(data stored in ACNUC8465 zone)

HOGENOMDNA: STAA2_1

ID   STAA2_1; SV 1; empty ; DNA; empty ; PRO; 30429 BP.
XX
AC   NC_009619;
XX
PR   Project: 58457;
XX
DE   Staphylococcus aureus subsp. aureus JH1 plasmid pSJH101, complete
DE   sequence.
XX
OS   Staphylococcus aureus subsp. aureus JH1
OC   Bacteria; Firmicutes; Bacillales; Staphylococcus.
XX
RN   [1]
RP   1-30429
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Ivanova,N., Tomasz,A. and Richardson,P.;
RT   "Complete sequence of plasmid pSJH101 of Staphylococcus aureus subsp.
RT   aureus JH1";
RL   Unpublished
XX
RN   [2]
RP   1-30429
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-JUL-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-30429
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P.,
RA   Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M.,
RA   Hauser,L., Kyrpides,N., Ivanova,N., Tomasz,A. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (20-JUN-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000737.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001072
CC   Source DNA and bacteria available from Alexander Tomasz
CC   (tomasz@rockefeller.edu)
CC   Contacts: Alexander Tomasz (tomasz@rockefeller.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..30429
FT                   /sub_species="aureus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:359787"
FT                   /strain="JH1"
FT                   /plasmid="pSJH101"
FT                   /organism="Staphylococcus aureus subsp. aureus JH1"
FT   gene            complement(52..144)
FT                   /db_xref="GeneID:5314970"
FT                   /locus_tag="SaurJH1_2794"
FT   CDS_pept        complement(52..144)
FT                   /locus_tag="SaurJH1_2794"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sau:SAP007 hypothetical protein"
FT                   /db_xref="GI:150375693"
FT                   /db_xref="GeneID:5314970"
FT                   /translation="MLIIFVHIIAPVISGCAVAYYTYWLSKRNK"
FT                   /protein_id="YP_001312290.1"
FT   gene            complement(301..648)
FT                   /db_xref="GeneID:5314999"
FT                   /locus_tag="SaurJH1_2795"
FT   CDS_pept        complement(301..648)
FT                   /locus_tag="SaurJH1_2795"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulatory protein ArsR"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: sau:SAP006
FT                   CadX"
FT                   /db_xref="GI:150375694"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:5314999"
FT                   /translation="MSYENTCDVICVHEDKVNNALSFLEDDKSKKLLNILEKICDEKKL
FT                   KIILSLIKEDELCVCDISLILKMSVASTSHHLRLLYKNEVLDFYKDGKMAYYFIKDDEI
FT                   REFFSKNHEGF"
FT                   /protein_id="YP_001312291.1"
FT   misc_feature    complement(340..>477)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SaurJH1_2795"
FT   misc_feature    complement(order(358..366,379..387,403..408,412..417,
FT                   424..429,433..444,469..477))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SaurJH1_2795"
FT   misc_feature    complement(order(466..468,475..477))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SaurJH1_2795"
FT   gene            complement(667..1284)
FT                   /db_xref="GeneID:5314976"
FT                   /locus_tag="SaurJH1_2796"
FT   CDS_pept        complement(667..1284)
FT                   /locus_tag="SaurJH1_2796"
FT                   /gene_family="HOG000099674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cadmium resistance transporter CadD"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cadmium resistance transporter, CadD
FT                   family; PFAM: cadmium resistance transporter; KEGG:
FT                   sau:SAP005 CadD"
FT                   /db_xref="GI:150375695"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="GeneID:5314976"
FT                   /translation="MIQTVVAAAVLYIATAVDLLVILLIFFARAKTRKEYRDIYVGQYL
FT                   GSIILILVSLFLAFVLNYVPEKWILGLLGLIPIYLGIKVAIYDDCEGEKRAKKELNEKG
FT                   LSKLVGTVAIVTIASCGADNIGLFVPYFVTLSVTNLLLTLFVFLILIFFLVFTAQKLAN
FT                   IPGIGEIVEKFSRWIMAIIYIALGLFIIIENDTIQTILGFIF"
FT                   /protein_id="YP_001312292.1"
FT   misc_feature    complement(670..1284)
FT                   /note="Predicted permease, cadmium resistance protein
FT                   [Inorganic ion transport and metabolism]; Region: CadD;
FT                   COG4300"
FT                   /db_xref="CDD:34022"
FT                   /locus_tag="SaurJH1_2796"
FT   misc_feature    complement(676..1251)
FT                   /note="Cadmium resistance transporter; Region: Cad;
FT                   cl04177"
FT                   /db_xref="CDD:141807"
FT                   /locus_tag="SaurJH1_2796"
FT   gene            complement(2400..2594)
FT                   /db_xref="GeneID:5315000"
FT                   /locus_tag="SaurJH1_2797"
FT   CDS_pept        complement(2400..2594)
FT                   /locus_tag="SaurJH1_2797"
FT                   /gene_family="HOG000295300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sau:SAP004 hypothetical protein"
FT                   /db_xref="GI:150375696"
FT                   /db_xref="GeneID:5315000"
FT                   /translation="MNENLEKYIKSLPLLGLLISILLIVLFFFILDVDEDLFVVFLYCL
FT                   LPLIVNLSIYGFYVFVKRK"
FT                   /protein_id="YP_001312293.1"
FT   gene            2704..3396
FT                   /db_xref="GeneID:5314993"
FT                   /locus_tag="SaurJH1_2798"
FT   CDS_pept        2704..3396
FT                   /locus_tag="SaurJH1_2798"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sau:SAP003 hypothetical protein"
FT                   /db_xref="GI:150375697"
FT                   /db_xref="GeneID:5314993"
FT                   /translation="MKIIKLFSIISLFLLVFSANFSNAYANEEQKSSLLENQKEKLKSK
FT                   NIEVSQMTKKEISFLEQLQNKNEDMQKFEKQMKKEGFKKIKLEDKNSKLKYLATEANDK
FT                   NAYGYIANNAYKNEKTKEIVVSETIYDNYNKKITKFIAEKRSMTENKEGKILINKNYVE
FT                   YKAEKVDKNRPVTYAGFKWNGKAFACSMAGLYACAHYCGVWAIVNPIAGGVCEAVCGTA
FT                   FAAGCSVG"
FT                   /protein_id="YP_001312294.1"
FT   sig_peptide     2704..2784
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.793 at
FT                   residue 27"
FT                   /locus_tag="SaurJH1_2798"
FT                   /product="hypothetical protein"
FT   gene            complement(4268..4570)
FT                   /db_xref="GeneID:5314980"
FT                   /locus_tag="SaurJH1_2799"
FT                   /pseudo
FT   gene            complement(4569..5552)
FT                   /db_xref="GeneID:5314985"
FT                   /locus_tag="SaurJH1_2800"
FT   CDS_pept        complement(4569..5552)
FT                   /locus_tag="SaurJH1_2800"
FT                   /gene_family="HOG000280338" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication initiator A domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: replication initiator A domain protein; KEGG:
FT                   sau:SAP001 putative replication initiation protein Rep"
FT                   /db_xref="GI:150375698"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="GeneID:5314985"
FT                   /translation="MQNQYFTVQENYKERFYQIPKVFFTSENYKNLTNDMKIAYAILRD
FT                   RLNLSIKNSWVDEDGNIYFVYSNEKLMEILNCKKEKLTKIKKGLENDGLLIQKRRGLNK
FT                   PNILYLMKPIVTERDIYKIEKEENDVEPYGEKEVRKSNVQKFENRTSRSSKIERPEVRK
FT                   SNTNDTDFNDIDFNDTENNDMNDLNDIKYKNEISNHSNHSNQFTHNFDDKEMLLQEFPE
FT                   QLTNYLLKYDYRDLEIIKAVILKAKKSFNSRHEDMHYMLEDIEDEILTSLKRLKKAIHD
FT                   RGVKGQKETIKSMQAYLMQTILTELEETHALYMRRKNMKQYNIFNQ"
FT                   /protein_id="YP_001312295.1"
FT   misc_feature    complement(5322..5513)
FT                   /note="Replication initiator protein A (RepA) N-terminus;
FT                   Region: RepA_N; pfam06970"
FT                   /db_xref="CDD:148536"
FT                   /locus_tag="SaurJH1_2800"
FT   gene            complement(5605..5721)
FT                   /db_xref="GeneID:5315005"
FT                   /locus_tag="SaurJH1_2801"
FT   CDS_pept        complement(5605..5721)
FT                   /locus_tag="SaurJH1_2801"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sar:SAR0710 hypothetical protein"
FT                   /db_xref="GI:150375699"
FT                   /db_xref="GeneID:5315005"
FT                   /translation="MVIKRLETVYLYNFRYLYYIMNNILVQAPKSLNKCKAK"
FT                   /protein_id="YP_001312296.1"
FT   gene            5978..6721
FT                   /db_xref="GeneID:5314997"
FT                   /locus_tag="SaurJH1_2802"
FT   CDS_pept        5978..6721
FT                   /locus_tag="SaurJH1_2802"
FT                   /gene_family="HOG000280339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF536; KEGG:
FT                   sau:SAP031 hypothetical protein"
FT                   /db_xref="GI:150375700"
FT                   /db_xref="InterPro:IPR007489"
FT                   /db_xref="GeneID:5314997"
FT                   /translation="MKSVKKLSEELGVSKQTIFNNIKRLNIETIKQENTSFIKEDTDIE
FT                   KIIQRVNENKKKYGFESTTEDKQKKGSDNINFESKSDAQIVEILKNQIDTLNNQIEKQE
FT                   SRHETTIEFYRKELQERSKLLENQQVLALESNKKIQKLENQLEKEKHLNYPFDTSTNTR
FT                   QNVDAQEKTYTTNPVNINRDQEETKETEIQYKDISGSQSDESTQGEEAKKEDVPANLND
FT                   NDSDIEEKSEETEPKKGFWSRLFGS"
FT                   /protein_id="YP_001312297.1"
FT   misc_feature    <6014..6667
FT                   /note="DNA topoisomerase II; Provisional; Region: PTZ00108"
FT                   /db_xref="CDD:173400"
FT                   /locus_tag="SaurJH1_2802"
FT   gene            7086..7760
FT                   /db_xref="GeneID:5314990"
FT                   /locus_tag="SaurJH1_2803"
FT   CDS_pept        7086..7760
FT                   /locus_tag="SaurJH1_2803"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: sha:SH0760
FT                   transposase for IS431mec"
FT                   /db_xref="GI:150375701"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5314990"
FT                   /translation="MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHS
FT                   TVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWL
FT                   RKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAIAKVIKAFKLKPDCHCTSKYLN
FT                   NLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEIRDML
FT                   AS"
FT                   /protein_id="YP_001312298.1"
FT   misc_feature    7086..7736
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="SaurJH1_2803"
FT   gene            7792..8013
FT                   /db_xref="GeneID:5314984"
FT                   /locus_tag="SaurJH1_2804"
FT                   /pseudo
FT   gene            8058..8462
FT                   /db_xref="GeneID:5314982"
FT                   /locus_tag="SaurJH1_2805"
FT   CDS_pept        8058..8462
FT                   /locus_tag="SaurJH1_2805"
FT                   /gene_family="HOG000280340" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sav:SAVP027 hypothetical protein"
FT                   /db_xref="GI:150375702"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:5314982"
FT                   /translation="MTEFMEEVLIDDNMVFDIDNLKGFLNDTSSFGFIAKENNKIIGFA
FT                   YCYTLLRPDGKTMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEIGCSEMFLITDKGNP
FT                   RACHVYEKLGGKNDYKDEIVYVYDYEKGDK"
FT                   /protein_id="YP_001312299.1"
FT   misc_feature    8154..8348
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="SaurJH1_2805"
FT   misc_feature    order(8247..8255,8283..8288)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="SaurJH1_2805"
FT   misc_feature    <8259..8438
FT                   /note="Predicted acetyltransferase [General function
FT                   prediction only]; Region: COG3393"
FT                   /db_xref="CDD:33200"
FT                   /locus_tag="SaurJH1_2805"
FT   gene            8463..9902
FT                   /db_xref="GeneID:5314981"
FT                   /locus_tag="SaurJH1_2806"
FT   CDS_pept        8463..9902
FT                   /locus_tag="SaurJH1_2806"
FT                   /gene_family="HOG000280341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase;
FT                   aminoglycoside phosphotransferase; KEGG: efa:EFA0061
FT                   6'-aminoglycoside N-acetyltransferase"
FT                   /db_xref="GI:150375703"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="GeneID:5314981"
FT                   /translation="MNIVENEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLES
FT                   LKKHYTEPWEDEVFRVIIEYNNVPIGYGQIYKMYDELYTDYHYPKTDEIVYGMDQFIGE
FT                   PNYWSKGIGTRYIKLIFEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHE
FT                   LHEGKKEDCYLMEYRYDDNATNVKAMKYLIEHYFDNFKVDSIEIIGSGYDSVAYLVNNE
FT                   YIFKTKFSTNKKKGYAKEKAIYNFLNTNLETNVKIPNIEYSYISDELSILGYKEIKGTF
FT                   LTPEIYSTMSEEEQNLLKRDIASFLRQMHGLDYTDISECTIDNKQNVLEEYILLRETIY
FT                   NDLTDIEKDYIESFMERLNATTVFEGKKCLCHNDFSCNHLLLDGNNRLTGIIDFGDSGI
FT                   IDEYCDFIYLLEDSEEEIGTNFGEDILRMYGNIDIEKAKEYQDIVEEYYPIETIVYGIK
FT                   NIKQEFIENGRKEIYKRTYKD"
FT                   /protein_id="YP_001312300.1"
FT   misc_feature    8463..9005
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    8649..8924
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    9069..>9401
FT                   /note="Aminoglycoside 3'-phosphotransferase (APH) and
FT                   Choline Kinase (ChoK) family. The APH/ChoK family is part
FT                   of a larger superfamily that includes the catalytic domains
FT                   of other kinases, such as the typical
FT                   serine/threonine/tyrosine protein kinases (PKs)...; Region:
FT                   APH_ChoK_like; cd05120"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    9072..9782
FT                   /note="Phosphotransferase enzyme family; Region: APH;
FT                   pfam01636"
FT                   /db_xref="CDD:145007"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    order(9096..9098,9108..9110,9132..9134,9138..9140,
FT                   9234..9236,9282..9293)
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    order(9108..9110,9132..9134,9138..9140,9234..9236,
FT                   9282..9293)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    9213..9785
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    order(9234..9236,9282..9293,9582..9584,9594..9599,
FT                   9603..9605,9636..9641,9696..9698)
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    order(9234..9236,9282..9293,9582..9584,9594..9599,
FT                   9603..9605,9636..9641)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SaurJH1_2806"
FT   misc_feature    order(9582..9584,9696..9698)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SaurJH1_2806"
FT   gene            complement(10032..10400)
FT                   /db_xref="GeneID:5314979"
FT                   /locus_tag="SaurJH1_2807"
FT                   /pseudo
FT   gene            10444..11118
FT                   /db_xref="GeneID:5314973"
FT                   /locus_tag="SaurJH1_2808"
FT   CDS_pept        10444..11118
FT                   /locus_tag="SaurJH1_2808"
FT                   /gene_family="HOG000039983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase catalytic region"
FT                   /transl_table="11"
FT                   /note="PFAM: Integrase catalytic region; KEGG: sha:SH0760
FT                   transposase for IS431mec"
FT                   /db_xref="GI:150375704"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="GeneID:5314973"
FT                   /translation="MNYFRYKQFNKDVITVAVGYYLRYALSYRDISEILRERGVNVHHS
FT                   TVYRWVQEYAPILYQIWKKKHKKAYYKWRIDETYIKIKGKWSYLYRAIDAEGHTLDIWL
FT                   RKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAIAKVIKAFKLKPDCHCTSKYLN
FT                   NLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNRRSLQIYGFSPCHEIRDML
FT                   AS"
FT                   /protein_id="YP_001312301.1"
FT   misc_feature    10444..11094
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="SaurJH1_2808"
FT   gene            complement(11228..12688)
FT                   /db_xref="GeneID:5314972"
FT                   /locus_tag="SaurJH1_2809"
FT   CDS_pept        complement(11228..12688)
FT                   /locus_tag="SaurJH1_2809"
FT                   /gene_family="HOG000046191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; KEGG: sab:SAB1366
FT                   glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="GI:150375705"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="GeneID:5314972"
FT                   /translation="MDKNLSSLITIFGGTGDLSYRKLLPSIFNLYKKGHFKKLVIISTG
FT                   LEDISDEEYRSKVKQILLSRENFEMVNLFLDNIFYFQQNVEDKTSWNKLKELSNDIDKK
FT                   YCLDGNRLFYLAMNPQFFKIITQSISQSGLSDTNGFSRLIIEKPFGKDLKSAEDLNKHI
FT                   RQYFKEEEIFRIDHYLGKEMVQNIESLRFGNTIFEPLWNNKYISNVQITLSETLGIEDR
FT                   GQYYDSTGALKDMVQNHALQILTLIAMEKPESRNSKDIRLKKIELLNNIKFLKGADVHK
FT                   YFVRGQYINGIINETPIMSYHEEKGVDSDSTTETFVAGKVLINNRRWEGTPFYIRTGKR
FT                   LGKKATEIVIEFKKNNNTLRYENNNEDTDCNLLVINIEPNAKISLYIYENKSNRNNRSH
FT                   NMKIYNSIDKNQVVDAYESLICDALIGNQTNFVHWEELKQSWEFIDYISTEWKKSNVTI
FT                   PQYKPGSFGPKESDQLLKQDNFEWWNNL"
FT                   /transl_table="11"
FT                   /protein_id="YP_001312302.1"
FT   misc_feature    complement(11237..12688)
FT                   /note="glucose-6-phosphate 1-dehydrogenase; Validated;
FT                   Region: PRK05722"
FT                   /db_xref="CDD:168207"
FT                   /locus_tag="SaurJH1_2809"
FT   misc_feature    complement(12131..12661)
FT                   /note="Glucose-6-phosphate dehydrogenase, NAD binding
FT                   domain; Region: G6PD_N; pfam00479"
FT                   /db_xref="CDD:144172"
FT                   /locus_tag="SaurJH1_2809"
FT   misc_feature    complement(11243..12121)
FT                   /note="Glucose-6-phosphate dehydrogenase, C-terminal
FT                   domain; Region: G6PD_C; pfam02781"
FT                   /db_xref="CDD:145765"
FT                   /locus_tag="SaurJH1_2809"
FT   gene            complement(12752..14158)
FT                   /db_xref="GeneID:5314977"
FT                   /locus_tag="SaurJH1_2810"
FT   CDS_pept        complement(12752..14158)
FT                   /locus_tag="SaurJH1_2810"
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /EC_number="1.1.1.44"
FT                   /note="catalyzes the formation of D-ribulose 5-phosphate
FT                   from 6-phospho-D-gluconate"
FT                   /db_xref="GI:150375706"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="GeneID:5314977"
FT                   /translation="MSSNIGILGLGVMGKNLAWNIEDKKYSVSIHSRDNNEINDTIQKS
FT                   HYQKIYPAYNLKEFVDSLEKPRKILLMIKAGSPTDNMINTLLPLLDDDDILIDGGNTNY
FT                   QDTIRRNKALAESGVNFIGMGVSGGEVGALTGPSLMPGGQEAAYNKVSDILDAISAKAQ
FT                   DGASCVTYIGPNGAGHYVKMVHNGIEYADMQLIAESYAMMKDLLGMSHTEISQTFKDWN
FT                   AGELESYLIEITGDIFTELDENNEPLVEKILDTAGQKGTGKWTSINALELGIPLTIITE
FT                   SVFARFISSIKEERVNASKSLNGPQASFDGNKEEFLEKIRKALYMSKICSYAQGFAQMR
FT                   KASEDHEWNLKLGDLAMIWREGCIIRAQFLQKIKDAYDNNPELENLLLDPYFKNIVTDY
FT                   QEALRDVVATGVKNGVPTPGFSASVNYYDSYRSEDLPANLIQAQRDYFGAHTYERKDHE
FT                   GVFHTQWDEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_001312303.1"
FT   misc_feature    complement(13292..14146)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="SaurJH1_2810"
FT   misc_feature    complement(12755..14122)
FT                   /note="6-phosphogluconate dehydrogenase; Validated; Region:
FT                   PRK09287"
FT                   /db_xref="CDD:169776"
FT                   /locus_tag="SaurJH1_2810"
FT   misc_feature    complement(12764..13627)
FT                   /note="6-phosphogluconate dehydrogenase, C-terminal domain;
FT                   Region: 6PGD; pfam00393"
FT                   /db_xref="CDD:109451"
FT                   /locus_tag="SaurJH1_2810"
FT   gene            complement(14190..15521)
FT                   /db_xref="GeneID:5314998"
FT                   /locus_tag="SaurJH1_2811"