(data stored in ACNUC7421 zone)

HOGENOMDNA: SHIBS_1

ID   SHIBS_1; SV 1; empty ; DNA; empty ; PRO; 126697 BP.
XX
AC   NC_007608;
XX
PR   Project: 58215;
XX
DE   Shigella boydii Sb227 plasmid pSB4_227, complete sequence.
XX
OS   Shigella boydii Sb227
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Shigella.
XX
RN   [1]
RP   1-126697
RX   PUBMED; 16275786.
RA   Yang,F., Yang,J., Zhang,X., Chen,L., Jiang,Y., Yan,Y., Tang,X., Wang,J.,
RA   Xiong,Z., Dong,J., Xue,Y., Zhu,Y., Xu,X., Sun,L., Chen,S., Nie,H.,
RA   Peng,J., Xu,J., Wang,Y., Yuan,Z., Wen,Y., Yao,Z., Shen,Y., Qiang,B.,
RA   Hou,Y., Yu,J. and Jin,Q.;
RT   "Genome dynamics and diversity of Shigella species, the etiologic agents
RT   of bacillary dysentery";
RL   Nucleic Acids Res. 33 (19), 6445-6458 (2005)
XX
RN   [2]
RP   1-126697
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (18-NOV-2005) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-126697
RA   Jin,Q., Yang,F., Yang,J., Jiang,Y., Yan,Y., Chen,L., Zhang,X., Peng,J.,
RA   Tang,X., Xiong,Z., Nie,H., Dong,J., Xue,Y., Xu,X., Zhu,Y., Shen,Y.,
RA   Qiang,B. and Hou,Y.;
RT   "Direct Submission";
RL   Submitted (29-OCT-2004) State Key Laboratory for Moleclular Virology and
RL   Genetic Engineering, Microbial Genome Center of Chinese Ministry of Public
RL   Health, 6 Rongjing Eastern Street, BDA, Beijing 100176, P. R. China
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000037.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..126697
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:300268"
FT                   /serotype="4"
FT                   /strain="Sb227"
FT                   /plasmid="pSB4_227"
FT                   /organism="Shigella boydii Sb227"
FT   gene            complement(191..493)
FT                   /note="SBOP002"
FT                   /db_xref="GeneID:3776749"
FT                   /locus_tag="SBO_P002"
FT   CDS_pept        complement(191..493)
FT                   /locus_tag="SBO_P002"
FT                   /gene_family="HOG000118817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS2 ORF2"
FT                   /transl_table="11"
FT                   /db_xref="GI:82524666"
FT                   /db_xref="GeneID:3776749"
FT                   /translation="MVHATGLMKHASSPGCWDFVEPKNTAVRSPESNRIAKSFVKTIKC
FT                   DYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALDYRSPREYLRQRANDNRCLEI"
FT                   /protein_id="YP_406226.1"
FT   misc_feature    complement(194..>436)
FT                   /note="IS2 transposase TnpB; Reviewed; Region: PRK09409"
FT                   /db_xref="CDD:181829"
FT                   /locus_tag="SBO_P002"
FT   repeat_region   complement(219..564)
FT                   /note="fragment"
FT                   /mobile_element="insertion sequence:IS2"
FT   gene            485..727
FT                   /note="SBOP001"
FT                   /db_xref="GeneID:3776748"
FT                   /locus_tag="SBO_P001"
FT   CDS_pept        485..727
FT                   /locus_tag="SBO_P001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative resolvase, fragment"
FT                   /transl_table="11"
FT                   /db_xref="GI:82524665"
FT                   /db_xref="GeneID:3776748"
FT                   /translation="MNHYPSVTSLETPEARCRSGVPPLPACRQRESIYGLIELFIQIVH
FT                   RLSVRSERRLVKTLLADFQRVHGKTALLFRIAEGL"
FT                   /protein_id="YP_406227.1"
FT   repeat_region   complement(793..2123)
FT                   /mobile_element="insertion sequence:IS2"
FT   gene            complement(804..1709)
FT                   /note="SBOP003"
FT                   /db_xref="GeneID:3776750"
FT                   /locus_tag="SBO_P003"
FT   CDS_pept        complement(804..1709)
FT                   /locus_tag="SBO_P003"
FT                   /gene_family="HOG000118817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="insertion element IS2 transposase InsD"
FT                   /transl_table="11"
FT                   /note="IS2 OrfB; forms an overlapping reading frame with
FT                   orfA; may form a fusion protein OrfAB due to ribosomal
FT                   frameshifting; in some cases OrfB is itself expressed; both
FT                   OrfA and OrfAB bind terminal inverted repeats"
FT                   /db_xref="GI:161984778"
FT                   /db_xref="GeneID:3776750"
FT                   /translation="MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSR
FT                   HTDDTDVLLRIHHVIGELPTYGYRRVWALLRRQAELDGMPAINTKRVYRIMRQNALLLE
FT                   RKPVVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVT
FT                   TGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNT
FT                   AVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSP
FT                   REYLRQRACNGLSDNRCLEI"
FT                   /protein_id="YP_406228.2"
FT   misc_feature    complement(807..1709)
FT                   /note="IS2 transposase TnpB; Reviewed; Region: PRK09409"
FT                   /db_xref="CDD:181829"
FT                   /locus_tag="SBO_P003"
FT   misc_feature    complement(984..1346)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="SBO_P003"
FT   gene            complement(1667..2032)
FT                   /note="SBOP004"
FT                   /db_xref="GeneID:3776751"
FT                   /locus_tag="SBO_P004"
FT   CDS_pept        complement(1667..2032)
FT                   /locus_tag="SBO_P004"
FT                   /gene_family="HOG000266654" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="insertion sequence 2 OrfA protein"
FT                   /transl_table="11"
FT                   /note="IS2 OrfA; forms an overlapping reading frame with
FT                   orfB; may form a fusion protein OrfAB due to ribosomal
FT                   frameshifting; both OrfA and OrfAB bind terminal inverted
FT                   repeats"
FT                   /db_xref="GI:82524668"
FT                   /db_xref="GeneID:3776751"
FT                   /translation="MIDVLGPEKRRRRTTQERIAIVQQSFEPGMTVSLVARQHGVAASQ
FT                   LFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVEYG
FT                   RAKKWIAHAPLLPGDGE"
FT                   /protein_id="YP_406229.1"
FT   misc_feature    complement(1670..2032)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:186341"
FT                   /locus_tag="SBO_P004"
FT   misc_feature    complement(1691..2017)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG2963"
FT                   /db_xref="CDD:32783"
FT                   /locus_tag="SBO_P004"
FT   gene            2511..3377
FT                   /note="SBOP005"
FT                   /db_xref="GeneID:3776752"
FT                   /locus_tag="SBO_P005"