TCTTTACCGT CTAGCTTCAC TGGTATAGCG TTCAAGCTGT ATCAAGCAAG      1680
     TGGTTTTCGC GAACAGCCAT GCATCGAGTT AAAAGCATCA CCAGCCAAAA TCACTCAAGG      1740
     GCATAACGTT TTCGGTTCTG AGTCGTTAGA GCTCGGTGTT CGCAGTGTTT TCCAAGCCCT      1800
     CGTTAGTGCC TTGCCCAATT TCGCTCACAT GCTTGATTTT GATACCGCTG AATTTTTCCG      1860
     TATTGATTCC ACGTTTAGCA TCAAATTACC CAATTCTGAT TGTCTGGCCT CTGCGCTTGA      1920
     TTCTCTTTCT CGTGTTTCTA ATCGTTACCT GCGTCCTAGT CGCGATGGTG ACTATGAGAC      1980
     AACGATCTAT TTCAACAAGG TACGTGGTGA AGCAGGGCGC AACACTGGCC GTTCTAGTTC      2040
     GCTGTGTATC TACTCCAAGC TTGACGAGGT TTTACACCAA CTTGATGAGC TTAGAGAAAA      2100
     AGCTAAGAAG GAAAAAACCA GTCGTTATGA CTCGGTGATT TCTGCGTTGG AGTCCGAATC      2160
     GTTGCAGTAT TTCGCAACTA ATCGCCTCCG CTTTGAGTCG CGCATTTGCG CACGTTTCTT      2220
     TGAGCGTCAC CAGTTGCCAA CTCGGGTTAT CGATCTACTT GAGTTTGTTC GTGGTTACGA      2280
     GTCAGAGAAC GGGAAGGGCT CATTTTGTCG ATTTTTGTGG CAAACGGCCA TGAAGGATTT      2340
     GCTTGATGCT ATTAGCGGTC AAGTGATCAC TGTTGTTCAT GATTCTAAGG TTAAAAAACT      2400
     GCTCCATTCG TTGTACGACA CGATAGATAA AAACGGCAAG TTGAGAACGG CTAAAACCGT      2460
     CCGCTTGTTT GGTTTCTACC GTCGCTTATG TACCGAAGGC TATGCAAAGG TGAAACGCAC      2520
     TATGGGAACA ACTGGCAAAT CATCGTTTTA CAACGCTGTA AACGATTTAT TGGCGGCTGG      2580
     CTTTTCTAAG GCTCAGCTTC AAAATTTGGA TAAGAAGGAA ACGCTTCCTT TAGTTCACCT      2640
     CCTTGAATTT GATTTTAATG CTCAGCGTCC TGCTGATTAT GTTGAACCCG TAATGCCTTT      2700
     GGCCGCACTC GATTATCGCG AGTTTTTAGC TGTTATGTCT GGTTCTGCTG CAATGCAAGA      2760
     TGAAGCTCTG ACACTCGATA GACGTTTGGC TATTTCTCTC GAGGGCTTCG GCTTACCAGC      2820
     TTCTTATGTT GAAGGTCTGA AAGCGGGTAG ATCTATTCGT TTAACTGGCG AACGCTCGTT      2880
     ATCACTTGCT CTTTGGGAGG ATGGTGAATT CGATCTCGTT GAGTCGGTAG CTGAAAATGA      2940
     ACTTCAGTGT ATTAGGGATA AGTTGGAGTT TAGGCGCTTG TCGCGTGACT CTGCTTTGAG      3000
     TGTTGAAGAT GCTCAATCTG AAATGGCTTA TTTGGGGTTT AATCCCGCTA GTCGTTATTC      3060
     GTATAAATCA AATGTTCAAG GGGTGAAGTG ATGATTGAAT TAGAAATTAA TTTTGCACAA      3120
     TACGGTGTTA TTGAAGATAA CGGTCAAGTT TGGGCCAATG CTCAAATGGT TACTGACTTT      3180
     GTTTTTGACT TGAATAAAGC GGGTTGTATG TTCGGTACTA TTCCCATTTT AACTGACAAC      3240
     AATAATGCTG TTGCAAAACG TTTAGTTGAA GAGTTAAAGC GTGCAGGCGG GCCAATTAAA      3300
     ATTATTGCTG AACAAGGTAA TAAGTCAGTT AAAGGTAGAA TATCTTCTAT TATTAAAGAT      3360
     TTTAAATTGG TTGATGATTT TTCTAAGTCT TCTCCTGTTA GTTCTCCTGC TTCACGAATG      3420
     ATTGAAAAAC CAAATGCCTA AATGTATTCA GATCACAGGC GACACAATAA TAGATACAGG      3480
     TCAATCAATT GCTGATTGCA CTGAATTTGT TGTGATGACT GGTTCTGATT ACAGGCTTTA      3540
     TACAAACGAT TCTTTTTATA CGTTGTTGCA AAGTTTATTT ATGTTTGATT TGGAGATTTG      3600
     CACACAGGTT GTAAGTGCTG GTCTCTTAAT GTTCCTCGTA AGTCATTACG CAGGTAATTT      3660
     AGTCCGCTGG CTCGGTAAGT AGCCATTCAA TAAAATAGGG AAATGATATG AAACTGTTTA      3720
     AAGCTGCTCG TAAATATGGT TCTAAAGTTG CTGTTGCTGG CTCTGCATTA GTTGCTGCTG      3780
     GTGCTCAAGC TGCCGACCAA TCTGCAATTA TTAACGCTGC TCAAGCTGAT GCAACTGCAA      3840
     ACCAAGGCTT AGTAATCGGT GCAGTATTGG CCGTTGCTGT TATGGGCTTT GGTGCTTATG      3900
     CGTTGTTAAA GTGGTTAGGC CGTTAATTTG GTCACATCAA TATTACTAGG AACAATATTT      3960
     TTATATTGCA TTGTTACTGG TTTTAAAACT GGCATTATTG CAAGTTGATA ACGCCAATTT      4020
     AAATAAGGGA GCAATTCGCT CCCTTTTTTT ATGGTGACAA TATGAGATTC TTATATTTAA      4080
     TTTTTCTCTT TCTTTTTTCG CTTAATGTTA ATTCTGCCTC AATTACTCAT ATAACTTATG      4140
     ACTATAACCT TCATGGTGGC CCACCTATTG GAACCGAGTT CGTTTCTTGT GCTCAGCTTG      4200
     CTTCTATGTT TAAAGGTTCT GATGGTTATA AACCCACTGG TTCCTGTAGC TTTTCAGCAA      4260
     CTAGGAACAG TGCTTCGATA GGTTTCCTTG ATAAACGCCC GGGTAATTTT TTTTCTATTG      4320
     AAGTTTCTTT TAATCTAGGT ACTACGTGCG CAATGTTTGG TACTCCTCGT TCAATGTTTT      4380
     GCGGTTTAGA ATGTAACAGC CAAGGCACTT GTTCTGAAAT TGCTATTTCA AAGTGTACTG      4440
     GTAATTCTTA TTTGCAAAGT TTCACTTATA AAGATGCTGC AAACTGGACT TTTGTTTGTG      4500
     GTGAATACGA TCCCGTTAAT CCTCCTGATG GTGGTGATGC TGGTTCTGGT TCTGGTGTTG      4560
     AAAATAATTT TTCATTCAAA GGTGACAAGG GTAACAAAGG TGATAAGGGT GATAGGGGTG      4620
     AAAAAGGAGA GCAAGGCGAA CAAGGCGAAA AAGGTGAAAA GGGTGAAAAG GGTGAAATAG      4680
     GTGAAACAGG TGAAAACGGT GTTGATGGTG TTAATGGCCT TGATGGTTTA AATGGTAAAG      4740
     ATGGTCTCAA TGGTTCAACT GGAGCAACTG GAGCAACTGG AGCTACTGGA GCTACTGGAG      4800
     CTACTGGAGC AACTGGCCTT CAGGGTGAAC GTGGTTTACA GGGTGAGCGT GGTCAAATCG      4860
     GTTTAACTGG CGAACGGGGT TTAACGGGTG AACGTGGTGA AATAGGTCTT ACTGGCTTAC      4920
     AAGGTCTTGC TGGCCTAGAT GGTCAGGATG GTGTTGATGG TGTTGGCTGT GAGGTATTTC      4980
     GTCAAGGTGA GGCTAGTGTT TTGCGTTGTG GTGCAGGTTC TCAGCTCACC TCTATTGATG      5040
     TTTTAGATTC TCGTTACTTA GATGTTATCA ATTTACAAGA AACTCAAATT AAGCAAATGA      5100
     AAAACTCGGG TTGTACCGTT GCCGCTGTTA ACGAGTCAAC GGGTGATATT TCCTTTGCTT      5160
     GTCTCGGTGA CACTGTTCTA CCTCCTGTAA ATTTAAAAGG TAAGCAGGGC GAACAAGGTG      5220
     TCGCTGGTAT CAATGGTTTA GATGGTAAGG ATGGCAATGA TGGCAAGGAT GGTATTGACG      5280
     GTATTAACGG TGTTGATGGT GTTGATGGTG TTGATGGCTT GGCTGGCATT AACGGCATTG      5340
     ATGGCAAGGA TGGGATAGAT GGTATTGATG GTATCAATGG CATTGATGGC AAAGATGGCA      5400
     AAGATGGCAA AGATGGTGCT CAAGGTATTC AAGGTATTCA GGGTTTACAA GGCATAGCTG      5460
     GCATTGCTGG CCTCGATGGT AAAGATGGTG AGAATGTTGA TACTGCTGCT GTTGTAAACG      5520
     CTATTAAAGA AGCCTCTGAC CGTTTAAATG ATAATTTAGA CTCTAAGATT GATTTAAGTC      5580
     CTGTCAATGT TTCTTCGGAA GGTTCTTTTG ATCAAGTTTT TGGTGAAAAT TCTTTAGGTG      5640
     TTTTAAAAAC TGAATTAATT GAAAGAACAG AAGAGTTAAA TTCTTTATTT AAAGATAAAA      5700
     AAGCTGAGTT AATAGCTTCT TTTTCAATTA ATGATGTTAA TGCTAATTTT GCTGACTCTG      5760
     GTTTTGTTTT ACATGTTCAA GGTATGAATA TTCCTGTCCC TTCATTCCTT AAAACTTGGT      5820
     CGCCATACTT TCCAGATTTA AGAAACTTAG TTTATTTAGT CGCTCTTTTA GCTGCGTTTG      5880
     CTATTTACTT TGGAGGTACA AGGAAATGAT TAAGCTAATA TTTATTTCAG TATTGTTTTT      5940
     AGCTTTCCCA GTTTTTGCCG TTTCTGATGG CTCAGGTTCT GGCTCTTGGA GTTTTGGCGG      6000
     TTTTTTTAGT GAAGTTGAAG CATTTTTTCA AATGATTCAC CATTTCATTT TTGAACAAAT      6060
     TCCTCTCATG TTTCAAAGGG CAGTGGAATA TTTTTATTAT TACGCAATTC TTATTAAAAT      6120
     TAAGTCTCTT ATATTTTTCA TGAAAGTGAG CTTTGGTGTT GCTGCTCTGT TCTTGTCTGA      6180
     CATAGGTCTT GCTTCCGCTA TGAACTCGGC TGTTAACGCT TTACCCCAAG ACATGCAAGC      6240
     CCTTGTTTCT CAGCTCGGTT TGATACGTGC AATAAACATT GTTATCGAGG CTTATATAGC      6300
     TCGATACGTC TTACAATATA TGCTTTAGGG GGTTATGTGG CTTCTTCTAT TTATCATGGC      6360
     AAACCCGGCT CTTATAAGAC CTCAACGGCG GTGTGGTTTC ACATACTGCC AGCTTTGAGG      6420
     AAAGGCCGCT TTGTTTGTAC AAATGTCGAA GGTCTTTTTT CTCTCGAAGA AATAGAAAAG      6480
     ATTTTAGGTG AGAAATTCCC TGAAACAGCT TATTTATTTA GGGTTTCAAC GCTCAATGAT      6540
     ATTGGTGTTA ATACAATGGC AAAATGGTTT CATTGGCTAC CATTGGGCGC TTTTATTGTT      6600
     ATTGATGAAA TTCAAAATTT ATATAATTCT AAAGATAGAA CTGATTTTAA AGTCCATGAT      6660
     ACAAATCGCT CTGTTAATAC TTTAGATAGG ATTCTTGACT TTCCTAGCTT GCCTGAGAAC      6720
     GTCAAATATT TATCTCAACA AGCTTTAATT TCTGTTATTG ATGATGGTTA TACCGATGAT      6780
     ATGGGTATTT CTGAACGTGA TTCTAATGGT CATGTTCTTT ATCCAGTTAA TATTAAAGAT      6840
     GCGCTTATGA GACATCGTAA ATACAATTGG GACATTATTG GTTGTACTCC TGAAATTGCT      6900
     CATGTTCATA CTCTTTATAG GGGTGTTTCT GAAAAAGCGG TGTCACATCG CAGTTTTGAT      6960
     TTTGTGCCTA TTCCTTGGTT TCAGCGTCGC CCTAGAACGC ATGAACATAA CCCAATGGAA      7020
     AAAGGTATTC GCCCTGTTAA GGGTGAAACT GTTAAGCGTC CTAAGATTCC TGTAAAGGTT      7080
     TTCTCTTTAT ATAAATCAAC ACAAACTGGT AAAAATAATC GGAGTGGCGT TAATGAAAAC      7140
     CCATTTAAAA ATCGTGCTAC GCTTTTTAAA ATCTTTATTC CTTTATCCAT TGTTCTTGGT      7200
     TTCCTATCTT TGCCATTATT CTATGGTTCT GATCCAAAGG GTGCCGATTC TAAACAGGTT      7260
     GGTTCAACGT CTCCAGCGGC TAATGGCCTT GTTTCTAAAG CGCATAACAC GATTGCTGGG      7320
     CAGGGTGTTC CTGTTTCTTC TGGTGATACT CATAATCCGA TTTTCAATGA TGCACCTGAT      7380
     TTCCTTGCTC AGTTGAAAGT TGAACAGCTT TTTATTGTTG GCCATGTTCA AAAAAGTAAG      7440
     TTCTTAGGCA TTGTTAAGAC GCAGAACGGC GCAGAGTCTC GCCAAACGAT TACTGATTAC      7500
     TTTGTTTTCT CGGCATCTTC TAAGGATGCT CAATACACTT TTAACAGTGA AGATTTAAAA      7560
     GAGATGGGTT ACACGATTAA GAAGATCACA AATTGCTATG TTCAAATAAA CAATGTTGTT      7620
     CGAACCGTTC ACAGCTTTTG CAATCCATCG TTGCCAGCTT CTGAACCTGA TTCAAAGAAC      7680
     GAATCAATTT TAGCTGGTAT CTAGCCTGCA CGCGCGAAGC CGAAGGCTGA GGCGCGCGCG      7740
     TGTGCAGGCT GATACATTGC TTAATTACTT AAAGGATTAT TATGCAACCC ATTTCTATAG      7800
     TTGAATTTTT AATTTATTTA TTGCTCGGAA TAGTTTTAGG CATGCTTGTA ACTGATTTTT      7860
     TTTGGCTTGA GGTACTTAAG CATTTAGACG AAATCACTGT TTGCCCATAG CTGCGCACAA      7920
     TGTACCGAAC GTTATGTTGA GGGTTTGCGT TTGGTACTAT GCGCAGCATC AAACGACAAA      7980
     AAGCAGTGCG GAGGG                                                       7995
//

If you have problems or comments...

PBIL Back to PBIL home page