(data stored in ACNUC8465 zone)

HOGENOMDNA: STALH_1

ID   STALH_1; SV 1; empty ; DNA; empty ; PRO; 2658366 BP.
XX
AC   NC_013893;
XX
PR   Project: 46233;
XX
DE   Staphylococcus lugdunensis HKU09-01 chromosome, complete genome.
XX
OS   Staphylococcus lugdunensis HKU09-01
OC   Bacteria; Firmicutes; Bacillales; Staphylococcus.
XX
RN   [1]
RP   1-2658366
RX   PUBMED; 20047907.
RA   Tse,H., Tsoi,H.W., Leung,S.P., Lau,S.K., Woo,P.C. and Yuen,K.Y.;
RT   "Complete genome sequence of Staphylococcus lugdunensis strain HKU09-01";
RL   J. Bacteriol. 192 (5), 1471-1472 (2010)
XX
RN   [2]
RP   1-2658366
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (22-FEB-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2658366
RA   Tse,H.;
RT   "Direct Submission";
RL   Submitted (09-DEC-2009) Department of Microbiology, The University of Hong
RL   Kong, Pokfulam Road, Hong Kong, China
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001837.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2658366
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:698737"
FT                   /country="Hong Kong"
FT                   /isolation_source="clinical specimen"
FT                   /strain="HKU09-01"
FT                   /host="Homo sapiens"
FT                   /organism="Staphylococcus lugdunensis HKU09-01"
FT   gene            405..884
FT                   /db_xref="GeneID:8820267"
FT                   /locus_tag="SLGD_00001"
FT   CDS_pept        405..884
FT                   /locus_tag="SLGD_00001"
FT                   /gene_family="HOG000218433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LSU methyltransferase RlmH/ybeA"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549372"
FT                   /db_xref="GeneID:8820267"
FT                   /translation="MKITILAVGKLKEKYWKQAIAEYEKRLSAYSKIELIEVPDEKAPE
FT                   NMSDKEIEQVKAKEGQRLLAKIKPQATVITLEIAGKMLSSEGLAQELQQRMTQGQSDFT
FT                   FVIGGSNGLHKDVLTRSNYALSFSKMTFPHQMMRVILIEQVYRTFKIMRGEAYHK"
FT                   /protein_id="YP_003470276.1"
FT   misc_feature    405..881
FT                   /note="Predicted SPOUT methyltransferase; Region:
FT                   SPOUT_MTase; cl00679"
FT                   /db_xref="CDD:174343"
FT                   /locus_tag="SLGD_00001"
FT   gene            complement(1074..1490)
FT                   /db_xref="GeneID:8817708"
FT                   /locus_tag="SLGD_00002"
FT   CDS_pept        complement(1074..1490)
FT                   /locus_tag="SLGD_00002"
FT                   /gene_family="HOG000086276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549373"
FT                   /db_xref="GeneID:8817708"
FT                   /translation="MALINYSNIGKTPFQQLLGHNENILKSWNDLANLLSDDGALSKEL
FT                   KEELRRILAQENGCLYCKAKGSPSNEYQDEKSLLCTGFVEVYLKTKENVPESTIQLLKD
FT                   VMTNKEIIELITFTLFTTAQQHLGAILKLSSETN"
FT                   /protein_id="YP_003470277.1"
FT   misc_feature    complement(<1299..1490)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG2128"
FT                   /db_xref="CDD:32311"
FT                   /locus_tag="SLGD_00002"
FT   gene            1593..2006
FT                   /db_xref="GeneID:8817709"
FT                   /locus_tag="SLGD_00003"
FT   CDS_pept        1593..2006
FT                   /locus_tag="SLGD_00003"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549374"
FT                   /db_xref="GeneID:8817709"
FT                   /translation="MNDLINEKILNILEKNSRMTINEISKQVNLSAPAVRERINKMVDL
FT                   GIIKSYTINIDYEKLGYDVEILIEITIKNNRYVDFKKFISEQDNVDFCYRVSGDACFVF
FT                   KVRLENMSSVESFIDLLQPYGHTKSQFIFSKVI"
FT                   /protein_id="YP_003470278.1"
FT   misc_feature    1599..1913
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00003"
FT   gene            2303..2440
FT                   /db_xref="GeneID:8817710"
FT                   /locus_tag="SLGD_00004"
FT   CDS_pept        2303..2440
FT                   /locus_tag="SLGD_00004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549375"
FT                   /db_xref="GeneID:8817710"
FT                   /translation="MRNQSLKQKIFELIDLKNVGSYWDYKQYHSTEHNHKLLYAIICLY
FT                   "
FT                   /protein_id="YP_003470279.1"
FT   gene            2468..2758
FT                   /db_xref="GeneID:8817711"
FT                   /locus_tag="SLGD_00005"
FT   CDS_pept        2468..2758
FT                   /locus_tag="SLGD_00005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549376"
FT                   /db_xref="GeneID:8817711"
FT                   /translation="MKGNGYKITKNSSVKNHKNLYDQTYYWVSNHKANGVFFSLDGKSV
FT                   SKKELINHYGEPKYYSSSAWGKECTYKIGNKDVRFYVDKKGYVIKCQIISE"
FT                   /protein_id="YP_003470280.1"
FT   gene            3227..4213
FT                   /db_xref="GeneID:8817712"
FT                   /locus_tag="SLGD_00006"
FT   CDS_pept        3227..4213
FT                   /product="beta-hemolysin"
FT                   /gene_family="HOG000083557" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00006"
FT                   /EC_number="3.1.4.3"
FT                   /db_xref="GI:289549377"
FT                   /db_xref="GeneID:8817712"
FT                   /translation="MYLDWQRKCIITTMVVLSSLLLVFSSITYASERNTEDSLKITTHN
FT                   VYFLPTAIYPNWGQSQRADLISKADYIQGQDVVILNELFDHKASNRLLTNLKSQYPYQT
FT                   PIVGQGTEGWQKTSGSYRKLKKVSGGVGIVSKWPIVQQEQHIYKNGCGADSVGNKGFAY
FT                   IKINKNGKYQHIIGTHLQAEDPVCMKGKDQTIRQSQMEEIKQFIKDKNIPKDEPVYIGG
FT                   DLNVIKGSAEYQKMSDNLNVSMPKQYEGNAYSWDTQTNGIANYNYPKLEPQHLDYILLD
FT                   RDHAQPSSWHNHTHKVKSPEWSVKSWGKTYRYNDYSDHYPVSAYAAN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470281.1"
FT   misc_feature    3341..4201
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:174238"
FT                   /locus_tag="SLGD_00006"
FT   gene            complement(4322..4876)
FT                   /db_xref="GeneID:8817713"
FT                   /locus_tag="SLGD_00007"
FT   CDS_pept        complement(4322..4876)
FT                   /locus_tag="SLGD_00007"
FT                   /gene_family="HOG000085276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549378"
FT                   /db_xref="GeneID:8817713"
FT                   /translation="MNIKDLRVVKTRASINKAFITLFFEKDFDTISIKEITEHAQVGRK
FT                   TFYLHYIDKYDLLDQVVSEKLTELEEICEAKKHLGLQEGTQLWFEFFENNRSFFMKLFN
FT                   ISNASSYKKKLLHFIEEEFKKKVPTTVATDKGLDYHLYINFISNGMIGLLDSYLNSSDN
FT                   TQEQEKIPLHVSRLLSLYDLA"
FT                   /protein_id="YP_003470282.1"
FT   misc_feature    complement(<4562..4846)
FT                   /note="probable dihydroxyacetone kinase regulator; Region:
FT                   DHAK_reg; TIGR02366"
FT                   /db_xref="CDD:162826"
FT                   /locus_tag="SLGD_00007"
FT   misc_feature    complement(4694..4813)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="SLGD_00007"
FT   gene            5052..5966
FT                   /db_xref="GeneID:8817714"
FT                   /locus_tag="SLGD_00008"
FT   CDS_pept        5052..5966
FT                   /locus_tag="SLGD_00008"
FT                   /gene_family="HOG000273854" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dienelactone hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549379"
FT                   /db_xref="GeneID:8817714"
FT                   /translation="MKQSVNFKSKTNLLAAHLYTPEQFDESKTYPAITVCHPGGGVKEQ
FT                   TAGMYAEKLAEFGYVTVVYDASHQGESEGSPKYLEDPFARTEDVRASVDYLTTLDFVDN
FT                   DRIGALGICAGGGYTVSAARTERRIKTLATVSMVDIGALFRKGPGDVISIEDQLSFMTQ
FT                   VADQRTEEASGADYAYTGYVPEEIDDAMPENSTMVQGHDYYLTERGYHKNAPNKILLRS
FT                   FSEVLTFAPFTYIDELLTQPFLAIAGTEADTFEYSEEAVEKAAGNNNELYKIEGASHVD
FT                   LYDIPEYVNQVLPKLESFYKETL"
FT                   /protein_id="YP_003470283.1"
FT   misc_feature    5091..5963
FT                   /note="Hydrolases of the alpha/beta superfamily [General
FT                   function prediction only]; Region: COG1073"
FT                   /db_xref="CDD:31271"
FT                   /locus_tag="SLGD_00008"
FT   misc_feature    5211..>5432
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00008"
FT   gene            5988..6626
FT                   /db_xref="GeneID:8817715"
FT                   /locus_tag="SLGD_00009"
FT   CDS_pept        5988..6626
FT                   /locus_tag="SLGD_00009"
FT                   /gene_family="HOG000262431" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549380"
FT                   /db_xref="GeneID:8817715"
FT                   /translation="MTRILIIGASGQISQEAIDLYLQNTDFDLTLLARNKSKLPDYDSN
FT                   RVTVFEGDATDKNAISKALENVDTVFVSSTGDTLGDQAKTIIEAMNDNGTKRLIFVTAL
FT                   NTLHEVPGKFGKWNDENIGPYLGPFREATEAIENSDLDYTIFRPAWLTNYDEIDYEVTQ
FT                   RDEPFKGTEVSRKSVADLAVKISQNPKRHSKENIGLNKPNTDGDKPSWM"
FT                   /protein_id="YP_003470284.1"
FT   misc_feature    5994..6584
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00009"
FT   gene            complement(7046..8026)
FT                   /db_xref="GeneID:8817716"
FT                   /locus_tag="SLGD_00010"
FT   CDS_pept        complement(7046..8026)
FT                   /locus_tag="SLGD_00010"
FT                   /gene_family="HOG000217857" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA dihydrouridine synthase B"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549381"
FT                   /db_xref="GeneID:8817716"
FT                   /translation="MKENFWRELPRPFFILAPMEDVTDIVFRHVVSEAARPDVFFTEFT
FT                   NTESYCHPEGIHSVRGRLTFSEDEQPMVAHIWGDKPEQFREMSFGLAEMGFKGIDLNMG
FT                   CPVANVAKKGKGSGLILRPETAAEIIQATKAGGLPVSVKTRLGYYDIDEWKDWLKHVFE
FT                   QDIANLSIHLRTRKEMSKVDAHWELIEAIKHMRDEIAPNTLLTINGDIPDRKTGMELAT
FT                   KYGIDGVMIGRGIFHNPFAFEKEPREHTSEELLSLFRLHLTLFDKHSSDETQQFKSLRR
FT                   FFKIYVRGIKGASQLRHQLMDTQTTDEARALLDAFEAQRHDEVES"
FT                   /protein_id="YP_003470285.1"
FT   misc_feature    complement(7070..8023)
FT                   /note="tRNA-dihydrouridine synthase [Translation, ribosomal
FT                   structure and biogenesis]; Region: COG0042"
FT                   /db_xref="CDD:30391"
FT                   /locus_tag="SLGD_00010"
FT   misc_feature    complement(7277..7987)
FT                   /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
FT                   domain. Members of this family catalyze the reduction of
FT                   the 5,6-double bond of a uridine residue on tRNA.
FT                   Dihydrouridine modification of tRNA is widely observed in
FT                   prokaryotes and eukaryotes, and...; Region: DUS_like_FMN;
FT                   cd02801"
FT                   /db_xref="CDD:73368"
FT                   /locus_tag="SLGD_00010"
FT   misc_feature    complement(order(7328..7333,7397..7399,7403..7405,
FT                   7511..7513,7598..7600,7721..7723,7802..7804,7895..7897,
FT                   7970..7978))
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73368"
FT                   /locus_tag="SLGD_00010"
FT   misc_feature    complement(order(7328..7330,7397..7402,7502..7507,
FT                   7511..7516,7592..7594,7598..7600,7709..7714,7802..7804))
FT                   /note="active site"
FT                   /db_xref="CDD:73368"
FT                   /locus_tag="SLGD_00010"
FT   misc_feature    complement(order(7505..7507,7511..7513,7592..7594,
FT                   7712..7714))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:73368"
FT                   /locus_tag="SLGD_00010"
FT   misc_feature    complement(order(7397..7402,7502..7504,7514..7516,
FT                   7598..7600,7709..7711))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73368"
FT                   /locus_tag="SLGD_00010"
FT   gene            8069..8197
FT                   /db_xref="GeneID:8817717"
FT                   /locus_tag="SLGD_00011"
FT   CDS_pept        8069..8197
FT                   /locus_tag="SLGD_00011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549382"
FT                   /db_xref="GeneID:8817717"
FT                   /translation="MHDDITTNDELIQREFEKAQALKGRPTGSLKYVCAHHNSSAI"
FT                   /protein_id="YP_003470286.1"
FT   gene            complement(9698..9913)
FT                   /db_xref="GeneID:8817718"
FT                   /locus_tag="SLGD_00012"
FT   CDS_pept        complement(9698..9913)
FT                   /locus_tag="SLGD_00012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549383"
FT                   /db_xref="GeneID:8817718"
FT                   /translation="MIYIDQASPLIYCSAVEAHVQEHEQLQEHEQLQEQQPPAYCIASE
FT                   LLMSEYPLIEWLLIFIIFHLLLPNNK"
FT                   /protein_id="YP_003470287.1"
FT   gene            9941..10804
FT                   /db_xref="GeneID:8817719"
FT                   /locus_tag="SLGD_00013"
FT   CDS_pept        9941..10804
FT                   /locus_tag="SLGD_00013"
FT                   /gene_family="HOG000100935" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549384"
FT                   /db_xref="GeneID:8817719"
FT                   /translation="MESLMTIKDLKVDINNRKILNLNNSTINIYSEDKIALIGKNGAGK
FT                   TTLINCLLNEINYSGVIDRKISSKDIGIVFQENKYGDLIKVHELIYLATAYSKRSEEFK
FT                   AFTKAFSLEHLINKFVKDLSLGEQKRLTVGLVLNKQKKLYIFDELTSGLDYEKRQNLLQ
FT                   KTKEITQNKAVIKITHYFDEVENWANKLIILDKGELLYYGSIDQFFSKFYHYALIEIVN
FT                   QELDHLVKDDIEKINADVYFNAKIVTHNKEQMNDVINILNERKIEFKINMQNIYSTYLI
FT                   STLEEI"
FT                   /protein_id="YP_003470288.1"
FT   misc_feature    9947..10573
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    9953..10561
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    10055..10078
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    order(10064..10069,10073..10081,10166..10168,10379..10384,
FT                   10475..10477)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    10157..10168
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    10307..10336
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    10367..10384
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    10391..10402
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   misc_feature    10463..10483
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00013"
FT   gene            10801..11535
FT                   /db_xref="GeneID:8817720"
FT                   /locus_tag="SLGD_00014"
FT   CDS_pept        10801..11535
FT                   /locus_tag="SLGD_00014"
FT                   /gene_family="HOG000100936" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter, permease protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549385"
FT                   /db_xref="GeneID:8817720"
FT                   /translation="MINKILLSIKMQFRVPISVFFSLIFPIIMMLVIIMSYGNFSIGNG
FT                   RHFIDKYFLISTSIGLLPIAFISFPIWLSESIENDTLKRLKYFDVNISSLIVSNIISYC
FT                   FLAIFSVILNIIIGKVFFSLTLPNTQYFIAFFLQIFYNIIALLMIGTFLALLIRKSKVL
FT                   LPFGMILLFLTYMIIGVFVQYGELPNVLKEIGNWIPIKYATNDFYSIWTNERMWDVSFL
FT                   KLNSLYIVVTGVLSLCIYKFKK"
FT                   /protein_id="YP_003470289.1"
FT   gene            11547..11840
FT                   /db_xref="GeneID:8817721"
FT                   /locus_tag="SLGD_00015"
FT   CDS_pept        11547..11840
FT                   /locus_tag="SLGD_00015"
FT                   /gene_family="HOG000160576" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549386"
FT                   /db_xref="GeneID:8817721"
FT                   /translation="MLKRQEMRVIIEILAGIVLSAIITAISISIGYFIINKNGYAHFDV
FT                   NLLGLNLYKIHNHGDSGEPIITNIMFLGVALSILLVIIIELLVATKKRGKKQ"
FT                   /protein_id="YP_003470290.1"
FT   misc_feature    11837..12713
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|226223712|ref|YP_002757819.1| streptolysin S associated
FT                   ORF sagB"
FT   gene            11837..12355
FT                   /db_xref="GeneID:8817722"
FT                   /locus_tag="SLGD_00016"
FT   CDS_pept        11837..12355
FT                   /locus_tag="SLGD_00016"
FT                   /gene_family="HOG000130301" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Streptolysin S biosynthesis protein B SagB"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549387"
FT                   /db_xref="GeneID:8817722"
FT                   /translation="MINYQLKGMFNQHSLFKLNDDNIANNDNRNNFAQIILGNQESESL
FT                   KYLLNVNHQRLSDFKSMLAYNESNYAALVNEHQMLNEIKDEDTRSLPKSDKKIKESFYN
FT                   VLNHRKSTREFTSFEMASKELSTILKFSFGIAPRKVEYGDIKTSTRFYASAGGLYPIDI
FT                   SLYQQCRRL"
FT                   /protein_id="YP_003470291.1"
FT   misc_feature    12206..>12334
FT                   /note="Proteins of this family catalyze the reduction of
FT                   flavin or nitrocompounds using NAD(P)H as electron donor in
FT                   a obligatory two-electron transfer,  utilizing FMN or FAD
FT                   as cofactor. They are often found to be homodimers. Enzymes
FT                   of this family are...; Region: Nitro_FMN_reductase;
FT                   cl00514"
FT                   /db_xref="CDD:174256"
FT                   /locus_tag="SLGD_00016"
FT   gene            12318..12713
FT                   /db_xref="GeneID:8817723"
FT                   /locus_tag="SLGD_00017"
FT   CDS_pept        12318..12713
FT                   /locus_tag="SLGD_00017"
FT                   /gene_family="HOG000130302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Streptolysin S biosynthesis protein B SagB"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549388"
FT                   /db_xref="GeneID:8817723"
FT                   /translation="MIYLYINNVEDYDKGIYLYQPISHSLLKIVAQKDINTDDLLEGNN
FT                   IDIENCSFLVFFGYNFNSSFLKYGELALLNSLIEIGCMSHNFDLIITSLGYTGCPIAGF
FT                   KKNNIEKLLELDHVNEHILFTNICGKE"
FT                   /protein_id="YP_003470292.1"
FT   misc_feature    <12321..12707
FT                   /note="This family is the oxydase domain of NRPS
FT                   (non-ribosomal peptide synthetase) and other proteins that
FT                   modify polypeptides by cyclizing a thioester to form a
FT                   ring. These include epoB, part of the epothilone
FT                   biosynthesis pathway; tubD, part of the...; Region:
FT                   mcbC-like_oxidoreductase; cd02142"
FT                   /db_xref="CDD:48388"
FT                   /locus_tag="SLGD_00017"
FT   misc_feature    order(12621..12626,12687..12689)
FT                   /note="putative FMN binding site; other site"
FT                   /db_xref="CDD:48388"
FT                   /locus_tag="SLGD_00017"
FT   gene            12748..13650
FT                   /db_xref="GeneID:8817724"
FT                   /locus_tag="SLGD_00018"
FT   CDS_pept        12748..13650
FT                   /locus_tag="SLGD_00018"
FT                   /gene_family="HOG000100938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549389"
FT                   /db_xref="GeneID:8817724"
FT                   /translation="MFVEENNSEYILKKGYLHQHSIAIDKEESSKNFIDNFKTLIAENQ
FT                   IELNENDDIIEDFNKLTQLNLIHQKIDTFNKICIITDKAAKAFFKDHLDQVDEIYEFNE
FT                   VLERHEIEILNNQKNNLSINEVVKKQQSKFADMNVFVILSYANQPFIKAFNFLTNLLDM
FT                   AYTLAFYDNENVFFTNIHHGETGCYECLERQLISKFPGTIENYFVPDAQNQGMYNLKLY
FT                   SYILSIMINEINNIEIYGDSTLIGNVLHFYLPTYEYNFNFNKRQSTCSTCSTINNVLFK
FT                   EQNMKSANILKRVLENDNL"
FT                   /protein_id="YP_003470293.1"
FT   misc_feature    12796..13635
FT                   /note="bacteriocin biosynthesis cyclodehydratase, SagC
FT                   family; Region: cyclo_dehy_ocin; TIGR03603"
FT                   /db_xref="CDD:132642"
FT                   /locus_tag="SLGD_00018"
FT   gene            13637..14962
FT                   /db_xref="GeneID:8817725"
FT                   /locus_tag="SLGD_00019"
FT   CDS_pept        13637..14962
FT                   /locus_tag="SLGD_00019"
FT                   /gene_family="HOG000100939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Streptolysin S biosynthesis protein D (SagD)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549390"
FT                   /db_xref="GeneID:8817725"
FT                   /translation="MITFKNNLNYNLYRQNLLGGNVAGIWKDNSFFLGLNSYPIMNYHY
FT                   VTAQFNNFEKNFLSEDFKVNYHLSGYGIYYNEALASFLGESSERYAFTLLYQNLKGKII
FT                   YASHAQISEQLKNTNSLVLPLALINIYFEEKDAKHYIYDDDVIQWIPLKSLYHPDHDVL
FT                   VPLQMLVLFNKTIFKDEKQFTNSGVSTGTASHETFEKSLTNSIIEILQIDSYNLWWYGG
FT                   IEGKTISVNIAEKLNEWFKRPSIVHKFLDNFDVSFTDISFDKPIHVVVCEVKSKAKDLS
FT                   LPKYVVGVQGDMNLEQCIYRSLLECVTVLEYTMTEVWNNTTHFKNVTENIENHPIDNLD
FT                   DNVMYYAKYGLNFNMQKRKNTFQNTKNANNLHEIINELKHLSHYACYLDITPVEFYNKN
FT                   LVVVRTFIPELLTIAIPSYPPYLHPRYKEIGGIINDIPHPLA"
FT                   /protein_id="YP_003470294.1"
FT   misc_feature    13844..14959
FT                   /note="YcaO-like family; Region: YcaO; cl09146"
FT                   /db_xref="CDD:164132"
FT                   /locus_tag="SLGD_00019"
FT   gene            14937..15551
FT                   /db_xref="GeneID:8817726"
FT                   /locus_tag="SLGD_00020"
FT   CDS_pept        14937..15551
FT                   /locus_tag="SLGD_00020"
FT                   /gene_family="HOG000130299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549391"
FT                   /db_xref="GeneID:8817726"
FT                   /translation="MIFLILWHSLIGLMFFLTCFPGILLIFIRKVAYFKYLTEFYKYIL
FT                   VLIVVLLIDTCLFLSNTNIYLCVSVIIITPVIVYITEKSLLFNKNLFDFYNKNSKFILS
FT                   VLLAYPILEELNFRYFLYYFSLIYHYHFIQYIILSVLTFVFSHFLYQGKSSIVKIFFAT
FT                   IQAMIYLYFRDIFINIIIHMMFNILVFSSQMKKLNHSRIIK"
FT                   /protein_id="YP_003470295.1"
FT   gene            complement(15800..16903)
FT                   /db_xref="GeneID:8817727"
FT                   /locus_tag="SLGD_00021"
FT   CDS_pept        complement(15800..16903)
FT                   /locus_tag="SLGD_00021"
FT                   /gene_family="HOG000147917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="two-component sensor histidine kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549392"
FT                   /db_xref="GeneID:8817727"
FT                   /translation="MARIESIKTKLHRLNISVVIISIVVIFVLQLLLNILEFSNIGQSL
FT                   YHDFWHQPHYLFTISSICINLFIPLIVIYMLTRFFYKKHLSRNIDYLNHIIKSLKSDDI
FT                   DLKVTTTNIKEFNDVINEVQNINTFLKKRIADQLTIQNNFKKKLEIFEHDLKTPLTVMQ
FT                   GHIELLKKINNSELPNQEIKSKINSETKVILNALERINNQIKLHINNVKLLPNHSDKIN
FT                   IEKVISTINESYNNKYILKDKTMDIQVDNKLLHNHIFLNNQILYHVIDNLINNALKYAN
FT                   KEISINFKCLDQRLLQFSVINDGKQFTEDELKFAKEWGVKGKASNGSGIGLYFANEVIK
FT                   QYNSEIILENIENKAKVSFIVDISKMT"
FT                   /protein_id="YP_003470296.1"
FT   misc_feature    complement(15842..16795)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: BaeS; COG0642"
FT                   /db_xref="CDD:30987"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(16304..16447)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(16445..16447)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(order(16304..16306,16316..16318,16325..16327,
FT                   16337..16339,16346..16348,16358..16360,16409..16411,
FT                   16418..16420,16430..16432,16439..16441))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(15842..16111)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(order(15854..15856,15860..15862,15908..15919,
FT                   15983..15988,15992..15994,15998..16000,16004..16006,
FT                   16070..16072,16079..16081,16091..16093))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(16079..16081)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00021"
FT   misc_feature    complement(order(15911..15913,15917..15919,15986..15988,
FT                   15992..15994))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00021"
FT   gene            complement(16891..17556)
FT                   /db_xref="GeneID:8817728"
FT                   /locus_tag="SLGD_00022"
FT   CDS_pept        complement(16891..17556)
FT                   /locus_tag="SLGD_00022"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549393"
FT                   /db_xref="GeneID:8817728"
FT                   /translation="MYNIMIVDDEENIVSFIQESLKLEGFKTTVAYNGREALEKINEHI
FT                   HLIILDIKMPYSDGFEVAQSLSQSNIPIIFLTAKDNLDTRLKCFSLGAKDYIAKPFYME
FT                   ELIVRIENILTQNNSYSKNKNIKKTKDLIINYDTFSVYAGDHLLDITRTEFEIIKLLSL
FT                   NSNFYFSKDQIYDSINFNKIGNTQVVSEHIRKIRKKLHQYSDFEYIDTKWGVGYKWLE"
FT                   /protein_id="YP_003470297.1"
FT   misc_feature    complement(16900..17553)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(17215..17544)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(order(17257..17262,17269..17271,17326..17328,
FT                   17380..17382,17404..17406,17530..17535))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(17404..17406)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(order(17380..17388,17392..17397))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(17254..17262)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(16900..17148)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00022"
FT   misc_feature    complement(order(16909..16911,16924..16926,16957..16962,
FT                   16984..16986,16993..16995,17044..17049,17104..17106))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00022"
FT   gene            complement(17643..18254)
FT                   /db_xref="GeneID:8817729"
FT                   /locus_tag="SLGD_00023"
FT   CDS_pept        complement(17643..18254)
FT                   /locus_tag="SLGD_00023"
FT                   /gene_family="HOG000147918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549394"
FT                   /db_xref="GeneID:8817729"
FT                   /translation="MGKLLFLEIKTNLSKLYLGCVIFFICSLFMFGVGNLTHDRITQFI
FT                   ELIFTLLGIILFTTIYAIDNTRNTILIINSKRYHYRFLLLLRLFLTIVFTILLILIGLV
FT                   TFKICNSNVVFIQDIFIALTNTMFIGSLSLFISMISKNALIGYMFGLVYFLLCLGFKNM
FT                   SFMYLFSETFGFPFYFKLIQFSISILVSIITIYITKKVKI"
FT                   /protein_id="YP_003470298.1"
FT   gene            complement(18226..19341)
FT                   /db_xref="GeneID:8817730"
FT                   /locus_tag="SLGD_00024"
FT   CDS_pept        complement(18226..19341)
FT                   /locus_tag="SLGD_00024"
FT                   /gene_family="HOG000147919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549395"
FT                   /db_xref="GeneID:8817730"
FT                   /translation="MNLFLIEIKKLLFSKIFIFYCILVIFFVFVNCNQVIDKNINSDIY
FT                   QPKSMTTYTTNNKVIMKNAIDNLKKELHSNNFKVYQFGFLKQKKLNKDKLDKIKTSIKN
FT                   MENSKDFKRFKYYSNKVSHEIGWGSNYSEKNLYLFGTKQMSKEDFSMEKKMIKNKDIYF
FT                   GAYSRYLSDIAGVIIGILPFFLGAHIYLLDRKNHVFKTINSRNISSFKLILTRVLALII
FT                   LSFLPILLFSVYFLISLSVVHPISIKAIFIFYEILFMWTTPTLLVASILGLLITMIFNS
FT                   YLGSLIQIIIWFINLNIGSNYVEGHYGSLLIPRHNSLFNTSFFYNHLNDILINRISYCF
FT                   IAILLLLISVWLFDLKRKGLTRSGKITLLRN"
FT                   /protein_id="YP_003470299.1"
FT   gene            complement(19345..20220)
FT                   /db_xref="GeneID:8817731"
FT                   /locus_tag="SLGD_00025"
FT   CDS_pept        complement(19345..20220)
FT                   /locus_tag="SLGD_00025"
FT                   /codon_start="1"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549396"
FT                   /db_xref="GeneID:8817731"
FT                   /translation="MNNIVIKDVNKTYDGKTYALKNINLEINNGMFGILGRNGSGKSTL
FT                   MNMLSTILQQSSGTIEINNISLTQTKQIRKMIGYLPQDFDFYPNMKVKETLHYLGILSG
FT                   IPKANLKINVAASLEKVNLVEHQNKKVKSLSGGMKKRLGIAQAIIHNPQVLIVDEPTAG
FT                   LDPEERVRLRHLLSNLAKDKIVIISTHIVSDIESTCENIAILDKGVIAYKGSIKNLIEL
FT                   SDNKVYEITISPSKLNQLKKNNIFITKIQEYEHLLKVRFVSESNLEGTRKVKQDFEDAY
FT                   MYFLKMNQGG"
FT                   /protein_id="YP_003470300.1"
FT   misc_feature    complement(19360..20220)
FT                   /note="ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]; Region: CcmA; COG1131"
FT                   /db_xref="CDD:31326"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(19579..20211)
FT                   /note="ABC-type multidrug transport system, ATPase
FT                   component.  The biological function of this family is not
FT                   well characterized, but display ABC domains similar to
FT                   members of ABCA subfamily.  ABC transporters are a large
FT                   family of proteins involved in the...; Region:
FT                   ABC_drug_resistance_like; cd03264"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(20092..20115)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(order(19651..19653,19744..19749,19975..19977,
FT                   20089..20097,20101..20106))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(19975..19986)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(19792..19821)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(19744..19761)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(19726..19737)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   misc_feature    complement(19645..19665)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73023"
FT                   /locus_tag="SLGD_00025"
FT   gene            20725..21630
FT                   /db_xref="GeneID:8817732"
FT                   /locus_tag="SLGD_00026"
FT   CDS_pept        20725..21630
FT                   /locus_tag="SLGD_00026"
FT                   /gene_family="HOG000022412" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549397"
FT                   /db_xref="GeneID:8817732"
FT                   /translation="MKNIIYIENHYFVTAKDNSIKFRNIIDKTEKFYFFSDIEAIIFDH
FT                   YRSYFSHKLVIKCMQNNIAILFCDNKHSPMTQLLSEYGMSNRIQRIQTQFRFSGRSKER
FT                   VWKKIVVGKIINQARCVENNIDKSKSIVLKELAKEVKPGDNNNREAIAAKIYFRDLYGP
FT                   QFKRGRYNDIINSALNYGYSIIRSFIKRELAIHGFEMSLGIKHHSTENPFNLADDVIEV
FT                   FRPFVDNMVYNIVMKDGVKVFDTKEKKVLLNVLFEKCIIDKKIVRLLDSIKIMIDSLIR
FT                   CYKENTATYLLIPKMIEVGN"
FT                   /protein_id="YP_003470301.1"
FT   misc_feature    20728..21564
FT                   /note="CRISPR associated protein Cas1; Region: Cas_Cas1;
FT                   cl00656"
FT                   /db_xref="CDD:163892"
FT                   /locus_tag="SLGD_00026"
FT   gene            21630..21935
FT                   /db_xref="GeneID:8817733"
FT                   /locus_tag="SLGD_00027"
FT   CDS_pept        21630..21935
FT                   /locus_tag="SLGD_00027"
FT                   /gene_family="HOG000022401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549398"
FT                   /db_xref="GeneID:8817733"
FT                   /translation="MFLLISFDLPRDTKYERKIANKYRLRLLELGFSMKQFSLYERYTS
FT                   DTQKKDKILSILKEEMPNTGKITMYVLPDEVNNKQITILGKEAKIINYKEPKLIFI"
FT                   /protein_id="YP_003470302.1"
FT   misc_feature    21630..21929
FT                   /note="CRISPR associated protein Cas2; Region: CRISPR_Cas2;
FT                   cl11442"
FT                   /db_xref="CDD:164225"
FT                   /locus_tag="SLGD_00027"
FT   gene            21951..24224
FT                   /db_xref="GeneID:8817734"
FT                   /locus_tag="SLGD_00028"
FT   CDS_pept        21951..24224
FT                   /locus_tag="SLGD_00028"
FT                   /gene_family="HOG000220575" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative hydrolase of the HD superfamily
FT                   (permuted catalytic motifs)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549399"
FT                   /db_xref="GeneID:8817734"
FT                   /translation="MNKKTVLMYGSLLHDIGKIIYRSNDQPYAKGTHSELGYQFLSQFS
FT                   AFKNKELLDSLAYHHYKELSKANLSSDNTAYITYIADNIASGVDRRDVIEEGDSEYEKQ
FT                   TFNFDKFTPLYSIFNIVNSEKYKYTEGKYRFSKENNIEYPKNEDVRYTSGNYTNLIEDM
FT                   RYDLEHKIKVTEKNFPSLLQWTESLWQFIPSSTNKNQLIDISLYDHSRITCAIASCIFD
FT                   YLYENSIDNYKEELFLKYEKTKEFYQKQAFLLLSMDMSGIQEFIYNISGSKALKSLRSR
FT                   SFYLELMLEVIVDKLLERLKLTRANLLYTGGGHAYLLIANTDKTKTIIKDFISELKQWF
FT                   LSEFTTDLSLSIAYEACSGDDLMNSNGNYKSIWRNVSNKLSDSKAHKYSYEDILLLNSH
FT                   SSFGDRECKECLRSDIEINDDGLCSICEGIISISNDLRDKAFFVLSDNGKLKMPFNKYI
FT                   SVISYQEAENLVNRDDSVRIYSKNKPFVGEGIATNLWMCDYDYASNDKSLRAKGIGSYT
FT                   ERKEGIKRLGVVRADIDNLGATFISGIPESYNSISRTATLSRQLSLFFKYELNNLLENY
FT                   LITSIYSGGDDLFLIGAWDDIVEASVYVNEKFNEFTLGKLTMSAGVGMFSGKYPVSKMA
FT                   FETGLLEESAKKGEKNQIALWVEEKVYNWDKFKHNILEDKLVVLQQGFLKSDEHGKAFI
FT                   YKMLNLLRNNEVINIARLAYLLSRSEMSDEFSSKIFYWAQNEEDKEQLITALEYYVYQI
FT                   REAN"
FT                   /protein_id="YP_003470303.1"
FT   misc_feature    21951..22205
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="SLGD_00028"
FT   misc_feature    21969..23891
FT                   /note="CRISPR-associated protein, Csm1 family; Region:
FT                   cas_TM1811_Csm1; TIGR02578"
FT                   /db_xref="CDD:162931"
FT                   /locus_tag="SLGD_00028"
FT   gene            24226..24651
FT                   /db_xref="GeneID:8817735"
FT                   /locus_tag="SLGD_00029"
FT   CDS_pept        24226..24651
FT                   /locus_tag="SLGD_00029"
FT                   /gene_family="HOG000137946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein"
FT                   /transl_table="11"
FT                   /note="TM1810 family"
FT                   /db_xref="GI:289549400"
FT                   /db_xref="GeneID:8817735"
FT                   /translation="MILAKTKSGKIIDLNFAHEVVKNNLKMEKDKRGKEELKLFSGLTT
FT                   SKLRNLMEQVNRLYTMIFNSTEEKLSRNFIDELEYLKIKFYYEAGREKSVDEFLKKTLM
FT                   FPIIDKVIQKESKKFFLDYCKYFEALVAYSKYYQKED"
FT                   /protein_id="YP_003470304.1"
FT   misc_feature    24352..24642
FT                   /note="Protein of unknown function (DUF310); Region:
FT                   DUF310; cl00622"
FT                   /db_xref="CDD:163886"
FT                   /locus_tag="SLGD_00029"
FT   gene            24653..25297
FT                   /db_xref="GeneID:8817736"
FT                   /locus_tag="SLGD_00030"
FT   CDS_pept        24653..25297
FT                   /locus_tag="SLGD_00030"
FT                   /gene_family="HOG000012840" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA repair protein, RAMP superfamily"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549401"
FT                   /db_xref="GeneID:8817736"
FT                   /translation="MYSKIKVTGTIEIITGLHIGGSGEISMIGAIDSPVVRDLLTKLPI
FT                   IPGSSIKGKMRSLLARDFGLKLNQDNHNQDDDRVLRLFGSSEKGNIQRARLQISDAFYS
FT                   DKTKQIFTDNDISFTETKFENTINRLTAVANPRQIERVTRGAEFDFTFIYNVIDETQVE
FT                   DDFNNIKKAILLLENDYLGGGGTRGNGRIEFKDINIETVVGEYDSTNIKIK"
FT                   /protein_id="YP_003470305.1"
FT   misc_feature    24656..25234
FT                   /note="RAMP superfamily; Region: RAMPs; cl00592"
FT                   /db_xref="CDD:163882"
FT                   /locus_tag="SLGD_00030"
FT   gene            25308..26216
FT                   /db_xref="GeneID:8817737"
FT                   /locus_tag="SLGD_00031"
FT   CDS_pept        25308..26216
FT                   /locus_tag="SLGD_00031"
FT                   /gene_family="HOG000220573" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549402"
FT                   /db_xref="GeneID:8817737"
FT                   /translation="MITKIFKLSFKTPVHFGKKRLSDGEMTIKADTLFSALYTETLNLG
FT                   KQTNWLMNDLIISDTFPYESELYYLPKPLIKIESNSEGNHKDFKKLKYVPVYNYNDYIK
FT                   GQLSEEDVRDLNDIFRVGQFSLQTKVSLKAQEQSPNEDSEPYSVGTFSFEKDAGLYFIA
FT                   KGSERTIQRLNEVMYALQFSGIGGKRSAGYGRFEYTCVSNENISNLLNQDGDNFILLST
FT                   SMAKREELEASLNKARYILSKRTGFIQSTTYSDRLVKKNDFYSFSVGSVFKTIFKGDIF
FT                   NVGNQGQHPVYRYAKPLWMEV"
FT                   /protein_id="YP_003470306.1"
FT   misc_feature    25320..26201
FT                   /note="RAMP superfamily; Region: RAMPs; cl00592"
FT                   /db_xref="CDD:163882"
FT                   /locus_tag="SLGD_00031"
FT   gene            26220..27230
FT                   /db_xref="GeneID:8817738"
FT                   /locus_tag="SLGD_00032"
FT   CDS_pept        26220..27230
FT                   /locus_tag="SLGD_00032"
FT                   /gene_family="HOG000137947" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein, Csm5 family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549403"
FT                   /db_xref="GeneID:8817738"
FT                   /translation="MTIKTFDAIIQTIGPIHIGSGQVLKKQDYIYDFHKSKVHMINGNQ
FT                   LVKVLKRKNLLNMYQEFLRYPPKNPRENGLKNFLEAHKITQSEWKEFISYSESVNQGKK
FT                   YGNIKPKPLNDLHLMIRDGQNKVYIPGSSIKGAIKTALVSKYDNENDKSVFSRIKISDS
FT                   EPVDESNLAIYQKIDINKDEKPMPLYRECIDVNTQIKFKITIEDNQYSIEDIENCIQDF
FT                   YKNYYNQWLSRFKNTRGGQKFILEGGMPEVKGQNILYLGGGVGFSSKTTHYQTKSHEQA
FT                   KHDTFEILRKRFRGTYGKMKRIPQNVSVALKGTLNYSKNQSYQQGMCQITFKKND"
FT                   /protein_id="YP_003470307.1"
FT   misc_feature    26247..27029
FT                   /note="RAMP superfamily; Region: RAMPs; cl00592"
FT                   /db_xref="CDD:163882"
FT                   /locus_tag="SLGD_00032"
FT   gene            27244..27921
FT                   /db_xref="GeneID:8817739"
FT                   /locus_tag="SLGD_00033"
FT   CDS_pept        27244..27921
FT                   /locus_tag="SLGD_00033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Csm6"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549404"
FT                   /db_xref="GeneID:8817739"
FT                   /translation="MKVLFSPIGNTDPWSNERDGAMLHIVRHYRPEKVILFFTESIWFG
FT                   NENIPGRKQFEWEKIVSKVSPQTSVEIKVENIEHEHDFDSYKDLFSYFIKGIRMSNPES
FT                   EILLNVTSGTPQMESTLCLEYISNPNNAQCIQVSAPQPSNNTKRLYANPNNAFKDLEKV
FT                   NQNEHLADNRCKSINILSFREVMVRSQVRGLIDNYDYEGALNLISAQKSFRNGKVLQKN
FT                   CVI"
FT                   /protein_id="YP_003470308.1"
FT   misc_feature    27424..>27900
FT                   /note="CRISPR-associated protein (Cas_Csm6); Region:
FT                   Cas_Csm6; cl09873"
FT                   /db_xref="CDD:158748"
FT                   /locus_tag="SLGD_00033"
FT   gene            28190..28528
FT                   /db_xref="GeneID:8817740"
FT                   /locus_tag="SLGD_00034"
FT   CDS_pept        28190..28528
FT                   /locus_tag="SLGD_00034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549405"
FT                   /db_xref="GeneID:8817740"
FT                   /translation="MHLQKRIKKEDIINIDVSKNTLGLPAFIDILSLLQPKSKLLKEVR
FT                   PVNDINRLRNSVAHNLDMLNLDSNKNYKKIELAVKAIQNMLITTFSEIEEEDFEYLTEK
FT                   NKELKGLL"
FT                   /protein_id="YP_003470309.1"
FT   misc_feature    <28250..28522
FT                   /note="CRISPR-associated protein (Cas_Csm6); Region:
FT                   Cas_Csm6; cl09873"
FT                   /db_xref="CDD:158748"
FT                   /locus_tag="SLGD_00034"
FT   gene            28609..29277
FT                   /db_xref="GeneID:8817741"
FT                   /locus_tag="SLGD_00035"
FT   CDS_pept        28609..29277
FT                   /locus_tag="SLGD_00035"
FT                   /gene_family="HOG000137948" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549406"
FT                   /db_xref="GeneID:8817741"
FT                   /translation="MDYLSNDIASSLHHNFAYSPLKQRVFYFEDKKIWEIVSMSEELFN
FT                   ELVNLFNKENKIYLKHYKSTVSIEKYSVEKISIQKLIDTFLHKRDLSRYIKINVSTPMS
FT                   FKLNNQYMIFPNVKRFFRSIMIQFDAFFESHKLYDKETLEFLEQNVNIVNYKLKSVRFH
FT                   MEKVKIPSFKGEIVFKINGPLPFLQLVYFLLAFGEFSGTGIKTSLGMGKYNIVDKNQDN
FT                   "
FT                   /protein_id="YP_003470310.1"
FT   misc_feature    28909..29247
FT                   /note="CRISPR associated protein Cas6; Region: Cas_Cas6;
FT                   cl11443"
FT                   /db_xref="CDD:164226"
FT                   /locus_tag="SLGD_00035"
FT   gene            30123..30476
FT                   /db_xref="GeneID:8817742"
FT                   /locus_tag="SLGD_00036"
FT   CDS_pept        30123..30476
FT                   /locus_tag="SLGD_00036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549407"
FT                   /db_xref="GeneID:8817742"
FT                   /translation="MEEVLDLIINLVKLFIIVPYWLISVGVTAFFYFKLVVFIRNTFKA
FT                   FFDKYFYGEDSDSIPYAVGPYIMIITAMLIGLGIVMVIVLFFNALLGQNLYTLLFIVGV
FT                   ILLIIKFKRGYKN"
FT                   /protein_id="YP_003470311.1"
FT   gene            complement(30829..31455)
FT                   /db_xref="GeneID:8817743"
FT                   /locus_tag="SLGD_00037"
FT   CDS_pept        complement(30829..31455)
FT                   /locus_tag="SLGD_00037"
FT                   /gene_family="HOG000279728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549408"
FT                   /db_xref="GeneID:8817743"
FT                   /translation="MKLFITQMNHTYKDIAHWMSQSHRQLKKPERLTYRFSKDKWMHRI
FT                   GDLLIQYSIEHTHGLMPSQWSYDIQPNGHVKIASPIDIYVNLSYSFPYIICAIDHLPIG
FT                   ADIEEIKGMDDLNIAKQFSTNEFNQIQTLEDFYTIWTKKESYSKMIGEGLIRGLAYYDV
FT                   TKPLYYQHHTIKFKQHLIDNCIIQLCHISSNHPFEIVDVPLKQLF"
FT                   /protein_id="YP_003470312.1"
FT   misc_feature    complement(<30964..31407)
FT                   /note="Phosphopantetheinyl transferase [Coenzyme
FT                   metabolism]; Region: Sfp; COG2091"
FT                   /db_xref="CDD:32274"
FT                   /locus_tag="SLGD_00037"
FT   misc_feature    complement(31003..31149)
FT                   /note="4'-phosphopantetheinyl transferase superfamily;
FT                   Region: ACPS; cl00500"
FT                   /db_xref="CDD:174247"
FT                   /locus_tag="SLGD_00037"
FT   gene            complement(31452..38633)
FT                   /db_xref="GeneID:8817744"
FT                   /locus_tag="SLGD_00038"
FT   CDS_pept        complement(31452..38633)
FT                   /locus_tag="SLGD_00038"
FT                   /gene_family="HOG000279727" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="Related to non-ribosomal peptide and polyketide
FT                   synthesis"
FT                   /db_xref="GI:289549409"
FT                   /db_xref="GeneID:8817744"
FT                   /translation="MNKQLLNFQKYFYLKYLKQSSSTHRMTYWVKLDTRIDCHQLVYAL
FT                   LNVVQHQPVLRSQFNIDDSDDLCVSIREFFPFIELKAFDDYSKNIDIESFFQQKLNSYY
FT                   LNQLPQFNFTIYQFLDEAYLLLDFHSMIFNDNQLQIFLSELNKAYKHSLNQHAGISQFY
FT                   MTVQKINEKACNPNAPKDFNQFKVLHADNENYAYMPVKNVSDKKEMRYVRTQLSSFDIH
FT                   RLAVSTYLAHHFMSQSNEVALNIHFPVANKQSELLMVPNSNVSPVCLYIDQHASVDSLL
FT                   TAWTSAIHSLQNHGASFITEANADVMELESMFHVTPVVADFELHQVSHEVHRLYNNKSS
FT                   LANIEIYPLANGGFDLVYDANAYDDLTIQTLRRLITTIYMQSVNQPTMLVQEIQLNDQT
FT                   DLQLYERINSHSMTQLNGNDAYQTVMSRFEYQVNQHPDAIALQFEQQSMTYRQLNQQAN
FT                   YIAHLLRTTYGIQPNDTVALIMERSMEMIVAILGILKSGAGYLPIDPDYPQERTHYILK
FT                   DAMPKAIITYHITLQSDLPLIKMEEINWEECTYIDNLPHINTPEDTAYVIYTSGTTGKP
FT                   KGTVIAHRGIDRLVHQPNYVELNDDTVILLSGTIAFDAATFEIYGALLNGGRLIITSKD
FT                   TLLDSKQLGQTIADKQVNTMWLTSSLFNQIASERIEVLESLKYLLIGGEVLNAKWVNLL
FT                   NSRARHPQIINGYGPTENTTFTTTYAIPPKLPARIPIGSPINGTTVYVIQGQRLCGVGV
FT                   PGELCIGGSGLAKGYLNQPEQTQQSFVKSPLNGEAIYKSGDLVRLQEDGNIDYISRIDK
FT                   QVKIRGFRIELSEIEKAIEAIRDINKAVVVVHEHEQDRDKQIVAYYEASQPQSTSTLKK
FT                   LLSHTLPNYMIPVHFMKIDKIPITINGKLDTRALPDIDMIDESNYVAPRNELERVLCRI
FT                   FEEILHVDRVGIKDNFFELGGHSLRATLVVNRIEEQLQKRLKVGDIMKSPTVKALSQQL
FT                   KETQNEHYEVIPKASEDTQYELSAVQKSMYLLWSVNPKDTVYNIPFLWRLTSELNVNQL
FT                   QRSLSQLIQRHEILRTQYIIDHNEVKQRIAKDVIPDFEEVTTDLTDEQDIIHAYTHPFN
FT                   LEKPSQIRMKYIHSPEHHYLFIDTHHSINDGMSNTILLADLNALYQNKSLPQLSLQYRD
FT                   YSEWMAQRDLSTQRHYWLEQFEDGVPVLNMPTDYPRPSIKTTHGHMMTFHYDQTFKSQL
FT                   KSYVEQHQITDFMFFASAIMVLLHKYTRQDDLVIGSVISSRTHRDTENMLGMFANTLVY
FT                   RGQPSNDKPWEQFISEMKETSLAAYEQQEYPFESLVNDLVGDRDPSRNPLFDVMLVLQN
FT                   NETNHANFGHSRLTHIPPQSTTAKFDLSFIIEEDYNDYTVNIEYNTDLYSKATIQLMAQ
FT                   QLENIFKYVITTSNPKIKEIQEDPHILDWINTNVNCYTRDDTTHETVQQRFNRVVKQHS
FT                   EDVALRMNGQSMTYQTLDAYANQLAYELTVNGVQSGDRIALLTERSFEMIISMVAAIKV
FT                   GASYVPIDVAHPDKRIDYMIKDAQASAVITYGKDIHMNIPTIALETLELTNNNKRPFSE
FT                   YAGSLEDEIYCIYTSGTTGMPKGVSIQQSNILNLVNAWTDRLELSEHETIIQYSNYVFD
FT                   ASAMDIYSSLLNGHTLVIANKNERTNTELLEQLITKEAITVASIPLQVLNVMHQFYIPK
FT                   IITGGATSTPSFVQHISKHCDTYYNAYGPSESTVVTTTWSHAKGDPIPSTIPIGQPLAN
FT                   IQVYIVSEMQLCGIGIAGELCIAGDSLAAGYLNQPELNAQAFIDNPFGTGKLYRSGDLA
FT                   RFTPDGNIEFLGRIDKQVKVNGYRIELEEIENVINALDGVDDSVVIIRQQGGHDLLHAY
FT                   YVGNHDIASHLLKQLTQYLPKYMIPNTFTAIDEIPLTSNDKVDESKLPNPEMHHHQFEP
FT                   PRNDTEQIFASIMAEILDISEIGIDDDFFKLGGSSLDTMVLISKLKRKHIHLTMQDIYQ
FT                   YKTIRHLSAHLEQQSDESCVTLPDHLPQLQSLIKQRYQMRSKPMIVRHLGHVLLTGATG
FT                   FLGAYLINELTGYTDKITCVVRGQNKKDARQLVEENLSCYFDPAHVADLMIRVEVVLGE
FT                   FSNLDILNITSHIDTIIHAGARTDHFGDDEAFINVNVKSTEDLLTLAETHKARFIYIST
FT                   ISVGTVFDSHAEDYTFSEQDLYKGQLFTSPYTKSKFYSEIKVLEAIEAGLDAQIMRLGN
FT                   LTSAYTGKLNMKNLTTNRFSIVMNDLLKLPFIGDSFSQTEIEFSFIDITARDIVTLAIS
FT                   NATPIIYHVYSPHVLTMKNVLEETKDTDLPLINDEEFDKALHELNMHEVIGLNSQASNQ
FT                   ITGVTQSSMTQNLLRDLDEVWPKVTQHWLYQWRELLNEKFECKEYHR"
FT                   /protein_id="YP_003470313.1"
FT   misc_feature    complement(<38181..38609)
FT                   /note="Condensation domain; Region: Condensation; cl09290"
FT                   /db_xref="CDD:158480"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(36108..37337)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(36111..37289)
FT                   /note="amino acid adenylation domain; Region:
FT                   AA-adenyl-dom; TIGR01733"
FT                   /db_xref="CDD:162508"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(35667..35861)
FT                   /note="Phosphopantetheine attachment site; Region:
FT                   PP-binding; cl09936"
FT                   /db_xref="CDD:175050"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(34779..35609)
FT                   /note="Condensation domain; Region: Condensation; cl09290"
FT                   /db_xref="CDD:158480"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(33075..34982)
FT                   /note="Non-ribosomal peptide synthetase modules and related
FT                   proteins [Secondary metabolites biosynthesis, transport,
FT                   and catabolism]; Region: EntF; COG1020"
FT                   /db_xref="CDD:31223"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(33051..34259)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(32880..>33212)
FT                   /note="acetoacetyl-CoA synthase; Region: ac_ac_CoA_syn;
FT                   TIGR01217"
FT                   /db_xref="CDD:162256"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(32625..32816)
FT                   /note="Phosphopantetheine attachment site; Region:
FT                   PP-binding; cl09936"
FT                   /db_xref="CDD:175050"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(31500..32507)
FT                   /note="thioester reductase domain; Region: Thioester-redct;
FT                   TIGR01746"
FT                   /db_xref="CDD:162515"
FT                   /locus_tag="SLGD_00038"
FT   misc_feature    complement(31791..32498)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00038"
FT   gene            39003..39209
FT                   /db_xref="GeneID:8817745"
FT                   /locus_tag="SLGD_00039"
FT   CDS_pept        39003..39209
FT                   /locus_tag="SLGD_00039"
FT                   /gene_family="HOG000155854" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="staphylococcus tandem lipoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549410"
FT                   /db_xref="GeneID:8817745"
FT                   /translation="MKHLKRLSLSIVFLLLIFCISGCGSSQKENTKTESSKKEFSREAQ
FT                   IKQSFNKTLKLYPTKNLDDFYDK"
FT                   /protein_id="YP_003470314.1"
FT   misc_feature    39003..>39206
FT                   /note="Protein of unknown function, DUF576; Region: DUF576;
FT                   cl04553"
FT                   /db_xref="CDD:164060"
FT                   /locus_tag="SLGD_00039"
FT   gene            39270..39818
FT                   /db_xref="GeneID:8817746"
FT                   /locus_tag="SLGD_00040"
FT   CDS_pept        39270..39818
FT                   /locus_tag="SLGD_00040"
FT                   /gene_family="HOG000279704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549411"
FT                   /db_xref="GeneID:8817746"
FT                   /translation="MTIQHKDESLKSRGMTLYVNRNTRTTKGNFIVREITEDSKGYTHS
FT                   KDKKYPVKMEHNKIIPTKPIHDDKLKKEIENFKFFVQYGKFKDLNDYKGGDISYNPNVP
FT                   SYSAKYQLSNDDYNVQQLRKRYNIPTKQAPKLLLKGDGDLKGSSVGHKNLEFTFVENQE
FT                   ENIFFTDSINFKPTERDES"
FT                   /protein_id="YP_003470315.1"
FT   misc_feature    <39270..39803
FT                   /note="Protein of unknown function, DUF576; Region: DUF576;
FT                   cl04553"
FT                   /db_xref="CDD:164060"
FT                   /locus_tag="SLGD_00040"
FT   gene            40078..40863
FT                   /db_xref="GeneID:8817747"
FT                   /locus_tag="SLGD_00041"
FT   CDS_pept        40078..40863
FT                   /locus_tag="SLGD_00041"
FT                   /gene_family="HOG000279704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549412"
FT                   /db_xref="GeneID:8817747"
FT                   /translation="MRQSRKLKLGICLILLIILIGSCIILTKTNSRNAQIKKTFNQTLS
FT                   LYPTKNLEDFYDKEGFRDQEFDKGDKGTWIIHSEMVIEPKGRNMESRGMVLHVNRNTRT
FT                   TKGYFLISEITEDKKGYVHNKDKKYPVKMEHNKIIPIKPIPNDKLKKEIENFKFFVQYG
FT                   NFKDFKDYKNGDISYNPNVPSYSAKYLLNNDDYNVQQLRKRYNIPTKQAPELKLKGDGD
FT                   LKGSSIGSKDLEFTFVENKKENIFFTDSVQFTPSEVNKS"
FT                   /protein_id="YP_003470316.1"
FT   misc_feature    40156..40848
FT                   /note="Protein of unknown function, DUF576; Region: DUF576;
FT                   cl04553"
FT                   /db_xref="CDD:164060"
FT                   /locus_tag="SLGD_00041"
FT   gene            40954..41721
FT                   /db_xref="GeneID:8817748"
FT                   /locus_tag="SLGD_00042"
FT   CDS_pept        40954..41721
FT                   /locus_tag="SLGD_00042"
FT                   /gene_family="HOG000279704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549413"
FT                   /db_xref="GeneID:8817748"
FT                   /translation="MEHSKKLKLCASLFILVIFVGGCGSFNKEAQIKKSFNKTLSVYPT
FT                   KNLEDFYDKEGFRDQEFDKDDKGTWIIYSEMVIEPKGKNMESRGMVLYINRNTRTTKGN
FT                   FIVNEITEDSKGRPTNNKKKYPVKMEHNRIIPTKPIPNDKLKKEIENFKFFVQYGNFKD
FT                   FKDYKNGDISYNPNVPSYSAKYQLNNDDYNVKQLRKRYNIPTKQAPELKLQGDGDLKGS
FT                   SIGSKDLEFTFVENQEENIFFTDSIDFTPTEHS"
FT                   /protein_id="YP_003470317.1"
FT   misc_feature    40954..41712
FT                   /note="Protein of unknown function, DUF576; Region: DUF576;
FT                   cl04553"
FT                   /db_xref="CDD:164060"
FT                   /locus_tag="SLGD_00042"
FT   gene            41866..42576
FT                   /db_xref="GeneID:8817749"
FT                   /locus_tag="SLGD_00043"
FT   CDS_pept        41866..42576
FT                   /locus_tag="SLGD_00043"
FT                   /gene_family="HOG000279704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549414"
FT                   /db_xref="GeneID:8817749"
FT                   /translation="MTKINNRNAQIKESFNKTLSLYPTKNLEDFYDKEGFRDQEFEKGD
FT                   KGTWIVNSEMVIGPKGKNMESRGMVLYINRNTRTTKGYYFISETTYDNNGRPKDDEKRY
FT                   PVKMAHNKIIPTKRIPDDKLKKEIENFKFFVQYGNFKDFKDYKNGDISYNPNVPSYSAK
FT                   YLLSNDDYNVQQLRKRYNIPTKQAPELKLKGDGDLKGSSIGSKDLEFTFVENKKENIFF
FT                   TDSVQFTPSKDNKS"
FT                   /protein_id="YP_003470318.1"
FT   misc_feature    41866..42561
FT                   /note="Protein of unknown function, DUF576; Region: DUF576;
FT                   cl04553"
FT                   /db_xref="CDD:164060"
FT                   /locus_tag="SLGD_00043"
FT   gene            42913..43623
FT                   /db_xref="GeneID:8817750"
FT                   /locus_tag="SLGD_00044"
FT   CDS_pept        42913..43623
FT                   /locus_tag="SLGD_00044"
FT                   /gene_family="HOG000279704" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549415"
FT                   /db_xref="GeneID:8817750"
FT                   /translation="MTKTNSRNAQIKKTFNQTLRLYPTKNLEDFYDKEGFRDQEFEKGD
FT                   KGTWIIYSKMIIEPKGRNMESRGMVLHINRNTRTTRGNFIVNEITEDSKGRPLNNKKKY
FT                   PVKMEHNRIIPTKPIHDDKLKKEIENFKFFVQYGSFKDFKDYKNGDISYNPNVPSYSAK
FT                   YQLSNDDYNVQQLRKRYNIPTKQAPELKLKGDGDLKGSSIGSKDLEFTFVENQEENIYF
FT                   TDTVQFTPSEVDKT"
FT                   /protein_id="YP_003470319.1"
FT   misc_feature    42913..43608
FT                   /note="Protein of unknown function, DUF576; Region: DUF576;
FT                   cl04553"
FT                   /db_xref="CDD:164060"
FT                   /locus_tag="SLGD_00044"
FT   gene            43620..44945
FT                   /db_xref="GeneID:8817751"
FT                   /locus_tag="SLGD_00045"
FT   CDS_pept        43620..44945
FT                   /locus_tag="SLGD_00045"
FT                   /gene_family="HOG000279817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549416"
FT                   /db_xref="GeneID:8817751"
FT                   /translation="MNQTEYKIKPGNIKGNSEETSTVSKISYEIENANNSGLKRDKINE
FT                   QIEGLKEYDKFPGNLEYVDSYTDPKTGTTTSAFLNKETGKVTLGMTGTNLHKGAMLKQA
FT                   FGVASPQDYRDVYETLNDIRADINIGLHSVTDKDPHYKNTQDFIKGIKKDYDIDTITGH
FT                   SLGGRDAIILGTSNDIKHIVVYNPAPLAVKDVSILYDDGEELKKMIEKYDGHIVRFVSN
FT                   QDILDAGVRDLMYETAGEKIVIKNGEGHSMDGFLIKGTQAKILAELKRVKGYQDANNKS
FT                   FKSVRKQTRRRLDKVETLRANWIQTNGGALSSSQQQLLESLTALTIAQGLSQLVDEESQ
FT                   HLKKMYQSMAHKFGENWKKAQEAGNEIAEKLTFAEVIDELRAGGAYESKLETDPQRKID
FT                   NKLKKLNDVSKNCDDYIAKIKQSIHAIVEKDKALASQIGGIM"
FT                   /protein_id="YP_003470320.1"
FT   misc_feature    <43968..44294
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00045"
FT   misc_feature    44103..44117
FT                   /note="nucleophilic elbow; other site"
FT                   /db_xref="CDD:29806"
FT                   /locus_tag="SLGD_00045"
FT   misc_feature    44109..44111
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29806"
FT                   /locus_tag="SLGD_00045"
FT   gene            44945..45271
FT                   /db_xref="GeneID:8817752"
FT                   /locus_tag="SLGD_00046"
FT   CDS_pept        44945..45271
FT                   /locus_tag="SLGD_00046"
FT                   /gene_family="HOG000279818" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549417"
FT                   /db_xref="GeneID:8817752"
FT                   /translation="MFTEYKKLSDLENAFDVERKKLNDELNQLYELKHQTRRKCEQMYD
FT                   HFLYLKHKLNYSEAATIKMTRIIEAFDGEMNQRIRHQEMKLEDDKDTLRRDYLKQSARI
FT                   EGDE"
FT                   /protein_id="YP_003470321.1"
FT   gene            45274..45561
FT                   /db_xref="GeneID:8817753"
FT                   /locus_tag="SLGD_00047"
FT   CDS_pept        45274..45561
FT                   /locus_tag="SLGD_00047"
FT                   /gene_family="HOG000279819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549418"
FT                   /db_xref="GeneID:8817753"
FT                   /translation="MIRGSNAIPDLAVMGGMMEKEQIRTVIAPEHDRMHHDHQNKLKSD
FT                   EKILLDQMVSHFKKFEGEFKNAAQGDWVKSAMSELNDISDDLKHIQDIEV"
FT                   /protein_id="YP_003470322.1"
FT   gene            complement(45979..46941)
FT                   /db_xref="GeneID:8817754"
FT                   /locus_tag="SLGD_00048"
FT   CDS_pept        complement(45979..46941)
FT                   /product="L-lactate dehydrogenase"
FT                   /gene_family="HOG000213793" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00048"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="GI:289549419"
FT                   /db_xref="GeneID:8817754"
FT                   /translation="MKAFGKKVVLIGDGSVGSSYAFAMVTQSVADEFVIIDIATDKVNA
FT                   DVQDLNHGTAHCPSPVNISAGTYSDCKDADLVVITAGAPQKPGETRLQLVEKNAKIMKD
FT                   IVKSVMDSGFDGYFLIAANPVDILTRFIKEYTGLPAERVIGSGTVLDSARLQYLISREF
FT                   DVAPASVNASIIGEHGDSELAVWSQANIAGMPVFEALKEKTGSEAKAEEIYVNTRDAAY
FT                   EIIQAKGSTYYGIALALMRISKAILNNENNVLNVSTQLTGQYGGYRDVYVGVPTLVNQD
FT                   GAVKIYELPLDEKEKALFDQSVKTLEDIYNSIKYLLEDK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470323.1"
FT   misc_feature    complement(46003..46941)
FT                   /note="L-lactate dehydrogenase; Reviewed; Region: ldh;
FT                   PRK00066"
FT                   /db_xref="CDD:166760"
FT                   /locus_tag="SLGD_00048"
FT   misc_feature    complement(46006..46926)
FT                   /note="L-2-hydroxyisocapronate dehydrogenases and some
FT                   bacterial L-lactate dehydrogenases; Region: HicDH_like;
FT                   cd05291"
FT                   /db_xref="CDD:133427"
FT                   /locus_tag="SLGD_00048"
FT   misc_feature    complement(order(46075..46080,46102..46104,46183..46185,
FT                   46189..46203,46360..46365,46378..46380,46435..46437,
FT                   46444..46446,46450..46452,46762..46764,46849..46851,
FT                   46924..46926))
FT                   /note="tetramer (dimer of dimers) interface; other site"
FT                   /db_xref="CDD:133427"
FT                   /locus_tag="SLGD_00048"
FT   misc_feature    complement(order(46408..46410,46504..46506,46573..46581,
FT                   46693..46704,46828..46833,46894..46902))
FT                   /note="NAD binding site; other site"
FT                   /db_xref="CDD:133427"
FT                   /locus_tag="SLGD_00048"
FT   misc_feature    complement(order(46219..46221,46231..46233,46240..46248,
FT                   46258..46263,46438..46440,46474..46476,46480..46485,
FT                   46774..46779,46786..46800,46804..46806,46861..46866,
FT                   46876..46878,46885..46890))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133427"
FT                   /locus_tag="SLGD_00048"
FT   misc_feature    complement(order(46249..46251,46279..46281,46408..46410,
FT                   46480..46482,46573..46575,46669..46671))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:133427"
FT                   /locus_tag="SLGD_00048"
FT   gene            47653..48366
FT                   /db_xref="GeneID:8817755"
FT                   /locus_tag="SLGD_00049"
FT   CDS_pept        47653..48366
FT                   /locus_tag="SLGD_00049"
FT                   /gene_family="HOG000228717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted transcriptional regulator of
FT                   N-Acetylglucosamine utilization, GntR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549420"
FT                   /db_xref="GeneID:8817755"
FT                   /translation="MKKANTPLYFQIYETLHKGIKSGLYQEGDKLPSERKLCEEYNVSR
FT                   ITVREALDRLEKDHLIKREHGKGSFVLGSQYTQLLNKLYSFKDEIEKNGDDASTKMLNI
FT                   ELKVSTPFLQEKMNLEPYQYVYELTRLRLSNGKPLIYEVSYLPLRFCEGLERFDFNNVS
FT                   LYETLNQHYNIQITNAYENLVASKLNKKYAALLNGEVDDSCMYIERFSYYGDVLIEYTQ
FT                   SIASGHKYKYKVKLM"
FT                   /protein_id="YP_003470324.1"
FT   misc_feature    47653..48360
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PhnF; COG2188"
FT                   /db_xref="CDD:32371"
FT                   /locus_tag="SLGD_00049"
FT   misc_feature    47671..47865
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="SLGD_00049"
FT   misc_feature    order(47671..47673,47677..47679,47746..47748,47752..47757,
FT                   47779..47793,47797..47802,47809..47811,47839..47844,
FT                   47848..47859)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="SLGD_00049"
FT   misc_feature    47932..48345
FT                   /note="UTRA domain; Region: UTRA; cl06649"
FT                   /db_xref="CDD:176600"
FT                   /locus_tag="SLGD_00049"
FT   gene            48395..49513
FT                   /db_xref="GeneID:8817756"
FT                   /locus_tag="SLGD_00050"
FT   CDS_pept        48395..49513
FT                   /locus_tag="SLGD_00050"
FT                   /gene_family="HOG000272306" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted galactosamine-6-phosphate isomerase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549421"
FT                   /db_xref="GeneID:8817756"
FT                   /translation="MLNETYTYQEIKQQPDMWRRTADIVAQKQDAFETFMHHMISNNKD
FT                   KKLKVIFTGAGSSAYVGDIARMACATEKFTQFDFESVPTTHFVTSPEVYIDDATAYLIV
FT                   SFARSGNSPETKATVEIANQLTDNAYHLFITNNKDGFLGTVEESERIFKIVLPDETNDQ
FT                   SLAMTSSFSSMLFAIYILFGGKYNASFFDKAKENFEWIEAQVDQVSMLDFSKVFYVGTG
FT                   LIGELTKEISLKMNELTAGRVEIARETTLGFRHGPKAGLSDNAIFIMLRSNQPYKRQYE
FT                   QDIIAEVNQVKGKYHILTLESQLTDETHAITLPNSTELTDLELALEYLMFGQLLAAKKS
FT                   VAFGLNPDNPSPDGFINRVVKGVTIYPVQASH"
FT                   /protein_id="YP_003470325.1"
FT   misc_feature    48401..49495
FT                   /note="putative sugar isomerase, AgaS family; Region:
FT                   agaS_fam; TIGR02815"
FT                   /db_xref="CDD:131862"
FT                   /locus_tag="SLGD_00050"
FT   misc_feature    48539..48934
FT                   /note="SIS (Sugar ISomerase) domain repeat 1 found in
FT                   Glucosamine 6-phosphate synthase (GlmS) and
FT                   Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is
FT                   found in many phosphosugar isomerases and phosphosugar
FT                   binding proteins. GlmS contains a N-terminal...; Region:
FT                   SIS_GlmS_GlmD_1; cd05008"
FT                   /db_xref="CDD:88405"
FT                   /locus_tag="SLGD_00050"
FT   misc_feature    order(48557..48562,48590..48595,48608..48613,48632..48634,
FT                   48638..48640,48650..48652,48659..48661,48734..48736)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88405"
FT                   /locus_tag="SLGD_00050"
FT   misc_feature    order(48563..48568,48713..48721)
FT                   /note="active site"
FT                   /db_xref="CDD:88405"
FT                   /locus_tag="SLGD_00050"
FT   misc_feature    49040..49483
FT                   /note="SIS domain. SIS (Sugar ISomerase) domains are found
FT                   in many phosphosugar isomerases and phosphosugar binding
FT                   proteins. SIS domains are also found in proteins that
FT                   regulate the expression of genes involved in synthesis of
FT                   phosphosugars; Region: SIS; cl00389"
FT                   /db_xref="CDD:174166"
FT                   /locus_tag="SLGD_00050"
FT   gene            49997..50929
FT                   /db_xref="GeneID:8817757"
FT                   /locus_tag="SLGD_00051"
FT   CDS_pept        49997..50929
FT                   /product="Tagatose 1,6-diphosphate aldolase"
FT                   /gene_family="HOG000241518" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00051"
FT                   /EC_number="4.1.2.40"
FT                   /db_xref="GI:289549422"
FT                   /db_xref="GeneID:8817757"
FT                   /translation="MTVKNLSRLVDKNGIYSAVAVDQRGALKKLLGKQGTAQNLASFKK
FT                   LVAEVLTPESSSFLVDPEFGLEAAKANVAGLILAYEQTGYIKDQPGRLPRLIEGQSVKR
FT                   LVEAGADAIKFLLYYDVDEPDEINQKKQAVIERVGAECKAEHVPFLLEILTYDDQIGDE
FT                   KGDAFALVKPHKVNSAMKLFSEARFGVDTLKVELPVNMNFVQGYGHEGCMTQQEAAEAF
FT                   KAQANSTHIPYIYLSAGMDSQLFNKSLQFAAENGSTFNGVLCGRATWQGATEVLAKDGE
FT                   AAAREWLQTEGIKNLKALNQVNQQTATPI"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470326.1"
FT   misc_feature    50006..50923
FT                   /note="TIM barrel proteins share a structurally conserved
FT                   phosphate binding motif and in general share an eight
FT                   beta/alpha closed barrel structure. Specific for this
FT                   family is the conserved phosphate binding site at the edges
FT                   of strands 7 and 8. The phosphate...; Region:
FT                   TIM_phosphate_binding; cl09108"
FT                   /db_xref="CDD:176427"
FT                   /locus_tag="SLGD_00051"
FT   gene            51129..51608
FT                   /db_xref="GeneID:8817758"
FT                   /locus_tag="SLGD_00052"
FT   CDS_pept        51129..51608
FT                   /product="Predicted PTS system, galactosamine-specific IIB
FT                   /gene_family="HOG000096437" [ FAMILY / ALN / TREE ]
FT                   component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00052"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549423"
FT                   /db_xref="GeneID:8817758"
FT                   /translation="MAIIANRIDGRLIHGQVANLWATKLNVGRFMIIDDEIAQSDIDKQ
FT                   ALKLATPAGIKLSVLPIEKAATNIKNGKYDSQRVMIIAKRPDRFVELVNQGVQIDNLNV
FT                   GNMSQTNETRSITNSINVMDEDVENFEKLQSAGVTITSQMVPNDKAVDFMSLIKA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470327.1"
FT   misc_feature    51135..51587
FT                   /note="Mannose/sorbose specific IIB subunit. The bacterial
FT                   phosphoenolpyruvate: sugar phosphotransferase system (PTS)
FT                   is a multi-protein system involved in the regulation of a
FT                   variety of metabolic and transcriptional processes. This
FT                   family is one of four...; Region: PTS_IIB_man; cd00001"
FT                   /db_xref="CDD:28885"
FT                   /locus_tag="SLGD_00052"
FT   misc_feature    order(51147..51149,51159..51161,51168..51170)
FT                   /note="active site"
FT                   /db_xref="CDD:28885"
FT                   /locus_tag="SLGD_00052"
FT   misc_feature    51168..51170
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:28885"
FT                   /locus_tag="SLGD_00052"
FT   gene            51628..52527
FT                   /db_xref="GeneID:8817759"
FT                   /locus_tag="SLGD_00053"
FT   CDS_pept        51628..52527
FT                   /locus_tag="SLGD_00053"
FT                   /gene_family="HOG000097553" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PTS system, IIC component"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549424"
FT                   /db_xref="GeneID:8817759"
FT                   /translation="MEIMWWQILLLTLYAGYQILDDLQFNIFGHPVFAGIVSGLIMGDI
FT                   KTGLIIGGGMQLTVLGVGTFGGASRIDANSGTVLAVAYSVALGMNPQQALATLAVPVAS
FT                   LMIQTDVLARFTNTFFAHRIDAKIEQMDYKGIQRNYLYGAIPWALSRAIPVFLGLFFGG
FT                   GVVKNIVNYLNGDLKWLGDGLTVAGAVLPAVGFAILLRYLPLKKHYPYFILGFIITALM
FT                   VTVFDGLSGIGTSVAHLDDKFTMSFSSLPMLAIAAIGFALASLEYKRTSTLTAMSSASG
FT                   KQDLNHADDEGEIDDDEL"
FT                   /protein_id="YP_003470328.1"
FT   misc_feature    51628..52416
FT                   /note="PTS system sorbose-specific iic component; Region:
FT                   EII-Sor; cl01506"
FT                   /db_xref="CDD:174637"
FT                   /locus_tag="SLGD_00053"
FT   gene            52514..53404
FT                   /db_xref="GeneID:8817760"
FT                   /locus_tag="SLGD_00054"
FT   CDS_pept        52514..53404
FT                   /locus_tag="SLGD_00054"
FT                   /gene_family="HOG000098669" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PTS system, IID component"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549425"
FT                   /db_xref="GeneID:8817760"
FT                   /translation="MTNFNHKKQDTSKTHVHKDAKPLTGKSPETPYKLTNKDFRQINMR
FT                   SLFFYQWGWNYERMQGSGYLFTILPQLRKIYGDDTPELKEMMKTHAQFFNTSNFFNTII
FT                   TGIDIAMEEKEQFAAKESVEGFKVGLMGPFAAVGDAIFASLVPTIFGAIAANMAQDGNP
FT                   FGALLWFIAILAVIVFRWKQLKFAYKEGVALVTTMQHRLESLTNAATLLGVFMVGALVA
FT                   TMIRVQFAWKPKIGDLTVNIQDSANMILPRLLPLVIVFLIYWLLGRKKMNSTRAIFLVI
FT                   IVSIILSALGVIKNI"
FT                   /protein_id="YP_003470329.1"
FT   misc_feature    52607..53338
FT                   /note="PTS system mannose/fructose/sorbose family IID
FT                   component; Region: EIID-AGA; cl01507"
FT                   /db_xref="CDD:174638"
FT                   /locus_tag="SLGD_00054"
FT   gene            53422..53817
FT                   /db_xref="GeneID:8817761"
FT                   /locus_tag="SLGD_00055"
FT   CDS_pept        53422..53817
FT                   /product="Predicted PTS system, galactosamine-specific IIA
FT                   /gene_family="HOG000095324" [ FAMILY / ALN / TREE ]
FT                   component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00055"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549426"
FT                   /db_xref="GeneID:8817761"
FT                   /translation="MKKLILISHGSFCEGIKNSVEMIFGAQDYIHTVALTPEQGQETFE
FT                   KNFKALIEDDDDVVVFADLQGGTPANTVSKLIMQGAKYQLYTGMNLPMIIAYINAQMIG
FT                   QPADIAQKAKDGIIDVNALLAHDDDEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470330.1"
FT   misc_feature    53425..53766
FT                   /note="PTS_IIA, PTS system, mannose/sorbose specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_man;
FT                   cd00006"
FT                   /db_xref="CDD:28890"
FT                   /locus_tag="SLGD_00055"
FT   misc_feature    order(53446..53448,53488..53493,53524..53526,53623..53625,
FT                   53716..53718)
FT                   /note="active pocket/dimerization site; other site"
FT                   /db_xref="CDD:28890"
FT                   /locus_tag="SLGD_00055"
FT   misc_feature    order(53446..53448,53608..53610,53623..53625)
FT                   /note="active site"
FT                   /db_xref="CDD:28890"
FT                   /locus_tag="SLGD_00055"
FT   misc_feature    53446..53448
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:28890"
FT                   /locus_tag="SLGD_00055"
FT   gene            complement(53985..54683)
FT                   /db_xref="GeneID:8817762"
FT                   /locus_tag="SLGD_00056"
FT   CDS_pept        complement(53985..54683)
FT                   /locus_tag="SLGD_00056"
FT                   /gene_family="HOG000034815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding response regulator KdpE"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549427"
FT                   /db_xref="GeneID:8817762"
FT                   /translation="MKSTLLVVEDDAAILHLIDVTLTMNYYKVITARNGKDAAFRIRTE
FT                   HPDVILLDLGLPDIDGFTLIKQIRTDIDTPIIVISARTEEQTIVNALDCGANDYMIKPF
FT                   NVDELQARIRVALRVSKKTTTEENNFKNGPLTVDFNAKMVYINDQPIHLTPNEFQLLKI
FT                   LSHHVGKVLTYQVLLKSIFGYVNKCEMASLRVHMASLRKKLNYSEDDAHMDKKLIITHP
FT                   RIGYQMQHLV"
FT                   /protein_id="YP_003470331.1"
FT   misc_feature    complement(53994..54671)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(54333..54668)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(order(54375..54380,54387..54389,54444..54446,
FT                   54501..54503,54525..54527,54654..54659))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(54525..54527)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(order(54501..54509,54513..54518))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(54372..54380)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(54000..54296)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00056"
FT   misc_feature    complement(order(54009..54011,54024..54026,54072..54077,
FT                   54099..54101,54108..54110,54162..54167,54222..54224))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00056"
FT   gene            complement(54688..57342)
FT                   /db_xref="GeneID:8817763"
FT                   /locus_tag="SLGD_00057"
FT   CDS_pept        complement(54688..57342)
FT                   /locus_tag="SLGD_00057"
FT                   /gene_family="HOG000082933" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Osmosensitive K+ channel histidine kinase KdpD"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549428"
FT                   /db_xref="GeneID:8817763"
FT                   /translation="MESSYKKRGTLTIYLGYSPGVGKTYEMLSNGIDQYKEGVDVKIGY
FT                   IEPHQRPETNALAKQLPEITTSSHKFGSHMFQFINVERIIEAQPDIVLIDELAHTNISK
FT                   NRHLKRYMDIEEILSHGIDVWTTLNIQHIESLSGQIELMTGIQVTERVPDQFIMSADAF
FT                   EVVDISPNMLIQRLKAGKVYKKERLETAFSNFFSYENLTRLRELALRTVADIMSQKEQQ
FT                   CNTKHTDITPHIAVAVSGSIYNERVIREARRSAYKEHAKFTAIYIDTFETPSESKIQDH
FT                   YVHKNLMLAKSLGAEIKVLYAQDVAKALTDWCDSAFVTKLVLGQSENPKWKHYFKKSLI
FT                   EEINHAPHYFKLEIVPIYYINSNKQERTQSMNKPSYQIALSVDIMKMLIIQTFCVLLGM
FT                   WIYTIDKNESSAIILLLFFIGIILLSIWTQSYLIGFFTSILNVFIFNYFFTVPRFTLEM
FT                   YRFEYPITFVISIFASIFTSAILKNLKYQHSLTERQLYRTDIMLQFNQSIKESYSIMKL
FT                   LNIAGEQIHQLLHQNVTVFLVESKKVVKSSSFGHPSFKNTKNMEDVEDAETLTWVIENE
FT                   HRAGRLTDTFPGSKYLCIPIGSNPVKGIVSIQFDDKDYIDMYDNSILDSMLNDLMLAIE
FT                   NVYLLKQTRQSMLTAEREATRSNFLHSISHDIRTPLTSIIGNLDVLKFHSKSLDNAEKL
FT                   KLLTASYKEAQYLYTLVTNILSLTKLESSDIKVKRTAYLIEELLEEFEQGLIRRHQNQK
FT                   VTIETEDTMAFVHIDSKLILQVLFNLVDNALKHSGTTSEIKLCIHLQPSRVRFEMIDFG
FT                   KGIPEEERHLIYKPYYSGDYFKDNKKDSLGLGLYLVQLILKQHDSQLEYQPNHPHGSIF
FT                   YFYLDIDQIDMKG"
FT                   /protein_id="YP_003470332.1"
FT   misc_feature    complement(54691..57327)
FT                   /note="Osmosensitive K+ channel histidine kinase [Signal
FT                   transduction mechanisms]; Region: KdpD; COG2205"
FT                   /db_xref="CDD:32387"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(56701..57327)
FT                   /note="Osmosensitive K+ channel His kinase sensor domain;
FT                   Region: KdpD; pfam02702"
FT                   /db_xref="CDD:145711"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(56275..56646)
FT                   /note="USP domain is located between the N-terminal sensor
FT                   domain and C-terminal catalytic domain of this
FT                   Osmosensitive K+ channel histidine kinase family. The
FT                   family of KdpD sensor kinase proteins regulates the kdpFABC
FT                   operon responsible for potassium...; Region: USP_OKCHK;
FT                   cd01987"
FT                   /db_xref="CDD:30174"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(order(56323..56334,56362..56367,56371..56376,
FT                   56542..56544,56626..56634))
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:30174"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(55186..55386)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(order(55201..55203,55213..55215,55222..55224,
FT                   55234..55236,55243..55245,55255..55257,55312..55314,
FT                   55321..55323,55333..55335,55342..55344,55354..55356,
FT                   55366..55368))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(55348..55350)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(54718..55029)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(order(54730..54732,54736..54741,54754..54756,
FT                   54760..54762,54808..54819,54898..54903,54907..54909,
FT                   54913..54915,54919..54921,54988..54990,54997..54999,
FT                   55009..55011))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(54997..54999)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00057"
FT   misc_feature    complement(order(54811..54813,54817..54819,54901..54903,
FT                   54907..54909))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00057"
FT   gene            57610..59286
FT                   /db_xref="GeneID:8817764"
FT                   /locus_tag="SLGD_00058"
FT   CDS_pept        57610..59286
FT                   /locus_tag="SLGD_00058"
FT                   /gene_family="HOG000244102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Potassium-transporting ATPase A chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="TC 3.A.3.7.1"
FT                   /db_xref="GI:289549429"
FT                   /db_xref="GeneID:8817764"
FT                   /translation="MSIILFLMIFIALTYIVSRYLYLVALIVPSKIDILFNPIEKVIYR
FT                   LINTKLEHMSGKTYLKHFFWFNGITGIVALILLLTQQWLWINPNHNLNQSISLAFNTMA
FT                   SFITNTNLQHYSGETGLSYLTQMTVITFLMFTSAASGYAVCIAMLRRLTGMTDVIGNFY
FT                   QDIIRFIVRVLIPFSFIISLFLISQGTPQTFKGNLVIETLSGVKQTIAYGPIASMEAIK
FT                   HLGTNGGGFLGANASTPFENPNYWTNFVEALSMMLIPGALVFLYGRMLKNKKQVHPHAV
FT                   MIFVAMFVLFIACLVMCLHFEFSGNPVLQHLGITGGNMEGKETRFGVGLSALFTTITTA
FT                   FTTGSVNNMHDSLTPLGGLVPLLLMMLNAVFGGEGVGLMNMLIYVMLTVFMCSLMIGKT
FT                   PSYLGMKIEGKEMKLIALSFLIHPLLILFFSALAFIVPGATDAITNPQFHGVSQVLYEF
FT                   SSSSANNGSGFEGLKDNTTFWNISTGIVMLLARYIPIILQLSIVSSLVNKKTYQNLTED
FT                   VPINNLFFSSVLIIFIILLSGLTFLPDLMLGPIGEHLLLHS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470333.1"
FT   misc_feature    57610..59277
FT                   /note="Potassium-transporting ATPase A subunit; Region:
FT                   KdpA; pfam03814"
FT                   /db_xref="CDD:112618"
FT                   /locus_tag="SLGD_00058"
FT   misc_feature    57616..59280
FT                   /note="K+-transporting ATPase, A chain [Inorganic ion
FT                   transport and metabolism]; Region: KdpA; cl00903"
FT                   /db_xref="CDD:176588"
FT                   /locus_tag="SLGD_00058"
FT   gene            59304..61325
FT                   /db_xref="GeneID:8817765"
FT                   /locus_tag="SLGD_00059"
FT   CDS_pept        59304..61325
FT                   /locus_tag="SLGD_00059"
FT                   /gene_family="HOG000244113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Potassium-transporting ATPase B chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="TC 3.A.3.7.1"
FT                   /db_xref="GI:289549430"
FT                   /db_xref="GeneID:8817765"
FT                   /translation="MIETKKIFESSLVKQALKESIIKLNPVCMVKNPIMFVVEVGMMLS
FT                   LILTMAPNLFSYENVSRTYLFSIFFILLLTLIFANFSEALAEGRGKAQAKALRQTQTEM
FT                   TARRIKSDGSYEIIDASQLKKGDIVRVETGEQIPNDGQVINGLATVDESAITGESAPVI
FT                   KESGGDFNNVIGGTSVASDWLEVEITSNPGQSFLDKMIYLVENATRKKTPNEIALFTLL
FT                   MTLTIVFLAVILTMYPLATFLHFNLSIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQ
FT                   FNILAKSGRSVETCGDVNVLILDKTGTITYGNRMASEFIPVASTQFERLVKASYECSVE
FT                   DDTPEGSSIVKLARQQHIDLPTDRGEYFPFTAETRMSGVKFSNREVYKGAPNSMIKRVK
FT                   EAGGHIPDDLDTYVNEVSKKGGTPLVVIENNVILGVIYLKDVIKEGLVARFQELRAMGI
FT                   ETVMCTGDNQLTAATIAKEAGVDRFVAECKPEDKINVIKEEQAKGHIVAMTGDGTNDAP
FT                   ALAVANVGLAMNSGTMSAKEAANLIDLDSNPTKLMEVVLIGRQLLMTRGALTTFSIAND
FT                   VAKYFAILPAMFMSAMPAMNHLNMMHLHSPESAVLSALIFNALIIVLLIPIAMKGVKFK
FT                   GVSTQMILIKNILIYGIGGMIVPFIGIKLIDLIIQFIV"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470334.1"
FT   misc_feature    59319..61319
FT                   /note="potassium-transporting ATPase subunit B;
FT                   Provisional; Region: PRK01122"
FT                   /db_xref="CDD:167162"
FT                   /locus_tag="SLGD_00059"
FT   misc_feature    59550..60185
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="SLGD_00059"
FT   misc_feature    <60654..60956
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="SLGD_00059"
FT   gene            61342..61905
FT                   /db_xref="GeneID:8817766"
FT                   /locus_tag="SLGD_00060"
FT   CDS_pept        61342..61905
FT                   /locus_tag="SLGD_00060"
FT                   /gene_family="HOG000244124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="TC 3.A.3.7.1"
FT                   /db_xref="GI:289549431"
FT                   /db_xref="GeneID:8817766"
FT                   /translation="MIQAIRKSTRLVIVMLILCGLLFPLTVTAVGQIIFPHQANGSLIT
FT                   KNGKVVGSELIGQQWESRKYFHGRISAVNYNMNNQEVNSNGGPASGGSNFGNSNPKLKQ
FT                   RVKEMIQQEGKARSVDAVTASASGLDPDITVKNAEQQAQRIAKARDIDVSKVNHVIVEN
FT                   KKSLPMADDYVNVLKMNIALDKLK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470335.1"
FT   misc_feature    61345..61899
FT                   /note="K+-transporting ATPase, c chain; Region: KdpC;
FT                   cl00944"
FT                   /db_xref="CDD:174473"
FT                   /locus_tag="SLGD_00060"
FT   gene            complement(62212..64284)
FT                   /db_xref="GeneID:8817767"
FT                   /locus_tag="SLGD_00061"
FT   CDS_pept        complement(62212..64284)
FT                   /locus_tag="SLGD_00061"
FT                   /gene_family="HOG000280077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549432"
FT                   /db_xref="GeneID:8817767"
FT                   /translation="MKNNHENNNARPNQHFSIRKFSIGAASITLGTCLFLNAEHQAQAA
FT                   ENAVEPAHSAVASENNTPAQSKPVAPTVETNEQPNADHTDKTVATTTTNDKSRAQANDK
FT                   QTVTPATNVSNTTQPKAAPASTALTTNAVNPKSSTAVSNPAKQAVDQSIKDAVKDKTYT
FT                   NKPHDTSNSRPVSFEMKNKDGDLQFYHYASTISPANVYFNKDKNKTTVELGLKTASTWK
FT                   KFEVYENNKKLPIELVTYNPETDDAYIRFDVSNGTKELVIKSSTQIYNDPETNYDYTKM
FT                   VFEQPIYNDESKFKTREDFETEALLADYNKAKTLERKIYELNRVKDQLPEKLRAQYSQK
FT                   LEQLKKDLDQEVASAKVEFEHAPVKKVQITNSKSLDISVLQSDDDDLSTMDGFVEKPFE
FT                   LVEVDGKKYIKLTTTIDSIWKDFQVEGQRVMTIDKDTVNDKRTVLFPYVEGKEIYNSIV
FT                   KVDFPTIGYSGQYHVRIKNNAISKKADAETPTTPNNKKEAKPDINQADTATSNNKKADK
FT                   PIVKPADTTTDHKKVTKSVVTTTHAPANHKQMNKPTVSVASNTGHTKQTVVQQTAAHNH
FT                   THSNTSHQNVSTKTQISTLNVAKHSVHNQVQHNNQRSHHTQQQDVTKPLSHAQNNHTVQ
FT                   SQISHMHKTAAHPSPVAQHTLPATGQTTNHATLWASLVAILGGIMFLIRPKKKHQ"
FT                   /protein_id="YP_003470336.1"
FT   misc_feature    complement(64177..64248)
FT                   /note="YSIRK type signal peptide; Region: YSIRK_signal;
FT                   cl04650"
FT                   /db_xref="CDD:164062"
FT                   /locus_tag="SLGD_00061"
FT   misc_feature    complement(<63850..>64125)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="SLGD_00061"
FT   misc_feature    complement(63400..63774)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cl02760"
FT                   /db_xref="CDD:155090"
FT                   /locus_tag="SLGD_00061"
FT   misc_feature    complement(62839..63165)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00061"
FT   misc_feature    complement(order(62866..62868,62872..62874,62884..62886,
FT                   62899..62901,62905..62907,63031..63033,63106..63108,
FT                   63115..63120,63142..63144))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00061"
FT   gene            64594..65178
FT                   /db_xref="GeneID:8817768"
FT                   /locus_tag="SLGD_00062"
FT   CDS_pept        64594..65178
FT                   /locus_tag="SLGD_00062"
FT                   /gene_family="HOG000113486" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549433"
FT                   /db_xref="GeneID:8817768"
FT                   /translation="MKRQTLDVKELIHIGIFTAIYFMVIAIPGILGIIPIFMLLLPAMI
FT                   GFLGAIPIMLLIAKTQKFGALTILCLIINILLIIGGHPWIALIYSIPVTVIADYIMASG
FT                   HYQNTKLNALGYIIFSMWSIGNLLPFYFMRQTFLAHLAERHGSHYEQTVAMLFSYQMIP
FT                   VLIILTIIGAWLGYIIATTVLRKHFKRAGMI"
FT                   /protein_id="YP_003470337.1"
FT   misc_feature    64615..65163
FT                   /note="Hypothetical bacterial integral membrane protein
FT                   (Trep_Strep); Region: Trep_Strep; cl09823"
FT                   /db_xref="CDD:164152"
FT                   /locus_tag="SLGD_00062"
FT   gene            65180..65887
FT                   /db_xref="GeneID:8817769"
FT                   /locus_tag="SLGD_00063"
FT   CDS_pept        65180..65887
FT                   /locus_tag="SLGD_00063"
FT                   /gene_family="HOG000113487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transmembrane component of general energizing
FT                   module of ECF transporters"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549434"
FT                   /db_xref="GeneID:8817769"
FT                   /translation="MLGYISNKPRIFNFDPRVKITLMLLISFVAMTGNSLGLHKYPRLF
FT                   LMLIPVCLLIGVGYYYKGLILGIMIGMSWYIEAFMSIRTQLLLFIVVIIITKFASALAM
FT                   GYFIVQTTQVETLIQGLERLKVSRKVTLPLAVMFRFIPTIKEESSAIKDAMTMRQIDVK
FT                   SAGKHPIKYIEYRYVPLINSVLKIGNELTMSAITRGLNLTNARTSIHHIQMTLLDWMML
FT                   LGTLSLVILYYVM"
FT                   /protein_id="YP_003470338.1"
FT   misc_feature    65240..65872
FT                   /note="Cobalt transport protein; Region: CbiQ; cl00463"
FT                   /db_xref="CDD:163835"
FT                   /locus_tag="SLGD_00063"
FT   gene            65899..67359
FT                   /db_xref="GeneID:8817770"
FT                   /locus_tag="SLGD_00064"
FT   CDS_pept        65899..67359
FT                   /locus_tag="SLGD_00064"
FT                   /codon_start="1"
FT                   /product="Spermidine Putrescine transport ATP-binding
FT                   protein potA"
FT                   /transl_table="11"
FT                   /note="TC_3.A.1.11.1"
FT                   /db_xref="GI:289549435"
FT                   /db_xref="GeneID:8817770"
FT                   /translation="MIELKHVSFSYENGTPSLKDIDLLISSGEVICFTGASGCGKTTLL
FT                   RLFNGLIPYFFNGKLTGEIIINGTSTQTQSIYDLSKQTGSVFQNPRAQFFCLNSTSEMA
FT                   FEAENYGYHPQYITEQIRKGTTDLNLSHLLDRDIFKLSGGEKQLLACATIEVCQHDIII
FT                   LDEPSSNLDHETIKKLKQLILRWKQAGKTVIIAEHRLYYLYDIVDRLVVMEQGAVAHSY
FT                   TSAELKQLTQTQLAGLGLRATRLDLLPGKSHQRHIDSENRLQLNEFNFKYKKQDKTTLQ
FT                   LGDLSLARGSVTAIVGHNGAGKSTFARCLCGLERHFKGTVVEAQLTLKRKARLKNVFMV
FT                   FQDVHRQLFAEDLEEELRLSDETLTAEEIQHNLEIFNIAHQSDTHPLALSGGQQQRLAV
FT                   ASAVVSNRKILIFDEPSSGLDGANMRQMAALLNRLADKGYTIVLITHDYELLMACTDEV
FT                   IEIEHGQLVAQFVLNPENEMRLAPLFIN"
FT                   /protein_id="YP_003470339.1"
FT   misc_feature    65899..66576
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    65905..66546
FT                   /note="Domain I of the ABC component of a cobalt transport
FT                   family found in bacteria, archaea, and eukaryota.  The
FT                   transition metal cobalt is an essential component of many
FT                   enzymes and must be transported into cells in appropriate
FT                   amounts when needed.  This...; Region:
FT                   ABC_cobalt_CbiO_domain1; cd03225"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66001..66024
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    order(66010..66015,66019..66027,66160..66162,66391..66396,
FT                   66490..66492)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66151..66162
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66319..66348
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66379..66396
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66403..66414
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66478..66498
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66679..67305
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66703..67299
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66787..66810
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    order(66796..66801,66805..66813,66922..66924,67135..67140,
FT                   67234..67236)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    66913..66924
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    67063..67092
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    67123..67140
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    67147..67158
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   misc_feature    67222..67242
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00064"
FT   gene            complement(67444..69384)
FT                   /db_xref="GeneID:8817771"
FT                   /locus_tag="SLGD_00065"
FT   CDS_pept        complement(67444..69384)
FT                   /locus_tag="SLGD_00065"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549436"
FT                   /db_xref="GeneID:8817771"
FT                   /translation="MKKHQRIQTNKFGFIANHYSIRKFSVGTASIIVGSLLFLGNPAHA
FT                   AEANTTQNEPATHQENKVETNIDPIIIDQPQNQAATTNQTPKTEQNHTQANKQQAKSNQ
FT                   AAAVTSDSKSQNDAQASPQQSSTSKQDAVKQQATQANTKAPAQPATQQTREAQPVVRSV
FT                   KSATSETTEDFEFQVNKDKTKQKSTMNQYMNHPGKLVHANNKYYFEAELNHAKWWKSFE
FT                   FYDENNNKLNTVVTKDDTSKNIKTIRVEVASGTQQLISKVHIIVPVINYDHEYTTQIAF
FT                   AKPVPQPAKAQASKAQALDVQSTQKNAVKPETLAQAKNVARPSVMTLSAKKPASQQAKS
FT                   AAVTQTAKYKVQKDKSTETSVMDGYMEHPGKFIKENGKTYFEVTLKNADWWKSFQFFTP
FT                   QNKELTTTVVKHDKKADTKTIRVEVKPGMKQLISRVHIVVPAINYDNKYQTTLLFETPV
FT                   PELTTAKPETPKTKPANKTNKAKTSTTKPTKANKENKANKTKKVDKAKNNAPKVVQPAT
FT                   TVNQHSKAAATHKTIKTSHVSTTVNHDATATQHHTPVVASTYKPAKDEVKAQATMAQPT
FT                   TQQHVHLSQNKHEDKQHVAMTKPQPAQQSHMHSLPNTGQENATTSASIFGSLLALGGSI
FT                   LLFGRKRKEQR"
FT                   /protein_id="YP_003470340.1"
FT   misc_feature    complement(69244..>69336)
FT                   /note="YSIRK type signal peptide; Region: YSIRK_signal;
FT                   cl04650"
FT                   /db_xref="CDD:164062"
FT                   /locus_tag="SLGD_00065"
FT   misc_feature    complement(68548..68880)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00065"
FT   misc_feature    complement(order(68554..68556,68560..68562,68572..68574,
FT                   68587..68589,68593..68595,68734..68736,68809..68811,
FT                   68818..68823,68845..68847))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00065"
FT   misc_feature    complement(68017..68355)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00065"
FT   misc_feature    complement(order(68035..68037,68041..68043,68053..68055,
FT                   68068..68070,68074..68076,68215..68217,68290..68292,
FT                   68299..68304,68326..68328))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00065"
FT   gene            70014..70700
FT                   /db_xref="GeneID:8817772"
FT                   /locus_tag="SLGD_00066"
FT   CDS_pept        70014..70700
FT                   /locus_tag="SLGD_00066"
FT                   /gene_family="HOG000059157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NPQTN cell wall anchored protein IsdC"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549437"
FT                   /db_xref="GeneID:8817772"
FT                   /translation="MKTVFKIVSFIFLCIFSFGILSSSSAFAEGQSLNYEVLKYNTNDT
FT                   SIANDYFNKPATVVERNGKKYVQITVNHSHWITGMSIEGKNEKIINTNKAKDERTSEFE
FT                   VSKTSGKVDGKISVYINEKVNGKPFKYDHHYNITYKFNGKDSGSSSAATPGINKSENGG
FT                   TGSAASDAGNGTSSDSNSASTDGSSVENPQTSAGTPAYVYLIPVVAVVFLMLSVAILKR
FT                   NRKGNH"
FT                   /protein_id="YP_003470341.1"
FT   misc_feature    70014..70694
FT                   /note="heme uptake protein IsdC; Region: IsdC; TIGR03656"
FT                   /db_xref="CDD:163379"
FT                   /locus_tag="SLGD_00066"
FT   misc_feature    70104..70439
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00066"
FT   misc_feature    order(70128..70130,70152..70157,70164..70166,70239..70241,
FT                   70365..70367,70371..70373,70404..70406,70416..70418,
FT                   70422..70424)
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00066"
FT   misc_feature    70584..70685
FT                   /note="sortase B signal domain, NPQTN class; Region:
FT                   srtB_sig_NPQTN; TIGR03068"
FT                   /db_xref="CDD:132112"
FT                   /locus_tag="SLGD_00066"
FT   gene            70703..72100
FT                   /db_xref="GeneID:8817773"
FT                   /locus_tag="SLGD_00067"
FT   CDS_pept        70703..72100
FT                   /locus_tag="SLGD_00067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549438"
FT                   /db_xref="GeneID:8817773"
FT                   /translation="MSKRLKLLLATSLIFSWSVVTGSYSNAAMLNVRADDSSYSSAPSH
FT                   IDTNQWTHSSNAQLSIYYADSKTLAQSYNKMVDPSVQIIKDHGRLVAKINIAKHGLWKQ
FT                   LQVEDQGQMRLLNIHTTPSQPTKDYVLLPLNKQQTHYKVNVTTIENGQEKQQQLLFNIT
FT                   PSTAQEDGHQVNKRAVNFYVRKKEENKLSHMDDYVKHPGHYVTIQGKRYFEMTLTHIDW
FT                   WQSYQFYHQNTKLQHEVIYENSDTQEATVRIPVEEDTKEIEARIHIVIPELNYDHHYTT
FT                   YIVLGVKHPNETDDSQSDTSAEKRNKDKHQQDPGDKSVPPASEKQQAHVKQQQQTQQNN
FT                   DTHASNNEDTSSRTTTPSNNSETTTQSSSSTPTPSSHESSAQQGEKKQVTTAASKNKAH
FT                   AAQQHKDKNKRTPAFDRNADKSYHTDGNKQPNVNLPKHTKDYIIFGILIFISVAGLIAT
FT                   YFINRKR"
FT                   /protein_id="YP_003470342.1"
FT   misc_feature    71237..71557
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00067"
FT   misc_feature    order(71255..71257,71279..71284,71291..71293,71366..71368,
FT                   71504..71506,71510..71512,71525..71527,71537..71539,
FT                   71543..71545)
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00067"
FT   gene            72109..72999
FT                   /db_xref="GeneID:8817774"
FT                   /locus_tag="SLGD_00068"
FT   CDS_pept        72109..72999
FT                   /locus_tag="SLGD_00068"
FT                   /gene_family="HOG000059045" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme transporter IsdDEF, lipoprotein IsdE"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549439"
FT                   /db_xref="GeneID:8817774"
FT                   /translation="MNISKIMSSLAILLMLLTGCSQSSKHTKGDNVDQQGNAYRIVPTT
FT                   VALTMTLDKLDIPIVGKPTTYKTLPKRYKDVPEVGQPMQPSVEAVKQVNPTHVLSVSTI
FT                   KDEMKPFYKQLNMKGYYYDYDSLDGMEKSITQLGHQFNRESKAKALNQHINSVKKDIQD
FT                   KAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKDTSKQYISSNTENLV
FT                   NVDPDIILRLPHGMPDEVKKMFQKEFKQNDIWKHFKAVKEDRVYDLEEIPFGITANVDA
FT                   DDAMKQLYDVFYNQH"
FT                   /protein_id="YP_003470343.1"
FT   misc_feature    72226..72990
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="SLGD_00068"
FT   misc_feature    72229..72912
FT                   /note="Periplasmic binding protein; Region: Peripla_BP_2;
FT                   pfam01497"
FT                   /db_xref="CDD:144914"
FT                   /locus_tag="SLGD_00068"
FT   misc_feature    order(72436..72441,72448..72450,72535..72537)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="SLGD_00068"
FT   gene            73021..73995
FT                   /db_xref="GeneID:8817775"
FT                   /locus_tag="SLGD_00069"
FT   CDS_pept        73021..73995
FT                   /locus_tag="SLGD_00069"
FT                   /gene_family="HOG000045409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme transporter IsdDEF, permease component IsdF"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549440"
FT                   /db_xref="GeneID:8817775"
FT                   /translation="MKKHPAFLMVIMLALLIVTTYVAVVVGKIPISFDQVMTKVTTGSE
FT                   QHVDAVIDLRFPRIFIALFVGAILAVSGALLQAVLQNPLAEANILGVSSGALVVRSLVL
FT                   LLFPGLYFYAPFLSFIGGVIPFMVLFVLIAKYKLAPVRMILVGVALYAMLNGILELLAQ
FT                   DPFMKIPQGLTMKTWNDVYIVAITAIIGITLALILAQKTNLLAFDEKQANNIGFNITKY
FT                   RLMIGLVAVFLASGATAIVGQMAFVGLIVPHIVRRCIGSNYKKVLPYSAMMGAWLVLLA
FT                   DIIGRTIHPPLEIPANVLTMMLGGPILIYMICKGAVSHAHRTS"
FT                   /protein_id="YP_003470344.1"
FT   misc_feature    73036..73956
FT                   /note="ABC-type enterobactin transport system, permease
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   FepG; COG4779"
FT                   /db_xref="CDD:34391"
FT                   /locus_tag="SLGD_00069"
FT   misc_feature    73195..73956
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00069"
FT   misc_feature    order(73249..73251,73261..73269,73606..73611,73615..73623,
FT                   73627..73632,73636..73653,73657..73665,73786..73788,
FT                   73807..73809)
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00069"
FT   misc_feature    order(73264..73266,73270..73272,73285..73287,73444..73446,
FT                   73450..73455,73462..73467,73474..73479,73486..73488,
FT                   73495..73500,73504..73506,73528..73533,73540..73542,
FT                   73756..73758,73912..73914,73921..73926,73933..73935,
FT                   73942..73947,73954..73956)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00069"
FT   misc_feature    order(73504..73506,73558..73560,73732..73734,73744..73746,
FT                   73876..73878,73903..73905)
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00069"
FT   gene            73976..74755
FT                   /db_xref="GeneID:8817776"
FT                   /locus_tag="SLGD_00070"
FT   CDS_pept        73976..74755
FT                   /locus_tag="SLGD_00070"
FT                   /codon_start="1"
FT                   /product="Heme transporter analogous to IsdDEF, ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549441"
FT                   /db_xref="GeneID:8817776"
FT                   /translation="MRIEHLNFYYDLQRPIFEDISLEFKSNAITTIIGPNGSGKSTLLQ
FT                   LLSHNLKPKSGQIFLQDKLLNQYSQKALAQRLATVHQKSKVPEDFTVRQVIETGRYSYQ
FT                   RLFKKDLRKDSVVNTVIQQLDLTQFEHQSVMNLSGGELQRVFIGMALAQEPQYLLLDEP
FT                   TTFLDIHYQYQVLDIIKWLHEEYQMTIIMVLHDINQAIEYSDELICLGNKGLLAQGRPK
FT                   DIIDHTLIQDMYHIDAKILQDPDCGTVIVKKRGGHNK"
FT                   /protein_id="YP_003470345.1"
FT   misc_feature    73976..74728
FT                   /note="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components [Inorganic ion transport and
FT                   metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
FT                   /db_xref="CDD:31317"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    73979..74632
FT                   /note="ABC transporters, involved in the uptake of
FT                   siderophores, heme, and vitamin B12, are widely conserved
FT                   in bacteria and archaea.  Only very few species lack
FT                   representatives of the siderophore family transporters. The
FT                   E. coli BtuCD protein is an ABC...; Region:
FT                   ABC_Iron-Siderophores_B12_Hemin; cd03214"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    74075..74098
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    order(74084..74089,74093..74101,74219..74221,74456..74461,
FT                   74558..74560)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    74210..74221
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    74384..74413
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    74444..74461
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    74468..74479
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   misc_feature    74546..74566
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00070"
FT   gene            74752..75474
FT                   /db_xref="GeneID:8817777"
FT                   /locus_tag="SLGD_00071"
FT   CDS_pept        74752..75474
FT                   /locus_tag="SLGD_00071"
FT                   /gene_family="HOG000058823" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NPQTN specific sortase B"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549442"
FT                   /db_xref="GeneID:8817777"
FT                   /translation="MKLVLRLCQIILIAVIVISVYQIYHLHLADKQAEERYKNLQQNYT
FT                   TQSANNEVRPQFTQLEQVNKDIVGWIHLSDSTLNYPVLQAKDNKTYLQHDFEHEASRKG
FT                   SIFMDYRNAIAQPDLNTVIYGHHVGDNTMFDVLEKYLKQSFYDKHKSIQFDTKYHKYRL
FT                   EVLSAYQTTTKDNYIQTYFKTQQAYDKFLKETMRKSVINTTTEVSAKDKIVTLSTCEDA
FT                   YSQTSGRIVVVTKLVELK"
FT                   /protein_id="YP_003470346.1"
FT   misc_feature    74839..75459
FT                   /note="Sortase B (SrtB) or subfamily-2 sortases are
FT                   membrane cysteine transpeptidases found in gram-positive
FT                   bacteria that anchor surface proteins to peptidoglycans of
FT                   the bacterial cell wall envelope. This involves a
FT                   transpeptidation reaction in which the...; Region:
FT                   Sortase_B_2; cd05826"
FT                   /db_xref="CDD:99709"
FT                   /locus_tag="SLGD_00071"
FT   misc_feature    order(75013..75015,75079..75081,75115..75117,75121..75123,
FT                   75127..75129,75403..75408,75427..75429,75436..75438)
FT                   /note="active site"
FT                   /db_xref="CDD:99709"
FT                   /locus_tag="SLGD_00071"
FT   misc_feature    order(75127..75129,75406..75408,75436..75438)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:99709"
FT                   /locus_tag="SLGD_00071"
FT   gene            75492..75815
FT                   /db_xref="GeneID:8817778"
FT                   /locus_tag="SLGD_00072"
FT   CDS_pept        75492..75815
FT                   /locus_tag="SLGD_00072"
FT                   /gene_family="HOG000008026" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549443"
FT                   /db_xref="GeneID:8817778"
FT                   /translation="MNFMAENKLKLDKGTAEGIIDRFYTRHGIETLEGFKGMFVTKTHE
FT                   LEDYDEVKILTLWDTEEDFKDWLQSDVFRKAHQHVRHQSQDSSSPILENTVIKYDIGYQ
FT                   YLK"
FT                   /protein_id="YP_003470347.1"
FT   misc_feature    75498..75812
FT                   /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
FT                   cl10022"
FT                   /db_xref="CDD:175061"
FT                   /locus_tag="SLGD_00072"
FT   gene            75889..77385
FT                   /db_xref="GeneID:8817779"
FT                   /locus_tag="SLGD_00073"
FT   CDS_pept        75889..77385
FT                   /locus_tag="SLGD_00073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Secretory antigen precursor SsaA"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549444"
FT                   /db_xref="GeneID:8817779"
FT                   /translation="MSRNKLIFCVITVTALSQLISTPLSSYAMDTQVHQHKNKKVHKQD
FT                   EDAYLSPKDKHIESTEVPINDIEEEVPLPKVVASHQRVNQHKPPKVTLLPPNETSTVAS
FT                   QHDDETLIQRMQHDEESNDVQSKQLTTSKAQHQQVNNPQTSENESSQRRAAQVVTKQGD
FT                   SSTNGYRDTAILQQAPDTDDDKVETQYEVAQSSDTREFIQNIAEDAHHVAQKEHLYASV
FT                   MIAQAILESDSGNSALASAPHNNLFGVKGAYQGETTNFNTLEADSEGKMYQTTAAFRNY
FT                   PDTKAALEDYAKLIRYGIDGNNNIYQGSWKTPGMTYEDATKSLVGTYSTDPDYDKKLNS
FT                   IIKQYRLTELDGEEMPILDEAFFNKSYDDNQGDYKPFKEMDSQSKNFYPQGQCTWYVYN
FT                   RLQQFNLYVDGSMGNGGDWAVRARDKGYQVSNHPSEHTAVSFKPGQLNADRYYGHVAFV
FT                   EKVNSDGSIIISESNVKGLGVISYRKINANQAETLQYIQP"
FT                   /protein_id="YP_003470348.1"
FT   misc_feature    76465..76971
FT                   /note="Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase; Region: Glucosaminidase;
FT                   cl00743"
FT                   /db_xref="CDD:174371"
FT                   /locus_tag="SLGD_00073"
FT   misc_feature    77038..77376
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="SLGD_00073"
FT   gene            complement(77739..78737)
FT                   /db_xref="GeneID:8817780"
FT                   /locus_tag="SLGD_00074"
FT   CDS_pept        complement(77739..78737)
FT                   /locus_tag="SLGD_00074"
FT                   /gene_family="HOG000045409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme transporter IsdDEF, permease component IsdF"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549445"
FT                   /db_xref="GeneID:8817780"
FT                   /translation="MTERIKKKDFYYLIIALIFLIVISVISMMAGSSYISLQRIVMYFF
FT                   NPADSIDQFTIEVLRLPRIILAILAGMALGISGLILQNVLKNPIASPDIIGITGGASLG
FT                   AVIFINFFNQISIQVLPLFAVTGGMIAMLVLLIFQKHGQIKPTTLIIIGISMQTLCIAL
FT                   VQGLLITTKQLSAAKAYTWLVGSLYGATFKDSIVLGSVLIAIVPLLLVIIPKMKISALT
FT                   DPLAIGLGLHVQRMKLMQILIATILVSIAISLVGNISFVGLIAPHIAKTIVKGSYASKL
FT                   LMSGMLGAISIVIADLIGRTLFLPKEVPAGIFIAAFGAPFFIYLLLTVKKL"
FT                   /protein_id="YP_003470349.1"
FT   misc_feature    complement(77829..78527)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00074"
FT   misc_feature    complement(order(77907..77909,77928..77930,78051..78059,
FT                   78063..78080,78084..78089,78093..78101,78105..78110,
FT                   78474..78482,78492..78494))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00074"
FT   misc_feature    complement(order(77958..77960,78186..78188,78195..78200,
FT                   78231..78233,78237..78239,78243..78245,78252..78254,
FT                   78261..78266,78273..78278,78285..78290,78294..78296,
FT                   78456..78458,78471..78473,78477..78479))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00074"
FT   misc_feature    complement(order(77838..77840,77970..77972,77982..77984,
FT                   78156..78158,78231..78233))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00074"
FT   gene            complement(78734..79729)
FT                   /db_xref="GeneID:8817781"
FT                   /locus_tag="SLGD_00075"
FT   CDS_pept        complement(78734..79729)
FT                   /locus_tag="SLGD_00075"
FT                   /gene_family="HOG000045410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme transporter IsdDEF, permease component IsdF"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549446"
FT                   /db_xref="GeneID:8817781"
FT                   /translation="MLLKPKYQIALAGFCLVIVAISSLMIGNTLVSPMTLIQALFNFDS
FT                   ANELHHIVTGTRTSRTIIALLTGAALAIAGLLMQALTRNPIASPGLFGVNAGAVFFVIL
FT                   SITFFQIQSFKVIIVIAFLGAIIVTILVVTLGMFRQTQFSPQRVILAGAAISMLFTAFT
FT                   QGILIMNETDLQGLLFWLSGSVSLRNIWDMTWIIPLILILILIAFSMGAHINILMTSDD
FT                   IATGLGQNIRVVKWLIILLISMLASISVAVAGSIAFIGLIVPNISKRLLPPNYKYLIPF
FT                   NALAGANLMLLSDMIARVIIQPLELPIGVVTAIMGASVLIYLMQKGPHRL"
FT                   /protein_id="YP_003470350.1"
FT   misc_feature    complement(78758..79498)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00075"
FT   misc_feature    complement(order(78905..78907,78926..78928,79049..79057,
FT                   79061..79078,79082..79087,79091..79099,79103..79108,
FT                   79475..79483,79493..79495))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00075"
FT   misc_feature    complement(order(78758..78760,78767..78772,78779..78781,
FT                   78788..78793,78800..78802,78956..78958,79184..79186,
FT                   79193..79198,79229..79231,79235..79240,79247..79249,
FT                   79256..79261,79268..79273,79280..79285,79289..79291,
FT                   79457..79459,79472..79474,79478..79480))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00075"
FT   misc_feature    complement(order(78809..78811,78836..78838,78968..78970,
FT                   78980..78982,79154..79156,79229..79231))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00075"
FT   gene            complement(79745..80737)
FT                   /db_xref="GeneID:8817782"
FT                   /locus_tag="SLGD_00076"
FT   CDS_pept        complement(79745..80737)
FT                   /locus_tag="SLGD_00076"
FT                   /gene_family="HOG000045521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Siderophore staphylobactin ABC transporter,
FT                   substrate-binding protein SirA, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549447"
FT                   /db_xref="GeneID:8817782"
FT                   /translation="MNKVVNIIVTALACIVILAGCSGNSNKSTSDQSDKDTMKIKHAMG
FT                   TTEIKGQPKRVVTLYQGATDVAVSLGVKPVGAVESWTQKPKYNYLKKALKDTTIVGQEP
FT                   TPNLEEISKLKPDLIVASKVRNEKVYDQLSKIAPTISTDNVFKFKDTTKLMGKALGKER
FT                   KADKLLKKYDDKVAAFKKDAEAKYKDAWPLSASVVNFRADHTRIYAGGYAGEILSDLGF
FT                   KRNKALQKEVDKGKDIIQLTSKESIPLMKADHIFVVQSDPTAKDAGLVKKTEDEWTSSK
FT                   EWKHLTAVKNNQVSTDLDEITWNLAGGYQSSLKLIDDLYDKLNIDKQSK"
FT                   /protein_id="YP_003470351.1"
FT   misc_feature    complement(79757..80719)
FT                   /note="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component [Inorganic ion transport and
FT                   metabolism]; Region: FepB; COG0614"
FT                   /db_xref="CDD:30959"
FT                   /locus_tag="SLGD_00076"
FT   misc_feature    complement(79784..80587)
FT                   /note="Fe3+-siderophore binding domain FhuD.  These
FT                   proteins have been shown to function as initial receptors
FT                   in ABC transport of Fe3+-siderophores in many eubacterial
FT                   species. They belong to the TroA-like superfamily of
FT                   helical backbone metal receptor...; Region: FhuD; cd01146"
FT                   /db_xref="CDD:29749"
FT                   /locus_tag="SLGD_00076"
FT   misc_feature    complement(order(80120..80122,80363..80365,80426..80431,
FT                   80480..80482))
FT                   /note="siderophore binding site; other site"
FT                   /db_xref="CDD:29749"
FT                   /locus_tag="SLGD_00076"
FT   gene            complement(81100..81708)
FT                   /db_xref="GeneID:8817783"
FT                   /locus_tag="SLGD_00077"
FT   CDS_pept        complement(81100..81708)
FT                   /locus_tag="SLGD_00077"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549448"
FT                   /db_xref="GeneID:8817783"
FT                   /translation="MYIPKHYQMKNDNNIKKFMEEHNFVTIVTVDDHIPIATHVPVMIE
FT                   YNEDTMYLSGHFAKGNPQWKTIQDNSNILVIFSGPHSYISSSWYEEEDVPTWDYQSVHA
FT                   YGTGALLNEAELTYALKSMLNKYEAHRENGATWDKLSNQTLKQIKGVIGFKIKVNRLEA
FT                   AYKLSQTRSEKEKENIISKLKQSNDNVQINLADETENYK"
FT                   /protein_id="YP_003470352.1"
FT   misc_feature    complement(81226..81705)
FT                   /note="Pyridoxine 5'-phosphate (PNP) oxidase-like proteins;
FT                   Region: PNPOx_like; cl00381"
FT                   /db_xref="CDD:174160"
FT                   /locus_tag="SLGD_00077"
FT   gene            complement(81722..82228)
FT                   /db_xref="GeneID:8817784"
FT                   /locus_tag="SLGD_00078"
FT   CDS_pept        complement(81722..82228)
FT                   /locus_tag="SLGD_00078"
FT                   /gene_family="HOG000078532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549449"
FT                   /db_xref="GeneID:8817784"
FT                   /translation="MIRSCTIDDAVQLQKIAYQTFDETFRFQNKEENINQYLAENFTHD
FT                   KVIDELNNPHSFFYFIYDEDKLAGYLKLNIKDAQTETYNDNDLEIERIYILSTFQHKGL
FT                   GKALFNQALTLANQLSCDSIWLGVWEKNDNAIIFYKSLGFHVIDSHIFYMGDEKQTDYI
FT                   MMMHI"
FT                   /protein_id="YP_003470353.1"
FT   misc_feature    complement(81737..82126)
FT                   /note="ribosomal-protein-alanine acetyltransferase; Region:
FT                   rimI; TIGR01575"
FT                   /db_xref="CDD:162430"
FT                   /locus_tag="SLGD_00078"
FT   misc_feature    complement(81851..82057)
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="SLGD_00078"
FT   misc_feature    complement(order(81911..81916,81944..81952))
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="SLGD_00078"
FT   misc_feature    complement(81737..>81934)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="SLGD_00078"
FT   gene            complement(82246..82698)
FT                   /db_xref="GeneID:8817785"
FT                   /locus_tag="SLGD_00079"
FT   CDS_pept        complement(82246..82698)
FT                   /locus_tag="SLGD_00079"
FT                   /gene_family="HOG000225730" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549450"
FT                   /db_xref="GeneID:8817785"
FT                   /translation="MEDILRDIGVIARALDSISNIEFKEIDLTKGQFIYLTRICENPGI
FT                   IQEKLAEMLKIDRTTASRAIKNLEKNHMIVKKNDATNKKNKLLFPTEKGKSLYPFIIRE
FT                   NNHSNAVALQGFSQKEITDLSLALKRVKQNISEDWSKVKKGYKRKY"
FT                   /protein_id="YP_003470354.1"
FT   misc_feature    complement(82309..82671)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   MarR; COG1846"
FT                   /db_xref="CDD:32031"
FT                   /locus_tag="SLGD_00079"
FT   misc_feature    complement(82336..82635)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00079"
FT   gene            83064..83264
FT                   /db_xref="GeneID:8817786"
FT                   /locus_tag="SLGD_00080"
FT   CDS_pept        83064..83264
FT                   /locus_tag="SLGD_00080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549451"
FT                   /db_xref="GeneID:8817786"
FT                   /translation="MKKAWYKRIFNPVNYCQYLVHSLKHVPGPTDKASWGGAPTERIST
FT                   RNSTSKASWGRPPTERKEQAL"
FT                   /protein_id="YP_003470355.1"
FT   gene            complement(83322..84254)
FT                   /db_xref="GeneID:8817787"
FT                   /locus_tag="SLGD_00081"
FT   CDS_pept        complement(83322..84254)
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /gene_family="HOG000050222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00081"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="GI:289549452"
FT                   /db_xref="GeneID:8817787"
FT                   /translation="MYKIAIAGAGAMGGRIGVSLKQAGYDVTLIDDWQEHVNCINENGM
FT                   EVQTEMDTYTVNIPAVLTKDVSGQFDLIIILTKAMQSEKMLQHLQEANTIHKDTAILSM
FT                   MNGLGHEERLSKLVPLSQIYLAVTMWTAGLRGPGQLLLEGEGAIDLQRADGEKDSRTEV
FT                   ILNMLNTSGLNAQISSDVFKSIWSKATLNSVLNPLCTILDKTIYEFGCYEDAQDMITPI
FT                   VDEIISVGQAKHIDLNRQTLLDKIEASYPKEAQGLHYPSMHQDYNNGRLTEIDYLNGQI
FT                   VEYGKVFNIPTPTNALITHLIHQLEMKNH"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470356.1"
FT   misc_feature    complement(83337..84197)
FT                   /note="2-dehydropantoate 2-reductase; Reviewed; Region:
FT                   PRK06522"
FT                   /db_xref="CDD:168592"
FT                   /locus_tag="SLGD_00081"
FT   misc_feature    complement(83790..84197)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00081"
FT   misc_feature    complement(83337..83717)
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="SLGD_00081"
FT   gene            84723..85841
FT                   /db_xref="GeneID:8817788"
FT                   /locus_tag="SLGD_00082"
FT   CDS_pept        84723..85841
FT                   /locus_tag="SLGD_00082"
FT                   /codon_start="1"
FT                   /product="Spermidine Putrescine transport ATP-binding
FT                   protein potA"
FT                   /transl_table="11"
FT                   /note="TC_3.A.1.11.1"
FT                   /db_xref="GI:289549453"
FT                   /db_xref="GeneID:8817788"
FT                   /translation="MITLKHLNKVYDGNHYAVKDFNLEVDDQEFVVFVGPSGCGKSTTL
FT                   RMIAGLEEISEGEIYVDDQLLNQVQPKDRGIAMVFQNYALYPHMSVYKNLAFGLKMRGI
FT                   HKKEYDQRIQDAAKILEISHLLDRKPKALSGGQRQRVALGRAIVRDAKIFLMDEPLSNL
FT                   DAKLRTHMRTEIIKLHKKMGATTIYVTHDQTEAMTMATKIVLLKDGVIQQVGSPEEIYH
FT                   HPINQFVATFIGNPTMNMIPLDIKDQSWLFNQQLVVDAQVLGVFEHNALNLGIRSENIQ
FT                   FSTESAALKDYELQLPDWQVTLVELIGATKLIHCVNGETHIVVSTDNQMDLKPGETIHL
FT                   GMQLADCHLFDRETGDLVTPQQQAMNSETVSI"
FT                   /protein_id="YP_003470357.1"
FT   misc_feature    84723..85787
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:171228"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    84726..85367
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    84825..84848
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    order(84834..84839,84843..84851,84963..84965,85191..85196,
FT                   85293..85295)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    84954..84965
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    85119..85148
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    85179..85196
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    85203..85214
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    85281..85301
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00082"
FT   misc_feature    85539..85772
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="SLGD_00082"
FT   gene            85869..86837
FT                   /db_xref="GeneID:8817789"
FT                   /locus_tag="SLGD_00083"
FT   CDS_pept        85869..86837
FT                   /locus_tag="SLGD_00083"
FT                   /gene_family="HOG000047980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549454"
FT                   /db_xref="GeneID:8817789"
FT                   /translation="MKETLHVNHAHPVKQHKVTLLQRIWQHKVLYLMLLPCLLFFLIFN
FT                   YIPMAGLVLAFKEFRFDTTIFGGQWEGFKYFKRFFSDSQSYQIIINTLIISGMKLVLAL
FT                   PFPIALAIMFNEISHTKKLGRFRGLFQGVMYIPHFLSWVVVVGIFQKVLAPDSGLINQL
FT                   IQQFGGNGATFFMMNPEYFHTIMFSSYLWKNVGWDSIIYFAAIMGINPEIYESAKIDGA
FT                   NRWQQIIHITLPMLTPTIIILFILSLGDILKAGFDQIYLLKTPGNAKYAEILDTFVIRT
FT                   GIQQGDFSYSIAIGLLQGVIGLILVIVVNRFADRKFNTSLY"
FT                   /protein_id="YP_003470358.1"
FT   misc_feature    86004..86747
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="SLGD_00083"
FT   gene            86848..88539
FT                   /db_xref="GeneID:8817790"
FT                   /locus_tag="SLGD_00084"
FT   CDS_pept        86848..88539
FT                   /locus_tag="SLGD_00084"
FT                   /gene_family="HOG000147907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549455"
FT                   /db_xref="GeneID:8817790"
FT                   /translation="MKHIKKLSILLLVLLLVFVTACGKDEDEEKRRADAKGKPKTWIAD
FT                   RKLKGLVFQSKNDVSPEMNKEIEKELKKKTGITLELQTASGNDSTEALTSGLASGDLPD
FT                   FIVYYLDNSGRPEMKVLNKAAKQGQLTDLKPLLKDTNVYKKYLKKDYLPKDTRDNIMFP
FT                   KDLDGTYFVHMGINRKPGDPGRKVVGGPYIRKDIAEQLNLDPSSIKTSKDMKALAEKIK
FT                   NHHFKDDNGKEITPIGPTAWGGSDRTAFYNDLVWTGGADEKFQIDHDKVKHESDTDYGM
FT                   KRVKYVKSLMDEGLMHKAFYTMSENQAKEGLVNGSWGIVSDLHNYVTENQSMKYIPLGP
FT                   LNTVKGKYQMEMSYKSGYGGWSIPKSTKHPEDVVKLADFLASREGKLLGEYGIKGRDYN
FT                   LDKKGNPVVKKEVLKEIDEHPDQAKKRGFRGAGSYWADHLGLTDVDNLDDFGEREYGDN
FT                   ARKKQGKTNPEKMAESWHYDEKLKHAKVIDGLTVKSFLPKFDKGEELEIALDEYDESLK
FT                   RAYYAKTDKESERILEDAKKKLDQAGLPEFEKMIEKKIKNGEKIRF"
FT                   /protein_id="YP_003470359.1"
FT   misc_feature    <87448..88005
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="SLGD_00084"
FT   gene            88553..89449
FT                   /db_xref="GeneID:8817791"
FT                   /locus_tag="SLGD_00085"
FT   CDS_pept        88553..89449
FT                   /locus_tag="SLGD_00085"
FT                   /gene_family="HOG000220527" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549456"
FT                   /db_xref="GeneID:8817791"
FT                   /translation="MKIKRDWSSIIIRSISWVIIITLALSILLPMINIIALAFNSGADA
FT                   QKGGITFWPRQFSLDNFKEIFKQGTILNALFISLAKTIIGTVLSVILTAMAAYALTIKS
FT                   LPFRRTISFFLVFTMLFSAGVVPLYILLNQLSLTDTFWVYIIPSLYSVYNILIMRTFFN
FT                   QIPISVIEAARIDGCNDWQIFWKIILPMSKPVIATITLFNAVSQWNDWFTGAFFVRNPQ
FT                   LKPLATVLQDMLTSQDSIANALKQKSGAYQMIERITITGDSLQMAMIVLLIIPVLLLFP
FT                   FVQKHFVKGVNIGSTKE"
FT                   /protein_id="YP_003470360.1"
FT   misc_feature    88763..89272
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00085"
FT   misc_feature    order(88811..88816,88823..88828,88841..88843,88871..88882,
FT                   88886..88903,88910..88915,88919..88921,88994..88999,
FT                   89003..89005,89009..89011,89018..89023,89027..89029,
FT                   89039..89044,89051..89053,89102..89104,89144..89149,
FT                   89156..89158,89177..89182,89186..89191,89198..89203,
FT                   89240..89245)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00085"
FT   misc_feature    order(88889..88903,88904..88921,89177..89182,89186..89197)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00085"
FT   misc_feature    order(88919..88921,88979..88981,89198..89200,89234..89236,
FT                   89243..89245)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00085"
FT   misc_feature    order(89054..89092,89108..89113,89123..89125)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00085"
FT   gene            89463..90323
FT                   /db_xref="GeneID:8817792"
FT                   /locus_tag="SLGD_00086"
FT   CDS_pept        89463..90323
FT                   /locus_tag="SLGD_00086"
FT                   /gene_family="HOG000249829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549457"
FT                   /db_xref="GeneID:8817792"
FT                   /translation="MSKFKIMQFTDLHLSPKNNDKDQQTYQLLEQLITTYQPDLCMFTG
FT                   DQIWSQGVMDSEKVYRNLIEFLNQFDTSIATTFGNHDTENHLSRSDLRQIEAELANNYA
FT                   CKKHSKIVNDKEAYVLEVYDNDQLSHLLYVIDGGDYSTTAIGQYAYIHPDHVAWIAEVE
FT                   RYYEQQDQIMPKHNLLFTHIPIPEYQAISQTKLYHGIFNEEIGCPTMNSGLFAQMLHSG
FT                   NIEGMFCGHDHDNDFSFNHYGIHLNYGRISGFHCYGDITRGARLIELSPNKPYETKIVE
FT                   YDQCF"
FT                   /protein_id="YP_003470361.1"
FT   misc_feature    89466..>89750
FT                   /note="Saccharomyces cerevisiae DCR2 phosphatase and
FT                   related proteins, metallophosphatase domain; Region:
FT                   MPP_Dcr2; cd07383"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00086"
FT   misc_feature    89472..90161
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="SLGD_00086"
FT   misc_feature    order(89493..89495,89499..89501,89598..89600,89700..89705)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00086"
FT   misc_feature    order(89493..89495,89499..89501,89598..89600,89700..89702)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00086"
FT   misc_feature    <89904..90236
FT                   /note="Saccharomyces cerevisiae DCR2 phosphatase and
FT                   related proteins, metallophosphatase domain; Region:
FT                   MPP_Dcr2; cd07383"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00086"
FT   gene            90307..91722
FT                   /db_xref="GeneID:8817793"
FT                   /locus_tag="SLGD_00087"
FT   CDS_pept        90307..91722
FT                   /locus_tag="SLGD_00087"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Potassium-transporting ATPase A chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="TC 3.A.3.7.1"
FT                   /db_xref="GI:289549458"
FT                   /db_xref="GeneID:8817793"
FT                   /translation="MTSVSKSRFQKIYVPILIEQLFMMLMGQADVIMLSAYDTKAIAVS
FT                   GISTQILTLLTFVITIVHVGVSIRLVHQKERDMTAIKSELYHSLTLNLVLSALLGITAL
FT                   ICYRWILMLMQVSQDIFELTYQFGVILLLGFAITTAQMLVSTILRILYMANIAAKITVG
FT                   INIINIILSCCILFVFTDYVGNPILAVAVATLMSRLLGLLYGGYYLIKKYKPQAKFLKL
FT                   NMFMTKKVILLGLPGAGEQISYNFAQTITTAFTTGSVNNMHDSLTPLGGLVPLLLMMLN
FT                   AVFGGEGVGLMNMLIYVMLTVFMCSLMIGKTPSYLGMKIEGKEMKLIALSFLIHPLLIL
FT                   FFSCIGIYSTGCNDAITNPQFHGVSQVLYEFSSSSANNGSGFEGLKDNTTFWNISTGIV
FT                   MLLARYIPIILQLSIVSSLVNKKTYQNLTEDVPINNLFFSSVLIIFIILLSGLTFLPDL
FT                   MLGPIGEHLLLHS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470362.1"
FT   misc_feature    90349..90753
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="SLGD_00087"
FT   misc_feature    <91051..91716
FT                   /note="K+-transporting ATPase, A chain [Inorganic ion
FT                   transport and metabolism]; Region: KdpA; cl00903"
FT                   /db_xref="CDD:176588"
FT                   /locus_tag="SLGD_00087"
FT   gene            91740..93761
FT                   /db_xref="GeneID:8817794"
FT                   /locus_tag="SLGD_00088"
FT   CDS_pept        91740..93761
FT                   /locus_tag="SLGD_00088"
FT                   /gene_family="HOG000244113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Potassium-transporting ATPase B chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="TC 3.A.3.7.1"
FT                   /db_xref="GI:289549459"
FT                   /db_xref="GeneID:8817794"
FT                   /translation="MIETKKIFESSLVKQALKESIIKLNPVCMVKNPIMFVVEVGMMLS
FT                   LILTMAPNLFSYENVSRTYLFSIFFILLLTLIFANFSEALAEGRGKAQAKALRQTQTEM
FT                   TARRIKSDGSYEIIDASQLKKGDIVRVETGEQIPNDGQVINGLATVDESAITGESAPVI
FT                   KESGGDFNNVIGGTSVASDWLEVEITSNPGQSFLDKMIYLVENATRKKTPNEIALFTLL
FT                   MTLTIVFLAVILTMYPLATFLHFNLSIAMLIALTVCLIPTTIGGLLSAIGIAGMDRVTQ
FT                   FNILAKSGRSVETCGDVNVLILDKTGTITYGNRMASEFIPVASTQFERLVKASYECSVE
FT                   DDTPEGSSIVKLARQQHIDLPTDRGEYFPFTAETRMSGVKFSNREVYKGAPNSMIKRVK
FT                   EAGGHIPDDLDTYVNEVSKKGGTPLVVIENNVILGVIYLKDVIKEGLVARFQELRAMGI
FT                   ETVMCTGDNQLTAATIAKEAGVDRFVAECKPEDKINVIKEEQAKGHIVAMTGDGTNDAP
FT                   ALAVANVGLAMNSGTMSAKEAANLIDLDSNPTKLMEVVLIGRQLLMTRGALTTFSIAND
FT                   VAKYFAILPAMFMSAMPAMNHLNMMHLHSPESAVLSALIFNALIIVLLIPIAMKGVKFK
FT                   GVSTQMILIKNILIYGIGGMIVPFIGIKLIDLIIQFIV"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470363.1"
FT   misc_feature    91755..93755
FT                   /note="potassium-transporting ATPase subunit B;
FT                   Provisional; Region: PRK01122"
FT                   /db_xref="CDD:167162"
FT                   /locus_tag="SLGD_00088"
FT   misc_feature    91986..92621
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="SLGD_00088"
FT   misc_feature    <93090..93392
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="SLGD_00088"
FT   gene            93778..94341
FT                   /db_xref="GeneID:8817795"
FT                   /locus_tag="SLGD_00089"
FT   CDS_pept        93778..94341
FT                   /locus_tag="SLGD_00089"
FT                   /gene_family="HOG000244124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Potassium-transporting ATPase C chain"
FT                   /EC_number="3.6.3.12"
FT                   /note="TC 3.A.3.7.1"
FT                   /db_xref="GI:289549460"
FT                   /db_xref="GeneID:8817795"
FT                   /translation="MIQAIRKSTRLVIVMLILCGLLFPLTVTAVGQIIFPHQANGSLIT
FT                   KNGKVVGSELIGQQWESRKYFHGRISAVNYNMNNQEVNSNGGPASGGSNFGNSNPKLKQ
FT                   RVKEMIQQEGKARSVDAVTASASGLDPDITVKNAEQQAQRIAKARDIDVSKVNHVIVEN
FT                   KKSLPMADDYVNVLKMNIALDKLK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470364.1"
FT   misc_feature    93781..94335
FT                   /note="K+-transporting ATPase, c chain; Region: KdpC;
FT                   cl00944"
FT                   /db_xref="CDD:174473"
FT                   /locus_tag="SLGD_00089"
FT   gene            complement(94648..96720)
FT                   /db_xref="GeneID:8817796"
FT                   /locus_tag="SLGD_00090"
FT   CDS_pept        complement(94648..96720)
FT                   /locus_tag="SLGD_00090"
FT                   /gene_family="HOG000280077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="surface protein SasI"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549461"
FT                   /db_xref="GeneID:8817796"
FT                   /translation="MKNNHENNNARPNQHFSIRKFSIGAASITLGTCLFLNAEHQAQAA
FT                   ENAVEPAHSAVASENNTPAQSKPVAPTVETNEQPNADHTDKTVATTTTNDKSRAQANDK
FT                   QTVTPATNVSNTTQPKAAPASTALTTNAVNPKSSTAVSNPAKQAVDQSIKDAVKDKTYT
FT                   NKPHDTSNSRPVSFEMKNKDGDLQFYHYASTISPANVYFNKDKNKTTVELGLKTASTWK
FT                   KFEVYENNKKLPIELVTYNPETDDAYIRFDVSNGTKELVIKSSTQIYNDPETNYDYTKM
FT                   VFEQPIYNDESKFKTREDFETEALLADYNKAKTLERKIYELNRVKDQLPEKLRAQYSQK
FT                   LEQLKKDLDQEVASAKVEFEHAPVKKVQITNSKSLDISVLQSDDDDLSTMDGFVEKPFE
FT                   LVEVDGKKYIKLTTTIDSIWKDFQVEGQRVMTIDKDTVNDKRTVLFPYVEGKEIYNSIV
FT                   KVDFPTIGYSGQYHVRIKNNAISKKADAETPTTPNNKKEAKPDINQADTATSNNKKADK
FT                   PIVKPADTTTDHKKVTKSVVTTTHAPANHKQMNKPTVSVASNTGHTKQTVVQQTAAHNH
FT                   THSNTSHQNVSTKTQISTLNVAKHSVHNQVQHNNQRSHHTQQQDVTKPLSHAQNNHTVQ
FT                   SQISHMHKTAAHPSPVAQHTLPATGQTTNHATLWASLVAILGGIMFLIRPKKKHQ"
FT                   /protein_id="YP_003470365.1"
FT   misc_feature    complement(96613..96684)
FT                   /note="YSIRK type signal peptide; Region: YSIRK_signal;
FT                   cl04650"
FT                   /db_xref="CDD:164062"
FT                   /locus_tag="SLGD_00090"
FT   misc_feature    complement(<96286..>96561)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="SLGD_00090"
FT   misc_feature    complement(95836..96210)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cl02760"
FT                   /db_xref="CDD:155090"
FT                   /locus_tag="SLGD_00090"
FT   misc_feature    complement(95275..95601)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00090"
FT   misc_feature    complement(order(95302..95304,95308..95310,95320..95322,
FT                   95335..95337,95341..95343,95467..95469,95542..95544,
FT                   95551..95556,95578..95580))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00090"
FT   gene            97030..97614
FT                   /db_xref="GeneID:8817797"
FT                   /locus_tag="SLGD_00091"
FT   CDS_pept        97030..97614
FT                   /locus_tag="SLGD_00091"
FT                   /gene_family="HOG000113486" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Substrate-specific component of predicted ECF
FT                   transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549462"
FT                   /db_xref="GeneID:8817797"
FT                   /translation="MKRQTLDVKELIHIGIFTAIYFMVIAIPGILGIIPIFMLLLPAMI
FT                   GFLGAIPIMLLIAKTQKFGALTILCLIINILLIIGGHPWIALIYSIPVTVIADYIMASG
FT                   HYQNTKLNALGYIIFSMWSIGNLLPFYFMRQTFLAHLAERHGSHYEQTVAMLFSYQMIP
FT                   VLIILTIIGAWLGYIIATTVLRKHFKRAGMI"
FT                   /protein_id="YP_003470366.1"
FT   misc_feature    97051..97599
FT                   /note="Hypothetical bacterial integral membrane protein
FT                   (Trep_Strep); Region: Trep_Strep; cl09823"
FT                   /db_xref="CDD:164152"
FT                   /locus_tag="SLGD_00091"
FT   gene            97616..98323
FT                   /db_xref="GeneID:8817798"
FT                   /locus_tag="SLGD_00092"
FT   CDS_pept        97616..98323
FT                   /locus_tag="SLGD_00092"
FT                   /gene_family="HOG000113487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transmembrane component of energizing module of
FT                   predicted ECF transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549463"
FT                   /db_xref="GeneID:8817798"
FT                   /translation="MLGYISNKPRIFNFDPRVKITLMLLISFVAMTGNSLGLHKYPRLF
FT                   LMLIPVCLLIGVGYYYKGLILGIMIGMSWYIEAFMSIRTQLLLFIVVIIITKFASALAM
FT                   GYFIVQTTQVETLIQGLERLKVSRKVTLPLAVMFRFIPTIKEESSAIKDAMTMRQIDVK
FT                   SAGKHPIKYIEYRYVPLINSVLKIGNELTMSAITRGLNLTNARTSIHHIQMTLLDWMML
FT                   LGTLSLVILYYVM"
FT                   /protein_id="YP_003470367.1"
FT   misc_feature    97676..98308
FT                   /note="Cobalt transport protein; Region: CbiQ; cl00463"
FT                   /db_xref="CDD:163835"
FT                   /locus_tag="SLGD_00092"
FT   gene            98335..99795
FT                   /db_xref="GeneID:8817799"
FT                   /locus_tag="SLGD_00093"
FT   CDS_pept        98335..99795
FT                   /locus_tag="SLGD_00093"
FT                   /codon_start="1"
FT                   /product="Duplicated ATPase component of energizing module
FT                   of predicted ECF transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549464"
FT                   /db_xref="GeneID:8817799"
FT                   /translation="MIELKHVSFSYENGTPSLKDIDLLISSGEVICFTGASGCGKTTLL
FT                   RLFNGLIPYFFNGKLTGEIIINGTSTQTQSIYDLSKQTGSVFQNPRAQFFCLNSTSEMA
FT                   FEAENYGYHPQYITEQIRKGTTDLNLSHLLDRDIFKLSGGEKQLLACATIEVCQHDIII
FT                   LDEPSSNLDHETIKKLKQLILRWKQAGKTVIIAEHRLYYLYDIVDRLVVMEQGAVAHSY
FT                   TSAELKQLTQTQLAGLGLRATRLDLLPGKSHQRHIDSENRLQLNEFNFKYKKQDKTTLQ
FT                   LGDLSLARGSVTAIVGHNGAGKSTFARCLCGLERHFKGTVVEAQLTLKRKARLKNVFMV
FT                   FQDVHRQLFAEDLEEELRLSDETLTAEEIQHNLEIFNIAHQSDTHPLALSGGQQQRLAV
FT                   ASAVVSNRKILIFDEPSSGLDGANMRQMAALLNRLADKGYTIVLITHDYELLMACTDEV
FT                   IEIEHGQLVAQFVLNPENEMRLAPLFIN"
FT                   /protein_id="YP_003470368.1"
FT   misc_feature    98335..99012
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98341..98982
FT                   /note="Domain I of the ABC component of a cobalt transport
FT                   family found in bacteria, archaea, and eukaryota.  The
FT                   transition metal cobalt is an essential component of many
FT                   enzymes and must be transported into cells in appropriate
FT                   amounts when needed.  This...; Region:
FT                   ABC_cobalt_CbiO_domain1; cd03225"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98437..98460
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    order(98446..98451,98455..98463,98596..98598,98827..98832,
FT                   98926..98928)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98587..98598
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98755..98784
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98815..98832
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98839..98850
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    98914..98934
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99115..99741
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99139..99735
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99223..99246
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    order(99232..99237,99241..99249,99358..99360,99571..99576,
FT                   99670..99672)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99349..99360
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99499..99528
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99559..99576
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99583..99594
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   misc_feature    99658..99678
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00093"
FT   gene            complement(99880..101820)
FT                   /db_xref="GeneID:8817800"
FT                   /locus_tag="SLGD_00094"
FT   CDS_pept        complement(99880..101820)
FT                   /locus_tag="SLGD_00094"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cell surface protein IsdA, transfers heme from
FT                   hemoglobin to apo-IsdC"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549465"
FT                   /db_xref="GeneID:8817800"
FT                   /translation="MKKHQRIQTNKFGFIANHYSIRKFSVGTASIIVGSLLFLGNPAHA
FT                   AEANTTQNEPATHQENKVETNIDPIIIDQPQNQAATTNQTPKTEQNHTQANKQQAKSNQ
FT                   AAAVTSDSKSQNDAQASPQQSSTSKQDAVKQQATQANTKAPAQPATQQTREAQPVVRSV
FT                   KSATSETTEDFEFQVNKDKTKQKSTMNQYMNHPGKLVHANNKYYFEAELNHAKWWKSFE
FT                   FYDENNNKLNTVVTKDDTSKNIKTIRVEVASGTQQLISKVHIIVPVINYDHEYTTQIAF
FT                   AKPVPQPAKAQASKAQALDVQSTQKNAVKPETLAQAKNVARPSVMTLSAKKPASQQAKS
FT                   AAVTQTAKYKVQKDKSTETSVMDGYMEHPGKFIKENGKTYFEVTLKNADWWKSFQFFTP
FT                   QNKELTTTVVKHDKKADTKTIRVEVKPGMKQLISRVHIVVPAINYDNKYQTTLLFETPV
FT                   PELTTAKPETPKTKPANKTNKAKTSTTKPTKANKENKANKTKKVDKAKNNAPKVVQPAT
FT                   TVNQHSKAAATHKTIKTSHVSTTVNHDATATQHHTPVVASTYKPAKDEVKAQATMAQPT
FT                   TQQHVHLSQNKHEDKQHVAMTKPQPAQQSHMHSLPNTGQENATTSASIFGSLLALGGSI
FT                   LLFGRKRKEQR"
FT                   /protein_id="YP_003470369.1"
FT   misc_feature    complement(101680..>101772)
FT                   /note="YSIRK type signal peptide; Region: YSIRK_signal;
FT                   cl04650"
FT                   /db_xref="CDD:164062"
FT                   /locus_tag="SLGD_00094"
FT   misc_feature    complement(100984..101316)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00094"
FT   misc_feature    complement(order(100990..100992,100996..100998,
FT                   101008..101010,101023..101025,101029..101031,
FT                   101170..101172,101245..101247,101254..101259,
FT                   101281..101283))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00094"
FT   misc_feature    complement(100453..100791)
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00094"
FT   misc_feature    complement(order(100471..100473,100477..100479,
FT                   100489..100491,100504..100506,100510..100512,
FT                   100651..100653,100726..100728,100735..100740,
FT                   100762..100764))
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00094"
FT   gene            102450..103136
FT                   /db_xref="GeneID:8817801"
FT                   /locus_tag="SLGD_00095"
FT   CDS_pept        102450..103136
FT                   /locus_tag="SLGD_00095"
FT                   /gene_family="HOG000059157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NPQTN cell wall anchored protein IsdC"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549466"
FT                   /db_xref="GeneID:8817801"
FT                   /translation="MKTVFKIVSFIFLCIFSFGILSSSSAFAEGQSLNYEVLKYNTNDT
FT                   SIANDYFNKPATVVERNGKKYVQITVNHSHWITGMSIEGKNEKIINTNKAKDERTSEFE
FT                   VSKTSGKVDGKISVYINEKVNGKPFKYDHHYNITYKFNGKDSGSSSAATPGINKSENGG
FT                   TGSAASDAGNGTSSDSNSASTDGSSVENPQTSAGTPAYVYLIPVVAVVFLMLSVAILKR
FT                   NRKGNH"
FT                   /protein_id="YP_003470370.1"
FT   misc_feature    102450..103130
FT                   /note="heme uptake protein IsdC; Region: IsdC; TIGR03656"
FT                   /db_xref="CDD:163379"
FT                   /locus_tag="SLGD_00095"
FT   misc_feature    102540..102875
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00095"
FT   misc_feature    order(102564..102566,102588..102593,102600..102602,
FT                   102675..102677,102801..102803,102807..102809,
FT                   102840..102842,102852..102854,102858..102860)
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00095"
FT   misc_feature    103020..103121
FT                   /note="sortase B signal domain, NPQTN class; Region:
FT                   srtB_sig_NPQTN; TIGR03068"
FT                   /db_xref="CDD:132112"
FT                   /locus_tag="SLGD_00095"
FT   gene            103139..104536
FT                   /db_xref="GeneID:8817802"
FT                   /locus_tag="SLGD_00096"
FT   CDS_pept        103139..104536
FT                   /locus_tag="SLGD_00096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cell surface protein IsdA, transfers heme from
FT                   hemoglobin to apo-IsdC"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549467"
FT                   /db_xref="GeneID:8817802"
FT                   /translation="MSKRLKLLLATSLIFSWSVVTGSYSNAAMLNVRADDSSYSSAPSH
FT                   IDTNQWTHSSNAQLSIYYADSKTLAQSYNKMVDPSVQIIKDHGRLVAKINIAKHGLWKQ
FT                   LQVEDQGQMRLLNIHTTPSQPTKDYVLLPLNKQQTHYKVNVTTIENGQEKQQQLLFNIT
FT                   PSTAQEDGHQVNKRAVNFYVRKKEENKLSHMDDYVKHPGHYVTIQGKRYFEMTLTHIDW
FT                   WQSYQFYHQNTKLQHEVIYENSDTQEATVRIPVEEDTKEIEARIHIVIPELNYDHHYTT
FT                   YIVLGVKHPNETDDSQSDTSAEKRNKDKHQQDPGDKSVPPASEKQQAHVKQQQQTQQNN
FT                   DTHASNNEDTSSRTTTPSNNSETTTQSSSSTPTPSSHESSAQQGEKKQVTTAASKNKAH
FT                   AAQQHKDKNKRTPAFDRNADKSYHTDGNKQPNVNLPKHTKDYIIFGILIFISVAGLIAT
FT                   YFINRKR"
FT                   /protein_id="YP_003470371.1"
FT   misc_feature    103673..103993
FT                   /note="NEAr Transport domain, a component of cell surface
FT                   proteins; Region: NEAT; cd06920"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00096"
FT   misc_feature    order(103691..103693,103715..103720,103727..103729,
FT                   103802..103804,103940..103942,103946..103948,
FT                   103961..103963,103973..103975,103979..103981)
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:132993"
FT                   /locus_tag="SLGD_00096"
FT   gene            104545..105435
FT                   /db_xref="GeneID:8817803"
FT                   /locus_tag="SLGD_00097"
FT   CDS_pept        104545..105435
FT                   /locus_tag="SLGD_00097"
FT                   /gene_family="HOG000059045" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme transporter IsdDEF, lipoprotein IsdE"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549468"
FT                   /db_xref="GeneID:8817803"
FT                   /translation="MNISKIMSSLAILLMLLTGCSQSSKHTKGDNVDQQGNAYRIVPTT
FT                   VALTMTLDKLDIPIVGKPTTYKTLPKRYKDVPEVGQPMQPSVEAVKQVNPTHVLSVSTI
FT                   KDEMKPFYKQLNMKGYYYDYDSLDGMEKSITQLGHQFNRESKAKALNQHINSVKKDIQD
FT                   KAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKDTSKQYISSNTENLV
FT                   NVDPDIILRLPHGMPDEVKKMFQKEFKQNDIWKHFKAVKEDRVYDLEEIPFGITANVDA
FT                   DDAMKQLYDVFYNQH"
FT                   /protein_id="YP_003470372.1"
FT   misc_feature    104662..105426
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="SLGD_00097"
FT   misc_feature    104665..105348
FT                   /note="Periplasmic binding protein; Region: Peripla_BP_2;
FT                   pfam01497"
FT                   /db_xref="CDD:144914"
FT                   /locus_tag="SLGD_00097"
FT   misc_feature    order(104872..104877,104884..104886,104971..104973)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="SLGD_00097"
FT   gene            105457..106431
FT                   /db_xref="GeneID:8817804"
FT                   /locus_tag="SLGD_00098"
FT   CDS_pept        105457..106431
FT                   /locus_tag="SLGD_00098"
FT                   /gene_family="HOG000045409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme transporter IsdDEF, permease component IsdF"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549469"
FT                   /db_xref="GeneID:8817804"
FT                   /translation="MKKHPAFLMVIMLALLIVTTYVAVVVGKIPISFDQVMTKVTTGSE
FT                   QHVDAVIDLRFPRIFIALFVGAILAVSGALLQAVLQNPLAEANILGVSSGALVVRSLVL
FT                   LLFPGLYFYAPFLSFIGGVIPFMVLFVLIAKYKLAPVRMILVGVALYAMLNGILELLAQ
FT                   DPFMKIPQGLTMKTWNDVYIVAITAIIGITLALILAQKTNLLAFDEKQANNIGFNITKY
FT                   RLMIGLVAVFLASGATAIVGQMAFVGLIVPHIVRRCIGSNYKKVLPYSAMMGAWLVLLA
FT                   DIIGRTIHPPLEIPANVLTMMLGGPILIYMICKGAVSHAHRTS"
FT                   /protein_id="YP_003470373.1"
FT   misc_feature    105472..106392
FT                   /note="ABC-type enterobactin transport system, permease
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   FepG; COG4779"
FT                   /db_xref="CDD:34391"
FT                   /locus_tag="SLGD_00098"
FT   misc_feature    105631..106392
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00098"
FT   misc_feature    order(105685..105687,105697..105705,106042..106047,
FT                   106051..106059,106063..106068,106072..106089,
FT                   106093..106101,106222..106224,106243..106245)
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00098"
FT   misc_feature    order(105700..105702,105706..105708,105721..105723,
FT                   105880..105882,105886..105891,105898..105903,
FT                   105910..105915,105922..105924,105931..105936,
FT                   105940..105942,105964..105969,105976..105978,
FT                   106192..106194,106348..106350,106357..106362,
FT                   106369..106371,106378..106383,106390..106392)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00098"
FT   misc_feature    order(105940..105942,105994..105996,106168..106170,
FT                   106180..106182,106312..106314,106339..106341)
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00098"
FT   gene            106412..107191
FT                   /db_xref="GeneID:8817805"
FT                   /locus_tag="SLGD_00099"
FT   CDS_pept        106412..107191
FT                   /locus_tag="SLGD_00099"
FT                   /codon_start="1"
FT                   /product="Heme transporter analogous to IsdDEF, ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549470"
FT                   /db_xref="GeneID:8817805"
FT                   /translation="MRIEHLNFYYDLQRPIFEDISLEFKSNAITTIIGPNGSGKSTLLQ
FT                   LLSHNLKPKSGQIFLQDKLLNQYSQKALAQRLATVHQKSKVPEDFTVRQVIETGRYSYQ
FT                   RLFKKDLRKDSVVNTVIQQLDLTQFEHQSVMNLSGGELQRVFIGMALAQEPQYLLLDEP
FT                   TTFLDIHYQYQVLDIIKWLHEEYQMTIIMVLHDINQAIEYSDELICLGNKGLLAQGRPK
FT                   DIIDHTLIQDMYHIDAKILQDPDCGTVIVKKRGGHNK"
FT                   /protein_id="YP_003470374.1"
FT   misc_feature    106412..107164
FT                   /note="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components [Inorganic ion transport and
FT                   metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
FT                   /db_xref="CDD:31317"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106415..107068
FT                   /note="ABC transporters, involved in the uptake of
FT                   siderophores, heme, and vitamin B12, are widely conserved
FT                   in bacteria and archaea.  Only very few species lack
FT                   representatives of the siderophore family transporters. The
FT                   E. coli BtuCD protein is an ABC...; Region:
FT                   ABC_Iron-Siderophores_B12_Hemin; cd03214"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106511..106534
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    order(106520..106525,106529..106537,106655..106657,
FT                   106892..106897,106994..106996)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106646..106657
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106820..106849
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106880..106897
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106904..106915
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   misc_feature    106982..107002
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72973"
FT                   /locus_tag="SLGD_00099"
FT   gene            107188..107910
FT                   /db_xref="GeneID:8817806"
FT                   /locus_tag="SLGD_00100"
FT   CDS_pept        107188..107910
FT                   /locus_tag="SLGD_00100"
FT                   /gene_family="HOG000058823" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NPQTN specific sortase B"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549471"
FT                   /db_xref="GeneID:8817806"
FT                   /translation="MKLVLRLCQIILIAVIVISVYQIYHLHLADKQAEERYKNLQQNYT
FT                   TQSANNEVRPQFTQLEQVNKDIVGWIHLSDSTLNYPVLQAKDNKTYLQHDFEHEASRKG
FT                   SIFMDYRNAIAQPDLNTVIYGHHVGDNTMFDVLEKYLKQSFYDKHKSIQFDTKYHKYRL
FT                   EVLSAYQTTTKDNYIQTYFKTQQAYDKFLKETMRKSVINTTTEVSAKDKIVTLSTCEDA
FT                   YSQTSGRIVVVTKLVELK"
FT                   /protein_id="YP_003470375.1"
FT   misc_feature    107275..107895
FT                   /note="Sortase B (SrtB) or subfamily-2 sortases are
FT                   membrane cysteine transpeptidases found in gram-positive
FT                   bacteria that anchor surface proteins to peptidoglycans of
FT                   the bacterial cell wall envelope. This involves a
FT                   transpeptidation reaction in which the...; Region:
FT                   Sortase_B_2; cd05826"
FT                   /db_xref="CDD:99709"
FT                   /locus_tag="SLGD_00100"
FT   misc_feature    order(107449..107451,107515..107517,107551..107553,
FT                   107557..107559,107563..107565,107839..107844,
FT                   107863..107865,107872..107874)
FT                   /note="active site"
FT                   /db_xref="CDD:99709"
FT                   /locus_tag="SLGD_00100"
FT   misc_feature    order(107563..107565,107842..107844,107872..107874)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:99709"
FT                   /locus_tag="SLGD_00100"
FT   gene            107928..108251
FT                   /db_xref="GeneID:8817807"
FT                   /locus_tag="SLGD_00101"
FT   CDS_pept        107928..108251
FT                   /locus_tag="SLGD_00101"
FT                   /gene_family="HOG000008026" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Heme-degrading cytoplasmic oxygenase IsdG"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549472"
FT                   /db_xref="GeneID:8817807"
FT                   /translation="MNFMAENKLKLDKGTAEGIIDRFYTRHGIETLEGFKGMFVTKTHE
FT                   LEDYDEVKILTLWDTEEDFKDWLQSDVFRKAHQHVRHQSQDSSSPILENTVIKYDIGYQ
FT                   YLK"
FT                   /protein_id="YP_003470376.1"
FT   misc_feature    107934..108248
FT                   /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
FT                   cl10022"
FT                   /db_xref="CDD:175061"
FT                   /locus_tag="SLGD_00101"
FT   gene            108325..109821
FT                   /db_xref="GeneID:8817808"
FT                   /locus_tag="SLGD_00102"
FT   CDS_pept        108325..109821
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 4,
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   needed for cell separation and autolysis"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00102"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="GI:289549473"
FT                   /db_xref="GeneID:8817808"
FT                   /translation="MSRNKLIFCVITVTALSQLISTPLSSYAMDTQVHQHKNKKVHKQD
FT                   EDAYLSPKDKHIESTEVPINDIEEEVPLPKVVASHQRVNQHKPPKVTLLPPNETSTVAS
FT                   QHDDETLIQRMQHDEESNDVQSKQLTTSKAQHQQVNNPQTSENESSQRRAAQVVTKQGD
FT                   SSTNGYRDTAILQQAPDTDDDKVETQYEVAQSSDTREFIQNIAEDAHHVAQKEHLYASV
FT                   MIAQAILESDSGNSALASAPHNNLFGVKGAYQGETTNFNTLEADSEGKMYQTTAAFRNY
FT                   PDTKAALEDYAKLIRYGIDGNNNIYQGSWKTPGMTYEDATKSLVGTYSTDPDYDKKLNS
FT                   IIKQYRLTELDGEEMPILDEAFFNKSYDDNQGDYKPFKEMDSQSKNFYPQGQCTWYVYN
FT                   RLQQFNLYVDGSMGNGGDWAVRARDKGYQVSNHPSEHTAVSFKPGQLNADRYYGHVAFV
FT                   EKVNSDGSIIISESNVKGLGVISYRKINANQAETLQYIQP"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470377.1"
FT   misc_feature    108901..109407
FT                   /note="Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase; Region: Glucosaminidase;
FT                   cl00743"
FT                   /db_xref="CDD:174371"
FT                   /locus_tag="SLGD_00102"
FT   misc_feature    109474..109812
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="SLGD_00102"
FT   gene            complement(110175..111173)
FT                   /db_xref="GeneID:8817809"
FT                   /locus_tag="SLGD_00103"
FT   CDS_pept        complement(110175..111173)
FT                   /locus_tag="SLGD_00103"
FT                   /gene_family="HOG000045409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Siderophore staphylobactin ABC transporter,
FT                   permease protein SirC"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549474"
FT                   /db_xref="GeneID:8817809"
FT                   /translation="MTERIKKKDFYYLIIALIFLIVISVISMMAGSSYISLQRIVMYFF
FT                   NPADSIDQFTIEVLRLPRIILAILAGMALGISGLILQNVLKNPIASPDIIGITGGASLG
FT                   AVIFINFFNQISIQVLPLFAVTGGMIAMLVLLIFQKHGQIKPTTLIIIGISMQTLCIAL
FT                   VQGLLITTKQLSAAKAYTWLVGSLYGATFKDSIVLGSVLIAIVPLLLVIIPKMKISALT
FT                   DPLAIGLGLHVQRMKLMQILIATILVSIAISLVGNISFVGLIAPHIAKTIVKGSYASKL
FT                   LMSGMLGAISIVIADLIGRTLFLPKEVPAGIFIAAFGAPFFIYLLLTVKKL"
FT                   /protein_id="YP_003470378.1"
FT   misc_feature    complement(110265..110963)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00103"
FT   misc_feature    complement(order(110343..110345,110364..110366,
FT                   110487..110495,110499..110516,110520..110525,
FT                   110529..110537,110541..110546,110910..110918,
FT                   110928..110930))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00103"
FT   misc_feature    complement(order(110394..110396,110622..110624,
FT                   110631..110636,110667..110669,110673..110675,
FT                   110679..110681,110688..110690,110697..110702,
FT                   110709..110714,110721..110726,110730..110732,
FT                   110892..110894,110907..110909,110913..110915))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00103"
FT   misc_feature    complement(order(110274..110276,110406..110408,
FT                   110418..110420,110592..110594,110667..110669))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00103"
FT   gene            complement(111170..112165)
FT                   /db_xref="GeneID:8817810"
FT                   /locus_tag="SLGD_00104"
FT   CDS_pept        complement(111170..112165)
FT                   /locus_tag="SLGD_00104"
FT                   /gene_family="HOG000045410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Siderophore staphylobactin ABC transporter,
FT                   permease protein SirB"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549475"
FT                   /db_xref="GeneID:8817810"
FT                   /translation="MLLKPKYQIALAGFCLVIVAISSLMIGNTLVSPMTLIQALFNFDS
FT                   ANELHHIVTGTRTSRTIIALLTGAALAIAGLLMQALTRNPIASPGLFGVNAGAVFFVIL
FT                   SITFFQIQSFKVIIVIAFLGAIIVTILVVTLGMFRQTQFSPQRVILAGAAISMLFTAFT
FT                   QGILIMNETDLQGLLFWLSGSVSLRNIWDMTWIIPLILILILIAFSMGAHINILMTSDD
FT                   IATGLGQNIRVVKWLIILLISMLASISVAVAGSIAFIGLIVPNISKRLLPPNYKYLIPF
FT                   NALAGANLMLLSDMIARVIIQPLELPIGVVTAIMGASVLIYLMQKGPHRL"
FT                   /protein_id="YP_003470379.1"
FT   misc_feature    complement(111194..111934)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00104"
FT   misc_feature    complement(order(111341..111343,111362..111364,
FT                   111485..111493,111497..111514,111518..111523,
FT                   111527..111535,111539..111544,111911..111919,
FT                   111929..111931))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00104"
FT   misc_feature    complement(order(111194..111196,111203..111208,
FT                   111215..111217,111224..111229,111236..111238,
FT                   111392..111394,111620..111622,111629..111634,
FT                   111665..111667,111671..111676,111683..111685,
FT                   111692..111697,111704..111709,111716..111721,
FT                   111725..111727,111893..111895,111908..111910,
FT                   111914..111916))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00104"
FT   misc_feature    complement(order(111245..111247,111272..111274,
FT                   111404..111406,111416..111418,111590..111592,
FT                   111665..111667))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="SLGD_00104"
FT   gene            complement(112181..113173)
FT                   /db_xref="GeneID:8817811"
FT                   /locus_tag="SLGD_00105"
FT   CDS_pept        complement(112181..113173)
FT                   /locus_tag="SLGD_00105"
FT                   /gene_family="HOG000045521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Siderophore staphylobactin ABC transporter,
FT                   substrate-binding protein SirA, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549476"
FT                   /db_xref="GeneID:8817811"
FT                   /translation="MNKVVNIIVTALACIVILAGCSGNSNKSTSDQSDKDTMKIKHAMG
FT                   TTEIKGQPKRVVTLYQGATDVAVSLGVKPVGAVESWTQKPKYNYLKKALKDTTIVGQEP
FT                   TPNLEEISKLKPDLIVASKVRNEKVYDQLSKIAPTISTDNVFKFKDTTKLMGKALGKER
FT                   KADKLLKKYDDKVAAFKKDAEAKYKDAWPLSASVVNFRADHTRIYAGGYAGEILSDLGF
FT                   KRNKALQKEVDKGKDIIQLTSKESIPLMKADHIFVVQSDPTAKDAGLVKKTEDEWTSSK
FT                   EWKHLTAVKNNQVSTDLDEITWNLAGGYQSSLKLIDDLYDKLNIDKQSK"
FT                   /protein_id="YP_003470380.1"
FT   misc_feature    complement(112193..113155)
FT                   /note="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component [Inorganic ion transport and
FT                   metabolism]; Region: FepB; COG0614"
FT                   /db_xref="CDD:30959"
FT                   /locus_tag="SLGD_00105"
FT   misc_feature    complement(112220..113023)
FT                   /note="Fe3+-siderophore binding domain FhuD.  These
FT                   proteins have been shown to function as initial receptors
FT                   in ABC transport of Fe3+-siderophores in many eubacterial
FT                   species. They belong to the TroA-like superfamily of
FT                   helical backbone metal receptor...; Region: FhuD; cd01146"
FT                   /db_xref="CDD:29749"
FT                   /locus_tag="SLGD_00105"
FT   misc_feature    complement(order(112556..112558,112799..112801,
FT                   112862..112867,112916..112918))
FT                   /note="siderophore binding site; other site"
FT                   /db_xref="CDD:29749"
FT                   /locus_tag="SLGD_00105"
FT   gene            complement(113536..114144)
FT                   /db_xref="GeneID:8817812"
FT                   /locus_tag="SLGD_00106"
FT   CDS_pept        complement(113536..114144)
FT                   /locus_tag="SLGD_00106"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549477"
FT                   /db_xref="GeneID:8817812"
FT                   /translation="MYIPKHYQMKNDNNIKKFMEEHNFVTIVTVDDHIPIATHVPVMIE
FT                   YNEDTMYLSGHFAKGNPQWKTIQDNSNILVIFSGPHSYISSSWYEEEDVPTWDYQSVHA
FT                   YGTGALLNEAELTYALKSMLNKYEAHRENGATWDKLSNQTLKQIKGVIGFKIKVNRLEA
FT                   AYKLSQTRSEKEKENIISKLKQSNDNVQINLADETENYK"
FT                   /protein_id="YP_003470381.1"
FT   misc_feature    complement(113662..114141)
FT                   /note="Pyridoxine 5'-phosphate (PNP) oxidase-like proteins;
FT                   Region: PNPOx_like; cl00381"
FT                   /db_xref="CDD:174160"
FT                   /locus_tag="SLGD_00106"
FT   gene            complement(114158..114664)
FT                   /db_xref="GeneID:8817813"
FT                   /locus_tag="SLGD_00107"
FT   CDS_pept        complement(114158..114664)
FT                   /locus_tag="SLGD_00107"
FT                   /gene_family="HOG000078532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protease synthase and sporulation negative
FT                   regulatory protein pai 1"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549478"
FT                   /db_xref="GeneID:8817813"
FT                   /translation="MIRSCTIDDAVQLQKIAYQTFDETFRFQNKEENINQYLAENFTHD
FT                   KVIDELNNPHSFFYFIYDEDKLAGYLKLNIKDAQTETYNDNDLEIERIYILSTFQHKGL
FT                   GKALFNQALTLANQLSCDSIWLGVWEKNDNAIIFYKSLGFHVIDSHIFYMGDEKQTDYI
FT                   MMMHI"
FT                   /protein_id="YP_003470382.1"
FT   misc_feature    complement(114173..114562)
FT                   /note="ribosomal-protein-alanine acetyltransferase; Region:
FT                   rimI; TIGR01575"
FT                   /db_xref="CDD:162430"
FT                   /locus_tag="SLGD_00107"
FT   misc_feature    complement(114287..114493)
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="SLGD_00107"
FT   misc_feature    complement(order(114347..114352,114380..114388))
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="SLGD_00107"
FT   misc_feature    complement(114173..>114370)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="SLGD_00107"
FT   gene            complement(114682..115134)
FT                   /db_xref="GeneID:8817814"
FT                   /locus_tag="SLGD_00108"
FT   CDS_pept        complement(114682..115134)
FT                   /locus_tag="SLGD_00108"
FT                   /gene_family="HOG000225730" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549479"
FT                   /db_xref="GeneID:8817814"
FT                   /translation="MEDILRDIGVIARALDSISNIEFKEIDLTKGQFIYLTRICENPGI
FT                   IQEKLAEMLKIDRTTASRAIKNLEKNHMIVKKNDATNKKNKLLFPTEKGKSLYPFIIRE
FT                   NNHSNAVALQGFSQKEITDLSLALKRVKQNISEDWSKVKKGYKRKY"
FT                   /protein_id="YP_003470383.1"
FT   misc_feature    complement(114745..115107)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   MarR; COG1846"
FT                   /db_xref="CDD:32031"
FT                   /locus_tag="SLGD_00108"
FT   misc_feature    complement(114772..115071)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00108"
FT   gene            115500..115700
FT                   /db_xref="GeneID:8817815"
FT                   /locus_tag="SLGD_00109"
FT   CDS_pept        115500..115700
FT                   /locus_tag="SLGD_00109"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549480"
FT                   /db_xref="GeneID:8817815"
FT                   /translation="MKKAWYKRIFNPVNYCQYLVHSLKHVPGPTDKASWGGAPTERIST
FT                   RNSTSKASWGRPPTERKEQAL"
FT                   /protein_id="YP_003470384.1"
FT   gene            complement(115758..116690)
FT                   /db_xref="GeneID:8817816"
FT                   /locus_tag="SLGD_00110"
FT   CDS_pept        complement(115758..116690)
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /gene_family="HOG000050222" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00110"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="GI:289549481"
FT                   /db_xref="GeneID:8817816"
FT                   /translation="MYKIAIAGAGAMGGRIGVSLKQAGYDVTLIDDWQEHVNCINENGM
FT                   EVQTEMDTYTVNIPAVLTKDVSGQFDLIIILTKAMQSEKMLQHLQEANTIHKDTAILSM
FT                   MNGLGHEERLSKLVPLSQIYLAVTMWTAGLRGPGQLLLEGEGAIDLQRADGEKDSRTEV
FT                   ILNMLNTSGLNAQISSDVFKSIWSKATLNSVLNPLCTILDKTIYEFGCYEDAQDMITPI
FT                   VDEIISVGQAKHIDLNRQTLLDKIEASYPKEAQGLHYPSMHQDYNNGRLTEIDYLNGQI
FT                   VEYGKVFNIPTPTNALITHLIHQLEMKNH"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470385.1"
FT   misc_feature    complement(115773..116633)
FT                   /note="2-dehydropantoate 2-reductase; Reviewed; Region:
FT                   PRK06522"
FT                   /db_xref="CDD:168592"
FT                   /locus_tag="SLGD_00110"
FT   misc_feature    complement(116226..116633)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00110"
FT   misc_feature    complement(115773..116153)
FT                   /note="Ketopantoate reductase PanE/ApbA C terminal; Region:
FT                   ApbA_C; pfam08546"
FT                   /db_xref="CDD:149559"
FT                   /locus_tag="SLGD_00110"
FT   gene            117159..118277
FT                   /db_xref="GeneID:8817817"
FT                   /locus_tag="SLGD_00111"
FT   CDS_pept        117159..118277
FT                   /locus_tag="SLGD_00111"
FT                   /codon_start="1"
FT                   /product="multiple sugar-binding transport ATP-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549482"
FT                   /db_xref="GeneID:8817817"
FT                   /translation="MITLKHLNKVYDGNHYAVKDFNLEVDDQEFVVFVGPSGCGKSTTL
FT                   RMIAGLEEISEGEIYVDDQLLNQVQPKDRGIAMVFQNYALYPHMSVYKNLAFGLKMRGI
FT                   HKKEYDQRIQDAAKILEISHLLDRKPKALSGGQRQRVALGRAIVRDAKIFLMDEPLSNL
FT                   DAKLRTHMRTEIIKLHKKMGATTIYVTHDQTEAMTMATKIVLLKDGVIQQVGSPEEIYH
FT                   HPINQFVATFIGNPTMNMIPLDIKDQSWLFNQQLVVDAQVLGVFEHNALNLGIRSENIQ
FT                   FSTESAALKDYELQLPDWQVTLVELIGATKLIHCVNGETHIVVSTDNQMDLKPGETIHL
FT                   GMQLADCHLFDRETGDLVTPQQQAMNSETVSI"
FT                   /protein_id="YP_003470386.1"
FT   misc_feature    117159..118223
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:171228"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117162..117803
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117261..117284
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    order(117270..117275,117279..117287,117399..117401,
FT                   117627..117632,117729..117731)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117390..117401
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117555..117584
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117615..117632
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117639..117650
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117717..117737
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="SLGD_00111"
FT   misc_feature    117975..118208
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="SLGD_00111"
FT   gene            118305..119273
FT                   /db_xref="GeneID:8817818"
FT                   /locus_tag="SLGD_00112"
FT   CDS_pept        118305..119273
FT                   /locus_tag="SLGD_00112"
FT                   /gene_family="HOG000047980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="maltose/maltodextrin transport permease-like
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549483"
FT                   /db_xref="GeneID:8817818"
FT                   /translation="MKETLHVNHAHPVKQHKVTLLQRIWQHKVLYLMLLPCLLFFLIFN
FT                   YIPMAGLVLAFKEFRFDTTIFGGQWEGFKYFKRFFSDSQSYQIIINTLIISGMKLVLAL
FT                   PFPIALAIMFNEISHTKKLGRFRGLFQGVMYIPHFLSWVVVVGIFQKVLAPDSGLINQL
FT                   IQQFGGNGATFFMMNPEYFHTIMFSSYLWKNVGWDSIIYFAAIMGINPEIYESAKIDGA
FT                   NRWQQIIHITLPMLTPTIIILFILSLGDILKAGFDQIYLLKTPGNAKYAEILDTFVIRT
FT                   GIQQGDFSYSIAIGLLQGVIGLILVIVVNRFADRKFNTSLY"
FT                   /protein_id="YP_003470387.1"
FT   misc_feature    118440..119183
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="SLGD_00112"
FT   gene            119284..120975
FT                   /db_xref="GeneID:8817819"
FT                   /locus_tag="SLGD_00113"
FT   CDS_pept        119284..120975
FT                   /locus_tag="SLGD_00113"
FT                   /gene_family="HOG000147907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter (membrane spanning protein)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549484"
FT                   /db_xref="GeneID:8817819"
FT                   /translation="MKHIKKLSILLLVLLLVFVTACGKDEDEEKRRADAKGKPKTWIAD
FT                   RKLKGLVFQSKNDVSPEMNKEIEKELKKKTGITLELQTASGNDSTEALTSGLASGDLPD
FT                   FIVYYLDNSGRPEMKVLNKAAKQGQLTDLKPLLKDTNVYKKYLKKDYLPKDTRDNIMFP
FT                   KDLDGTYFVHMGINRKPGDPGRKVVGGPYIRKDIAEQLNLDPSSIKTSKDMKALAEKIK
FT                   NHHFKDDNGKEITPIGPTAWGGSDRTAFYNDLVWTGGADEKFQIDHDKVKHESDTDYGM
FT                   KRVKYVKSLMDEGLMHKAFYTMSENQAKEGLVNGSWGIVSDLHNYVTENQSMKYIPLGP
FT                   LNTVKGKYQMEMSYKSGYGGWSIPKSTKHPEDVVKLADFLASREGKLLGEYGIKGRDYN
FT                   LDKKGNPVVKKEVLKEIDEHPDQAKKRGFRGAGSYWADHLGLTDVDNLDDFGEREYGDN
FT                   ARKKQGKTNPEKMAESWHYDEKLKHAKVIDGLTVKSFLPKFDKGEELEIALDEYDESLK
FT                   RAYYAKTDKESERILEDAKKKLDQAGLPEFEKMIEKKIKNGEKIRF"
FT                   /protein_id="YP_003470388.1"
FT   misc_feature    <119884..120441
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="SLGD_00113"
FT   gene            120989..121885
FT                   /db_xref="GeneID:8817820"
FT                   /locus_tag="SLGD_00114"
FT   CDS_pept        120989..121885
FT                   /locus_tag="SLGD_00114"
FT                   /gene_family="HOG000220527" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="maltose/maltodextrin transport permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549485"
FT                   /db_xref="GeneID:8817820"
FT                   /translation="MKIKRDWSSIIIRSISWVIIITLALSILLPMINIIALAFNSGADA
FT                   QKGGITFWPRQFSLDNFKEIFKQGTILNALFISLAKTIIGTVLSVILTAMAAYALTIKS
FT                   LPFRRTISFFLVFTMLFSAGVVPLYILLNQLSLTDTFWVYIIPSLYSVYNILIMRTFFN
FT                   QIPISVIEAARIDGCNDWQIFWKIILPMSKPVIATITLFNAVSQWNDWFTGAFFVRNPQ
FT                   LKPLATVLQDMLTSQDSIANALKQKSGAYQMIERITITGDSLQMAMIVLLIIPVLLLFP
FT                   FVQKHFVKGVNIGSTKE"
FT                   /protein_id="YP_003470389.1"
FT   misc_feature    121199..121708
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00114"
FT   misc_feature    order(121247..121252,121259..121264,121277..121279,
FT                   121307..121318,121322..121339,121346..121351,
FT                   121355..121357,121430..121435,121439..121441,
FT                   121445..121447,121454..121459,121463..121465,
FT                   121475..121480,121487..121489,121538..121540,
FT                   121580..121585,121592..121594,121613..121618,
FT                   121622..121627,121634..121639,121676..121681)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00114"
FT   misc_feature    order(121325..121339,121340..121357,121613..121618,
FT                   121622..121633)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00114"
FT   misc_feature    order(121355..121357,121415..121417,121634..121636,
FT                   121670..121672,121679..121681)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00114"
FT   misc_feature    order(121490..121528,121544..121549,121559..121561)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00114"
FT   gene            121899..122759
FT                   /db_xref="GeneID:8817821"
FT                   /locus_tag="SLGD_00115"
FT   CDS_pept        121899..122759
FT                   /locus_tag="SLGD_00115"
FT                   /gene_family="HOG000249829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphohydrolase, Icc family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549486"
FT                   /db_xref="GeneID:8817821"
FT                   /translation="MSKFKIMQFTDLHLSPKNNDKDQQTYQLLEQLITTYQPDLCMFTG
FT                   DQIWSQGVMDSEKVYRNLIEFLNQFDTSIATTFGNHDTENHLSRSDLRQIEAELANNYA
FT                   CKKHSKIVNDKEAYVLEVYDNDQLSHLLYVIDGGDYSTTAIGQYAYIHPDHVAWIAEVE
FT                   RYYEQQDQIMPKHNLLFTHIPIPEYQAISQTKLYHGIFNEEIGCPTMNSGLFAQMLHSG
FT                   NIEGMFCGHDHDNDFSFNHYGIHLNYGRISGFHCYGDITRGARLIELSPNKPYETKIVE
FT                   YDQCF"
FT                   /protein_id="YP_003470390.1"
FT   misc_feature    121902..>122186
FT                   /note="Saccharomyces cerevisiae DCR2 phosphatase and
FT                   related proteins, metallophosphatase domain; Region:
FT                   MPP_Dcr2; cd07383"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00115"
FT   misc_feature    121908..122597
FT                   /note="Calcineurin-like phosphoesterase; Region:
FT                   Metallophos; pfam00149"
FT                   /db_xref="CDD:143917"
FT                   /locus_tag="SLGD_00115"
FT   misc_feature    order(121929..121931,121935..121937,122034..122036,
FT                   122136..122141)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00115"
FT   misc_feature    order(121929..121931,121935..121937,122034..122036,
FT                   122136..122138)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00115"
FT   misc_feature    <122340..122672
FT                   /note="Saccharomyces cerevisiae DCR2 phosphatase and
FT                   related proteins, metallophosphatase domain; Region:
FT                   MPP_Dcr2; cd07383"
FT                   /db_xref="CDD:163626"
FT                   /locus_tag="SLGD_00115"
FT   gene            122743..124083
FT                   /db_xref="GeneID:8817822"
FT                   /locus_tag="SLGD_00116"
FT   CDS_pept        122743..124083
FT                   /locus_tag="SLGD_00116"
FT                   /gene_family="HOG000147914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549487"
FT                   /db_xref="GeneID:8817822"
FT                   /translation="MTSVSKSRFQKIYVPILIEQLFMMLMGQADVIMLSAYDTKAIAVS
FT                   GISTQILTLLTFVITIVHVGVSIRLVHQKERDMTAIKSELYHSLTLNLVLSALLGITAL
FT                   ICYRWILMLMQVSQDIFELTYQFGVILLLGFAITTAQMLVSTILRILYMANIAAKITVG
FT                   INIINIILSCCILFVFTDYVGNPILAVAVATLMSRLLGLLYGGYYLIKKYKPQAKFLKL
FT                   NMFMTKKVILLGLPGAGEQISYNFAQTITTAFIAVLGTEVLAAKSLTVAISNVSFCVAM
FT                   AYSLASQIYLGKLIARRKFNVLHRSVYKGLAINVLRSAVIMVAVVGVFYSLGRYISGDD
FT                   SVYHLTLSYLMLFIALEPIRAINNFIVDILNVAGDVRYPVCVNVITTWCLLIPLSYLTA
FT                   FVLGWGYIGIILINIFEEGVRFILIIRRWDKGHWKMKLAQIGVHLHV"
FT                   /protein_id="YP_003470391.1"
FT   misc_feature    122773..124056
FT                   /note="Na+-driven multidrug efflux pump [Defense
FT                   mechanisms]; Region: NorM; COG0534"
FT                   /db_xref="CDD:30880"
FT                   /locus_tag="SLGD_00116"
FT   misc_feature    122785..123189
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="SLGD_00116"
FT   misc_feature    123448..123933
FT                   /note="MatE; Region: MatE; pfam01554"
FT                   /db_xref="CDD:144956"
FT                   /locus_tag="SLGD_00116"
FT   gene            124076..124840
FT                   /db_xref="GeneID:8817823"
FT                   /locus_tag="SLGD_00117"
FT   CDS_pept        124076..124840
FT                   /locus_tag="SLGD_00117"
FT                   /gene_family="HOG000224683" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lactose phosphotransferase system repressor"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549488"
FT                   /db_xref="GeneID:8817823"
FT                   /translation="MYKKKSRLEVICERIATHGKVFVSDLALYFEVTPETIRKDLETLE
FT                   EDKKVTRIHGGAVKYNYLNKEQSYTNKWEKQAQVKERLAMRAAQFINNAEIIVLDGGTT
FT                   IGRIPKYLNHLSNCTFVTNSFMTVMELNKAVEEQRIEAEIIMLPGISNTEQDVVRGSLT
FT                   NQVLQQFKFDKAFLSCGAFDTSQIYEYDLEEALVSNMMLQKSSETFLVADSTKRDNNAS
FT                   FVINDFKAIDYMITDYAKPDHVEFDNNHWLQV"
FT                   /protein_id="YP_003470392.1"
FT   misc_feature    124082..124801
FT                   /note="Transcriptional regulators of sugar metabolism
FT                   [Transcription / Carbohydrate transport and metabolism];
FT                   Region: GlpR; COG1349"
FT                   /db_xref="CDD:31540"
FT                   /locus_tag="SLGD_00117"
FT   misc_feature    124094..124249
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00117"
FT   misc_feature    124313..124786
FT                   /note="SugarP_isomerase: Sugar Phosphate Isomerase family;
FT                   includes type A ribose 5-phosphate isomerase (RPI_A),
FT                   glucosamine-6-phosphate (GlcN6P) deaminase, and
FT                   6-phosphogluconolactonase (6PGL). RPI catalyzes the
FT                   reversible conversion of ribose-5-phosphate to...; Region:
FT                   SugarP_isomerase; cl00339"
FT                   /db_xref="CDD:174126"
FT                   /locus_tag="SLGD_00117"
FT   gene            124964..125542
FT                   /db_xref="GeneID:8817824"
FT                   /locus_tag="SLGD_00118"
FT   CDS_pept        124964..125542
FT                   /locus_tag="SLGD_00118"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549489"
FT                   /db_xref="GeneID:8817824"
FT                   /translation="MKKTLYLIRHGQTIFNKKCQIQGASDSPLTDLGKQQAALAKTYFN
FT                   QLNLSDYELFSSTQERASDTLEIIFPNENYRRLKGIKEWNYGIYEGESELLNPPHDSVI
FT                   DFGSFFADYGGETADEVQQRTVNTLQEILNETNKHNVVVVSHGDVLSLFTHTCLPLAEA
FT                   SEMKFTNCCILKFDYEDGAFTFKSIHHPA"
FT                   /protein_id="YP_003470393.1"
FT   misc_feature    124973..125506
FT                   /note="Histidine phosphatase domain found in
FT                   phosphoglycerate mutases and related proteins, mostly
FT                   phosphatases; contains a His residue which is
FT                   phosphorylated during the reaction; Region: HP_PGM_like;
FT                   cd07067"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="SLGD_00118"
FT   misc_feature    order(124988..124993,125144..125146,125399..125404)
FT                   /note="catalytic core; other site"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="SLGD_00118"
FT   gene            complement(125814..126860)
FT                   /db_xref="GeneID:8817825"
FT                   /locus_tag="SLGD_00119"
FT   CDS_pept        complement(125814..126860)
FT                   /product="Sensor histidine protein kinase SaeS (exoprotein
FT                   /gene_family="HOG000279878" [ FAMILY / ALN / TREE ]
FT                   expression protein S)"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00119"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="GI:289549490"
FT                   /db_xref="GeneID:8817825"
FT                   /translation="MTIRKQLIISFFTSITFSTLFLFVLNELMWFDMTQTLLLTLFSLI
FT                   SSMVTMMIAMTFSIPTIHKIEKLNHETQKVANGSFEIEPLDIQSPLELKELNDSFETMV
FT                   TKVREQMERIKSEETEKIHMVQNLAHDLKTPLATIKSYSEALKDGVINTEERQQHAYKV
FT                   LISQSDRLSHMFDDLTTMMTVSGHSQDLGYLQIDQLLLPILEAYQQQIEQQHRELIVDV
FT                   EKGIPRFLQDGMAIERILSNFLDNALKFSKLETPIVVTAKKVDTTHVSIAVTDQGCGIA
FT                   EHHLKRIFERTYRIEHSRNLKSGGSGLGLYIAQMLAHQIDGHITVDSKLNEGTTMTLTF
FT                   NTHKSKLS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470394.1"
FT   misc_feature    complement(126318..126509)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00119"
FT   misc_feature    complement(order(126327..126329,126339..126341,
FT                   126348..126350,126360..126362,126369..126371,
FT                   126384..126386,126435..126437,126444..126446,
FT                   126456..126458,126465..126467,126477..126479,
FT                   126489..126491))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00119"
FT   misc_feature    complement(126471..126473)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="SLGD_00119"
FT   misc_feature    complement(125841..126155)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00119"
FT   misc_feature    complement(order(125853..125855,125859..125864,
FT                   125877..125879,125883..125885,125931..125942,
FT                   126021..126026,126030..126032,126036..126038,
FT                   126042..126044,126114..126116,126123..126125,
FT                   126135..126137))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00119"
FT   misc_feature    complement(126123..126125)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00119"
FT   misc_feature    complement(order(125934..125936,125940..125942,
FT                   126024..126026,126030..126032))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00119"
FT   gene            complement(126861..127541)
FT                   /db_xref="GeneID:8817826"
FT                   /locus_tag="SLGD_00120"
FT   CDS_pept        complement(126861..127541)
FT                   /locus_tag="SLGD_00120"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Response regulator SaeR (Staphylococcus
FT                   exoprotein expression protein R)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549491"
FT                   /db_xref="GeneID:8817826"
FT                   /translation="MERIAIIDDEPDIRDICRTYFEFEGYEVLTASNGQEALDLLEQDV
FT                   DLFILDIMMPEKDGYAVIKEMKARQLDIPYIYLTAKTTESDTIYGLMLGADDYVKKPFS
FT                   PRELVIRAKNILSRTVKHSSAQTLSFGALTLDNLTKTATINNETITLRIKEFDLLWYLA
FT                   THENVALSKTDLLEQVWGYDYYEDMNTLNVHIHRLRDKLEQHHYKDYIISTVWGLGYKF
FT                   HRGY"
FT                   /protein_id="YP_003470395.1"
FT   misc_feature    complement(126876..127535)
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(127194..127526)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(order(127236..127241,127248..127250,
FT                   127305..127307,127365..127367,127389..127391,
FT                   127515..127520))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(127389..127391)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(order(127365..127373,127377..127382))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(127233..127241)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(126876..127160)
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00120"
FT   misc_feature    complement(order(126885..126887,126900..126902,
FT                   126936..126941,126963..126965,126972..126974,
FT                   127026..127031,127086..127088))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00120"
FT   gene            complement(127519..128001)
FT                   /db_xref="GeneID:8817827"
FT                   /locus_tag="SLGD_00121"
FT   CDS_pept        complement(127519..128001)
FT                   /locus_tag="SLGD_00121"
FT                   /gene_family="HOG000279879" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549492"
FT                   /db_xref="GeneID:8817827"
FT                   /translation="MTNTITNAMTMTWKIIILLLRMGSGFVILKQGYEKLTGGFAVDGL
FT                   VPVIKENQDSPEWYKYFFEHVVAHHLDLFQWMIPIGEIAIGLGLLFGVLSYTASFFGTF
FT                   VMLNYILADMIFTYPLQLFFFIILLMNKETLQSLELMHFFKKKQSRNDVNGKNRHH"
FT                   /protein_id="YP_003470396.1"
FT   misc_feature    complement(<127666..127959)
FT                   /note="DoxX; Region: DoxX; cl00976"
FT                   /db_xref="CDD:154119"
FT                   /locus_tag="SLGD_00121"
FT   gene            complement(128107..128535)
FT                   /db_xref="GeneID:8817828"
FT                   /locus_tag="SLGD_00122"
FT   CDS_pept        complement(128107..128535)
FT                   /locus_tag="SLGD_00122"
FT                   /gene_family="HOG000279880" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549493"
FT                   /db_xref="GeneID:8817828"
FT                   /translation="MKLKTLLLSTALATSLLLGACGNSNHDSDTKKDEKKTESQKSNHT
FT                   TAEKGMFKGENKETVEGKAMIKDNKLMLTDFKSSKGPDLHVYLTKNGDIKTGKKIDAVK
FT                   YDEKEQTFDLKGIDVKAYDTVTIYCDKAHVVFGNAKIK"
FT                   /protein_id="YP_003470397.1"
FT   misc_feature    complement(128110..128388)
FT                   /note="Electron transfer DM13; Region: DM13; cl02735"
FT                   /db_xref="CDD:155083"
FT                   /locus_tag="SLGD_00122"
FT   gene            129200..129361
FT                   /db_xref="GeneID:8817829"
FT                   /locus_tag="SLGD_00123"
FT   CDS_pept        129200..129361
FT                   /locus_tag="SLGD_00123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549494"
FT                   /db_xref="GeneID:8817829"
FT                   /translation="MSKNVLRMLIAMVFVISTIVFIVKQDWLFATIFGVVVIVFVLRWT
FT                   KEMNQHNK"
FT                   /protein_id="YP_003470398.1"
FT   gene            129463..130074
FT                   /db_xref="GeneID:8817830"
FT                   /locus_tag="SLGD_00124"
FT   CDS_pept        129463..130074
FT                   /locus_tag="SLGD_00124"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549495"
FT                   /db_xref="GeneID:8817830"
FT                   /translation="MKGKYSMMLVIFVTLGCYYMFGLNHKLDVWLEDFINTQSWLQYIS
FT                   INVLFMIMMVPFYLYIRRTMQQINHINTLFMQEKDKPDFNMEKFKESIDIPSSQFIYFA
FT                   LFPMIVLLGLGLKIVKHYQFEIPSIIVIALYVITFIATCNYSTKLIMNMVHNQWLGYVI
FT                   IFLIAVIVTYLTSTEEQMFLLLFSTVSYIMNKISLKHNYV"
FT                   /protein_id="YP_003470399.1"
FT   gene            complement(130220..130414)
FT                   /db_xref="GeneID:8817831"
FT                   /locus_tag="SLGD_00125"
FT   CDS_pept        complement(130220..130414)
FT                   /locus_tag="SLGD_00125"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549496"
FT                   /db_xref="GeneID:8817831"
FT                   /translation="MKIKMYIFSLLICFIGFFVTYYLFELIVGNPITVGEGLVGALGFT
FT                   CVIGIFSLLSLFLKRNNDK"
FT                   /protein_id="YP_003470400.1"
FT   gene            130648..131439
FT                   /db_xref="GeneID:8817832"
FT                   /locus_tag="SLGD_00126"
FT   CDS_pept        130648..131439
FT                   /locus_tag="SLGD_00126"
FT                   /gene_family="HOG000090058" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549497"
FT                   /db_xref="GeneID:8817832"
FT                   /translation="MKLKGLKVGIATTVLLMCSGITHHYTYAAADQYEVKVYVDSDKVV
FT                   KDNRHIKHDVLEALGSEDKDEDFNVAFLDNKERSNYKDKVTYRLRKSEKDKKYALQYKK
FT                   RYPIVNNQVDQAIKQAKADGYNGDEFEVEYGENSQTLSVTKEAKADTDLKGLEMPNAAQ
FT                   SLTLFKSFATSPYKNKLAAITQPTLIGPVHFERHKGTINNHDIKIENWDVKNQNIVEIS
FT                   TKVKTEAEAKKAQKDIVNKLNDLGIHEQRDQLKTNLIFDNY"
FT                   /protein_id="YP_003470401.1"
FT   gene            complement(131703..132572)
FT                   /db_xref="GeneID:8817833"
FT                   /locus_tag="SLGD_00127"
FT   CDS_pept        complement(131703..132572)
FT                   /locus_tag="SLGD_00127"
FT                   /gene_family="HOG000090057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549498"
FT                   /db_xref="GeneID:8817833"
FT                   /translation="MNTKQMLIFKHFVEYQNENMVAEKLNITQPTVTFHLKNLNQRYGT
FT                   PLYHKKGKHFKLTEAGELLFRNSNKLLYLMQETEDILEDYRQSKRGTLKIGASHAPVYH
FT                   ILPHILKNYLQAYPHIQIDLIVDTAPNIIEKLRHREIEIGVISEKGFYDDDIKVKRFTD
FT                   NPLMVAMDCHHPLAAQEHLTLTDITQYPFILHSGGSTRQSIEEWQTENFVDLPVRMQAN
FT                   SVSSILEMLKDADYLSLISERALSNNPYITAKTLPHAPAPRHISLIYREDQYMTPIIQN
FT                   FISLMYES"
FT                   /protein_id="YP_003470402.1"
FT   misc_feature    complement(131709..132572)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="SLGD_00127"
FT   misc_feature    complement(132387..132563)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00127"
FT   misc_feature    complement(131715..132299)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="SLGD_00127"
FT   misc_feature    complement(order(131874..131879,131883..131888,
FT                   131904..131921,132195..132215,132219..132221,
FT                   132231..132233,132240..132245,132249..132254))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="SLGD_00127"
FT   gene            132709..133746
FT                   /db_xref="GeneID:8817834"
FT                   /locus_tag="SLGD_00128"
FT   CDS_pept        132709..133746
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00128"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="GI:289549499"
FT                   /db_xref="GeneID:8817834"
FT                   /translation="MVLELRDITKSFNSKQVIQGIDLTVKQGTFLSLLGTSGCGKTTLL
FT                   RLIAGLETPDNGVITNDDDVYFSSQQHAFMAPGDRDLGMVFQDFALWPHMTVFQNVAYP
FT                   LKVKKDTNQLKERVMAALAEVKLADQHDKAIHQLSGGQQQRVSLARAIISQSKLILMDE
FT                   PLSALDAGLREDMQLLIKRLIKTYGMTAIFVTHDQYEAMTMSDEIAVMSDGKIIQQGAP
FT                   ESLYYNPQSKKVATFIGKGTYIEGQVQTHIFTNKQGLELPVNDEIKEGTYGLLIRPENI
FT                   HVHAEEQENQAIIKTMHFTGERYQYTAQLANETVMFYDTQLHDIEDTVYLTFDIPKNYF
FT                   IHLGE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470403.1"
FT   misc_feature    132709..133710
FT                   /note="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components [Amino acid transport and metabolism];
FT                   Region: PotA; COG3842"
FT                   /db_xref="CDD:33633"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    132715..133425
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    132811..132834
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    order(132820..132825,132829..132837,132967..132969,
FT                   133192..133197,133294..133296)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    132958..132969
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    133120..133149
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    133180..133197
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    133204..133215
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    133282..133302
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00128"
FT   misc_feature    133528..133710
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="SLGD_00128"
FT   gene            133751..134773
FT                   /db_xref="GeneID:8817835"
FT                   /locus_tag="SLGD_00129"
FT   CDS_pept        133751..134773
FT                   /locus_tag="SLGD_00129"
FT                   /gene_family="HOG000087438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549500"
FT                   /db_xref="GeneID:8817835"
FT                   /translation="MKQLIKYFVLTIAAVLVLTACQNKSEDGNNKSDSSSGSKDKLVLY
FT                   AAGPDDLVKDMVKEFEKESGKKVEVFQGTTGEILGRLEAEKDNPKADVVQLASLPAALD
FT                   YKKKGLIEPYKVKNHNKLYKDWIDSKGYYYGFSGSALGLSYNTKAVKQPPKDVKDLTNA
FT                   KYKNKIAIPDPSESGTALDLLSIKVNNEGDKAWDEYKKLKDNGMKQAGANKPALESVIK
FT                   GDNDVVYGGVDYMVYKAKANGEPVDIKYPESGTAISPRPAFILKSSKHKELAKQYMDYV
FT                   TGKKGQKQVDDHYLIPADKAAEKKKGKAKRQDIKEYKYDWENLSDKSEKVLKQFTELMR
FT                   "
FT                   /protein_id="YP_003470404.1"
FT   misc_feature    133916..134761
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="SLGD_00129"
FT   gene            134775..136433
FT                   /db_xref="GeneID:8817836"
FT                   /locus_tag="SLGD_00130"
FT   CDS_pept        134775..136433
FT                   /locus_tag="SLGD_00130"
FT                   /gene_family="HOG000087439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ferric iron ABC transporter, permease protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549501"
FT                   /db_xref="GeneID:8817836"
FT                   /translation="MPQNKLMLRTNQILASVVLFLLIIMPLCLILFKGFVPSEENTFVG
FT                   NISQLFESYHLKILWNSIVLGISVLILSTVIALPLSFIMTKTTLVKHQWLDMMIMIPFM
FT                   VPPYIGAMGWMLTMQRNGLLEQISPIFAHITPYFFSFFGMVLIMSCHLTPFLYVMLKNA
FT                   LLTIHQSQEEAAEIYGGSFMYRFRKIIVPQFISGYSMAALLVFVKTIGEFGTPVTMGNR
FT                   IGFHVLTSEIHHSASIWPIDFQRAALLSSLLLAVSMTVWAFQQWVQTRTNIQADSGKGH
FT                   QVKIHKASSWNILCYAFVVVELFVTIVLPYASIFVSAFMKKLAAGFHFSNFTINNFINV
FT                   LMGNGGIALFNSIMLATIAATLATVIGLWCVLITKHKSMLSRLIDFTSLLPNTVPGIIV
FT                   VIGLILFWNNRYNILPIYNTIAILVVAYTVLYIPYAVQNIKNVERTLSPNLYEAAAISG
FT                   SRGWTLFRTITLPLLKPGMISGWILIFCISMRELVASLMLRPPNTDTSSTFIYRQFEQG
FT                   DSAQGMAMALMSIGITSVILIALEVYQRKSSVQQS"
FT                   /protein_id="YP_003470405.1"
FT   misc_feature    134811..136418
FT                   /note="ABC-type Fe3+ transport system, permease component
FT                   [Inorganic ion transport and metabolism]; Region: ThiP;
FT                   COG1178"
FT                   /db_xref="CDD:31371"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    134949..135503
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(134997..135002,135009..135014,135027..135029,
FT                   135057..135068,135072..135101,135108..135113,
FT                   135117..135119,135222..135227,135231..135233,
FT                   135237..135239,135246..135251,135255..135257,
FT                   135267..135272,135279..135281,135330..135332,
FT                   135372..135377,135384..135386,135405..135416,
FT                   135423..135428,135465..135470,135498..135503)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(135075..135119,135405..135422)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(135117..135119,135207..135209,135423..135425,
FT                   135459..135461,135468..135470,135498..135500)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(135282..135320,135336..135341,135351..135353)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    135912..136385
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(135924..135935,135939..135968,135975..135980,
FT                   135984..135986,136059..136064,136068..136070,
FT                   136074..136076,136083..136088,136092..136094,
FT                   136104..136109,136116..136118,136167..136169,
FT                   136209..136214,136221..136223,136242..136253,
FT                   136260..136265,136302..136307,136335..136340,
FT                   136347..136352,136356..136361,136368..136373,
FT                   136380..136385)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(135942..135986,136242..136259)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(135984..135986,136044..136046,136260..136262,
FT                   136296..136298,136305..136307,136335..136337)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   misc_feature    order(136119..136157,136173..136178,136188..136190)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00130"
FT   gene            136475..137089
FT                   /db_xref="GeneID:8817837"
FT                   /locus_tag="SLGD_00131"
FT   CDS_pept        136475..137089
FT                   /locus_tag="SLGD_00131"
FT                   /gene_family="HOG000251870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549502"
FT                   /db_xref="GeneID:8817837"
FT                   /translation="MPQRILVASDIHGHGDALIKLLSEAVYNAETDQLVLLGDYVNNGP
FT                   DSVGTLRLVQKLVNKGAIALVGNHELRWLERQDSEAQAWHKFLSGLPYIKVLDSYIFVH
FT                   AGIDVRVPIDKQQCEHVTAHHSVALNQHQIKGKTIIHGHVPNYKLGYSKEEIHIENGMI
FT                   DIDTGAGHNMYLTLVDLTNACSYSVNVSHKDGTIRKRHLML"
FT                   /protein_id="YP_003470406.1"
FT   misc_feature    136499..136987
FT                   /note="phosphoprotein phosphatases of the
FT                   metallophosphatase superfamily, metallophosphatase domain;
FT                   Region: MPP_PPP_family; cd00144"
FT                   /db_xref="CDD:163613"
FT                   /locus_tag="SLGD_00131"
FT   misc_feature    order(136502..136504,136508..136510,136589..136591,
FT                   136601..136603,136676..136681,136784..136786,
FT                   136901..136903)
FT                   /note="active site"
FT                   /db_xref="CDD:163613"
FT                   /locus_tag="SLGD_00131"
FT   misc_feature    order(136502..136504,136508..136510,136589..136591,
FT                   136676..136678,136784..136786,136901..136903)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163613"
FT                   /locus_tag="SLGD_00131"
FT   gene            137558..138256
FT                   /db_xref="GeneID:8817838"
FT                   /locus_tag="SLGD_00132"
FT   CDS_pept        137558..138256
FT                   /locus_tag="SLGD_00132"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549503"
FT                   /db_xref="GeneID:8817838"
FT                   /translation="MSEKEIGQALQIPASSLFNLLKTMVEANYIRKDYQNKYLLGSKLI
FT                   SLGNRAREDLDLYNESLSYIKHLSDELNETIFLAYPQGYEMIYLTKIDSHRSIRTAAQP
FT                   GANKPIYTTGLGKACLYMYDKKLLDCFFLDIEFEQVTPYTVKNYEMLKVQLRRFKAQGY
FT                   AIDDEENELGLYCIAAPILNDAGHVIGAISCAGPKERIQHNDLIPQKIKQNAYFISRAM
FT                   GLTRNGVDIN"
FT                   /protein_id="YP_003470407.1"
FT   misc_feature    137570..138226
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="SLGD_00132"
FT   misc_feature    <137570..137767
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00132"
FT   misc_feature    137870..138220
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="SLGD_00132"
FT   gene            138253..139203
FT                   /db_xref="GeneID:8817839"
FT                   /locus_tag="SLGD_00133"
FT   CDS_pept        138253..139203
FT                   /product="2-dehydro-3-deoxygluconate kinase"
FT                   /gene_family="HOG000235951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00133"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="GI:289549504"
FT                   /db_xref="GeneID:8817839"
FT                   /translation="MTVISYGEIMGVFSSNHAQLKYTNQLNFYIAGAEANTLIGLSRLG
FT                   IHSSLISALGNDAVGEAIKYQLNGEGVDTRFVQTLNHYSTGLMTKERGIAQAIRVDYFR
FT                   KNSAINYLNINSFLNDIFESADILYLTGITPALSNHTYQETLKLIKVAKQHHMTIVFDP
FT                   NFRKKLWNENDLKAFYQIIEPHVDVLLAGKSEADILFNTPSMEQLMNHIDQTNLKLLVI
FT                   KNGDQGAVFINRHTHIHGQAYSVKDIDPVGAGDAFAAGVIYSLKMYGYDQLTVMSKYAL
FT                   AMGALATTSYGDFYGLPTLSEVEQFIEHQLTDVER"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470408.1"
FT   misc_feature    138259..139134
FT                   /note="2-keto-3-deoxygluconate kinase (KdgK) phosphorylates
FT                   2-keto-3-deoxygluconate (KDG) to form
FT                   2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common
FT                   intermediate product, that allows organisms to channel
FT                   D-glucuronate and/or D-galacturinate into the...; Region:
FT                   KdgK; cd01166"
FT                   /db_xref="CDD:29350"
FT                   /locus_tag="SLGD_00133"
FT   misc_feature    order(138346..138351,138358..138360,138514..138516,
FT                   138556..138558,138562..138564,138649..138651,
FT                   138748..138750,139006..139008,139015..139017,
FT                   139129..139131)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:29350"
FT                   /locus_tag="SLGD_00133"
FT   misc_feature    order(138919..138921,138934..138936,138979..138981,
FT                   139006..139014,139021..139023,139093..139095,
FT                   139105..139107)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29350"
FT                   /locus_tag="SLGD_00133"
FT   gene            139211..139834
FT                   /db_xref="GeneID:8817840"
FT                   /locus_tag="SLGD_00134"
FT   CDS_pept        139211..139834
FT                   /product="4-Hydroxy-2-oxoglutarate
FT                   /gene_family="HOG000233113" [ FAMILY / ALN / TREE ]
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00134"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /db_xref="GI:289549505"
FT                   /db_xref="GeneID:8817840"
FT                   /translation="MNIELVKQHKIISIVRGYDTEDTLKIVEALKQAGIKLVEVTLNSP
FT                   NVFNTLQKLSKQYKGDIYIGAGTVLTVESCQKAIDAGAQFIISPDVNTDVIQCTKENHV
FT                   LSIPGAFTPSEITLALNQGADIIKVFPVSSMGPSYIKDILAPLNNTQLLPTGGVDATNI
FT                   NEYINVGAIGVGVSSSIVKTNLAIDNETLTTIKRNAQKLIKAMN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470409.1"
FT   misc_feature    139217..139822
FT                   /note="Entner-Doudoroff aldolase; Region: eda; TIGR01182"
FT                   /db_xref="CDD:162241"
FT                   /locus_tag="SLGD_00134"
FT   misc_feature    139226..139768
FT                   /note="KDPG and KHG aldolase. This family belongs to the
FT                   class I adolases whose reaction mechanism involves Schiff
FT                   base formation between a substrate carbonyl and lysine
FT                   residue in the active site.
FT                   2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase,  is
FT                   best...; Region: KDPG_aldolase; cd00452"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="SLGD_00134"
FT   misc_feature    order(139250..139252,139325..139327,139337..139339,
FT                   139412..139414,139592..139594,139598..139600,
FT                   139673..139675)
FT                   /note="active site"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="SLGD_00134"
FT   misc_feature    order(139337..139339,139412..139414,139418..139420,
FT                   139475..139486,139544..139555,139559..139561,
FT                   139571..139573,139598..139603,139634..139636,
FT                   139646..139651)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="SLGD_00134"
FT   misc_feature    139592..139594
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29938"
FT                   /locus_tag="SLGD_00134"
FT   gene            139847..140992
FT                   /db_xref="GeneID:8817841"
FT                   /locus_tag="SLGD_00135"
FT   CDS_pept        139847..140992
FT                   /product="Gluconate dehydratase"
FT                   /gene_family="HOG000113756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00135"
FT                   /EC_number="4.2.1.39"
FT                   /db_xref="GI:289549506"
FT                   /db_xref="GeneID:8817841"
FT                   /translation="MKIVNYELYQVPPRWLFLKIITDEGLEGWGEPVIEGKAATVKAAV
FT                   IELMDTLIGEDPCQIEGLWNQMYRSSFYRGGPILMSAISGIDQALWDIKGKYFNAPIHQ
FT                   LLGGKARDSIKVYSWIGGDRPSDVAREAQKVADKGFNAIKMNATEELQYIDDFQKVEDV
FT                   VARVDAIRKKMGNNFGIGIDFHGRVHKPMAKLLIKELEPYHPLFIEEPVLPEHNEILKV
FT                   LANYSVPIATGERMFSRYDYKDALASGYIDIIQPDLSHAGGITECKKIISMAEAYDIAA
FT                   APHCPLGPIALAACLQVDATCHNAIIQEQSLGIHYNKSNDLLDYVQDRTIFDYQDGFVN
FT                   IPQKPGLGIDIAEDYVKERAKIGHNWKNPVWKHQDGSIAEW"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470410.1"
FT   misc_feature    139847..140989
FT                   /note="galactonate dehydratase; Provisional; Region:
FT                   PRK14017"
FT                   /db_xref="CDD:172513"
FT                   /locus_tag="SLGD_00135"
FT   misc_feature    139850..140899
FT                   /note="D-galactonate dehydratase catalyses the dehydration
FT                   of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part
FT                   of the D-galactonate nonphosphorolytic catabolic
FT                   Entner-Doudoroff pathway. D-galactonate dehydratase belongs
FT                   to the enolase superfamily of...; Region:
FT                   D-galactonate_dehydratase; cd03325"
FT                   /db_xref="CDD:48200"
FT                   /locus_tag="SLGD_00135"
FT   misc_feature    order(140195..140197,140276..140278,140282..140284,
FT                   140393..140395,140465..140467,140471..140473,
FT                   140546..140548,140615..140617,140696..140698,
FT                   140771..140773)
FT                   /note="putative active site pocket; other site"
FT                   /db_xref="CDD:48200"
FT                   /locus_tag="SLGD_00135"
FT   misc_feature    order(140393..140395,140471..140473,140546..140548)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:48200"
FT                   /locus_tag="SLGD_00135"
FT   gene            141015..142376
FT                   /db_xref="GeneID:8817842"
FT                   /locus_tag="SLGD_00136"
FT   CDS_pept        141015..142376
FT                   /locus_tag="SLGD_00136"
FT                   /gene_family="HOG000237115" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Gluconate permease"
FT                   /transl_table="11"
FT                   /note="Bsu4004-like protein"
FT                   /db_xref="GI:289549507"
FT                   /db_xref="GeneID:8817842"
FT                   /translation="MSLLGVTLSVVVSVAFLLVLIIVFKLNTFVSLIITSILGGILLRI
FT                   PIQNVMESIEKGIGSTLGHIALIFGLGAMLGKLLADGGGANRIAETLINKFGEKYTQWA
FT                   IIIASFIVGIALFLEVGLVLLIPLVFTIAKKLKVSQVKIGIPMMAALSVTHGFLPPHPG
FT                   PTVIAKELHANIGEVLMYGMIIAIPVAIISGPVFLKVAEKIVTSAFYREGDISELGSQK
FT                   SFSQEEMPSFRLSVFTALLPVILMLISTILQLVTGHDSGKGTNFIENFIYFVGTAGTAM
FT                   VISVIFAIYSMGLHKGKKMQETMQSVTNSIYPIGMMLLIIGGGGAFKQILIDGGVGDTI
FT                   KAAFSGTSMSPLLFAWIIAAIFRIALGSATVAGISTTAIVLPLVQQSDVNVALVVLAIG
FT                   AGSLILSHVNDAAFWMFKEYFGLTIKETFLTWSLLETILSVSGIIFILFISLFV"
FT                   /protein_id="YP_003470411.1"
FT   misc_feature    141093..142322
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="SLGD_00136"
FT   misc_feature    141093..142322
FT                   /note="gluconate transporter; Region: gntP; TIGR00791"
FT                   /db_xref="CDD:129873"
FT                   /locus_tag="SLGD_00136"
FT   gene            complement(142591..143157)
FT                   /db_xref="GeneID:8817843"
FT                   /locus_tag="SLGD_00137"
FT   CDS_pept        complement(142591..143157)
FT                   /locus_tag="SLGD_00137"
FT                   /gene_family="HOG000134754" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549508"
FT                   /db_xref="GeneID:8817843"
FT                   /translation="MISIIYGGNTSGTCYELYQHILHQIPKQQRYDIFLQQSNIDFLLT
FT                   TGYHAPLSSQQQIWINQLEASSTLIFIYPLYWFNVTPILKSFIDQTFWPEHAFSFKNKQ
FT                   YFRNGLWKGKKAIIIYTQGGPEILHRFKGRLGYKVMKYPLNLSGIYDISVLHLDNLNRS
FT                   ATDNKKVVASMANIAQKVKQLIRNK"
FT                   /protein_id="YP_003470412.1"
FT   misc_feature    complement(142615..>142974)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="SLGD_00137"
FT   gene            complement(143150..143563)
FT                   /db_xref="GeneID:8817844"
FT                   /locus_tag="SLGD_00138"
FT   CDS_pept        complement(143150..143563)
FT                   /locus_tag="SLGD_00138"
FT                   /gene_family="HOG000134755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549509"
FT                   /db_xref="GeneID:8817844"
FT                   /translation="MTINDVAAHLNMSKSQIRYYEKVGLITVPRNDSGYRIFDEDTMFK
FT                   LKLINDLKDLDLDLQNINHIIQLYDQPISDTCNKQSNKFIENLITKIEQRLKQQQLILQ
FT                   KIKTLHQLSKDGQYEQNQHKIFAELAKEVSMND"
FT                   /protein_id="YP_003470413.1"
FT   misc_feature    complement(<143441..143563)
FT                   /note="Helix-Turn-Helix DNA binding domain of MerR-like
FT                   transcription regulators; Region: HTH_MerR-like; cd00592"
FT                   /db_xref="CDD:133378"
FT                   /locus_tag="SLGD_00138"
FT   misc_feature    complement(order(143456..143464,143510..143512,
FT                   143552..143560))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133378"
FT                   /locus_tag="SLGD_00138"
FT   gene            144133..146049
FT                   /db_xref="GeneID:8817845"
FT                   /locus_tag="SLGD_00139"
FT   CDS_pept        144133..146049
FT                   /product="Threonyl-tRNA synthetase"
FT                   /gene_family="HOG000003878" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00139"
FT                   /EC_number="6.1.1.3"
FT                   /db_xref="GI:289549510"
FT                   /db_xref="GeneID:8817845"
FT                   /translation="MSNQRINIQFPDGSQKAYEQGVLARDVAKSISTSLFKAAVVCRVN
FT                   GTLVDLTYPLQEDCELTFYTLEDAEGIEAMRHTAAHVLAQALTRLYPQVLLTIGPVIDN
FT                   GFYYDIDLDESISEVDLNKIEKEMKKIQSENLDIVKENVSYDEAKALFKDNPYKLEIIE
FT                   QYQGEQLSVYRQGEFLDLCVGPHVPNTKFVKHVKLTKVSGAYWRGDSDNKMLQRIYGVA
FT                   FQSQAQLDDYFEFLREAEARNHRKLGKQLKLFMFSEEAPGMPFYLSNGQFVRNQMENFL
FT                   REIQLKNDYDEVRTPLMMNQKLWEESGHWDHYHENMYFTKVDENDYALKPMNCPGHMLI
FT                   FKNELRSYKDLPLRMAEFGQVHRHEFSGALNGLLRVRTFCQDDAHIFIMKSQIKSEVED
FT                   ILKLIDYIYSVFGFTYSIELSTRPEDYLGELKLWNEAEQSLANVLDELGLKYTINEGDG
FT                   AFYGPKIDVHIKDALNRSHQCATVQLDFQMPEKFDLTYINEQNEKERPVVLHRAIFGSL
FT                   DRFFGILIEHFKGAFPLWMAPVQVNIIGVSDNNTAYVNKVFEALQNNNIRVVIDDRDEK
FT                   LGKKIRESQMKKIPYTLVLGDHEQENNVVSARKYSHEDNELMDIQAFIAQLQEEVESKA
FT                   LLV"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470414.1"
FT   misc_feature    144148..146040
FT                   /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
FT                   PRK00413"
FT                   /db_xref="CDD:166947"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    144148..144330
FT                   /note="TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is
FT                   a class II tRNA synthetase that couples threonine to its
FT                   cognate tRNA.  In addition to its catalytic and
FT                   anticodon-binding domains, ThrRS has an N-terminal TGS
FT                   domain, named after the ThrRS, GTPase...; Region:
FT                   TGS_ThrRS_N; cd01667"
FT                   /db_xref="CDD:133437"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    144640..144789
FT                   /note="Threonyl and Alanyl tRNA synthetase second
FT                   additional domain; Region: tRNA_SAD; cl08469"
FT                   /db_xref="CDD:158351"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    144862..145746
FT                   /note="Threonyl-tRNA synthetase (ThrRS) class II core
FT                   catalytic domain. ThrRS is a homodimer. It is responsible
FT                   for the attachment of threonine to the 3' OH group of
FT                   ribose of the appropriate tRNA. This domain is primarily
FT                   responsible for ATP-dependent...; Region: ThrRS_core;
FT                   cd00771"
FT                   /db_xref="CDD:29816"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    order(144868..144870,144907..144909,145057..145059,
FT                   145069..145071,145078..145083,145123..145125,
FT                   145219..145221,145225..145227,145231..145239,
FT                   145252..145260,145267..145269,145273..145275,
FT                   145555..145557,145564..145569,145579..145581,
FT                   145675..145680,145687..145689)
FT                   /note="active site"
FT                   /db_xref="CDD:29816"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    order(144880..144882,144898..144900,144904..144909,
FT                   144913..144915,144919..144921,144925..144930,
FT                   144934..144936,144943..144945,144988..144993,
FT                   145003..145008,145012..145014,145018..145026,
FT                   145030..145032,145084..145092,145096..145107,
FT                   145111..145113,145147..145152,145159..145167,
FT                   145171..145179,145216..145218,145222..145224,
FT                   145231..145233,145261..145266,145345..145347,
FT                   145468..145476,145621..145623,145627..145629)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29816"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    145003..145026
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:29816"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    145216..145227
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:29816"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    145675..145689
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:29816"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    145744..146016
FT                   /note="ThrRS Threonyl-anticodon binding domain. ThrRS
FT                   belongs to class II aminoacyl-tRNA synthetases (aaRS). This
FT                   alignment contains the anticodon binding domain, which is
FT                   responsible for specificity in tRNA-binding, so that the
FT                   activated amino acid is...; Region: ThrRS_anticodon;
FT                   cd00860"
FT                   /db_xref="CDD:29800"
FT                   /locus_tag="SLGD_00139"
FT   misc_feature    order(145768..145773,145876..145878,145894..145896,
FT                   145918..145920,145948..145950,145954..145956)
FT                   /note="anticodon binding site; other site"
FT                   /db_xref="CDD:29800"
FT                   /locus_tag="SLGD_00139"
FT   gene            complement(146248..147750)
FT                   /db_xref="GeneID:8817846"
FT                   /locus_tag="SLGD_00140"
FT   CDS_pept        complement(146248..147750)
FT                   /locus_tag="SLGD_00140"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549511"
FT                   /db_xref="GeneID:8817846"
FT                   /translation="MSNDVLIVGAGPSGLALAIALSAQGISYKLIDKNKGPGTASRAMV
FT                   VQSRVLEFYRQYGFDDKIVEAGIPIQHFNVYKDKRPVGKLPIAKKGKGVSPYPYVLTLP
FT                   QDIHEQILVEELEKVGGQVCWEHELISFDDNETFISATFQRPNGEEVTETFNYICGCDG
FT                   ASSTVRKRLDIGFPGGTYTQLFYVADVETNTQLDGASMGFHGNHFCVGFPIRTTEQLRL
FT                   IGIIPEEVKTNGEPPESFKPLIPFAENILPIHIKNINWYSSYRSHHRVAEHFRVNRAFI
FT                   CGDAGHIHSPAGGQGMNTGISDAFNLAWKLSNVIQGKADKSILDTYEPERIEFAKKLVN
FT                   TTDTGFKFMANSQVVKNWIIPYIFPTLLHLDILKKKLYKTISQTAIHYKHSDLSIGNYG
FT                   NIAGGDRLPWIHIDSIDNFEPLKSRTWQIHIYGKLTQELKQFAYDSQLPIYHIPWVTQM
FT                   SQKDIQRDAVFLVRPDGYISVATNSYDVEPFKQMIEKYHIKP"
FT                   /protein_id="YP_003470415.1"
FT   misc_feature    complement(146740..147750)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00140"
FT   misc_feature    complement(146320..147741)
FT                   /note="hypothetical protein; Provisional; Region: PRK06184"
FT                   /db_xref="CDD:168447"
FT                   /locus_tag="SLGD_00140"
FT   gene            148063..149421
FT                   /db_xref="GeneID:8817847"
FT                   /locus_tag="SLGD_00141"
FT   CDS_pept        148063..149421
FT                   /locus_tag="SLGD_00141"
FT                   /gene_family="HOG000270688" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Branched-chain amino acid transport system
FT                   carrier protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549512"
FT                   /db_xref="GeneID:8817847"
FT                   /translation="MKNHTLTLKQNIFIGSMLFGLFFGAGNLIFPIHLGQTAGANVWLA
FT                   NLGFLITAIGLPFLGIIAIGVSKTNGVFEIASRVSTSYAYIFTIGLYLVIGPFFALPRL
FT                   ATTSFEIAFSPFISPSTAKILLPIFSIVFFVLAWLFARKPSKILDYIGKFLNPIFLILL
FT                   GIVVILAFIHPMGSINHASISPNYKHGTVLKGFIDGYNTLDALASLAFGIIIVSTIKKL
FT                   GISNPNTIAKETFKSGTISIVAMGVIYTLLAVMGTMSLGHFKVSENGGIALAQIAQYYL
FT                   GDYGIIILSLIIIVACLKTAIGLITAFSETFTELFPKQNYLAIATIVSVLACIFANVGL
FT                   TKIIMYSIPVLMFIYPLAITLILLTLISPLFNHSTTVYRFTTFFTMIAALIDGIKASPE
FT                   FFVNTSFAQWLIALGEHYLPLFDIGMGWMLPALIGFIIGLIVYKIRLPRQPQT"
FT                   /protein_id="YP_003470416.1"
FT   misc_feature    148087..149397
FT                   /note="Branched-chain amino acid transport protein; Region:
FT                   Branch_AA_trans; cl00547"
FT                   /db_xref="CDD:163870"
FT                   /locus_tag="SLGD_00141"
FT   gene            complement(149566..149724)
FT                   /db_xref="GeneID:8817848"
FT                   /locus_tag="SLGD_00142"
FT   CDS_pept        complement(149566..149724)
FT                   /locus_tag="SLGD_00142"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549513"
FT                   /db_xref="GeneID:8817848"
FT                   /translation="MKINNHNSFFIPCGLFLGLGLGLIFKEIVAGAFLGLALGFLLYII
FT                   FNKRDNK"
FT                   /protein_id="YP_003470417.1"
FT   gene            150038..150766
FT                   /db_xref="GeneID:8817849"
FT                   /locus_tag="SLGD_00143"
FT   CDS_pept        150038..150766
FT                   /locus_tag="SLGD_00143"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549514"
FT                   /db_xref="GeneID:8817849"
FT                   /translation="MKCKQCGTEFNHFQQHCPTCGEPIQVDTTSNQQQTSKQSQKRDIR
FT                   SQFGAGAQQHKKRPDQQQEASHDSDVKEQVGASSTTDEANTHSTESQEQFGAHSGDHAS
FT                   HVSKNDFGASSTDSVSTGFLDVVKNIFKLDDTAAWAKRIIISIAFFVFYVFFIHITYNM
FT                   IIFILNVLLFPFVMCVVDHVLSKVFKKSSYAYDIQQHGFAIATGKVALKYIFLLFIWNF
FT                   SWILGILSFIYLYSLAKKLG"
FT                   /protein_id="YP_003470418.1"
FT   gene            150780..153392
FT                   /db_xref="GeneID:8817850"
FT                   /locus_tag="SLGD_00144"
FT   CDS_pept        150780..153392
FT                   /locus_tag="SLGD_00144"
FT                   /gene_family="HOG000158355" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sporulation protein K-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549515"
FT                   /db_xref="GeneID:8817850"
FT                   /translation="MKKPILVGKGFRRISFEKLVLETPIPDDSTIVFESLGDQKHYFNQ
FT                   GMQFQNMRFKLRGNSLPEDTVIDSWFYIENCNAVIENLTIDNSQPNDHALNIHNSHVTI
FT                   NNVILKGKQAIALYIDQNSSVSINEVTVDTHAEEEISGIFVDNGSRAQINQSLMNGLTA
FT                   NQDAYIEVNHSLSTETVCAQQEGRINANDLYIDKTEETIDIMLFSHGQMYIDGLTIVSG
FT                   SSEAYLEEGYLSLQHVNTENTNGFLVNIDNFSDAEGEGFEVINRDEYQRQLNDQGAYAQ
FT                   NIDDNIGQENVDTQFDEFYEDDTVNESENDSYEDTMDAFDEEAMPEEKGALDAIHELIG
FT                   LDGVKKAVEKFINISKINKIKQQKGLQPNMPAMHSLFIGNPGTGKTTVARLMAQALYEE
FT                   QVIKENNFVEVSRQDLVSEYIGRTATQTLEVLESAKNGVLFIDEAYTLVSEGDKGFGQE
FT                   AIDTILKYMEDHREEIMIIFAGYTNEMITFKNSNPGLASRIPHTFDFEDYKLPQLVQIG
FT                   EADLINKGYVFDADHYQKALANEYRHNFDNSNGRWVRNFNEKLTSEQIQRISESGEYID
FT                   DEALMTITDEDFSMFSSQDDGSDETLHDLLEELHQLIGLANVKQHVDKIINEVKFNKLL
FT                   EEQGKVTTHSNYHMIFTGAPGTGKTTVARLLAQIFKHLGLLSKGHLIETERSKLIGNYI
FT                   GQTEKNTKQAVEQAMGGVLFIDEAYQLTPKGQSDNDFGSQAIETLITELENNRDKFIAI
FT                   FAGYNDDMQRFLESNEGLKSRVPYQLHFEDYSPEEVADIVVMTLIKEDWQFDETLLREI
FT                   VEELYANIEESQKSNGRWARNFVQELLVRHKNKVIQTATPDADLTTISNETILEMQEV"
FT                   /protein_id="YP_003470419.1"
FT   misc_feature    151791..152543
FT                   /note="stage V sporulation protein K; Region: spore_V_K;
FT                   TIGR02881"
FT                   /db_xref="CDD:163057"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    151905..152297
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    151914..151937
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    order(151917..151940,152103..152105,152220..152222)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    152091..152108
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    152271..152273
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    152616..153371
FT                   /note="stage V sporulation protein K; Region: spore_V_K;
FT                   TIGR02881"
FT                   /db_xref="CDD:163057"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    152721..153125
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    152736..152759
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    order(152739..152762,152925..152927,153048..153050)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    152913..152930
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   misc_feature    153099..153101
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="SLGD_00144"
FT   gene            153469..154269
FT                   /db_xref="GeneID:8817851"
FT                   /locus_tag="SLGD_00145"
FT   CDS_pept        153469..154269
FT                   /locus_tag="SLGD_00145"
FT                   /gene_family="HOG000184783" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549516"
FT                   /db_xref="GeneID:8817851"
FT                   /translation="MFKLVVTDMDGTFLNAQGTFNKAHFQALLAPMKARGIRFAFCTGK
FT                   QVERVEAVVGDLSQDLFIIGDSATRIQLNGENIYTKTLDSAVGQQLINKIKKIDPELTI
FT                   IVCTPETAYVENSVRDQDKSMVFGSYEQVTFVDDLANLTAPILKITIYDHKAQCFNHVN
FT                   DLAEFQDDLYIVAAEESWIDITDKAVDKGTTIQFLQSLLNIPADETIVFGDGYNDMPLF
FT                   ENAAYKVAMDNAYPELKEKANLIALNHNQDGVVTTLNVLLKLAR"
FT                   /protein_id="YP_003470420.1"
FT   misc_feature    153478..153786
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="SLGD_00145"
FT   misc_feature    153481..154230
FT                   /note="haloacid dehalogenase-like hydrolase; Region:
FT                   Hydrolase_3; pfam08282"
FT                   /db_xref="CDD:116866"
FT                   /locus_tag="SLGD_00145"
FT   misc_feature    order(153490..153498,153595..153600)
FT                   /note="active site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="SLGD_00145"
FT   misc_feature    153490..153507
FT                   /note="motif I; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="SLGD_00145"
FT   misc_feature    153595..153597
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="SLGD_00145"
FT   misc_feature    <154015..154215
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="SLGD_00145"
FT   gene            154399..155757
FT                   /db_xref="GeneID:8817852"
FT                   /locus_tag="SLGD_00146"
FT   CDS_pept        154399..155757
FT                   /locus_tag="SLGD_00146"
FT                   /gene_family="HOG000269158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549517"
FT                   /db_xref="GeneID:8817852"
FT                   /translation="MEIVKSKEDLFRIIDHADEQYTSKMLLFMILGTIFLDAYDITILG
FT                   TMTDQLTQQFHLSPTMLSTVMTSLPIGALIGAIFGGVFAHRFGRKRILSISLLALVITS
FT                   LGAALSPNLTILLLCRFLMGMAIGMDSPVAFTFIAEISNRAQKGRNVNYWQVVWYVAIV
FT                   TSSLCVIAFFLMGTGSHLWRVAVGFGAIIALVLYLLRLKFLHESPTWMINHYSLGQAAD
FT                   YIRQKYHVDIQLASNQTNDVSSQERQPSARALFQPKYGKRLLLATAISTLQGMQYYAVG
FT                   LYIPIIATYIISKEKLGVLLGTAIVNIAGIVGAYFGAQLTYRLGTRKLTIIGFALVLIA
FT                   MVMTGVFYHLLPMILNTFLIALFLFGHSGGPGTQGKTIGALSFPTYLRSQATGFVEAVS
FT                   RTGSIIGTFIFPIILAAVGLTNTMLILSIVPLVGLIITSAIKWEPVGKNVEVE"
FT                   /protein_id="YP_003470421.1"
FT   misc_feature    154477..>155010
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00146"
FT   misc_feature    154498..155616
FT                   /note="benzoate transport; Region: 2A0115; TIGR00895"
FT                   /db_xref="CDD:162095"
FT                   /locus_tag="SLGD_00146"
FT   misc_feature    order(154519..154521,154528..154536,154540..154545,
FT                   154594..154596,154603..154608,154615..154617,
FT                   154627..154632,154636..154641,154777..154782,
FT                   154789..154794,154801..154806,154813..154815,
FT                   154849..154854,154861..154866,154882..154884)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00146"
FT   misc_feature    <155179..155709
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00146"
FT   gene            155922..156143
FT                   /db_xref="GeneID:8817853"
FT                   /locus_tag="SLGD_00147"
FT   CDS_pept        155922..156143
FT                   /locus_tag="SLGD_00147"
FT                   /gene_family="HOG000267426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549518"
FT                   /db_xref="GeneID:8817853"
FT                   /translation="MKFYRLDYQHHKDIVDENILTVFVVAQNKGEVEQLAKKLRYAVEN
FT                   ITKLTEKEFKKEKETNEHFRLEYAENYL"
FT                   /protein_id="YP_003470422.1"
FT   gene            156657..158258
FT                   /db_xref="GeneID:8817854"
FT                   /locus_tag="SLGD_00148"
FT   CDS_pept        156657..158258
FT                   /locus_tag="SLGD_00148"
FT                   /gene_family="HOG000125740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative substrate binding domain-containing
FT                   oligopeptide transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549519"
FT                   /db_xref="GeneID:8817854"
FT                   /translation="MNKLSKITVTLLASGMILAGCSDNKALENKKSEKTLSYTTVKDIG
FT                   DMNPHVYGGSMSAESMLYEPLVRNTKDGIKPLLAKKWDISADGKTYTFHLRDDVKFHDG
FT                   TKFDAEAVKKNIDAVQQNKKLHAWLKLSTLIDDVKVKDTYTVQLHLKEAYQPTLAELAM
FT                   PRPYVFVSPKDFKNGTTKDGVKAFDGTGPFKMGKHKKDEQANFNKNNDYWGTKPKLNQV
FT                   QAKVMPAGETAFLSMKKGETNFAFTDDRGTDSLDKDSLKQLKDTGNYQVKRSQAMNTKM
FT                   LVVNSGSKDSAVKDKTVRQALGHLVNRNKIATDILDKQEKPATQLFAKNVTDINFNIPT
FT                   RQFDTHKAQQLLDKAGWKASSKEGSIREKEGKALELALYYDKGSSSQKEQAEFLQAEFK
FT                   KVGIKLNINGETSDKVAERRTSGDYDLMFNQTWGLLYDPQSTIAAFKAKNGYESATSGI
FT                   AHKDALYRDIDAAFKMQNDKQRSAKYQHILKQMDDEGIFIPISHGRMTVVAPKDLEKVS
FT                   FTQSQYELPFNEMQYK"
FT                   /protein_id="YP_003470423.1"
FT   misc_feature    156657..158255
FT                   /note="ABC-type dipeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   DdpA; COG0747"
FT                   /db_xref="CDD:31090"
FT                   /locus_tag="SLGD_00148"
FT   misc_feature    156759..158237
FT                   /note="The substrate-binding component of an ABC-type
FT                   nickel import system contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_NikA; cd08489"
FT                   /db_xref="CDD:173854"
FT                   /locus_tag="SLGD_00148"
FT   misc_feature    order(156810..156812,156822..156824,157029..157031,
FT                   157038..157040,157149..157151,157950..157952,
FT                   157962..157964,158223..158225)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173854"
FT                   /locus_tag="SLGD_00148"
FT   gene            158271..159212
FT                   /db_xref="GeneID:8817855"
FT                   /locus_tag="SLGD_00149"
FT   CDS_pept        158271..159212
FT                   /locus_tag="SLGD_00149"
FT                   /gene_family="HOG000170251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative membrane permease domain-containing
FT                   oligopeptide transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549520"
FT                   /db_xref="GeneID:8817855"
FT                   /translation="MVKFIIKRIALMVPLMLVVSFLTFLLTYLTDENPAVTILHAQGVP
FT                   HVTPQLIAETKAKYGLDQPLLIQYKNWLIQALQLNFGTSYITGDPVASRITPAFINTLK
FT                   LTLISSVMVIMTSIIFGVISALTRGTLIDRSIRSMAFVLTALPSYWIASIFVIYISVKL
FT                   NLLPTSGLTGPESYVLPVLVITIAYAGIYFRNVRRSMIEQLNEDYVLYLRACGISTKKL
FT                   ICHVLRNALQVAVSIFCMSIPMIMGGLVVIEYIFAWPGLGQLSLKAILEHDFPIIQAYV
FT                   LIVAILFIVFNTLADIINALLNPRLREDISCS"
FT                   /protein_id="YP_003470424.1"
FT   misc_feature    158565..159143
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00149"
FT   misc_feature    order(158613..158618,158625..158630,158643..158645,
FT                   158676..158687,158691..158720,158727..158732,
FT                   158736..158738,158829..158834,158838..158840,
FT                   158844..158846,158853..158858,158862..158864,
FT                   158874..158879,158886..158888,158937..158939,
FT                   158976..158981,158988..158990,159009..159020,
FT                   159027..159032,159066..159071,159099..159104,
FT                   159111..159116,159120..159125,159132..159137)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00149"
FT   misc_feature    order(158694..158738,159009..159026)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00149"
FT   misc_feature    order(158736..158738,158814..158816,159027..159029,
FT                   159060..159062,159069..159071,159099..159101)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00149"
FT   misc_feature    order(158889..158927,158943..158945,158955..158957)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00149"
FT   gene            159203..160072
FT                   /db_xref="GeneID:8817856"
FT                   /locus_tag="SLGD_00150"
FT   CDS_pept        159203..160072
FT                   /locus_tag="SLGD_00150"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative membrane permease domain-containing
FT                   oligopeptide transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549521"
FT                   /db_xref="GeneID:8817856"
FT                   /translation="MLVMKRLLHDKGAVLALVIILGYVLLGVLAPLVTWYDPNHIDTAH
FT                   KYASISWQHLLGTDHLGRDILTRLIYAIRPSLLYVFVALICSVVIGAVLGFIAGYFRGY
FT                   IDALIMRLCDVMLAFPSYVVTLALIAMFGMGTENIILAFILTRWAWFCRVIRTSVMQYT
FT                   TAHHVQFAKTIGMSHFKIIHKHIMPLTLADIAIISSSSMCSMILQISGFSFLGLGVKAP
FT                   TAEWGMMLNEARKVMFTHPEMMFAPAIAIVIIVMAFNFLSDAIQLAIDPRLSMVERRQA
FT                   VKKGGIRI"
FT                   /protein_id="YP_003470425.1"
FT   misc_feature    159419..159919
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00150"
FT   misc_feature    order(159467..159472,159479..159484,159497..159499,
FT                   159527..159538,159542..159571,159578..159583,
FT                   159587..159589,159638..159643,159647..159649,
FT                   159653..159655,159662..159667,159671..159673,
FT                   159683..159688,159695..159697,159746..159748,
FT                   159788..159793,159800..159802,159821..159832,
FT                   159839..159844,159884..159889,159917..159919)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00150"
FT   misc_feature    order(159545..159589,159821..159838)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00150"
FT   misc_feature    order(159587..159589,159623..159625,159839..159841,
FT                   159878..159880,159887..159889,159917..159919)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00150"
FT   misc_feature    order(159698..159736,159752..159757,159767..159769)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00150"
FT   gene            160069..160884
FT                   /db_xref="GeneID:8817857"
FT                   /locus_tag="SLGD_00151"
FT   CDS_pept        160069..160884
FT                   /locus_tag="SLGD_00151"
FT                   /codon_start="1"
FT                   /product="putative ATPase domain-containing oligopeptide
FT                   transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549522"
FT                   /db_xref="GeneID:8817857"
FT                   /translation="MTRLNVHHLNIIDSWTGQALVSDVNFNVNSGETLGIIGESGSGKS
FT                   ITCKAIVGLNDDRLKVQGQINFESVDMLKLHDKQLKQYRGKEIAIIMQQGSRAFDPSSP
FT                   VGKQMMETMQAHTSLGRQQVIDILVERMLYMKLQNPKQVLSMYPHMLSGGMLQRLMIAL
FT                   ALSLQPKLIIADEPTTALDTITQYEVLEAFNDMKQQMGCAMIFISHDLTVVNHVADHVA
FT                   VMRAGRLVEQGTREAVLYHPQHAYTSYLLATKKKISDHFQRVMRGECNA"
FT                   /protein_id="YP_003470426.1"
FT   misc_feature    160078..160767
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160126..160824
FT                   /note="nickel import ATP-binding protein NikD; Region:
FT                   nickel_nikD; TIGR02770"
FT                   /db_xref="CDD:131817"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160180..160203
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    order(160189..160194,160198..160206,160345..160347,
FT                   160591..160596,160693..160695)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160336..160347
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160519..160548
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160579..160596
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160603..160614
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   misc_feature    160681..160701
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00151"
FT   gene            160877..161626
FT                   /db_xref="GeneID:8817858"
FT                   /locus_tag="SLGD_00152"
FT   CDS_pept        160877..161626
FT                   /locus_tag="SLGD_00152"
FT                   /codon_start="1"
FT                   /product="putative ATPase domain-containing oligopeptide
FT                   transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549523"
FT                   /db_xref="GeneID:8817858"
FT                   /translation="MLKISNVEKSYRTAHGFRHRQVSIVKGVSFNCPLNSSIAIIGESG
FT                   SGKSTLSRMILGLEKPDNGSVTLEQQPIYKRKVRRHHIAAVFQDYSSSLHPFQTVRDIM
FT                   FEVMCQCGKPSKAEMEECACECLIEVGLSSDYMDRYPHMLSGGEAQRVAIARAISINPQ
FT                   YILFDEAISSLDMSIQTQILDLLLTLRSTRQLSYIFITHDIQAATYLCDELIIFKDGAI
FT                   EAQMPTTALHCSENAYTNALINKQLSF"
FT                   /protein_id="YP_003470427.1"
FT   misc_feature    160877..161623
FT                   /note="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component [Amino acid transport and
FT                   metabolism / Inorganic ion transport and metabolism];
FT                   Region: DppF; COG1124"
FT                   /db_xref="CDD:31321"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    160877..161542
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    161000..161023
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    order(161009..161014,161018..161026,161138..161140,
FT                   161378..161383,161480..161482)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    161129..161140
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    161306..161335
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    161366..161383
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    161390..161401
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   misc_feature    161468..161488
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00152"
FT   gene            161638..162828
FT                   /db_xref="GeneID:8817859"
FT                   /locus_tag="SLGD_00153"
FT   CDS_pept        161638..162828
FT                   /locus_tag="SLGD_00153"
FT                   /gene_family="HOG000280262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Antibiotic resistance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549524"
FT                   /db_xref="GeneID:8817859"
FT                   /translation="MKGALSGPFLRLYLLTLLFFSANAILNVFIPLRGHDLGATNTVIG
FT                   VVMGAYMLTAMLLRPWAGQMIARVGPIKVLRIILIINALALILYGFTGLEGYFIARVMQ
FT                   GICTAFFSMSLQLGIIDALPEKHRAEGVSLYSLFSMIPNLIGPLIAVGIWQIHHMSAFA
FT                   VIMVMIALSTTIFGYRVTFGEQEPDTSSKIDALPYNAVTVFGQLFKNKALCQSGCIMIL
FT                   TSIVFGAVNTFIPLYAVRDSFVHAGLFLTIQAIAVVLSRFYLRKYIPSDGQWHSVFMLR
FT                   VLSLLVISAVVIAFGPQLPQMIVYIGAVCIGITQALVYPTLTSYLSFVLPKVERNMLLG
FT                   LFIACADLGISLGGVLMGPISDWLGFKFMYLLCASFVVIAMVSSVSNWNQQQCHKR"
FT                   /protein_id="YP_003470428.1"
FT   misc_feature    161698..162699
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="SLGD_00153"
FT   misc_feature    161701..162783
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00153"
FT   misc_feature    order(161704..161706,161713..161721,161725..161730,
FT                   161779..161781,161788..161793,161800..161802,
FT                   161812..161817,161821..161826,161959..161964,
FT                   161971..161976,161983..161988,161995..161997,
FT                   162031..162036,162043..162048,162064..162066,
FT                   162307..162309,162316..162321,162328..162333,
FT                   162340..162342,162373..162375,162385..162387,
FT                   162397..162399,162406..162408,162418..162420,
FT                   162571..162573,162580..162585,162592..162594,
FT                   162604..162609,162616..162618,162649..162654,
FT                   162661..162666,162673..162678,162685..162687)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00153"
FT   gene            complement(162965..164278)
FT                   /db_xref="GeneID:8817860"
FT                   /locus_tag="SLGD_00154"
FT   CDS_pept        complement(162965..164278)
FT                   /locus_tag="SLGD_00154"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549525"
FT                   /db_xref="GeneID:8817860"
FT                   /translation="MNISHKLLIALSTTITIALPISQCAQAASYVVNNENIDKDGRQAY
FT                   TGSYNRAALKQQTVKQMGPQNREAFKEDKLFKAPKNKQPIRKSENRSQNGGKQYSLNDQ
FT                   RTFTTIDNRTNQDEQTTATLKYDGKKAQVWVADQYITDKQAQNIGREFDERIDPLIENN
FT                   FGEPSDVDNNGKVNILVYDIKDNYDQTGTYIGGYFHPRDLYNVRGSNHSEIFYMDTYPS
FT                   MGTDRQHLNESQIYSTLAHEYQHMVNANENLFKEQSQEEMDPWLNEALSMASEQMYLNA
FT                   PLNSRIDYYNNSKSIAYGHSLIRWDEQGDTLSNYSLSYLFIEYLKKQSDNGEQVFKELI
FT                   NDPGDTNTALQNAIHEHVDPNLSLSKFMTNFRIALVKKENSGPYGFKGYADFNNVHPQP
FT                   ISQIPETLAPQGSVLFQTNQDFNVPNDKDEDISYNKVN"
FT                   /protein_id="YP_003470429.1"
FT   misc_feature    complement(162986..163948)
FT                   /note="Peptidase M30; Region: Peptidase_M30; pfam10460"
FT                   /db_xref="CDD:151033"
FT                   /locus_tag="SLGD_00154"
FT   gene            164491..165078
FT                   /db_xref="GeneID:8817861"
FT                   /locus_tag="SLGD_00155"
FT   CDS_pept        164491..165078
FT                   /locus_tag="SLGD_00155"
FT                   /gene_family="HOG000015209" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ThiJ/PfpI family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549526"
FT                   /db_xref="GeneID:8817861"
FT                   /translation="MKKAIFLLLDEYADWEGSYLASALNQSDTWEVMTASIQDEVRSMG
FT                   GLTTLIDVQLEAVNAYDLLVLIGGKSWHIDNQILNHFVQQAFEQHKPIAAICGAVDYLA
FT                   RQGHLNTYRHTGNAVQLLDQYENYQPTYPFIATQVVRDKHLVTANGTAAIPFTAAVQQL
FT                   IDFDSNDNIERQAYMNQFGFYDYCERYGNPYL"
FT                   /protein_id="YP_003470430.1"
FT   misc_feature    164500..164994
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in a subgroup of proteins similar to PfpI from
FT                   Pyrococcus furiosus; Region: GATase1_PfpI_3; cd03140"
FT                   /db_xref="CDD:153234"
FT                   /locus_tag="SLGD_00155"
FT   misc_feature    164779..164781
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153234"
FT                   /locus_tag="SLGD_00155"
FT   gene            165280..166911
FT                   /db_xref="GeneID:8817862"
FT                   /locus_tag="SLGD_00156"
FT   CDS_pept        165280..166911
FT                   /locus_tag="SLGD_00156"
FT                   /gene_family="HOG000173493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Amino acid transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549527"
FT                   /db_xref="GeneID:8817862"
FT                   /translation="MGNENKSNKISLAQLVLLGLGSLIGSGWLFGAWEASSIAGPAAII
FT                   SWVIGFIVIGTISYNYIEIGTMFPQSGGMSNYAQYTHGSLLGFIAAWANWVSLVTIIPI
FT                   EAVSAVQYISSWPWDWAKFTSVLMEDGSISTSGLFAVYIIIIIFSLLNYWSVKILTSFT
FT                   SLISVFKLGVPLLTVIMLMLSGFDTGNYGHSVSTFMPYGSAPIFAATTTSGIIFSFNAF
FT                   QTIINMGSEIRNPEKNIARGIAISLSLSAALYIILQSTFITSMPQSTINAHGWSGINFN
FT                   SPFADLAILLNINWLAILLYIEAVVSPFGTGVSFVAVTGRVLRAMEKNGHIPKFLGKMN
FT                   ETYNIPRVAILFNAIISIIMVTLFRDWGTLAAVISTATLVAYLTGPTTVIALRKMAPKM
FT                   TRPYRATLLKVMAPLSFVLASLAIYWAMWPTTAEVIFIIILGLPIYFFYEYKMNWRNTK
FT                   KQIGGSLWIIVYLIVLAILSFIGSKEFKGINLIHYPYDFIVIIVVALIFYSIGATSYFE
FT                   SIYFRHAKKINTKMARDLKDNELNNK"
FT                   /protein_id="YP_003470431.1"
FT   misc_feature    165418..166737
FT                   /note="Amino acid permease; Region: AA_permease; pfam00324"
FT                   /db_xref="CDD:144058"
FT                   /locus_tag="SLGD_00156"
FT   misc_feature    165418..166623
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="SLGD_00156"
FT   gene            complement(167058..167537)
FT                   /db_xref="GeneID:8817863"
FT                   /locus_tag="SLGD_00157"
FT   CDS_pept        complement(167058..167537)
FT                   /product="Peptide methionine sulfoxide reductase MsrA"
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00157"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="GI:289549528"
FT                   /db_xref="GeneID:8817863"
FT                   /translation="METVYLAGGCLYGVEAFIRTLPGVINTTSGRANGITKSLDGEYDG
FT                   YVEAVKTEFYPNVVSVTDLMGYLFEIIDPYSLHQQGQDIGLKYRTGFYSENPEHLKEAQ
FT                   AFIDAIEDHHLIATEVLPLTNYIKSADMHQNRLERYPDDYCHLPKSLVYKYKDNA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470432.1"
FT   misc_feature    complement(167070..167537)
FT                   /note="Peptide methionine sulfoxide reductase; Region:
FT                   PMSR; cl00366"
FT                   /db_xref="CDD:174150"
FT                   /locus_tag="SLGD_00157"
FT   gene            167732..168412
FT                   /db_xref="GeneID:8817864"
FT                   /locus_tag="SLGD_00158"
FT   CDS_pept        167732..168412
FT                   /locus_tag="SLGD_00158"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549529"
FT                   /db_xref="GeneID:8817864"
FT                   /translation="MKIYILQHVPFETPGSLAYLDAHIIKLYETPVRIPDAQQVDVLII
FT                   LGGPMSVNDDIPWLAEERALIIAMLKQQKPMLGICLGAQLIAQVLGATIYNNSAGKEVG
FT                   FSNIKKTTSRYNFLPETLDVLHWHGETFSLPPGAERLYCSPYCENQAFIYKDCVIGLQF
FT                   HLETTSQTLQDLVAADYKYIEGNVLQQTRDSILQHEIPTDNQIVLSKIMDHLIGGCTYG
FT                   ETYS"
FT                   /protein_id="YP_003470433.1"
FT   misc_feature    167732..168286
FT                   /note="GMP synthase - Glutamine amidotransferase domain
FT                   [Nucleotide transport and metabolism]; Region: GuaA;
FT                   COG0518"
FT                   /db_xref="CDD:30864"
FT                   /locus_tag="SLGD_00158"
FT   misc_feature    167735..168232
FT                   /note="Subgroup of proteins having the Type 1 glutamine
FT                   amidotransferase (GATase1) domain; Region: GATase1_1;
FT                   cd01741"
FT                   /db_xref="CDD:153212"
FT                   /locus_tag="SLGD_00158"
FT   misc_feature    order(167969..167971,168221..168223,168227..168229)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153212"
FT                   /locus_tag="SLGD_00158"
FT   gene            168393..169361
FT                   /db_xref="GeneID:8817865"
FT                   /locus_tag="SLGD_00159"
FT   CDS_pept        168393..169361
FT                   /locus_tag="SLGD_00159"
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Lipase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549530"
FT                   /db_xref="GeneID:8817865"
FT                   /translation="MEKHIHKDLLPAFKRLSPMIFTEARLPLIRGINQKLIRPYKDESL
FT                   QFTEHHITYADSDVSIRVKVYAPKAQQQPLPVVLYIHGGGTFFGTVEGNDATCASYVKH
FT                   VPCVVVSVDYRLAPEHPYPAALEDCYLALQWIVSERETLNIDIDRLAVVGGSTGGGLTA
FT                   ALTLLARDRKGPNIKFQMPLFPMIDDTCATPSSQEVLDSKVWSSELNQFAWSMYLKNIK
FT                   GDVPKYAAPIRETDFSQLPATYTSVGTLDPYRDETINYVQALAQAGVPVEFHLYPGCYH
FT                   EFESIAPDAPISKQSKAAALQALKQALTDEDASIKAKNIEK"
FT                   /protein_id="YP_003470434.1"
FT   misc_feature    168579..>168800
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00159"
FT   misc_feature    168624..169241
FT                   /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
FT                   pfam07859"
FT                   /db_xref="CDD:149109"
FT                   /locus_tag="SLGD_00159"
FT   gene            complement(169499..170098)
FT                   /db_xref="GeneID:8817866"
FT                   /locus_tag="SLGD_00160"
FT   CDS_pept        complement(169499..170098)
FT                   /locus_tag="SLGD_00160"
FT                   /gene_family="HOG000090051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549531"
FT                   /db_xref="GeneID:8817866"
FT                   /translation="MSEFIAAIIGGLFTLAGTFIALIFQFRKDERDKREDYHNDLVSSL
FT                   DVIAYKAAKVRNNYLDFNYSNFNKDNTTEIYQEIHTDFKGLDKQLQSLILLMSHHSDNS
FT                   NKVLRRLLTSYEPVENQFNNFKISYKIYTQKYESPDFNKNNITFSKRKLDISIEDFIAH
FT                   IKNFASEKYQHDLYEPTLNNLVDPNDAINNDKYYQK"
FT                   /protein_id="YP_003470435.1"
FT   gene            170513..172552
FT                   /db_xref="GeneID:8817867"
FT                   /locus_tag="SLGD_00161"
FT   CDS_pept        170513..172552
FT                   /product="PTS system, glucose-specific IIC component/PTS
FT                   /gene_family="HOG000250993" [ FAMILY / ALN / TREE ]
FT                   system, glucose-specific IIB component/PTS system,
FT                   glucose-specific IIA component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00161"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549532"
FT                   /db_xref="GeneID:8817867"
FT                   /translation="MRKKLFGQLQRIGKALMLPVAILPAAGLLLALGTAMQGESLQHYL
FT                   PFIKNGVIQNIALMMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIVMNKT
FT                   MGAILNVTPNEVKDAASGYASVLGIPTLQTGVFGGIIIGGLAAWCYNKFYNISLPSYLG
FT                   FFAGKRFVPIMMATTSFVLAFPMAYVWPMIQSGLNAFSEGLLDSNTGLAVFLFGFIKRL
FT                   LIPFGLHHIFHAPFWFEFGSWKNAAGHIVRGDQLIFIDQIREGAHLTAGKFMQGEFPVM
FT                   MFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFVIHA
FT                   LLDGLSFLILYLLHLHLGYTFSGGFIDYVLLGVLPNKTAWWLVIPVGLVYAVIYYVIFR
FT                   FLIKKLNFKTPGREDKMASAKQTAASELPYAVLEAMGGKTNIKHLDACITRLRVEVNDK
FT                   AKVDVAGLKDLGASGVLEVGNNMQAIFGPKSDQIKHEMQQIMNGEVVEHPMSAEDDSDE
FT                   AVVVTETKAQAETHSESVVAPLEGKVVDLADVPDQVFSEKMMGDGIAINPVSGEVRAPF
FT                   NGKVQMIFPTKHAIGLVSDQGLELLIHIGLDTVQLEGQGFTMHVEEGQTIEQGQQLVTF
FT                   DLDYLGENAKSLITPIIVTKGDITDIAVKAGNSIHFGDHLFNIK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470436.1"
FT   misc_feature    170519..172018
FT                   /note="PTS system, glucose-specific IIBC component; Region:
FT                   PTS-II-BC-glcB; TIGR02002"
FT                   /db_xref="CDD:162654"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    170651..171781
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    171785..172012
FT                   /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIB_glc;
FT                   cd00212"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    171848..171868
FT                   /note="active site turn"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    171851..171853
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    172115..172483
FT                   /note="PTS_IIA, PTS system, glucose/sucrose specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_glc;
FT                   cd00210"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    order(172163..172174,172184..172189,172253..172258,
FT                   172262..172267,172283..172291,172307..172315,
FT                   172319..172321,172331..172333,172337..172342,
FT                   172376..172378,172472..172474,172481..172483)
FT                   /note="HPr interaction site; other site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    order(172163..172165,172169..172174,172178..172180,
FT                   172184..172189,172256..172258,172262..172264,
FT                   172274..172276,172313..172315,172319..172321,
FT                   172331..172333,172337..172342,172346..172348,
FT                   172472..172474)
FT                   /note="glycerol kinase (GK) interaction site; other site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    order(172268..172270,172274..172276,172319..172321,
FT                   172325..172327)
FT                   /note="active site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00161"
FT   misc_feature    172319..172321
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00161"
FT   gene            complement(172918..173838)
FT                   /db_xref="GeneID:8817868"
FT                   /locus_tag="SLGD_00162"
FT   CDS_pept        complement(172918..173838)
FT                   /locus_tag="SLGD_00162"
FT                   /gene_family="HOG000045521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ferrichrome-binding periplasmic protein
FT                   precursor"
FT                   /transl_table="11"
FT                   /note="TC 3.A.1.14.3"
FT                   /db_xref="GI:289549533"
FT                   /db_xref="GeneID:8817868"
FT                   /translation="MKRFIILTLCTILFLAACNSNDNHERAKDHSNTKAMRTVTMDDGN
FT                   KVKIPKNPKRIAVLHPTYVGALVKFGHKPIAVPKFVAKNKVLNKATKGIKRIDNTSVEQ
FT                   VAKVKPDLIITSKGDKNYGKLKKIAPTYVFDANQSSYKDTTKKLAQLVNEQHKANQWLK
FT                   HWEKQLAKDKKALAPMIKGKTASVLQQTPKGIMAFSNHMGRGTEIIYEGYGLKQPKALK
FT                   QATQKKVATPINEEQFPEYIGDIAVIAQQGNKSPQFEQTQFWKSLNAVKKHRVIKFDVS
FT                   ETQYNDPISLERQRDIFYKALKAMK"
FT                   /protein_id="YP_003470437.1"
FT   misc_feature    complement(172975..173706)
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="SLGD_00162"
FT   misc_feature    complement(173002..173673)
FT                   /note="Periplasmic binding protein; Region: Peripla_BP_2;
FT                   pfam01497"
FT                   /db_xref="CDD:144914"
FT                   /locus_tag="SLGD_00162"
FT   misc_feature    complement(order(173389..173391,173458..173460,
FT                   173467..173472))
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="SLGD_00162"
FT   gene            173957..174649
FT                   /db_xref="GeneID:8817869"
FT                   /locus_tag="SLGD_00163"
FT   CDS_pept        173957..174649
FT                   /locus_tag="SLGD_00163"
FT                   /gene_family="HOG000134266" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative esterase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549534"
FT                   /db_xref="GeneID:8817869"
FT                   /translation="MNKRRQVFQMDGFEITIQLPKDYGKQKVKRYAALIVHDGDMLFKR
FT                   CNKDMIFIGILSKERTKDFTPWPAKVGTRLNQGQASRYLTWLTTQLLPYVREQYRVSLN
FT                   NQDIGIAGASYGGLVSLYALYTMPQQFGKYILISPSVWYPEFIDFMKQQQAINASVHVY
FT                   WYVGMKEGIKHTQIVKDMVGNSLLGKAILANDLANETSTFKFQTAKRGIHRQRYFKKFF
FT                   KRGLKEVF"
FT                   /protein_id="YP_003470438.1"
FT   misc_feature    173993..174571
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00163"
FT   gene            174771..175886
FT                   /db_xref="GeneID:8817870"
FT                   /locus_tag="SLGD_00164"
FT   CDS_pept        174771..175886
FT                   /locus_tag="SLGD_00164"
FT                   /gene_family="HOG000279794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Low temperature requirement protein A"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549535"
FT                   /db_xref="GeneID:8817870"
FT                   /translation="MERQPIQRHLEEKRAGFHELFFDLIFVYAIQKIAHVILHTHGGTI
FT                   SADLFFKYIMMSLILWILWSHQTFFTNRFGKTSKTDVCFMMFNLFVLIFLSNSLYPSFE
FT                   KTFFPFFLCVTIMYMSIGLQYLVQLRYTRYPNDYQTCKAFAIVAFTVAALSCLSLILPT
FT                   HIHYYSAFLGVFVAGTGLIPFRKYLYQSPVNMMHLVERFSLLTIIIFGEVLVGLASTFS
FT                   IKHFDIIYIFQFLILVSLFGIYWLVTENYINHQHKSIGFLLVYTHLVINIALGMLNTAL
FT                   VYSNSNELYRFFEINLLYVSIVLFLAGLWFNSSYFHAHLKIVKPIVYQIIIIIVAYMMS
FT                   IVFINVGHVFVIVTAIATCLILAIYYLKVAE"
FT                   /protein_id="YP_003470439.1"
FT   misc_feature    174804..175724
FT                   /note="Bacterial low temperature requirement A protein
FT                   (LtrA); Region: LtrA; cl01754"
FT                   /db_xref="CDD:120864"
FT                   /locus_tag="SLGD_00164"
FT   misc_feature    176085..177320
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|224477927|ref|YP_002635533.1| penicillin binding protein
FT                   4"
FT   gene            176085..176462
FT                   /db_xref="GeneID:8817871"
FT                   /locus_tag="SLGD_00165"
FT   CDS_pept        176085..176462
FT                   /product="D-alanyl-D-alanine carboxypeptidase/Penicillin
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   binding protein PBP4"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00165"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="GI:289549536"
FT                   /db_xref="GeneID:8817871"
FT                   /translation="MRQIKGFVLLLCLCMMFSPLTTYAAKTPTQIAEAEKQHIAQHYNP
FT                   KSMIVTTQQGQILYDYHQHDNVDPASITKLMTIYLVLDDIDKGKIKLTDEVKVSGRYAK
FT                   MSRIPGLTTFPLIKGKTYTIK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470440.1"
FT   misc_feature    176103..>176333
FT                   /note="Beta-lactamase; Region: Beta-lactamase; cl01009"
FT                   /db_xref="CDD:176824"
FT                   /locus_tag="SLGD_00165"
FT   gene            176511..177320
FT                   /db_xref="GeneID:8817872"
FT                   /locus_tag="SLGD_00166"
FT   CDS_pept        176511..177320
FT                   /locus_tag="SLGD_00166"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="penicillin binding protein 4"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549537"
FT                   /db_xref="GeneID:8817872"
FT                   /translation="MAEHIDGNSSDFTHRMNRKAQALHMRHTHFNNPSGADNRLIKPFA
FT                   PSKYKQQHFSKTTAKDMAVLTQQLVKQHPKVLKITRLTSDKQHGHMLKNTNLSLPAQAD
FT                   GLAGADGLKTGTSNHGYNLALTAKQNNLRIHSVLFQVQPFADERAKHVRQQLSNIMVRR
FT                   AFKNYDYRKVLSKGQHRIQGKMYYVKKDLYDVVPKDHKGYQFKINHGKYVHLTYQRSFL
FT                   PGTHPPKVEVVKVSGMKRPIVISLCISGGLIIAFIFTITMIKNRKRI"
FT                   /protein_id="YP_003470441.1"
FT   misc_feature    <176511..177221
FT                   /note="D-alanyl-D-alanine carboxypeptidase [Cell envelope
FT                   biogenesis, outer membrane]; Region: DacC; COG1686"
FT                   /db_xref="CDD:31872"
FT                   /locus_tag="SLGD_00166"
FT   misc_feature    <176511..>176615
FT                   /note="Beta-lactamase; Region: Beta-lactamase; cl01009"
FT                   /db_xref="CDD:176824"
FT                   /locus_tag="SLGD_00166"
FT   misc_feature    177018..177212
FT                   /note="Domain of unknown function (DUF1958); Region:
FT                   DUF1958; pfam09211"
FT                   /db_xref="CDD:150032"
FT                   /locus_tag="SLGD_00166"
FT   gene            complement(177711..178307)
FT                   /db_xref="GeneID:8817873"
FT                   /locus_tag="SLGD_00167"
FT   CDS_pept        complement(177711..178307)
FT                   /locus_tag="SLGD_00167"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family regulatory protein of MDR cluster"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549538"
FT                   /db_xref="GeneID:8817873"
FT                   /translation="MDKRQKRTNNYLKKGLTQLLSTQNYSDITIQQLAEASHINRSTFY
FT                   LHYQSKDDFIVSIIDETITELLDYVKRDSSSEDAIFSSEFKVSFYKLLEYIEMNYEFIR
FT                   VLFINMNNTRFRSLLVEKVRENIFLPLLEKNHVSLTFKNEIALNFIIHGHLGVIERWIN
FT                   DNVQYSSHYIAQVMLEIANTNPFELLGIESELEER"
FT                   /protein_id="YP_003470442.1"
FT   misc_feature    complement(<177933..178307)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="SLGD_00167"
FT   misc_feature    complement(178134..178256)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="SLGD_00167"
FT   gene            178541..181027
FT                   /db_xref="GeneID:8817874"
FT                   /locus_tag="SLGD_00168"
FT   CDS_pept        178541..181027
FT                   /locus_tag="SLGD_00168"
FT                   /gene_family="HOG000292420" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Putative membrane protein ydgH"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549539"
FT                   /db_xref="GeneID:8817874"
FT                   /translation="MKTILRFKWPISILVIIVIVLSLIFAPNLSQLAKEKGEIKPPDST
FT                   SSQKYEHMLKDVGANSNSIVAVIKMKEPLSEQGNDKVEHFIKEIKKIDGVNHVISPYTN
FT                   KDTFKKVVSKDKKTIIIPVEMTTGDSVKVADKINKIDNHPGKVYLTNNDLVTHDINKAT
FT                   DKGLQKTEIVTVALILIILFVVFRSVVTPFIPLFIVGLSYLFSSAIIAFLVKYCDFPVS
FT                   VYIQPFLVALLFGIGTDYCILLLNRYKEELAAHDDKTKAVYETFVSGGKTILICGSTIF
FT                   VSFLVILFAQFDLFRSAVGIGVGVVCLLIIMYTLLPLIMVLLGEKIFWPSKKATSHKEN
FT                   RFWGKLGNLSSKHAFVVILVILAVFLPLIYFTPNKITYDNTNEISNHYGSVKALDIIKD
FT                   KFELGEAFPVTIAIKDNDKLTTSKGLSDLETLTKSINKIDNVKGVNTITRPTGTPIKQL
FT                   SATNQLNEIQQQLTKANKGLGQINNGLGTMQQKVQPLTQSQVVQQQMQQASQNPQAGVQ
FT                   SITQQASQLSQGLQQAQQGNEQVIDGQKEIQSYLKGMSQDDSVNRSGMYISQDMLNNKD
FT                   MKRSIDQYSANHGNVVLLNVELKQNPYSKSAFKTLNNIKNTVDNQKNGTVFKNSKIEYG
FT                   GVTSQNADLDHTINTDMTKVIILMSLVTFLVLVVFKRSIIMPLYMMFSILITYYVSMGI
FT                   ANVLFDYSFGEKGVLLVAPFFSLVILFSLGIDYAIFLLNRFNEEVRTHDIHNALITAMK
FT                   KMGTVIVTACIIIVGTIAALYTSGMLTLMQIATILILGLLIYNLFILPLFIPAVVSTLG
FT                   KGNWWPLKGPKKQQHK"
FT                   /protein_id="YP_003470443.1"
FT   misc_feature    178541..>179977
FT                   /note="Predicted drug exporters of the RND superfamily
FT                   [General function prediction only]; Region: COG2409"
FT                   /db_xref="CDD:32544"
FT                   /locus_tag="SLGD_00168"
FT   misc_feature    <180503..180976
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cl00462"
FT                   /db_xref="CDD:176819"
FT                   /locus_tag="SLGD_00168"
FT   gene            181203..182234
FT                   /db_xref="GeneID:8817875"
FT                   /locus_tag="SLGD_00169"
FT   CDS_pept        181203..182234
FT                   /locus_tag="SLGD_00169"
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549540"
FT                   /db_xref="GeneID:8817875"
FT                   /translation="MDSKVLVTGGTGFLGMRIISELLKQGYDVRTTVRSINKQANILNT
FT                   MKANDIPTERLTFVEADLSSDEHWDDAMQGCQYVLSVASPVFFEIPDDESEVIRPAIEG
FT                   VQRILRAADHAGVQRVVMTSNFGAVGFSNKDKSSITTERNWTDEHEPGLSAYEKSKLLA
FT                   EKAAWNYVENATRKIEFATINPVAMMGPSLDAHISGSFDLVKNLVNGSMKRIPNIALNI
FT                   VDVRDVADLHIRAMTHNEADGKRFIATADGQITMPEIAALIKKERPNLAQKVSTKRVPN
FT                   FILSLGAKVNKQAKEGKLLLDINRNVSNEQARKYLGWTPIATQEEAILAALDSIVQYDL
FT                   LNN"
FT                   /protein_id="YP_003470444.1"
FT   misc_feature    181212..182207
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="SLGD_00169"
FT   misc_feature    181215..>181934
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00169"
FT   gene            182591..183160
FT                   /db_xref="GeneID:8817876"
FT                   /locus_tag="SLGD_00170"
FT   CDS_pept        182591..183160
FT                   /locus_tag="SLGD_00170"
FT                   /gene_family="HOG000279798" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549541"
FT                   /db_xref="GeneID:8817876"
FT                   /translation="MKKEKTITLITASVLFLGACSQSDNHTTTSNHQKDSHQGTIVLKE
FT                   VKTKPEDAIKKAQNSYKNQQVTEISFEKSNGEWVYKVEQQNPQNHNESEVIVNDKSQRV
FT                   EHKKSEKGDQDHSDDQDTFKYSEVKSYKSAIKAAQRAFDGEIKEWSLSKDDGKLVYDIT
FT                   LQKGKEQRDITVDAQTGKVIDNQQDD"
FT                   /protein_id="YP_003470445.1"
FT   misc_feature    182711..183157
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG3212"
FT                   /db_xref="CDD:33025"
FT                   /locus_tag="SLGD_00170"
FT   misc_feature    182978..183148
FT                   /note="Peptidase propeptide and YPEB domain; Region: PepSY;
FT                   pfam03413"
FT                   /db_xref="CDD:146184"
FT                   /locus_tag="SLGD_00170"
FT   gene            183474..185720
FT                   /db_xref="GeneID:8817877"
FT                   /locus_tag="SLGD_00171"
FT   CDS_pept        183474..185720
FT                   /product="Pyruvate formate-lyase"
FT                   /gene_family="HOG000011346" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00171"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="GI:289549542"
FT                   /db_xref="GeneID:8817877"
FT                   /translation="MKETYKHTDAWQGFKNGRWNKHVDVREFIQLNYNLYEGDDAFLTG
FT                   PTEATQTLWQQVMQLSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTDKP
FT                   FKRSMQPFGGIRMAKAACEAYGYELDADTEKIFTEYRKTHNQGVFDAYSKEMLACRKAG
FT                   VITGLPDAYGRGRIIGDYRRVALYGVDFLMEQKLHDFHTMSTEMSEDVIRLREELSEQY
FT                   RALKELKELGQTYGFDLSRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDIY
FT                   AERDLNNGTITESEVQEIIDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGIDG
FT                   RPLVTKNSFRFLHSLDNLGPAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDDL
FT                   MRESYGDDYGIACCVSAMKIGKQMQFFGARANLAKTLLYAINGGKDEKSGNQVGPEYKG
FT                   IDTEILDYDEVYDKFDKMMDWLAGVYINSLNIIHYMHDKYSYERIEMALHDTNIIRTMA
FT                   TGIAGLSVAADSLSAIKYAQVKPIRNEDGLVVDFDITGDFPKYGNNDSRVDDIAVELVE
FT                   RFMTKLRSHKTYRDSEHTMSVLTITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRDQ
FT                   KGALSSLSSVAKIPYDCCKDGISNTFSIVPKSLGKEDDDQNRNLTSMLDGYAMQHGHHL
FT                   NINVFNRETLMDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHEQM"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470446.1"
FT   misc_feature    183501..185717
FT                   /note="formate acetyltransferase 1; Region: pyr_form_ly_1;
FT                   TIGR01255"
FT                   /db_xref="CDD:162272"
FT                   /locus_tag="SLGD_00171"
FT   misc_feature    183501..185708
FT                   /note="Pyruvate formate lyase 1; Region: PFL1; cd01678"
FT                   /db_xref="CDD:153087"
FT                   /locus_tag="SLGD_00171"
FT   misc_feature    order(183819..183824,183906..183911,183918..183923,
FT                   183927..183929,183942..183944,183951..183956)
FT                   /note="coenzyme A binding site; other site"
FT                   /db_xref="CDD:153087"
FT                   /locus_tag="SLGD_00171"
FT   misc_feature    order(183999..184001,184272..184277,184437..184439,
FT                   184455..184457,184707..184709,184749..184751,
FT                   184758..184760,185265..185267,185271..185273)
FT                   /note="active site"
FT                   /db_xref="CDD:153087"
FT                   /locus_tag="SLGD_00171"
FT   misc_feature    order(184707..184712,185640..185642)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:153087"
FT                   /locus_tag="SLGD_00171"
FT   misc_feature    185631..185645
FT                   /note="glycine loop; other site"
FT                   /db_xref="CDD:153087"
FT                   /locus_tag="SLGD_00171"
FT   gene            185742..186497
FT                   /db_xref="GeneID:8817878"
FT                   /locus_tag="SLGD_00172"
FT   CDS_pept        185742..186497
FT                   /product="Pyruvate formate-lyase activating enzyme"
FT                   /gene_family="HOG000011458" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00172"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="GI:289549543"
FT                   /db_xref="GeneID:8817878"
FT                   /translation="MIKGHIHSVESMGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKIN
FT                   EPSREVTVDEMVNEILPYQPYFDASGGGVTVSGGEPLLQMPFLEALFKSLKAYGIHTCI
FT                   DTSAGCANDTIAFNRHFDTLQQYTDLILLDIKHIDNDKHMALTGRPNTHILKFAQKLSE
FT                   MKQPVWIRHVLVPGYSDDKEDLIRLGEFINSLDNVEKFEILPYHQLGVHKWKTLGVHYQ
FT                   LEDVDPPDEEAVMAAYRYVNFKGKIPVQL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470447.1"
FT   misc_feature    185757..186443
FT                   /note="pyruvate formate-lyase 1-activating enzyme; Region:
FT                   PFLA; TIGR02493"
FT                   /db_xref="CDD:131546"
FT                   /locus_tag="SLGD_00172"
FT   misc_feature    185808..186362
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="SLGD_00172"
FT   misc_feature    order(185826..185828,185832..185834,185838..185840,
FT                   185844..185852,185970..185972,185976..185981,
FT                   186054..186062,186135..186137,186258..186260,
FT                   186354..186359)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="SLGD_00172"
FT   gene            186621..186938
FT                   /db_xref="GeneID:8817879"
FT                   /locus_tag="SLGD_00173"
FT   CDS_pept        186621..186938
FT                   /locus_tag="SLGD_00173"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Arsenical resistance operon repressor"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549544"
FT                   /db_xref="GeneID:8817879"
FT                   /translation="MSYQSLAVKLKVCADATRLEILDLLSCDELCADNILKYFNISQPT
FT                   LSHHMKVLVAHHFVEVRKEGNKRMYRLNQEHYQQLIQQLNQIHQSNPMCICNDLERGGS
FT                   Q"
FT                   /protein_id="YP_003470448.1"
FT   misc_feature    186648..186836
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00173"
FT   misc_feature    order(186648..186653,186657..186659,186666..186668,
FT                   186675..186680,186687..186692,186699..186701,
FT                   186789..186791)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00173"
FT   misc_feature    order(186651..186656,186666..186674,186711..186719,
FT                   186744..186755,186759..186764,186771..186776,
FT                   186780..186785,186801..186809,186822..186830)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00173"
FT   misc_feature    order(186711..186713,186720..186722)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00173"
FT   gene            186935..188227
FT                   /db_xref="GeneID:8817880"
FT                   /locus_tag="SLGD_00174"
FT   CDS_pept        186935..188227
FT                   /locus_tag="SLGD_00174"
FT                   /gene_family="HOG000005271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Arsenic efflux pump protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549545"
FT                   /db_xref="GeneID:8817880"
FT                   /translation="MITMLAILIFIVTIIFIIWQPKGLDIGITALMGAIIALLTGVVSI
FT                   GDVVKVTDIVWNATLTFVALIIISLILDEIGFFEWAALHMVRASNGKGVKMFIYILLLG
FT                   AIVAACFANDGAALILTPIVLAMVRHLGFKEKVIFPFIIACGFIADTTSLPFTVSNLVN
FT                   IVSADFFSLSFMGYAIRMLIPNFFSLFASIIVLWLYFRKTIPKHFDHSQLKEPTAVIKD
FT                   YRLFRWSWLVLSVLFIGYILSEFLPIPISFIAGTIALVFLALALQSHVVNTTKVVKGAP
FT                   WNIVIFSIGMYLVVFGLKNVGITTLLSHVLVTIAHHGLFTSIMGMGFMSAILSSVMNNM
FT                   PTVMIDAIAIDQAAVVGIVKEGMIYANVIGSDLGPKMTPIGSLATLLWLHVLSQKGMKI
FT                   SWWTYIKTGVVITLPVLFITLIGLYITLKWL"
FT                   /protein_id="YP_003470449.1"
FT   misc_feature    186989..188224
FT                   /note="Di- and tricarboxylate transporters [Inorganic ion
FT                   transport and metabolism]; Region: CitT; COG0471"
FT                   /db_xref="CDD:30819"
FT                   /locus_tag="SLGD_00174"
FT   misc_feature    186989..188206
FT                   /note="Anion permease ArsB.  These permeases have been
FT                   shown to export arsenate and antimonite in eubacteria and
FT                   archaea.  A typical ArsB permease contains 8-13
FT                   transmembrane helices and can function either independently
FT                   as a chemiosmotic transporter or as a...; Region:
FT                   ArsB_permease; cd01118"
FT                   /db_xref="CDD:29732"
FT                   /locus_tag="SLGD_00174"
FT   misc_feature    order(186989..186991,187010..187051,187100..187153,
FT                   187223..187273,187277..187330,187349..187420,
FT                   187484..187528,187616..187654,187685..187729,
FT                   187772..187828,187898..187945,188024..188083,
FT                   188159..188197)
FT                   /note="transmembrane helices; other site"
FT                   /db_xref="CDD:29732"
FT                   /locus_tag="SLGD_00174"
FT   gene            188381..189196
FT                   /db_xref="GeneID:8817881"
FT                   /locus_tag="SLGD_00175"
FT   CDS_pept        188381..189196
FT                   /locus_tag="SLGD_00175"
FT                   /gene_family="HOG000090096" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549546"
FT                   /db_xref="GeneID:8817881"
FT                   /translation="MDLAIKGKSLTKVINGQVIFSDMTIEFPNQSIIQIVGANGSGKSV
FT                   TLKMLAQIYKPTVGNVTINGQVSYAPDHLPKSITLTVQQYLLFVEQLYEVQHSCFALDD
FT                   LIQRFHIEAFLSQPIKQCSKGTQQKLNLIQCLLKQADIYILDEPFSGLDKQSVSVLTSI
FT                   LKYLKQYATVILTSHDEAQHYGLVTHQFKLSTQRLMKLTEQAQVSYKIIETQFVSQIDL
FT                   NELVREFDMEIIEQHSTCTLIKVNQQQCNHLLKILIDKQYDITTVKEWT"
FT                   /protein_id="YP_003470450.1"
FT   misc_feature    188381..188920
FT                   /note="ABC-type transport system involved in cytochrome c
FT                   biogenesis, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: CcmA;
FT                   COG4133"
FT                   /db_xref="CDD:33889"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    188393..188917
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    188489..188512
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    order(188498..188503,188507..188515,188594..188596,
FT                   188816..188821,188912..188914)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    188585..188596
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    order(188642..188644,188747..188773)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    188804..188821
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    188828..188839
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   misc_feature    188900..188917
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00175"
FT   gene            189196..189903
FT                   /db_xref="GeneID:8817882"
FT                   /locus_tag="SLGD_00176"
FT   CDS_pept        189196..189903
FT                   /locus_tag="SLGD_00176"
FT                   /gene_family="HOG000134258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549547"
FT                   /db_xref="GeneID:8817882"
FT                   /translation="MGGLVIYQYKKFITAYQYIAPCMFFLTALIMLYFYSGQPILSSFA
FT                   SSAIILLFIMTWLTTIILNLENIEEQQLLFVQLNGKRKYILGKLVFSCLVSIPFILFAV
FT                   AYPIVTMRFEQHLSVSNILLGIYIHIALALLGIVFTLLLKVIQGLSQKYRWLVLVLIYL
FT                   ISILKIPLIQNFSILKFILWVFPPVSELLSVYNKDVSQLLNMPFAILNVWFALYICVLI
FT                   TLIFVFVSRTEYR"
FT                   /protein_id="YP_003470451.1"
FT   gene            complement(189900..190064)
FT                   /db_xref="GeneID:8817883"
FT                   /locus_tag="SLGD_00177"
FT   CDS_pept        complement(189900..190064)
FT                   /locus_tag="SLGD_00177"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549548"
FT                   /db_xref="GeneID:8817883"
FT                   /translation="MTILKNIISTLFCLAMVALGLFIIMKIGGHYFPQVDMLRTINEYN
FT                   PLSNLDIYY"
FT                   /protein_id="YP_003470452.1"
FT   gene            190279..191052
FT                   /db_xref="GeneID:8817884"
FT                   /locus_tag="SLGD_00178"
FT   CDS_pept        190279..191052
FT                   /product="2,3-butanediol dehydrogenase, S-alcohol forming,
FT                   (S)-acetoin-specific"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00178"
FT                   /EC_number="1.1.1.76"
FT                   /db_xref="GI:289549549"
FT                   /db_xref="GeneID:8817884"
FT                   /translation="MSKTAVVTGSAGGLGKGIAERLANDGFNVVIQDINGDVLLKTEEE
FT                   FKGKGYNVVAFRSDVSVKKEQQELVRFAVAEFGQLDVFVNNAGVDAVSPFLEVDEAQLQ
FT                   RVFNINVFGMVYGTQAAAEQFKKQHTKGKIINACSIAGHESYEMLSTYSASKHAVRSFT
FT                   QAAAKELAQDHITVNAYCPGVAKTEMWDRIDAEMVRYNDELQPGEAFAEFSAAIKLGRY
FT                   QEPRDVANLVSFLASDDSDYITGQAILTDGGLVYR"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470453.1"
FT   misc_feature    190279..191037
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00178"
FT   misc_feature    190285..191049
FT                   /note="acetoin reductases; Region: 23BDH; TIGR02415"
FT                   /db_xref="CDD:131468"
FT                   /locus_tag="SLGD_00178"
FT   gene            191301..191501
FT                   /db_xref="GeneID:8817885"
FT                   /locus_tag="SLGD_00179"
FT   CDS_pept        191301..191501
FT                   /locus_tag="SLGD_00179"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cold shock protein CspC"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549550"
FT                   /db_xref="GeneID:8817885"
FT                   /translation="MNNGTVKWFNAEKGFGFIEREDGNDVFVHFSGIAGEGYKTLEEGQ
FT                   KVEFDITEGQRGDQATNVVVM"
FT                   /protein_id="YP_003470454.1"
FT   misc_feature    191310..191495
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="SLGD_00179"
FT   misc_feature    order(191322..191324,191349..191351,191379..191381,
FT                   191466..191468)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="SLGD_00179"
FT   misc_feature    order(191340..191360,191376..191387)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="SLGD_00179"
FT   gene            complement(191557..192132)
FT                   /db_xref="GeneID:8817886"
FT                   /locus_tag="SLGD_00180"
FT   CDS_pept        complement(191557..192132)
FT                   /locus_tag="SLGD_00180"
FT                   /gene_family="HOG000237283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="truncated"
FT                   /db_xref="GI:289549551"
FT                   /db_xref="GeneID:8817886"
FT                   /translation="MAQDRRIRKSKQAIHHAFLQLLTETSFDKLTIQQLTETADINRST
FT                   FYSYYVDKYDLLEEIENKLIQDLQYFIAEQHQQQHNIMLKNIITYLIEHIDNHRDVFSI
FT                   LFKIGKASMIQEKLYNLIYNHLSQYKNEDDTIEGMPFSYYMSYVSGAGISLVKHWIQDP
FT                   HPIAKAQLEYHFYQIVSHGAAIMIRFDS"
FT                   /protein_id="YP_003470455.1"
FT   misc_feature    complement(<191818..192132)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="SLGD_00180"
FT   misc_feature    complement(191953..192078)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="SLGD_00180"
FT   gene            192287..193984
FT                   /db_xref="GeneID:8817887"
FT                   /locus_tag="SLGD_00181"
FT   CDS_pept        192287..193984
FT                   /locus_tag="SLGD_00181"
FT                   /gene_family="HOG000069067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted acyl esterase/dipeptidyl-peptidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549552"
FT                   /db_xref="GeneID:8817887"
FT                   /translation="MEKDMLGNPQLTVTPLEQIKEGTNHIVVDSVQYGNQEMIMEKDRP
FT                   VTMEDGTQLYVNIFRPNKEGQFPVVISADTYGKDNKPKITNMGPMWPTIGTILTSSFTP
FT                   EESPDPGFWVPNDYVVVKVALRGSAKSVGALYPWGLSEAKDYAQVIDWAGKQRWSNGNV
FT                   GTNGVSYLAVTQWWVASLNPTHLKAMIPWEGLNDMYREIAFHGGIPDTGFYRFWYQGLV
FT                   QRWPDMDIEDLIAAQQNHPLFDEYWQAKQAPLAHIQIPMFVCASWSTQGLHNRGTFEGF
FT                   KQASSQHKWLKIHGRKEWETYYARESLEQQKSFFDYYLKGIDNDWPETPRVSYEVRDKF
FT                   YQGYHNTATAYPLPQMSEKPLYLNAQDMSLQAQLPEETVSVSYLSDDSLDDEVRFSKRF
FT                   THNTEITGNMKLKLWVATEEADDMDLFIGIKKINRQGEEVHFPDFNHIENGQVATGWLR
FT                   VSHRELDIEKSTALQPWHHHMKEHKLAPQEIVAVEVEILPSSTLFKSGEQLQVVIKGSE
FT                   VVKGTSTPVPGMKTRYEHQDTVNHGLNHIYTGGKYDSHLLIPYQLLED"
FT                   /protein_id="YP_003470456.1"
FT   misc_feature    192368..193963
FT                   /note="Predicted acyl esterases [General function
FT                   prediction only]; Region: COG2936"
FT                   /db_xref="CDD:32759"
FT                   /locus_tag="SLGD_00181"
FT   misc_feature    193256..193834
FT                   /note="X-Pro dipeptidyl-peptidase C-terminal non-catalytic
FT                   domain; Region: PepX_C; pfam08530"
FT                   /db_xref="CDD:149547"
FT                   /locus_tag="SLGD_00181"
FT   gene            complement(194162..195367)
FT                   /db_xref="GeneID:8817888"
FT                   /locus_tag="SLGD_00182"
FT   CDS_pept        complement(194162..195367)
FT                   /locus_tag="SLGD_00182"
FT                   /gene_family="HOG000086948" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549553"
FT                   /db_xref="GeneID:8817888"
FT                   /translation="MKRIKVADALRGFSLLGIFIANLLIFQFDLTGQLYIDHFHLSPFN
FT                   HGVFNIINILFVGSFMPIFAMLFGFSMDKLYQSMKRKGVKRPKLKLFRRAFFLMIIGGL
FT                   HASYIWGGDILFGYGFSMLFVIPFIHMGKRAFKYFTLIIFGLLLVLFIVMPFSGDNGMQ
FT                   TTPSKHDTANYVSKITKIYSEGSYSDIRHVDETVEDPKFALFEDQLGSIFFLLIFILIP
FT                   LMEVPLFTLGVYLSKSGWFEKDALDWWSSKLWIWIIPLALIGKSAVLWVQHPTIAENFT
FT                   EVFGIILAFGYMSLFKYMYQKLPQHFTFRGLEHIGKMSLTFYLIQSVIGTMIFYGYGLG
FT                   QFGSDHVTMMFGIFIILYVLQVLVASWYQRHWRYGPMEYLLRMFTYWQLRVGKKKHARH
FT                   HS"
FT                   /protein_id="YP_003470457.1"
FT   misc_feature    complement(194177..195367)
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG2311"
FT                   /db_xref="CDD:32465"
FT                   /locus_tag="SLGD_00182"
FT   misc_feature    complement(<194981..195346)
FT                   /note="Protein of unknown function (DUF418); Region:
FT                   DUF418; cl12135"
FT                   /db_xref="CDD:175406"
FT                   /locus_tag="SLGD_00182"
FT   misc_feature    complement(194204..194665)
FT                   /note="Protein of unknown function (DUF418); Region:
FT                   DUF418; cl12135"
FT                   /db_xref="CDD:175406"
FT                   /locus_tag="SLGD_00182"
FT   gene            195569..196069
FT                   /db_xref="GeneID:8817889"
FT                   /locus_tag="SLGD_00183"
FT   CDS_pept        195569..196069
FT                   /locus_tag="SLGD_00183"
FT                   /gene_family="HOG000224658" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549554"
FT                   /db_xref="GeneID:8817889"
FT                   /translation="MNGIKVSKKLCRIALPLIGGQIIGKITVKNARRDYSENVKPPLSP
FT                   PGYVFPIVWPTLYLSMGIAHDIISQQKQHQAAQATYYLQLGLNYLWSLLYFKYKLRGAA
FT                   LIDSYILFSAVVATAVQFYQKHRIAGYLLIPYICWSAFASYLATGNWLLNKDNPDYTAG
FT                   HHA"
FT                   /protein_id="YP_003470458.1"
FT   misc_feature    195605..196006
FT                   /note="TspO/MBR family; Region: TspO_MBR; cl01379"
FT                   /db_xref="CDD:154365"
FT                   /locus_tag="SLGD_00183"
FT   gene            196062..196544
FT                   /db_xref="GeneID:8817890"
FT                   /locus_tag="SLGD_00184"
FT   CDS_pept        196062..196544
FT                   /locus_tag="SLGD_00184"
FT                   /gene_family="HOG000280284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glycosyl-4,4'-diaponeurosporenoate
FT                   acyltransferase precursor"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549555"
FT                   /db_xref="GeneID:8817890"
FT                   /translation="MRKKSVIWLIIGSGIYWFVLQMLVAVWGTRLSTTFLMKCDFCFKS
FT                   FAFEREGDFWNDVFQVKRWKDHLPKGHRLNPAIYNKSTLMAQPSAQDIYDFIIETRRAE
FT                   FVHGIAMLPMFVFLAAPKYIKIPHMTYALLANLPCMIVQRYNRPKLERYYHKLKNR"
FT                   /protein_id="YP_003470459.1"
FT   gene            196556..198055
FT                   /db_xref="GeneID:8817891"
FT                   /locus_tag="SLGD_00185"
FT   CDS_pept        196556..198055
FT                   /locus_tag="SLGD_00185"
FT                   /gene_family="HOG000278176" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Phytoene desaturase, neurosporene or lycopene
FT                   producing/4,4'-diapolycopene oxidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549556"
FT                   /db_xref="GeneID:8817891"
FT                   /translation="MPIKKVVVIGGGLGGISAAIRMAQSGYRVDLYEQNDHIGGKVNRL
FT                   TTSQFGFDLGPSILTMPYIFEQLFQHSGKEMRDYVDIERLPLQWRSFFPSGETIDLYDN
FT                   VADTIDNNSTLTAQDRQELMSFYDYAERIHRFTEQGYFRLGLDTLPEILTYHGPFKALR
FT                   GFDYFSTMQQAINRRVSNPQLRDMLGYFIKYVGSSSYDAPAVLSMLYHMQQEQGLWYVK
FT                   GGMHHLAQALETLAREEGVHIHTGVGVENIQTSFDKVVGVRLTTGESVEADYLISNMEV
FT                   IPTYRELLHFSDKKIERLEKIYEPASSGLVLHLGIDKYFPQLAHHNFFFTADSKRNYRE
FT                   VFHDKILPYDPTIYLVNANKTDPTQAPQGYESIKVLPHIPYIQNQPFSQEDYLQLKERV
FT                   LDKLEAMGLDDLRAHIVFEDMWTPEDIEHHYRSNRGAIYGVVADKKKNKGFKFPKQCAY
FT                   FNNLFFVGGSVNPGGGMPMVTLSGQQVADKINAIEHGERRD"
FT                   /protein_id="YP_003470460.1"
FT   misc_feature    196604..198034
FT                   /note="Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]; Region: COG1233"
FT                   /db_xref="CDD:31426"
FT                   /locus_tag="SLGD_00185"
FT   misc_feature    196604..198013
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00185"
FT   gene            198057..199175
FT                   /db_xref="GeneID:8817892"
FT                   /locus_tag="SLGD_00186"
FT   CDS_pept        198057..199175
FT                   /locus_tag="SLGD_00186"
FT                   /gene_family="HOG000270011" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4,4'-diaponeurosporenoate glycosyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549557"
FT                   /db_xref="GeneID:8817892"
FT                   /translation="MKWISSLTMLFTFFSIISGKVMYGRRHPLTHSKIHSSKQLELSVI
FT                   VPARDEAQRLPRLLKSLAQQTVSVEMIVMDDGSTDQTAEIARAAGASVYSVQADKPSLW
FT                   QGKSLACYQGATYASTPLLLFVDADVTLTSPRAIQALIDTYYQQDYRGLLSVQPYHSTI
FT                   RPYESLSALFNTLTVVGTNQFSLIDGQQTTRMAFGPVVLTNSTDYKSTQGHQQAKHHII
FT                   EGFALGQAYSQQGLPVNLYEGQQDIQFRMYEDGIQSLVHGWVKHFSVGATATSPKVMTS
FT                   IVIWLMGSIITASGLILSLLVKPISKVNMGILYILYTMQFIRIHRRVGHFSRWMLCLHP
FT                   ILFIFFSGVFLSSWIQSYCKRSVIWKGRTYHL"
FT                   /protein_id="YP_003470461.1"
FT   misc_feature    198177..199166
FT                   /note="hopene-associated glycosyltransferase HpnB; Region:
FT                   HonB; TIGR03469"
FT                   /db_xref="CDD:132509"
FT                   /locus_tag="SLGD_00186"
FT   misc_feature    198186..>198503
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="SLGD_00186"
FT   misc_feature    order(198195..198197,198201..198203,198276..198278,
FT                   198435..198437,198441..198443)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="SLGD_00186"
FT   misc_feature    <198549..198722
FT                   /note="D12 class N6 adenine-specific DNA methyltransferase;
FT                   Region: MethyltransfD12; cl00408"
FT                   /db_xref="CDD:174182"
FT                   /locus_tag="SLGD_00186"
FT   gene            199211..200074
FT                   /db_xref="GeneID:8817893"
FT                   /locus_tag="SLGD_00187"
FT   CDS_pept        199211..200074
FT                   /locus_tag="SLGD_00187"
FT                   /gene_family="HOG000220848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dehydrosqualene synthase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549558"
FT                   /db_xref="GeneID:8817893"
FT                   /translation="MTLDDHFQYCHQLMKHHSKSFSYAFDYLPDRERRAVWAIYAVCRV
FT                   IDDSIDVHHDPQYLQYIRQDIMAIEQQQLHPEFQSDARIMHAFSNVAHTFKMEYPAFYK
FT                   LIDTVRKDQYFEQFDTDEAMLDYCYGVAGTVGEVLTPILAQQPTTETFRVARKLGEALQ
FT                   LTNILRDVGEDFEQGRIYISKERLAHFNIDIKQQYQQGVTSNYIKMWEALAYIAEQAYH
FT                   DALSNIHVFNKQAQPIIELAAVIYASILDEVRKAGYTLHQRVYVSKVDKAKFYRRIKKK
FT                   YQGQVE"
FT                   /protein_id="YP_003470462.1"
FT   misc_feature    199232..200023
FT                   /note="Trans-Isoprenyl Diphosphate Synthases, head-to-head;
FT                   Region: Trans_IPPS_HH; cd00683"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   misc_feature    order(199259..199273,199997..200008)
FT                   /note="active site lid residues"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   misc_feature    order(199265..199267,199271..199273,199328..199330,
FT                   199340..199342,199349..199351,199361..199363,
FT                   199589..199591,199604..199606,199616..199618,
FT                   199685..199687,199694..199696,199715..199720,
FT                   199727..199732,199745..199747,199919..199924)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   misc_feature    order(199271..199273,199328..199330,199349..199351,
FT                   199361..199363,199589..199591,199613..199615,
FT                   199625..199627,199694..199696,199715..199720,
FT                   199730..199732,199745..199747,199919..199924,
FT                   199934..199936)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   misc_feature    order(199349..199363,199718..199732)
FT                   /note="substrate-Mg2+ binding site; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   misc_feature    199349..199363
FT                   /note="aspartate-rich region 1; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   misc_feature    199718..199732
FT                   /note="aspartate-rich region 2; other site"
FT                   /db_xref="CDD:173831"
FT                   /locus_tag="SLGD_00187"
FT   gene            200077..201582
FT                   /db_xref="GeneID:8817894"
FT                   /locus_tag="SLGD_00188"
FT   CDS_pept        200077..201582
FT                   /locus_tag="SLGD_00188"
FT                   /gene_family="HOG000278176" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dehydrosqualene desaturase (Diapophytoene
FT                   desaturase) (4,4'-diapophytoene desaturase)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549559"
FT                   /db_xref="GeneID:8817894"
FT                   /translation="MNIAVIGAGVTGLASAARLAAKGHQVTLFEKNDQLGGRMSQFTKD
FT                   GFTFDMGPTIVMIPEVYKAVFEACGKNFEDYVEMTQLPYIYDVYFAKDDKVRVPTDLAQ
FT                   LQQMLEHIEPGSTHGFMSFLTDIYKRYEIARKYFLERTFRKPSDFYNLTSLVQGAKLKT
FT                   LNHADDLIAQYVDNDKIQKLLAFQTLYIGIDPKRGPSLYSIIPMIEMMFGVHFIKGGMY
FT                   GMAQGLTRLNQDLGVDIRLNAQIDEIIIDPKYKRADGIRGNGLVERFDKVLCTVDFPYA
FT                   AQHLMPEHSPVKKYPPQKIAQLDYSCSACLMYIGIDQDLRDNLLLHNVIFSADFEQNVK
FT                   EIFNGQLSKDPSLYIYVPAVGDTTLAPEGQTGIYVLMPTAELKTTKIDWQDESIVARIK
FT                   EIIYHKLATIEALENIKQHIVSETIFTPLDFQRDYHAQYGAAFGLMPTLAQSNYYRPPN
FT                   VARDYHDLYFAGASTHPGAGVPIVLTSAKITVEEILKDIAAGI"
FT                   /protein_id="YP_003470463.1"
FT   misc_feature    200077..201576
FT                   /note="Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]; Region: COG1233"
FT                   /db_xref="CDD:31426"
FT                   /locus_tag="SLGD_00188"
FT   misc_feature    200089..201576
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00188"
FT   gene            complement(201755..202927)
FT                   /db_xref="GeneID:8817895"
FT                   /locus_tag="SLGD_00189"
FT   CDS_pept        complement(201755..202927)
FT                   /locus_tag="SLGD_00189"
FT                   /gene_family="HOG000031859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549560"
FT                   /db_xref="GeneID:8817895"
FT                   /translation="MTPSLKYNQITTIFFITGIAVMCSLYTALPLTVAFAKDFDIPKSI
FT                   ATLNGVVFSITYSVSCLFYGTISEKFGRIRTILCGLVGLVIICCLIGFVRSFILLIILR
FT                   ALQGICAAAFSPVSITYVTENYSPVKRVTAISFISTSFMLSGVIGQNLSEIIVRYTHWH
FT                   SVYFTLTILYLILAVAIYKKVPESPVYHPHIRLLSFFTNFKAFKTNKMVLLCYFVSLTL
FT                   LTMFISMYDIFNAYITSDIVGGNQTTAINAKLYGIFGMLLALLAGRLSDRIGVKNVILT
FT                   SLMISIISLLGMACTTNVTLLVMWSVMFIAGIAFCVPSVISNVGIVVNGNQGFFLSVNT
FT                   FILFLGTALAPIINIYIARIQSFSLQFIIIACIGIISLCVALFLPKTKRY"
FT                   /protein_id="YP_003470464.1"
FT   misc_feature    complement(201773..202891)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00189"
FT   misc_feature    complement(order(201887..201889,201896..201901,
FT                   201908..201913,201920..201925,201956..201958,
FT                   201965..201970,201983..201988,201995..201997,
FT                   202139..202141,202151..202153,202160..202162,
FT                   202172..202174,202184..202186,202226..202228,
FT                   202235..202240,202247..202252,202259..202261,
FT                   202490..202492,202508..202513,202520..202525,
FT                   202559..202561,202568..202573,202580..202585,
FT                   202592..202597,202733..202738,202742..202747,
FT                   202757..202759,202766..202771,202778..202780,
FT                   202829..202834,202838..202846,202853..202855))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00189"
FT   gene            complement(203152..203280)
FT                   /db_xref="GeneID:8817896"
FT                   /locus_tag="SLGD_00190"
FT   CDS_pept        complement(203152..203280)
FT                   /locus_tag="SLGD_00190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549561"
FT                   /db_xref="GeneID:8817896"
FT                   /translation="MVYASHPTRLIQPTLHNFERQTYVKVETEQETTNSNTLYTKN"
FT                   /protein_id="YP_003470465.1"
FT   gene            203372..204313
FT                   /db_xref="GeneID:8817897"
FT                   /locus_tag="SLGD_00191"
FT   CDS_pept        203372..204313
FT                   /locus_tag="SLGD_00191"
FT                   /gene_family="HOG000134760" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549562"
FT                   /db_xref="GeneID:8817897"
FT                   /translation="MKKVFLASSVALMLLTACQNSDSSQQENQKKTSQADNKKDEKHTS
FT                   KHQTENNEKQNKTSGQQHSDKEDKGQTKSSAGQLSDKTKLALIFYADPKGKYSLTKNEI
FT                   LTGKYKRQGTGDNDVKQIVDFGLVPYENISQAPDGMKFYMVYPDKGSYRTVVGVNNDKI
FT                   YIGATQSPIRNYQDALKSGDEYDLNKVYTENKNNRSLPEMENKIKITQKDPRMDESDTE
FT                   RKQRELKESGTEMAHARSQLFDQIAQLEGAPANKDYLWDNIKMTKDSWSINYRNQDGEI
FT                   LGTYKLQGKKMIKEDQNGNQIKSAPIKNDSAS"
FT                   /protein_id="YP_003470466.1"
FT   gene            204348..204821
FT                   /db_xref="GeneID:8817898"
FT                   /locus_tag="SLGD_00192"
FT   CDS_pept        204348..204821
FT                   /locus_tag="SLGD_00192"
FT                   /gene_family="HOG000091607" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549563"
FT                   /db_xref="GeneID:8817898"
FT                   /translation="MTKHLQNMQSLALVKELLQVNHSNTSIEIKTEPWNADYEAFRCEL
FT                   KGQTYMSRRAHKTPKKRGYFFAMWCKDDDNNNRPYQDAEFPMFLVVNVIDGQRFGQFVF
FT                   PREVLVKQHIISTTSHKGKMALRVYPTWEEDLNPSAAKTQHWQDKYFTNLTIE"
FT                   /protein_id="YP_003470467.1"
FT   misc_feature    204441..204809
FT                   /note="MepB protein; Region: MepB; cl01985"
FT                   /db_xref="CDD:121016"
FT                   /locus_tag="SLGD_00192"
FT   gene            complement(204948..205619)
FT                   /db_xref="GeneID:8817899"
FT                   /locus_tag="SLGD_00193"
FT   CDS_pept        complement(204948..205619)
FT                   /locus_tag="SLGD_00193"
FT                   /codon_start="1"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549564"
FT                   /db_xref="GeneID:8817899"
FT                   /translation="MIELHAISKSYKRKHIFEQLNMQFADNQLTVLLGENGAGKSTLLR
FT                   LISGIEQPNSGTIDYFGKTLSKRQIRNIVGYVPQDIALFEHMSAQENIQFFKSLCDKPV
FT                   DDDTIAHYLKLLNFTDMKARVSTLSGGNKRKINILIGLLSQPKILILDEPTVGIDLKSR
FT                   YDIHQLLNQMKSSCLIILTTHHLDEVEALADNIKLIGQHPFYRDVLNDKQWTYEHYHNA
FT                   L"
FT                   /protein_id="YP_003470468.1"
FT   misc_feature    complement(204990..205619)
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205032..205616)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205497..205520)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(order(205068..205070,205161..205166,
FT                   205383..205385,205494..205502,205506..205511))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205383..205394)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205209..205238)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205161..205178)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205143..205154)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   misc_feature    complement(205062..205082)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00193"
FT   gene            complement(205634..206554)
FT                   /db_xref="GeneID:8817900"
FT                   /locus_tag="SLGD_00194"
FT   CDS_pept        complement(205634..206554)
FT                   /locus_tag="SLGD_00194"
FT                   /gene_family="HOG000279754" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549565"
FT                   /db_xref="GeneID:8817900"
FT                   /translation="MKPYIQLVIRKQWLQYVLLLIIIGAALSLLYAGQKMASQNFKIPI
FT                   AIQDMSHSNDSKQLIKHISDTRFVSVKSISADDIYIDDAVKKKEAMISLQIPKDFDKRL
FT                   AENRLKSSIQLYGRDDFIGNIALEIVSRSLYEQQIPHIIQEHLDKNHHHQSIDKIKEAY
FT                   KNNTPTSKFKNVAIHSSANHSLSISLIFAWVLMISAIQIVLHQRLKQNAPLGRLFQFNH
FT                   SRLKLYGTYIVTHTCLLLFVMMMIQWLMHQPLSLFFYAKSFAVIFIYEWGIASLLFKVN
FT                   TLSHRLFMAIVWSIVIAILFISIQM"
FT                   /protein_id="YP_003470469.1"
FT   gene            complement(206551..207717)
FT                   /db_xref="GeneID:8817901"
FT                   /locus_tag="SLGD_00195"
FT   CDS_pept        complement(206551..207717)
FT                   /locus_tag="SLGD_00195"
FT                   /gene_family="HOG000279755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549566"
FT                   /db_xref="GeneID:8817901"
FT                   /translation="MKSIQLFHIYHSFLLKKWYLFVYLILIVLSLVLALTAVQYANQED
FT                   KGFRLGIVDKDHSKETQLILGSVGKGSNFGKHVTLKQYSEKTAKQRLSKHELDGYFVFD
FT                   KGMTHAFYHQGQLPITVYTYDQQSTKSVVISQLTHSVYDRLMLSMGGILSYTHLTEKPS
FT                   SQDMVMLMTDLLFTGLNRVNAFNYEPVKVYDTGSYYVVTGYLLSIFILCLSLFSVLKMN
FT                   QETALKERLQLFHFSFEKLTFVRGAIAWFYSMIWAILGFLWINHTLDGSFESYNWPTVA
FT                   IQLTYFVTFLVMLLILIELISKNWMNLLLKCVLTLIFIVFSGITVPTIFFQHSFNSILA
FT                   TQPFSLVTNQMLEITLNNFILDTHPAFYISFIAVALALCVVAVWRYRR"
FT                   /protein_id="YP_003470470.1"
FT   gene            complement(207996..209492)
FT                   /db_xref="GeneID:8817902"
FT                   /locus_tag="SLGD_00196"
FT   CDS_pept        complement(207996..209492)
FT                   /locus_tag="SLGD_00196"
FT                   /gene_family="HOG000279756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549567"
FT                   /db_xref="GeneID:8817902"
FT                   /translation="MSKKLKIIISAVVILLIVAGIGFGAYKIFSNTPKNTYLLSEQKTA
FT                   KKFQNYFNDRFDNEVKFQEKMKDNSYLSNMSLSADASKELIESMGLPKSVIDATKITAS
FT                   IGHDDKNTKSLIKVNPTIADKEVGNFQWAADKNFQYFTAPLFKGDYKVKNSELVKQYAE
FT                   ISGEDEEQLKSSGVTNQSLNLNTLLGSTQTQQKDLDTIIKRYTDIVFDHLKDDNFKKEG
FT                   KEEVKVDGETEKANKVTLKLDRADTKKLTLAILKKAKDDKELQSLVKNQMSKDEYKKQI
FT                   EDALKKAEDAKEKEFIEFTSTIYEKHHEILKRDITLTDKDNKKVKIVGNNSITDDKLAL
FT                   DYKFTTDDGSFSLKGKSTGKDDNYKDKYDATFDNNYNKSTLTFENKEKQDGTKRHDKGT
FT                   ITFDNAGTKQDFTFDNSLDTDVKNNQQKQKLTVGIKLQDEPINFILNSDTKLKADISFD
FT                   TDKAKDIGELSSKELDKLDKEISKNGEKLLESIIKKVTDD"
FT                   /protein_id="YP_003470471.1"
FT   gene            complement(209517..210113)
FT                   /db_xref="GeneID:8817903"
FT                   /locus_tag="SLGD_00197"
FT   CDS_pept        complement(209517..210113)
FT                   /locus_tag="SLGD_00197"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Phage protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549568"
FT                   /db_xref="GeneID:8817903"
FT                   /translation="MKRLFSLLLISSLVLTACGSKSHSESNSSEKKSSESKSATDKSES
FT                   VDSCLEKAKNKPTAKFKDNKFTSNKFDIEIKETKVVKPDKYADSKNPNLAIVYKVKNKS
FT                   SEKITASTAFIEAFDVYNDTKNVQKRLETGFAEDSDLYKKYGEDMRNNINKDGEVTGVR
FT                   FFEIKDDKKPITIEAKNPDGYTTKEIGKKIIKLEH"
FT                   /protein_id="YP_003470472.1"
FT   misc_feature    complement(209547..209954)
FT                   /note="Telomeric repeat-binding factor 2; Region: TRF2;
FT                   pfam11611"
FT                   /db_xref="CDD:152047"
FT                   /locus_tag="SLGD_00197"
FT   gene            210489..211172
FT                   /db_xref="GeneID:8817904"
FT                   /locus_tag="SLGD_00198"
FT   CDS_pept        210489..211172
FT                   /locus_tag="SLGD_00198"
FT                   /gene_family="HOG000022897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549569"
FT                   /db_xref="GeneID:8817904"
FT                   /translation="MKNSYEQWWHKGQEDDDTMARDHHDAWDRTIDVIAKEDIIGKTIL
FT                   DFGCNQGGFLRQLYQKVPFKQGVGIDLARKSLQKAELLKGDLPLSYVLTDMPSDTGLQF
FT                   DTAISTSVLYLIDDIPQHAKELKRVLKPQGVYYATFADLTDNPSCDYMAQVINTYGATP
FT                   SQNHSLKHIVDSFVQEGFQVSVKREMVPDEIDLTHYSDFYLSPSDYLRTLFQESYVIKA
FT                   TVKEG"
FT                   /protein_id="YP_003470473.1"
FT   misc_feature    210489..211166
FT                   /note="SAM-dependent methyltransferases [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]; Region: SmtA; COG0500"
FT                   /db_xref="CDD:30846"
FT                   /locus_tag="SLGD_00198"
FT   misc_feature    210615..210908
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="SLGD_00198"
FT   misc_feature    order(210627..210647,210699..210704,210765..210767,
FT                   210816..210818)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="SLGD_00198"
FT   gene            211178..212731
FT                   /db_xref="GeneID:8817905"
FT                   /locus_tag="SLGD_00199"
FT   CDS_pept        211178..212731
FT                   /locus_tag="SLGD_00199"
FT                   /gene_family="HOG000022899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Nickel ABC transporter, periplasmic
FT                   nickel-binding protein NikA"
FT                   /transl_table="11"
FT                   /note="TC 3.A.1.5.3"
FT                   /db_xref="GI:289549570"
FT                   /db_xref="GeneID:8817905"
FT                   /translation="MMKRQLCALVTGALILTSGCSQSQHNHKQVTLSLPTEAKAAKLDA
FT                   QGYDAAMPVYSAVYDALVQYDKKKTFKPGLAQKWEVEDGGKTYRFHLKKGVKFSDGSDF
FT                   DAQAVKFSIERAKAMNKETTVETLKQLKSVVVKNKHTVEINLKTPSNQVLNELTQVRPL
FT                   RIMSPHAVKDGKVTGQFKEAIGTGAFKIGDAGKEKTTLKPNPYFKGNKPLNYDLVFQTI
FT                   EDGDARQSAIQSGAVDITGGALGMLTDAQIKQAKSTQKLSVSENPSTVSHFIAFNPENK
FT                   QLQHKDLRQAISESIQTKALSSQPLKGLFQRDVQYVTAQNQQQHRFDKKAAQHAFEQAG
FT                   YHRNKQGMYEKDGQVLTFNLVIQTAEFPNWKDKAEQVQANLKAVGVKVNIKHLDAQSYY
FT                   DTLWTKKDYDLIFYRTYSDALMPYNFMNSVFKNNGDKPGVLANDKVLTQQLEAFPKEID
FT                   KQSQKKAFNHIFKHFNQQYYGVPIAYPNETFVTSDKIKSFKFSGLTDAPVDYKKLEVNQ
FT                   "
FT                   /protein_id="YP_003470474.1"
FT   misc_feature    211262..212698
FT                   /note="The substrate-binding domain of an ABC-type
FT                   nickel/oligopeptide-like import system contains the type 2
FT                   periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like;
FT                   cl01709"
FT                   /db_xref="CDD:174665"
FT                   /locus_tag="SLGD_00199"
FT   misc_feature    211385..212488
FT                   /note="Bacterial extracellular solute-binding proteins,
FT                   family 5 Middle; Region: SBP_bac_5; pfam00496"
FT                   /db_xref="CDD:144185"
FT                   /locus_tag="SLGD_00199"
FT   gene            212731..213681
FT                   /db_xref="GeneID:8817906"
FT                   /locus_tag="SLGD_00200"
FT   CDS_pept        212731..213681
FT                   /locus_tag="SLGD_00200"
FT                   /gene_family="HOG000022900" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dipeptide transport system permease protein DppB"
FT                   /transl_table="11"
FT                   /note="TC 3.A.1.5.2"
FT                   /db_xref="GI:289549571"
FT                   /db_xref="GeneID:8817906"
FT                   /translation="MWQRTYKLFGYLIVSSLIIFILVEQTAGNPAILYLQRHGYTQMTQ
FT                   QQIDMAQHHLGLGRHILLRYLDWLGHALIGDLGYSFSTQEPVMNLIANALKPTWILMSW
FT                   ATVLMLPLGVGLGYCVGMLPHARIAQSLRYISQVITSMPEYWIAIVAIYYMGVKWQLLP
FT                   FVGSASWQNYLLPVGIMIIVEGSHLLLMTAHLIAQTRQDDTYQLIKLRQATWKARIYCQ
FT                   FKVIFAPLMTIVVNSIIHLFSRAVILEVIFSMSGLGKLLITAINQRDYPLIQGIIMLII
FT                   VVIMLLNYLGDILILKSDPRIQRLRANKSKVRGAR"
FT                   /protein_id="YP_003470475.1"
FT   misc_feature    212812..213642
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="SLGD_00200"
FT   gene            213678..214448
FT                   /db_xref="GeneID:8817907"
FT                   /locus_tag="SLGD_00201"
FT   CDS_pept        213678..214448
FT                   /locus_tag="SLGD_00201"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oligopeptide permease, channel-forming protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549572"
FT                   /db_xref="GeneID:8817907"
FT                   /translation="MKYSHVNWQWRIIGVSLIGALYIAVFGWNSKPSEHLAPPSLQHLL
FT                   GTDQLGRDMFTRMIIGSGVTLGLTVVVVVLSVSIGLIFGMMAGLMGRWFDKLCMFVADL
FT                   LLAIPSFIIALVILGLVSDSMIGLLCALVIGWLGRYLRYFRNLTRDIQKEPFIQYAVLS
FT                   GNSNVQTLYAHMLPHLLSKIMALVTADFGKIMLSISGLAFLGLGVKPPIPELGTILFDG
FT                   KSYLTIAPWLFFFPGILLGGYALLFQIINNKIIK"
FT                   /protein_id="YP_003470476.1"
FT   misc_feature    213924..214400
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00201"
FT   misc_feature    order(213924..213926,213939..213941,213969..213980,
FT                   213984..214013,214020..214025,214029..214031,
FT                   214080..214085,214089..214091,214095..214097,
FT                   214104..214109,214113..214115,214125..214130,
FT                   214137..214139,214188..214190,214230..214235,
FT                   214242..214244,214263..214274,214281..214286,
FT                   214326..214331,214359..214364,214371..214376,
FT                   214380..214385,214392..214397)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00201"
FT   misc_feature    order(213987..214031,214263..214280)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00201"
FT   misc_feature    order(214029..214031,214065..214067,214281..214283,
FT                   214320..214322,214329..214331,214359..214361)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00201"
FT   misc_feature    order(214140..214178,214194..214199,214209..214211)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SLGD_00201"
FT   gene            214601..215188
FT                   /db_xref="GeneID:8817908"
FT                   /locus_tag="SLGD_00202"
FT   CDS_pept        214601..215188
FT                   /locus_tag="SLGD_00202"
FT                   /codon_start="1"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549573"
FT                   /db_xref="GeneID:8817908"
FT                   /translation="MTDDQLTYQGNVDIDLLHADAMFQDANSNLFQNITIKQHIAMLYD
FT                   AKKSTLSRAEQYQEVKTMMTRLGLEQPEQLLQYYPFELSGGMAQRVAFILSLIRNPQCL
FT                   ILDEPTSALDVQNRTKFMQQLMHIISERKMTVIFVTHDLSLVKDYATHVSIMQHGQIIE
FT                   SGQAQQVMHHPERHYTQTLIRTAERREAYATG"
FT                   /protein_id="YP_003470477.1"
FT   misc_feature    <214667..215095
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00202"
FT   misc_feature    214667..214672
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00202"
FT   misc_feature    214847..214876
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00202"
FT   misc_feature    214907..214924
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00202"
FT   misc_feature    214931..214942
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00202"
FT   misc_feature    215009..215029
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00202"
FT   gene            215175..215798
FT                   /db_xref="GeneID:8817909"
FT                   /locus_tag="SLGD_00203"
FT   CDS_pept        215175..215798
FT                   /locus_tag="SLGD_00203"
FT                   /codon_start="1"
FT                   /product="Nickel transport ATP-binding protein nikE"
FT                   /transl_table="11"
FT                   /note="TC 3.A.1.5.3"
FT                   /db_xref="GI:289549574"
FT                   /db_xref="GeneID:8817909"
FT                   /translation="MLQVDHINKTIQGRIILEDISFDLAQGNLIISGPSGCGKSTLAHI
FT                   IAGLDKQYTGSLRLDGRLMHDYKTKQWMRDIQYVPQYQRTSMDPRQTVEAVLTEPLKRF
FT                   GIPKTLHASRVDNVLSQCQLSSQLLQQRVSTLSGGQFQRVWIAKALIIQPKLLILDEAT
FT                   TNLDVVNEDLILQMLQSLTDIQLLIISHDPYVIQQFEAQHLSLT"
FT                   /protein_id="YP_003470478.1"
FT   misc_feature    215175..215774
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215175..215771
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215271..215294
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    order(215280..215285,215289..215297,215415..215417,
FT                   215652..215657,215745..215747)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215406..215417
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215580..215609
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215640..215657
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215664..215675
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   misc_feature    215733..215753
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="SLGD_00203"
FT   gene            complement(215988..217628)
FT                   /db_xref="GeneID:8817910"
FT                   /locus_tag="SLGD_00204"
FT   CDS_pept        complement(215988..217628)
FT                   /product="Pyruvate decarboxylase ; Alpha-keto-acid
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   decarboxylase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00204"
FT                   /EC_number="4.1.1.1"
FT                   /db_xref="GI:289549575"
FT                   /db_xref="GeneID:8817910"
FT                   /translation="MKQRVGQYLMDAIYQAGADRVFGVPGDFNLAFLDDIVAHEHLQWV
FT                   GNTNELNASYAADGYARLKGVSALVTTFGVGELSAVNGIAGSYAERVPVIAITGAPTRA
FT                   VEQAKKYVHHSLGEGTFDDYQKMFSHITTAQGYITPENATTEIPRLINASLQERRPVHI
FT                   HLPIDVAMTEIEVTEPFKLQNPKQHDVSEYIKLIQQKLQSASNPVIIAGHEINSFHLHD
FT                   ALEQLVNQTNIPVAQLSLGKGAFNEENPHYLGIFDGKFAEDNVRDYVNNSDAILNIGAK
FT                   LTDSATGGFSYDFDIEDVVMINHHNFKLGDTQNNEVSLPDMLHGLLEMDYHNKGTYSSY
FT                   VRPKAHSYTLSDEPLTQETYFNMIQDFLQPDDVLLAEQGTSFFGAYDLALYKNVDFIGQ
FT                   PLWGSIGYTLPATIGSQMADTTRRNILLIGDGSLQLTVQGLSTMIRNQLKPIIFVINND
FT                   GYTVERLIHGMKAPYNDIHMWDYKALPAVFGGDNVAIHDVHTSNDLKRTFDEINAESDV
FT                   MHYVEVTMAAEDAPEKLANIAEAFASQNK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470479.1"
FT   misc_feature    complement(215991..217628)
FT                   /note="Pyruvate decarboxylase and related thiamine
FT                   pyrophosphate-requiring enzymes [Carbohydrate transport and
FT                   metabolism / Coenzyme metabolism / General function
FT                   prediction only]; Region: COG3961"
FT                   /db_xref="CDD:33742"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(217128..217610)
FT                   /note="Pyrimidine (PYR) binding domain of pyruvate
FT                   decarboxylase (PDC), indolepyruvate decarboxylase (IPDC)
FT                   and related proteins; Region: TPP_PYR_PDC_IPDC_like;
FT                   cd07038"
FT                   /db_xref="CDD:132921"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(order(217239..217241,217248..217250,
FT                   217281..217283,217287..217292,217383..217385,
FT                   217404..217406,217482..217487,217518..217520,
FT                   217527..217529,217551..217556))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132921"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(order(217287..217292,217359..217361,
FT                   217371..217373,217383..217385,217404..217406,
FT                   217437..217445,217449..217451,217455..217457,
FT                   217461..217466,217473..217475,217482..217493,
FT                   217500..217502,217518..217520,217527..217529,
FT                   217551..217556))
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132921"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(order(217287..217289,217404..217406,
FT                   217479..217481,217554..217556))
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132921"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(216672..217049)
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(216027..216569)
FT                   /note="TPP-binding module; composed of proteins similar to
FT                   pyruvate decarboxylase (PDC) and indolepyruvate
FT                   decarboxylase (IPDC). PDC, a key enzyme in alcoholic
FT                   fermentation, catalyzes the conversion of pyruvate to
FT                   acetaldehyde and CO2. It is able to utilize...; Region:
FT                   TPP_PDC_IPDC; cd02005"
FT                   /db_xref="CDD:48168"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(order(216240..216254,216258..216260,
FT                   216333..216344,216414..216416,216420..216422,
FT                   216489..216491))
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48168"
FT                   /locus_tag="SLGD_00204"
FT   misc_feature    complement(order(216165..216170,216189..216194,
FT                   216198..216200,216210..216215,216228..216230,
FT                   216240..216242,216294..216296,216306..216308,
FT                   216315..216317,216324..216329,216420..216428))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48168"
FT                   /locus_tag="SLGD_00204"
FT   gene            217757..218236
FT                   /db_xref="GeneID:8817911"
FT                   /locus_tag="SLGD_00205"
FT   CDS_pept        217757..218236
FT                   /locus_tag="SLGD_00205"
FT                   /gene_family="HOG000238671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549576"
FT                   /db_xref="GeneID:8817911"
FT                   /translation="MTLFYFIESDVKMMNKNDYEHMLFYFAYKTFTLTANEIIEQYGMS
FT                   RQHHRFLFFINKLPGITIKELLQTLEISKQGSHATLKKLKDKQLIFEQPSKHDRRVKQL
FT                   YTTEEGEALIATLNKAQDELIQQTIKKVGTDWYAIMEELASYRQGFKNVKHLKDE"
FT                   /protein_id="YP_003470480.1"
FT   misc_feature    217865..218137
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00205"
FT   gene            complement(218434..218955)
FT                   /db_xref="GeneID:8817912"
FT                   /locus_tag="SLGD_00206"
FT   CDS_pept        complement(218434..218955)
FT                   /locus_tag="SLGD_00206"
FT                   /gene_family="HOG000280308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549577"
FT                   /db_xref="GeneID:8817912"
FT                   /translation="MNKMTKLVLSSTLVFGSVLGVNAISTNAQHVSHAAITPYYTYHGY
FT                   AGYNPSFLLTHEFKNGIKYKNITFNGKKIVPTKGTKTVKLYDQTFSGVTKSGKSASTVS
FT                   FDVTGKLTTAQLKNAYGKALKKVGPPKPSKKVKAVYDYRPSLETPRVLFTVNHNNRVTH
FT                   VDITYGSIGY"
FT                   /protein_id="YP_003470481.1"
FT   gene            219234..219929
FT                   /db_xref="GeneID:8817913"
FT                   /locus_tag="SLGD_00207"
FT   CDS_pept        219234..219929
FT                   /locus_tag="SLGD_00207"
FT                   /codon_start="1"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549578"
FT                   /db_xref="GeneID:8817913"
FT                   /translation="MSVLTVDNISKKINSKTILQDVSFNLEKGEIVGLVGANGAGKTSL
FT                   MKVILGYSNYQKGHYKVVDSGSKRSSIGALIESPGVYPFMSGYDNLKLLNESKDNSDID
FT                   DIVTKLKMKDYIHNKAKTYSLGMKQKLGIAIAFLNDPKLIILDEPMNGLDPRAVRDVRN
FT                   LILDKAQQGITFLISSHMLSELVKITDAILIIDEGKIVKETTREEIEQHDAENFETVLL
FT                   DIIDKEGDA"
FT                   /protein_id="YP_003470482.1"
FT   misc_feature    219243..219908
FT                   /note="gallidermin-class lantibiotic protection ABC
FT                   transporter, ATP-binding subunit; Region: galliderm_ABC;
FT                   TIGR03740"
FT                   /db_xref="CDD:163452"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219243..219842
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219339..219362
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    order(219348..219353,219357..219365,219462..219464,
FT                   219672..219677,219771..219773)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219453..219464
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219600..219629
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219660..219677
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219684..219695
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   misc_feature    219759..219779
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="SLGD_00207"
FT   gene            219931..220698
FT                   /db_xref="GeneID:8817914"
FT                   /locus_tag="SLGD_00208"
FT   CDS_pept        219931..220698
FT                   /locus_tag="SLGD_00208"
FT                   /gene_family="HOG000280276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Membrane spanning protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549579"
FT                   /db_xref="GeneID:8817914"
FT                   /translation="MGSLIKQECFKLSKKKSTWIWPIVIIAIMFTLLFISQNSDIMSSE
FT                   GLIQGGFSGFYWVVILMIVQASTIISMEFHYETIKNVLYRNYSRTSIVISKVITLVIYS
FT                   LICFIGVIAVTLLLYAISFNDIDLLAPHGSQPPLLNEMLLLAVADFVTMWLVLSLTLLI
FT                   SCAMKGPTLSITIGIFFYFVMSFVAALLTYFNGKWEWFKWNPLNMIMLPQQIVDNDFKE
FT                   MSHLELHELFIGNIVYIVIFLVLLVFVFKKKNV"
FT                   /protein_id="YP_003470483.1"
FT   gene            complement(220887..221402)
FT                   /db_xref="GeneID:8817915"
FT                   /locus_tag="SLGD_00209"
FT   CDS_pept        complement(220887..221402)
FT                   /locus_tag="SLGD_00209"
FT                   /gene_family="HOG000262659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549580"
FT                   /db_xref="GeneID:8817915"
FT                   /translation="MTQFNFDKVHSSIEFQIKHLMVSKVKGTFNDIDVTVEGDINNLSS
FT                   LKATATIDPKSIDTKNEDRDNHLRSGDFFATDEYDKITFVTKEVKDDKVVGDLTIKGET
FT                   HEETFDLEFNGVSKNPMNGEQVTGFVVSGKIDREKYGVSFNQALETGGVMLGKEVKFEA
FT                   SAEFSIQE"
FT                   /protein_id="YP_003470484.1"
FT   misc_feature    complement(220905..221393)
FT                   /note="YceI-like domain; Region: YceI; cl01001"
FT                   /db_xref="CDD:174493"
FT                   /locus_tag="SLGD_00209"
FT   gene            222281..223687
FT                   /db_xref="GeneID:8817916"
FT                   /locus_tag="SLGD_00210"
FT   CDS_pept        222281..223687
FT                   /locus_tag="SLGD_00210"
FT                   /gene_family="HOG000277480" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Short-chain fatty acids transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549581"
FT                   /db_xref="GeneID:8817916"
FT                   /translation="MARGYNKRPKRKLKFKTPHTYALLMIIITIAWIMTFIIPSGEYER
FT                   HKKGGQTLVVDGTYHHVPHAATSFLDIFRAIPEGLVSGAEIVFYIFLVGGAFGIVHKTG
FT                   SFENGVNKAMRALGNAKILMIPLTMTIFSILGFSIGLAEETIIFVPLGILIARTLGYDA
FT                   MTGAAMVILGAASGFIGGMLNPFTVGVAQTVAELPMFSGWGLRSIIYIFILIAAITTVM
FT                   LYARKVKQDHTKSLVYELEQQEGTMKEDIQYQHFTPRQVISLALMLGAIILNVVGIFKF
FT                   EWTFGEMSANFLLAGILAGLISGLGLNGTFDALIEGMQSILFGALVVGFAKGIVVILEN
FT                   GKIIDTIVHGMTSLLADVPASFVIIAMFILQFMLNFFIPSGSGQALTTMPLMVPISDLL
FT                   HINRQLTVLAFQYGDAISNVLFPTSAILMGALAVGRITYGQWIKFAWKLIVIWVLICAI
FT                   AMSIALFVGY"
FT                   /protein_id="YP_003470485.1"
FT   misc_feature    222308..223678
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1288"
FT                   /db_xref="CDD:31479"
FT                   /locus_tag="SLGD_00210"
FT   misc_feature    222512..223684
FT                   /note="Anion permease ArsB/NhaD.  These permeases have been
FT                   shown to translocate sodium, arsenate, antimonite, sulfate
FT                   and organic anions across biological membranes in all three
FT                   kingdoms of life.  A typical anion permease contains 8-13
FT                   transmembrane helices...; Region: ArsB_NhaD_permease;
FT                   cl09110"
FT                   /db_xref="CDD:176606"
FT                   /locus_tag="SLGD_00210"
FT   gene            223730..224251
FT                   /db_xref="GeneID:8817917"
FT                   /locus_tag="SLGD_00211"
FT   CDS_pept        223730..224251
FT                   /locus_tag="SLGD_00211"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549582"
FT                   /db_xref="GeneID:8817917"
FT                   /translation="MEFNHAIHQDNTHAKVTIIDNEILKYTSNIIFPFIVGVILFICGL
FT                   VVFIVIFGFLSAIITGQYSFVASGGIALVVSYSLFKGLHNKIFEKEVTLYQYGHERYEF
FT                   IIGNQQYTGYYKHVDKVRLRRYFGDTTLFAPDISLTLVTLNGTFKFATTRIGAQEAIGK
FT                   MEAHFKRLSQ"
FT                   /protein_id="YP_003470486.1"
FT   gene            224367..225710
FT                   /db_xref="GeneID:8817918"
FT                   /locus_tag="SLGD_00212"
FT   CDS_pept        224367..225710
FT                   /locus_tag="SLGD_00212"
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bicyclomycin resistance protein TcaB"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549583"
FT                   /db_xref="GeneID:8817918"
FT                   /translation="MNIKKYLIFIIGALGGLLYGYDNGIISGALTYIPKDIPLTSFQSG
FT                   LVVSSMLFGAVIGAGSSGPLSDKIGRRRLVLFIAIIFALGAFILAIAPNVTILVLGRIV
FT                   IGLAVGGSMATVPVYLSELAPTELRGSLGSLNQLMITIGILAAYLVSYGFADMGAWRWM
FT                   LGLAVVPSIILLIGIAFMPESPRWLLENKTEKAARHVMQITYSDEEIDREIKEMKELAE
FT                   KTESSWSVLKSKWLRPTLIIGCTFAILQQFIGINAVIFYASPILTKAGFGESASILGSV
FT                   GIGVVNVLVTVLALFIVDKIDRKKLLVVGNIGMVASLVIMAILIWTLGIQSSAWIIIVC
FT                   LSLFIVFFGASWGPVLWVMLPELFPTRARGAATGIATLVLNIGTLIVAQLFPMINAALD
FT                   VEWVFLIFAAIGVVALIFVIKFLPETRGRSLEEIEIELRQRAGVKTEQ"
FT                   /protein_id="YP_003470487.1"
FT   misc_feature    224445..225629
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00212"
FT   misc_feature    order(224445..224450,224454..224459,224508..224510,
FT                   224517..224522,224529..224531,224541..224546,
FT                   224550..224555,224691..224696,224703..224708,
FT                   224715..224720,224727..224729,224763..224768,
FT                   224775..224780,224796..224798,225120..225122,
FT                   225129..225134,225141..225146,225153..225155,
FT                   225192..225194,225204..225206,225216..225218,
FT                   225225..225227,225237..225239,225399..225401,
FT                   225408..225413,225420..225422,225435..225440,
FT                   225447..225449,225480..225485,225492..225497,
FT                   225504..225509,225516..225518)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00212"
FT   misc_feature    224448..225668
FT                   /note="Sugar (and other) transporter; Region: Sugar_tr;
FT                   pfam00083"
FT                   /db_xref="CDD:143864"
FT                   /locus_tag="SLGD_00212"
FT   gene            225729..226049
FT                   /db_xref="GeneID:8817919"
FT                   /locus_tag="SLGD_00213"
FT   CDS_pept        225729..226049
FT                   /locus_tag="SLGD_00213"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549584"
FT                   /db_xref="GeneID:8817919"
FT                   /translation="MVNHCSDVKNILRKGDIIFNKEQHPKLLTVLHIIMIVFVGLAVLT
FT                   LLISIIAHFIVGGRPFYHFAYVLFIIGMLAEVSINIIQRQTQAVVLSIIMIVLAIIIIF
FT                   AD"
FT                   /protein_id="YP_003470488.1"
FT   gene            226257..226382
FT                   /db_xref="GeneID:8817920"
FT                   /locus_tag="SLGD_00214"
FT   CDS_pept        226257..226382
FT                   /locus_tag="SLGD_00214"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549585"
FT                   /db_xref="GeneID:8817920"
FT                   /translation="MYFVFVSMLLWIISEVFDKQYVKAVIIALVVGVLTIIALII"
FT                   /protein_id="YP_003470489.1"
FT   gene            complement(226755..227552)
FT                   /db_xref="GeneID:8817921"
FT                   /locus_tag="SLGD_00215"
FT   CDS_pept        complement(226755..227552)
FT                   /product="N-hydroxyarylamine O-acetyltransferase"
FT                   /gene_family="HOG000205436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00215"
FT                   /EC_number="2.3.1.118"
FT                   /db_xref="GI:289549586"
FT                   /db_xref="GeneID:8817921"
FT                   /translation="MMNIRAFEHYMSIDSERYSEPSLEALNDYATCFMYTVPFENINVQ
FT                   NGIPISVDINDLYHKIVNNHRGGFCYELNTLFQTYLKAKGFDAQMISATVHTANGGHRL
FT                   EGSHVSLVVPLQGTYYVTDVGFGDLPLHAMPITLEQDSQPVQDISGTFRAIFENENKTR
FT                   FFVQKWESDTWKTKYDAILKASSIDAFKDKINYNETHPDSIFVQNLLITQPKSYGRVTM
FT                   SQQHLTVTKQNKKVQYDVTPQNYRQLLQDYFNLNVTIDRLELS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470490.1"
FT   misc_feature    complement(226770..227489)
FT                   /note="N-acetyltransferase; Region: Acetyltransf_2;
FT                   cl00949"
FT                   /db_xref="CDD:154104"
FT                   /locus_tag="SLGD_00215"
FT   gene            complement(227690..228445)
FT                   /db_xref="GeneID:8817922"
FT                   /locus_tag="SLGD_00216"
FT   CDS_pept        complement(227690..228445)
FT                   /locus_tag="SLGD_00216"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase family
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549587"
FT                   /db_xref="GeneID:8817922"
FT                   /translation="MFKLTNQIALVTGGANGIGKGIAAALAQAGAKVIIGDIDDTRGKE
FT                   TARELNGDFIELDVTQHDQVKDVVDQIVAKYERIDILASNTGVYPQIDIESLTEADWDY
FT                   IQNINLKGMFFVTQAVLKVMKAQRYGRVIITSSVTGPITGYPGWAHYGASKAGQLGFMR
FT                   SAALEYAKYGITVNAVQPGNVLTDGLKAQGEAYLEGTRKIIPTHELGEPLDIGYAVTFF
FT                   ASQEAKFITGQSLVIDGGQLLPEEPDGVL"
FT                   /protein_id="YP_003470491.1"
FT   misc_feature    complement(227711..228436)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Reviewed; Region: PRK12826"
FT                   /db_xref="CDD:171751"
FT                   /locus_tag="SLGD_00216"
FT   misc_feature    complement(227726..>228274)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00216"
FT   gene            complement(228549..229127)
FT                   /db_xref="GeneID:8817923"
FT                   /locus_tag="SLGD_00217"
FT   CDS_pept        complement(228549..229127)
FT                   /locus_tag="SLGD_00217"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549588"
FT                   /db_xref="GeneID:8817923"
FT                   /translation="MEEVLINDSFSNLTYTKLKRFNKDYWKFVLIMFPTIPISAILPYL
FT                   GNIYLKNNKDNIFVHGTIFPDNWTIIAGLIFALLFFYLIVLSPLLSFKNDVQTEIDIVN
FT                   SVLINNQGELHSFIHLIRCDHFETEYYEHLITFISREYTRVTKQDLSHEQQTRYDEVQP
FT                   HLSLDEAHRYVRELYLTLEKCYNNINLPE"
FT                   /protein_id="YP_003470492.1"
FT   gene            229375..230910
FT                   /db_xref="GeneID:8817924"
FT                   /locus_tag="SLGD_00218"
FT   CDS_pept        229375..230910
FT                   /product="PTS system, maltose and glucose-specific IIC
FT                   /gene_family="HOG000250995" [ FAMILY / ALN / TREE ]
FT                   component/PTS system, maltose and glucose-specific IIB
FT                   component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00218"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549589"
FT                   /db_xref="GeneID:8817924"
FT                   /translation="MNKVFEKAQQFGKSFMLPIAILPAVGLLLGIGGALSNPSTVKAYP
FT                   VLDVAILQNIFTLMSSAGNIVFQNLPVIFAIGVAIGLARSDKGTAGLAALIGFLIMNAT
FT                   MNGMLVITDGLAKTTELAKHGQSMVLGIQTIETGVFGGIVTGILTAYLHNKYNKITLPA
FT                   YLGFFSGSRFVPIVTAISAIFLGVILFYIWPTVQSGIFNAGGLVEKTGVIGTFFFGFIL
FT                   RLLGPFGLHHIFYLPFWQTGLGGSLEVGGHMVRGTQNIFLAQLGDPHVTHYFSGISRYM
FT                   SGRFITMMFGLCGAALAIYHTAKPQHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAP
FT                   VLYLIHAFLDGLAFMMADIFNITVGQTFSGGFIDYILFGVLQGNDKTNYLWVIPIGIVW
FT                   FVLYYVIFRTLITVFNFKTPGREDKEAQHTVASTERAETIVQGLGGKENIEVVDCCATR
FT                   LRVTLKDGDLLDKSTLLKTDAKGVIVRGNGAQIVYGPHVTTIKNEVEELLEQS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470493.1"
FT   misc_feature    229381..230898
FT                   /note="PTS system, glucose-specific IIBC component; Region:
FT                   PTS-II-BC-glcB; TIGR02002"
FT                   /db_xref="CDD:162654"
FT                   /locus_tag="SLGD_00218"
FT   misc_feature    229528..230670
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="SLGD_00218"
FT   misc_feature    230671..230898
FT                   /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIB_glc;
FT                   cd00212"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00218"
FT   misc_feature    230734..230754
FT                   /note="active site turn"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00218"
FT   misc_feature    230737..230739
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00218"
FT   gene            complement(231116..231886)
FT                   /db_xref="GeneID:8817925"
FT                   /locus_tag="SLGD_00219"
FT   CDS_pept        complement(231116..231886)
FT                   /locus_tag="SLGD_00219"
FT                   /codon_start="1"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase-like
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549590"
FT                   /db_xref="GeneID:8817925"
FT                   /translation="MMTTLQDQVILITGASRGIGSAIAEACAQSGAHVIINYKSNTQAA
FT                   QKTVSQCQAHGGIAEAIQADINQRQQVDEMMHYIQNNYGKLSCVVNNAFRPFEFNAETR
FT                   QVADEMNWQDYATQFEGALLYTHNVIQAALPYLKQQQAASIINMTTNLIKRPIVPYHSY
FT                   NVAKSALEAYTKNLAIDLGKYGIRVNCVAPGLVYPTNNTLATKEQLKQQLIQQTPLGRY
FT                   TVPDDIAGPVMFLASDWSRFMTGQVLYVDGGLTI"
FT                   /protein_id="YP_003470494.1"
FT   misc_feature    complement(231122..231883)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00219"
FT   misc_feature    complement(231119..231880)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:168093"
FT                   /locus_tag="SLGD_00219"
FT   gene            complement(231907..233340)
FT                   /db_xref="GeneID:8817926"
FT                   /locus_tag="SLGD_00220"
FT   CDS_pept        complement(231907..233340)
FT                   /locus_tag="SLGD_00220"
FT                   /gene_family="HOG000113872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative acyl-CoA reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549591"
FT                   /db_xref="GeneID:8817926"
FT                   /translation="MTIQLGYVPFLKAEDIHYQTIQVGNYTVKVPDLTQSQLTNVCHQI
FT                   KSARYHLQAYTINDIIDVIDHAIQILLDRTSKWRQLAEEILPQSTGYPFDIIKVGLTRY
FT                   LMTFRKHQLHRFIAEDLPNPQILNQFIPNHKGGYTKAVSPALITHLWSGNIPGLPLWSF
FT                   ISSLLVKSGSICKLPHAEPFLASWFAEIIAEIDPVIAQCFAVIHWPGGETQLESIAIEQ
FT                   SDVILGYGNNDVLSAIAQRIPVTKRFLAYGEKVSLALIGNETLSPNKVEQVTRNIAREI
FT                   ANYDQQGCYSPQMIFIQQGGNYHPLQVAQMIAHQLQQLEQLFPVQSFNLQDSMTRSHWL
FT                   QQEETQALLTDDIHVFKGSHASWIVTFHKQLTFLPSPLNRFVRIMPFTNITQLTQLLTP
FT                   YRSYLQTVGIAAATEKMFQWSEALAQVGVCRFSSLETMTLPEAGWHHDGGFNLRDLLSF
FT                   VDIEQPLLSSSEHFVDYEI"
FT                   /protein_id="YP_003470495.1"
FT   misc_feature    complement(231964..233244)
FT                   /note="Acyl-CoA reductase LuxC; Region:
FT                   ALDH_Acyl-CoA-Red_LuxC; cd07080"
FT                   /db_xref="CDD:143399"
FT                   /locus_tag="SLGD_00220"
FT   misc_feature    complement(231967..233187)
FT                   /note="Acyl-CoA reductase (LuxC); Region: LuxC; pfam05893"
FT                   /db_xref="CDD:147831"
FT                   /locus_tag="SLGD_00220"
FT   misc_feature    complement(232474..232476)
FT                   /note="putative catalytic cysteine; other site"
FT                   /db_xref="CDD:143399"
FT                   /locus_tag="SLGD_00220"
FT   gene            complement(233353..234420)
FT                   /db_xref="GeneID:8817927"
FT                   /locus_tag="SLGD_00221"
FT   CDS_pept        complement(233353..234420)
FT                   /product="Long-chain-fatty-acid--luciferin-component
FT                   /gene_family="HOG000113860" [ FAMILY / ALN / TREE ]
FT                   ligase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00221"
FT                   /EC_number="6.2.1.19"
FT                   /db_xref="GI:289549592"
FT                   /db_xref="GeneID:8817927"
FT                   /translation="MDITQIKQQMTNFITDGKSEDFPQMALTLFNFQFNHNLDYQKFCI
FT                   AQGKTPQTVRQWQDIPAVPIDAFKQATFSAIPPEDAAYVFMTSGTTRGIKGKNYHLDLD
FT                   VYDLAMTKFFKQKVMPQIERIDMGILFPSPNDMPHSSLAHYLEVVKQQFGTSLSDTFIN
FT                   QQGIQFESVVQSLRHAEAQGTPYALLGASYSLVHFLDYLADHGLYFKLPKDSFIFDTGG
FT                   YKNQSRDVPQSEFYSTLEKRFGVPKDKCINMYGVTELSTQFYDDGNAVSPSIKHGPHWC
FT                   RSRIVNPLTLEPVPNGEKGVLIHYDLANYNSVAAIMMEDIGEARNDGFILHGRTEGALA
FT                   KGCSLAVESFLNTMK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470496.1"
FT   misc_feature    complement(233386..234375)
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="SLGD_00221"
FT   gene            234924..235496
FT                   /db_xref="GeneID:8817928"
FT                   /locus_tag="SLGD_00222"
FT   CDS_pept        234924..235496
FT                   /locus_tag="SLGD_00222"
FT                   /gene_family="HOG000252253" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Substrate-specific component YkoE of
FT                   thiamin-regulated ECF transporter for
FT                   HydroxyMethylPyrimidine"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549593"
FT                   /db_xref="GeneID:8817928"
FT                   /translation="MKRLTLADILVTVLISFIFGIIYKMVGLTVAALKPLGLHLDQIAY
FT                   GLWFIAAIVAFLIIRKPGVAILAELAAGAGETILSGELNMSIIMHSLAQGLACELIFLI
FT                   FKYKSTKASVAMLAGATAGIFTVPVDWFFNYLGNMPWWNVILLYTIRILSGTILSGLFG
FT                   YYIVLSLEKTGVTRLYQSSTKKDIDSL"
FT                   /protein_id="YP_003470497.1"
FT   misc_feature    234924..235460
FT                   /note="ABC-type cobalt transport system, permease
FT                   component; Region: ABC_cobalt; cl01943"
FT                   /db_xref="CDD:154667"
FT                   /locus_tag="SLGD_00222"
FT   gene            complement(235986..237362)
FT                   /db_xref="GeneID:8817929"
FT                   /locus_tag="SLGD_00223"
FT   CDS_pept        complement(235986..237362)
FT                   /locus_tag="SLGD_00223"
FT                   /gene_family="HOG000263641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transmembrane efflux pump protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549594"
FT                   /db_xref="GeneID:8817929"
FT                   /translation="MSNSYQKGKQLIIGIILGILTYWLFAQSLLNIAPYVQHDYKIDMS
FT                   VVNIAVSLTSLLTGVFIVVAGGLSDKLGRVKMTNIGLILSIIGSLALIISNMPILLLTG
FT                   RVLQGLSAACLLPSTIALINQFFTGEERQKALSFWSFGSYGGTGLASLFAGTIATYVGW
FT                   RWIFILSIIFAFIAIILLRGTPESKDRSSDGKRFDVIGIIVFVIMMVSVNVVITQGSKI
FT                   GWLSPTILTLMIIFVLTLFIFYFYEQRQRHPFIDFSLFSNKVYIGTTIANLLVNTVIGS
FT                   LALFNIFAQAGLGLTGAQAGLITIPYMLGSLLMIRIGERFMQKKGPQIPLMAGPISISV
FT                   GILLLALNFLPHILYYIIALIGFSFIGLGLGFFATPALSTAVSNAPESKVGMASGIIKM
FT                   TSTLGAAFGIAVVTTVYSTLEINHTPHMAATIALIVGACMVISAFIVAFLVIPKQHVKA
FT                   "
FT                   /protein_id="YP_003470498.1"
FT   misc_feature    complement(236070..237284)
FT                   /note="drug resistance transporter, EmrB/QacA subfamily;
FT                   Region: efflux_EmrB; TIGR00711"
FT                   /db_xref="CDD:129794"
FT                   /locus_tag="SLGD_00223"
FT   misc_feature    complement(<236868..237281)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00223"
FT   gene            complement(237375..240407)
FT                   /db_xref="GeneID:8817930"
FT                   /locus_tag="SLGD_00224"
FT   CDS_pept        complement(237375..240407)
FT                   /locus_tag="SLGD_00224"
FT                   /gene_family="HOG000227327" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative NADH-dependent flavin oxidoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549595"
FT                   /db_xref="GeneID:8817930"
FT                   /translation="MDKHITDQLTLHCGATLKNRVLMAPMTIQAGYFDGSVTREMIDYY
FT                   QFRAGSASAIIVESCFVEDHGRGFPGAIGIDTDEKIPGLTRLADAIKSKGSKAILQLYH
FT                   AGRMANPKLNAGETPISASPVAALRPDASVPREMTHNQILNMIERFGEATRRAIEAGFD
FT                   GVEIHGANTYLLQQFFSPHSNRRQDDWGGSREKRTNFPVEVLKKVQQVASEHHAQNFII
FT                   GYRFSPEEIEEPGIRFEDTMFLLNTLAQYHPDYFHISANSYKRTSIVNQDDTEPLINKY
FT                   LSLQNETLAEIPIMGVGSIAQRADAEEALTLGYDLMSVGKAYLVEPNWLEKILNDETVE
FT                   DFADIHDQQTLHIPSPLWKVMDFMILDKAEEHRKYEKLKALQNKKVAFKAGVYNVYAKG
FT                   HNGNLPMQVELSKDKIISVHVDDSGESEGIANPVFERLPRDIIDGQTLNVDVISGATVT
FT                   SQGIIDGIADAITQAGENPDILRARPKPVVQWSNETIEETTDIVVIGTGGAGLSAAATA
FT                   LDNNKEVIMLEKFPAIGGNTIRTGGQVNAPEPQWQNRFPALAGERDTLRELLSLDEANI
FT                   AEDYLEDFHKVKDQIKDYLNATEEEKPYLFDSIELHRIQTYLGGKRTDKYGEEISGQYD
FT                   LVKTLTDNVLTSVKWLTDKGVHFDRSFVDMPVGALWRRGHKPMKAQGLEYVETLSNYVK
FT                   TNGGRIFTETTAEKLIVEDHKVVGVEARKANGAKVHIRARYGVILATGGFGANTKMLQQ
FT                   YNTYWDNIPDDIKTTNSPAITGDGIRLGAQAGAQLVGMGFTQMMPISDPKTGALFTGLI
FT                   VTPSNFIFVNKDGKRFVNEFESRDVLSKAALEQPDGLFYIIADANIKELAMNTSEDKIN
FT                   HELEDGTLVKADTLAALAEKLNINPDTFINTIERYNAAVDKGHDDDFGKNAFDLKIEKA
FT                   PFYATPRKPAVHHTMGGLSINTGAQVLDINGQVIQGLYASGEVAGGIHAGNRLGGNALA
FT                   DIFTFGRIAAQTASEHQVIKE"
FT                   /protein_id="YP_003470499.1"
FT   misc_feature    complement(239334..240395)
FT                   /note="Old yellow enzyme (OYE)-related FMN binding domain,
FT                   group 4.  Each monomer of OYE contains FMN as a
FT                   non-covalently bound cofactor, uses NADPH as a reducing
FT                   agent with oxygens, quinones, and alpha,beta-unsaturated
FT                   aldehydes and ketones, and can act as...; Region:
FT                   OYE_like_4_FMN; cd04735"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(239331..240368)
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family [Energy production and conversion]; Region: NemA;
FT                   COG1902"
FT                   /db_xref="CDD:32086"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(order(239445..239450,239721..239723,
FT                   239889..239891,240105..240107,240231..240233,
FT                   240327..240329,240333..240335))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(order(239445..239450,239721..239723,
FT                   240105..240107,240231..240233,240327..240329,
FT                   240333..240335))
FT                   /note="putative FMN binding site; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(order(239889..239891,239895..239897))
FT                   /note="putative substrate binding site; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(239889..239891)
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(238989..239213)
FT                   /note="FMN-binding domain; Region: FMN_bind; cl01081"
FT                   /db_xref="CDD:174518"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(237408..238844)
FT                   /note="flavocytochrome c; Region: flavo_cyto_c; TIGR01813"
FT                   /db_xref="CDD:162543"
FT                   /locus_tag="SLGD_00224"
FT   misc_feature    complement(237396..>238310)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00224"
FT   gene            complement(240485..241405)
FT                   /db_xref="GeneID:8817931"
FT                   /locus_tag="SLGD_00225"
FT   CDS_pept        complement(240485..241405)
FT                   /locus_tag="SLGD_00225"
FT                   /gene_family="HOG000080809" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hypothetical thiamin biosynthesis lipoprotein
FT                   ApbE"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549596"
FT                   /db_xref="GeneID:8817931"
FT                   /translation="MNKRQIKAMGTLIQLSINHDDAEYLFDFAEAKIRAWEQRFSANNT
FT                   QSELMAINQQAGIRPVQVHPELFHLIKKAHQASMSSNLKLNILIGPLVKLWRIGFEDAQ
FT                   LPTNTEIQQRLRRIQPHHLYLNDAKHEIFLAQHGMEIDLGAIAKGYFADELQAFFLQNG
FT                   VTSGIINLGGNVITIGSPATHKTWHVGIRDPFHHDGLPLLTVEIQQQSVVTSGIYERYF
FT                   YQDGQLYHHILDSTTGYPVNNDIASVTIISNHSIDGEIWSTLCSFGYAQQNIDLLNQID
FT                   GVEGVIIRKNHDILFTHQLRTKLHL"
FT                   /protein_id="YP_003470500.1"
FT   misc_feature    complement(240542..241306)
FT                   /note="ApbE family; Region: ApbE; cl00643"
FT                   /db_xref="CDD:174326"
FT                   /locus_tag="SLGD_00225"
FT   gene            241701..242213
FT                   /db_xref="GeneID:8817932"
FT                   /locus_tag="SLGD_00226"
FT   CDS_pept        241701..242213
FT                   /locus_tag="SLGD_00226"
FT                   /gene_family="HOG000280336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549597"
FT                   /db_xref="GeneID:8817932"
FT                   /translation="MMRNQNDKLKWSSLIMGTLLLITAIIIFSHPVKNFYALTWLIGVF
FT                   IVINGILGLFFRRAAKAMTGSGTLTTFMAIIDIIFGLLVMFNVGVGSAFFIYMFAVWFV
FT                   ISSVIGLMTLSGQGRFKGLSILINMLGLLFGIILLFNPMMGMVIVSMMIGISFTIIGVM
FT                   YIVDGLA"
FT                   /protein_id="YP_003470501.1"
FT   misc_feature    241704..>242066
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: HdeD; cl01277"
FT                   /db_xref="CDD:174605"
FT                   /locus_tag="SLGD_00226"
FT   gene            242727..243926
FT                   /db_xref="GeneID:8817933"
FT                   /locus_tag="SLGD_00227"
FT   CDS_pept        242727..243926
FT                   /locus_tag="SLGD_00227"
FT                   /gene_family="HOG000223048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Putative aminotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549598"
FT                   /db_xref="GeneID:8817933"
FT                   /translation="MTYNFDEIIDRRSTNAMNVEGYLPYLFGNADVSDLQHTDDLIRLW
FT                   IADMDFATPDVVLNAIRRRLDQKILGYTQVFHVDYYNAFVKWTQSRYGYHFPQEQLVFS
FT                   HGIVAGLIELVSYICNNEDHALILTPSYGPFKMACDENQVEVHYSPLINEEEYYRIDFD
FT                   DVERQIVQHNIKLCIFCNPHNPSGRVWSREELERFGNIMKAHDVWLISDEIHCDIMRKG
FT                   MQHLPFATVLSDYDKVITAMSQSKAFNIAGLMFSNLIIRHKGLLNTWKQQHFGSENPLS
FT                   IAATQAAYEQGEDWLQAMNTYLDGNFEWLKQFLQQELPNAKFKIPEATYLAWIDLSDYI
FT                   TQQHISEPMAKYFIKRAGVIIEGQEQFVHNADGHIRINLAVPRTVLQQGLTKIKAALMS
FT                   "
FT                   /protein_id="YP_003470502.1"
FT   misc_feature    242850..243911
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="SLGD_00227"
FT   misc_feature    order(243042..243050,243120..243122,243276..243278,
FT                   243369..243371,243453..243455,243459..243464,
FT                   243486..243488)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="SLGD_00227"
FT   misc_feature    order(243051..243053,243150..243152,243348..243350,
FT                   243480..243488,243567..243569,243576..243578)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="SLGD_00227"
FT   misc_feature    243462..243464
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="SLGD_00227"
FT   gene            244430..244732
FT                   /db_xref="GeneID:8817934"
FT                   /locus_tag="SLGD_00228"
FT   CDS_pept        244430..244732
FT                   /locus_tag="SLGD_00228"
FT                   /gene_family="HOG000134718" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549599"
FT                   /db_xref="GeneID:8817934"
FT                   /translation="MLGTFMEILKIITPVLLASAVIATQYLLSRTGKKRFGLIIPIITL
FT                   AVIVYMHITGILGLKLIGTILLTIIAELFLLGQWVSAQEDCKKKHAENESKDLKL"
FT                   /protein_id="YP_003470503.1"
FT   gene            245236..246588
FT                   /db_xref="GeneID:8817935"
FT                   /locus_tag="SLGD_00229"
FT   CDS_pept        245236..246588
FT                   /product="Dihydrolipoamide dehydrogenase of acetoin
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   dehydrogenase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00229"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="GI:289549600"
FT                   /db_xref="GeneID:8817935"
FT                   /translation="MTEKYDVIIIGAGPGGYVSAIRAAQLGKTVAIIEKNNAGGTCLNV
FT                   GCIPSKTLLEHGKKVHDIQSADEWGIHTSNLTIDAAQLTSRKVQVVQTLTSGVTHLLKK
FT                   NKVSYYKGEAKINSDLTVTVNDETLSSQDVVLATGSRPFVPSIPGLENVDYETTDTFFD
FT                   MEALPKSLVVIGGGVIATELASSMADLGVKVTIVEVADDILLTEIDEVRALLREHLESQ
FT                   GIEIITSADIEKVEKKSLHLKGQDTISFDRLLVATGRQPNIEIVNDLELSRDGKYLQVD
FT                   VHYQTSKAHLYAIGDLTSGYQLAHAASAHGIHVAEHLAGMQPKTIKQEDITRCIYTRLE
FT                   AASVGLSAEQAEALGYEVKVTTSGFQGNAKAIIKGEGQGFVQLVIDEKYKEILGAFIVG
FT                   PHATDLIGELLGVKASEGTIAELSEIIQPHPALLEAIGEGADAYYNQAIHM"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470504.1"
FT   misc_feature    245248..246585
FT                   /note="dihydrolipoamide dehydrogenase; Region:
FT                   lipoamide_DH; TIGR01350"
FT                   /db_xref="CDD:162312"
FT                   /locus_tag="SLGD_00229"
FT   misc_feature    245248..>245685
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00229"
FT   misc_feature    245743..245952
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00229"
FT   misc_feature    246226..246555
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase,
FT                   dimerization domain; Region: Pyr_redox_dim; pfam02852"
FT                   /db_xref="CDD:145812"
FT                   /locus_tag="SLGD_00229"
FT   gene            246677..247624
FT                   /db_xref="GeneID:8817936"
FT                   /locus_tag="SLGD_00230"
FT   CDS_pept        246677..247624
FT                   /locus_tag="SLGD_00230"
FT                   /gene_family="HOG000281336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Acetoin dehydrogenase E1 component alpha-subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549601"
FT                   /db_xref="GeneID:8817936"
FT                   /translation="MEKEQARWIYKTMNEIRYFEEKVHKIFSDGKIPGFVHLYVGEEAV
FT                   ATGVMSQLEDDDYITSTHRGHGHAIAKGCDLNGMMAEIMGKKTGLGHGKGGSMHVAEID
FT                   KGMLGANGIVSGGFGLAIGAGISIRNQQKENVAVCFFGDGAANEGNFHEGLNFASILNL
FT                   PVIFVCENNQFGEGTTHDYASASETIAERASAYNMPGVRVDGMDVMAVLEATEEAVARA
FT                   KKGEGPTLIECDTYRKYGHFEGDEQKVKSPDDRNADKNATEEFRKQAIEEGWLTEDEAD
FT                   DIEKAAEQAVEDAVKYADDSDLPDVESLYKDVFA"
FT                   /protein_id="YP_003470505.1"
FT   misc_feature    246701..247621
FT                   /note="pyruvate dehydrogenase E1 component alpha subunit;
FT                   Reviewed; Region: odpA; CHL00149"
FT                   /db_xref="CDD:164541"
FT                   /locus_tag="SLGD_00230"
FT   misc_feature    246701..247570
FT                   /note="Thiamine pyrophosphate (TPP) family, E1 of
FT                   PDC_ADC_BCADC subfamily, TPP-binding module; composed of
FT                   proteins similar to the E1 components of the human pyruvate
FT                   dehydrogenase complex (PDC), the acetoin dehydrogenase
FT                   complex (ADC) and the branched chain...; Region:
FT                   TPP_E1_PDC_ADC_BCADC; cd02000"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="SLGD_00230"
FT   misc_feature    order(246773..246775,246929..246931,247010..247015,
FT                   247106..247108,247112..247123,247130..247132,
FT                   247142..247144,247154..247156,247199..247210,
FT                   247250..247252,247265..247267,247406..247408,
FT                   247418..247420)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="SLGD_00230"
FT   misc_feature    order(246863..246868,247010..247012,247016..247018,
FT                   247100..247111,247190..247192,247196..247198,
FT                   247397..247399)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="SLGD_00230"
FT   misc_feature    order(246995..246997,247001..247003,247007..247009,
FT                   247022..247024,247031..247036,247043..247048,
FT                   247052..247057,247064..247066,247121..247126,
FT                   247142..247147,247154..247156)
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="SLGD_00230"
FT   misc_feature    order(247382..247402,247403..247435,247454..247459)
FT                   /note="phosphorylation loop region"
FT                   /db_xref="CDD:48163"
FT                   /locus_tag="SLGD_00230"
FT   gene            247640..248680
FT                   /db_xref="GeneID:8817937"
FT                   /locus_tag="SLGD_00231"
FT   CDS_pept        247640..248680
FT                   /locus_tag="SLGD_00231"
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Acetoin dehydrogenase E1 component beta-subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549602"
FT                   /db_xref="GeneID:8817937"
FT                   /translation="MTETRKLTFMGAINEAIDQSMEQDENVILIGTDVSGGAGVKHIKD
FT                   DDTFGGVFGVTKGLAKKYSRNRVIDTPIAEHITLSAGVGAAATGLRPIAELMFNDFLGF
FT                   GLDPILNQGAKMRYMFGGKAKIPLVVRTVHGAGAGAAAQHSQSLYNVFAAIPGVKVVVP
FT                   SNPYDAKGLLMAAVQDDNLVVFSEDKTLLGQKGNVPEEPYTVDIGKARVVREGEDLSIV
FT                   AIGKMVAVAEETADRLKDDNISVEVIDLRTVSPWDEETVLTSVKKTGRLIVIDESNPQC
FT                   NVAGDIASVMGDRAFDYLDGPIKKVTAPDTPVPFAANLEQAYIPNADKVLDVAAELVDD
FT                   LRKVKS"
FT                   /protein_id="YP_003470506.1"
FT   misc_feature    247655..248656
FT                   /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, beta subunit
FT                   [Energy production and conversion]; Region: AcoB; COG0022"
FT                   /db_xref="CDD:30372"
FT                   /locus_tag="SLGD_00231"
FT   misc_feature    247673..248206
FT                   /note="Pyrimidine (PYR) binding domain of the beta subunits
FT                   of the E1 components of human pyruvate dehydrogenase
FT                   complex (E1- PDHc) and related proteins; Region:
FT                   TPP_PYR_E1-PDHc-beta_like; cd07036"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="SLGD_00231"
FT   misc_feature    order(247712..247714,247718..247720,247736..247738,
FT                   247838..247840,247847..247849,247853..247870,
FT                   247877..247882,247886..247894,247949..247951,
FT                   247958..247963,247988..247993,248057..248059,
FT                   248066..248068,248111..248116,248177..248182)
FT                   /note="alpha subunit interface; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="SLGD_00231"
FT   misc_feature    order(247733..247735,247856..247858,247862..247864,
FT                   247940..247942,247949..247951)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="SLGD_00231"
FT   misc_feature    order(247736..247738,247847..247849,247853..247864,
FT                   247946..247951,247955..247957,247970..247972,
FT                   247982..247984,247991..247993,248057..248059,
FT                   248063..248068,248090..248092,248096..248101,
FT                   248105..248107)
FT                   /note="heterodimer interface; other site"
FT                   /db_xref="CDD:132919"
FT                   /locus_tag="SLGD_00231"
FT   misc_feature    248261..248620
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="SLGD_00231"
FT   gene            248698..249987
FT                   /db_xref="GeneID:8817938"
FT                   /locus_tag="SLGD_00232"
FT   CDS_pept        248698..249987
FT                   /locus_tag="SLGD_00232"
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Dihydrolipoamide acetyltransferase component (E2)
FT                   of acetoin dehydrogenase complex"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549603"
FT                   /db_xref="GeneID:8817938"
FT                   /translation="MSQNIIMPKLGMTMTEGTVEEWFVAEGDDVNEGDSIATISSEKLT
FT                   QDIEAPATGTLLKIEVQAGEDAKVKGVLGIIGDADEATDNSSSSTESTNETADTSEHDQ
FT                   HETSTETAKDDAQSYSTEKSTADVEKSPQHTRIFISPLARNMAEDKALDINRIKGTGGN
FT                   ARITKLDIQRVEAQGYDYDDSKATETSVQTSKNVDVTNIGEGLNPMRKRIAQNMRESLA
FT                   NTAQLTLHRKVDADRLLDFKDKLTVELNQADKDVKLTVTALLAKAVVLALKDYGAMNAR
FT                   YDNGELLEYEDVHLGIATSLEEGLMVPVINEADTKSIGALAEEIKKTSQAVRDGHTDDV
FT                   QLSGATFTITNMGTSGIEYFTPILNLGETGILGVGALMKEVTLDGDSLRQVSRIPLSLT
FT                   FDHQILDGAGAAEFLKVLAKYIENPYLLIL"
FT                   /protein_id="YP_003470507.1"
FT   misc_feature    248707..249984
FT                   /note="branched-chain alpha-keto acid dehydrogenase subunit
FT                   E2; Reviewed; Region: PRK11856"
FT                   /db_xref="CDD:171309"
FT                   /locus_tag="SLGD_00232"
FT   misc_feature    248710..248925
FT                   /note="Lipoyl domain of the dihydrolipoyl acyltransferase
FT                   component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
FT                   dehydrogenase multienzyme complexes, like pyruvate
FT                   dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
FT                   and branched-chain 2-oxo acid...; Region: lipoyl_domain;
FT                   cd06849"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="SLGD_00232"
FT   misc_feature    order(248794..248796,248815..248832,248842..248844)
FT                   /note="E3 interaction surface; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="SLGD_00232"
FT   misc_feature    248824..248826
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133458"
FT                   /locus_tag="SLGD_00232"
FT   misc_feature    249103..249216
FT                   /note="e3 binding domain; Region: E3_binding; pfam02817"
FT                   /db_xref="CDD:111687"
FT                   /locus_tag="SLGD_00232"
FT   misc_feature    249313..249984
FT                   /note="2-oxoacid dehydrogenases acyltransferase (catalytic
FT                   domain); Region: 2-oxoacid_dh; cl02008"
FT                   /db_xref="CDD:174698"
FT                   /locus_tag="SLGD_00232"
FT   gene            250133..250471
FT                   /db_xref="GeneID:8817939"
FT                   /locus_tag="SLGD_00233"
FT   CDS_pept        250133..250471
FT                   /locus_tag="SLGD_00233"
FT                   /gene_family="HOG000246980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549604"
FT                   /db_xref="GeneID:8817939"
FT                   /translation="MSVSNQMMKGLLDGAILGLIAKGETYGYEILEKLKENQFPEISDG
FT                   SIYPVLLRLSKKGYVHTTTRKSDNGGPKRKYYTISDSGLDELTRFKEKWQYLNIGMTNL
FT                   FGSEINVK"
FT                   /protein_id="YP_003470508.1"
FT   misc_feature    250202..250402
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00233"
FT   gene            250461..251225
FT                   /db_xref="GeneID:8817940"
FT                   /locus_tag="SLGD_00234"
FT   CDS_pept        250461..251225
FT                   /locus_tag="SLGD_00234"
FT                   /gene_family="HOG000280332" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549605"
FT                   /db_xref="GeneID:8817940"
FT                   /translation="MLSKQSEEFLTKLRVELLFRGKSEEQIDEIDEELRDHLTICEQQG
FT                   KDVSDIIDTPVQDYANRFARHMPFANQLAKYMTYFILFMIAVFTIPDLFTKSFTLSVGY
FT                   ILNIFFIFFINVIVGLYVIKMLILKFGDKKRLYVLAFLTGFPIFGLMVLSTYLTGKFPI
FT                   YNIVTLNQQQSIILGIVLLIAVMLACILLKQKVYALIILALCMPNIVACLFAKDNSQYI
FT                   YISVIGLVILTFVFIAFNIYQFWKESRTNKSK"
FT                   /protein_id="YP_003470509.1"
FT   misc_feature    250461..251183
FT                   /note="hypothetical protein; Validated; Region: PRK07668"
FT                   /db_xref="CDD:169052"
FT                   /locus_tag="SLGD_00234"
FT   gene            complement(251841..252170)
FT                   /db_xref="GeneID:8817941"
FT                   /locus_tag="SLGD_00235"
FT   CDS_pept        complement(251841..252170)
FT                   /locus_tag="SLGD_00235"
FT                   /gene_family="HOG000279891" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549606"
FT                   /db_xref="GeneID:8817941"
FT                   /translation="MNQEALDHELLLIKQSIDMLQETLAPDLKTRDLMLLRYGYTVNET
FT                   RELDCYFYELFQSKTSVSFEDYHQKVCKIRGLPHISKIQTEDILIGYKASGLYTQLMSE
FT                   ILRSK"
FT                   /protein_id="YP_003470510.1"
FT   gene            252554..253327
FT                   /db_xref="GeneID:8817942"
FT                   /locus_tag="SLGD_00236"
FT   CDS_pept        252554..253327
FT                   /locus_tag="SLGD_00236"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549607"
FT                   /db_xref="GeneID:8817942"
FT                   /translation="MLAILKSTVKFMLKFLDFEKKWDYYFMFFLNSIVIIGIFCFPLAI
FT                   EIKILLNLKNDFLEIMLIAIVCALILSNIMVWIVLIQTCLNFFIIYRDLQGRWFIKRGL
FT                   NRKFYENKLRLDTVEDINKELASKNVDYPLRALYKCIHYRYYDFEGNMYEEIACIFSKL
FT                   HMIRMHLFSHPHKKKKLGLLILTFMMSIMVCISYITGGSPIFLNRIIPYAQCVYCLIST
FT                   GILAFINDDLITENNRAKILVIRYFQQRNNNKRNF"
FT                   /protein_id="YP_003470511.1"
FT   gene            253559..255418
FT                   /db_xref="GeneID:8817943"
FT                   /locus_tag="SLGD_00237"
FT   CDS_pept        253559..255418
FT                   /locus_tag="SLGD_00237"
FT                   /gene_family="HOG000280310" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Activator of the mannose operon (transcriptional
FT                   antiterminator), BglG family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549608"
FT                   /db_xref="GeneID:8817943"
FT                   /translation="MIDRQLKLVQLFLNNQSSYLTSDEIATYLNVSNRTARNDIKIVNM
FT                   SLLAELIISVKAKGYTLNTARYTIEDIEAALQRFSLQDSNHLVQLGYRLLMHHTIVTLT
FT                   DLEQQFCFTKRELLDYLERLRMWCDKFEVDIHIKKRKGIIVEGSETAINNAILHLNQLA
FT                   TQHVRVEDLILNELPEAHVCTIRQIFKTNLQAEQLSTSDIQIEQLMIHLILIMKRHQSN
FT                   AQSWHLNEEALVISRGIIEEINHRLGYDLNDDTSQLFSFFIGYHFNKFELTFEKLFIDS
FT                   YIQQLILKMEAKMHIPFSQDVILKDNLTEHFSRTYLRIIKEVYMNNPLTSEIKTLYPYA
FT                   FNVLFDIVQTLSQRADITLSEDEIAFLTIHFQASIDRNEVTRVHMVICCYYGLGISQLL
FT                   ETKLTTLNRHIKVQDTLQYDDLATYSFEGVDVLVMTHDIDVEVPSYVDVIKISPLLSEK
FT                   DQHQIQSLVKQKLNPTITSHDMSSIPIKVITAKSYQSLPELFDRVHDILMACHAVQEDY
FT                   IHTALLREKASSTYIGHGVTMPHGDPDKVLKSHVLIFKHSEGFYWQEHEVKLVFFLAIT
FT                   PQDIHMNKQLMHVLAQLDDSAVEHLSRLDEVAFKQEIFGLIQG"
FT                   /protein_id="YP_003470512.1"
FT   misc_feature    253559..254989
FT                   /note="Transcriptional antiterminator [Transcription];
FT                   Region: BglG; COG3711"
FT                   /db_xref="CDD:33506"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    253568..253738
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    254408..254680
FT                   /note="PRD domain; Region: PRD; pfam00874"
FT                   /db_xref="CDD:144460"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    254714..254968
FT                   /note="PTS_IIB_bgl_like: the PTS (phosphotransferase
FT                   system) IIB domain of a family of sensory systems composed
FT                   of a membrane-bound sugar-sensor (similar to BglF) and a
FT                   transcription antiterminator (similar to BglG) which
FT                   regulate expression of genes involved...; Region:
FT                   PTS_IIB_bgl_like; cd05568"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    order(254723..254734,254738..254746)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    order(254723..254725,254729..254734,254741..254746)
FT                   /note="active site"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    254723..254725
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    255017..255409
FT                   /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_fru;
FT                   cd00211"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    order(255128..255130,255176..255178)
FT                   /note="active site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00237"
FT   misc_feature    255176..255178
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00237"
FT   gene            255498..257447
FT                   /db_xref="GeneID:8817944"
FT                   /locus_tag="SLGD_00238"
FT   CDS_pept        255498..257447
FT                   /product="PTS system, mannose-specific IIB component/PTS
FT                   /gene_family="HOG000227677" [ FAMILY / ALN / TREE ]
FT                   system, mannose-specific IIC component/PTS system,
FT                   mannose-specific IIA component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00238"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549609"
FT                   /db_xref="GeneID:8817944"
FT                   /translation="MKILAITSCPNGIAHTYMAQEKLEQAAKEMGVDIKVETQGGVGAE
FT                   NVLTAKEIREADGIIIAADRQVDLARFHGKRLINENVREGIHHPQALIQRIIDHDAKIY
FT                   HHHGETNEHDVVDDENKKSGVQMVYQHLMNGVSFMVPFIVVGGLLIAIALTLGGETSSK
FT                   GLVVHDGTFWKSIENIGKLSFGFMVPILAGYIAYSIADKPGLVPGMIGGAIAADGSFYG
FT                   SAAGAGFLGGIVAGFIAGYVAKWIKQVKVPKAMAPIMPIIIIPILASLVVGLIFIFVIG
FT                   GPISSIFSVLTTWLKGMQGTNIIILALVIGAMIAFDMGGPVNKVAFLFGSALIAEGNYT
FT                   VMGMVAVSVCTPPIGLGLATFFQKHKFNQSEQEMGKASFTMGLFGITEGAIPFAAQDPL
FT                   RIIPANMFGAMVAAVIAALGGVGDRVAHGGPIVAVLGGIDHIVWFFIAVIVGSIVTTLT
FT                   VLLLKRKTPAINVDETQAKTTLATEVTTPPQSSVNENLDNKNTAEQQVFHQELIERVQT
FT                   PMTRDEAIDCLIQQLDKHGYINDCLTLKDAIVAREAEATTAIGMNVAIPHAKSAAVKEP
FT                   VVAVLQHQTGVKWDSLDGSLPQIIFLIAVPNHSNDTHLKLLQRLSRALMDDATRKQFIE
FT                   AASTADIYHMLQQL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470513.1"
FT   misc_feature    255498..256850
FT                   /note="putative PTS transporter components IIBC;
FT                   Provisional; Region: PRK11404"
FT                   /db_xref="CDD:138559"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    255504..255788
FT                   /note="PTS_IIB_fructose: subunit IIB of enzyme II (EII) of
FT                   the fructose-specific phosphoenolpyruvate:carbohydrate
FT                   phosphotransferase system (PTS). In this system, EII (also
FT                   referred to as FruAB) is a fructose-specific permease made
FT                   up of two proteins (FruA...; Region: PTS_IIB_fructose;
FT                   cd05569"
FT                   /db_xref="CDD:99911"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    order(255522..255533,255537..255545)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:99911"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    order(255522..255524,255528..255533,255540..255545)
FT                   /note="active site"
FT                   /db_xref="CDD:99911"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    255522..255524
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:99911"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    255879..256856
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    257016..257435
FT                   /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_fru;
FT                   cd00211"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    order(257148..257150,257196..257198)
FT                   /note="active site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00238"
FT   misc_feature    257196..257198
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00238"
FT   gene            257463..258401
FT                   /db_xref="GeneID:8817945"
FT                   /locus_tag="SLGD_00239"
FT   CDS_pept        257463..258401
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /gene_family="HOG000054245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00239"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="GI:289549610"
FT                   /db_xref="GeneID:8817945"
FT                   /translation="MVLFLQPVFQERIWGGRALQQQFNYDIPSHTTGECWAISAHPNGP
FT                   NIIENGPHKGKTLTQVWDEDRALFGEDQRSQFPLLTKILDANDKLSVQVHPDDAYALAH
FT                   EGEYGKTECWYIISAKEGAEIIYGVHADNQIELAQKIDARDFDTLFKHVPVKAGDFFYV
FT                   PAGTVHAIGAGITILETQQSSDTTYRIYDYDRKDKNGQLRALHLEQSKAVIDLETKNPN
FT                   TVPIHSIKHGQSMTQFVSNAFFTVDKWEIDGTLPYEKPHVYCLVSVIDGQGIVAIDGEQ
FT                   WPINKGSHFIITADDYDVEFDGQLTLIVSHP"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470514.1"
FT   misc_feature    257463..258398
FT                   /note="Phosphomannose isomerase [Carbohydrate transport and
FT                   metabolism]; Region: ManA; COG1482"
FT                   /db_xref="CDD:31671"
FT                   /locus_tag="SLGD_00239"
FT   misc_feature    257469..258395
FT                   /note="mannose-6-phosphate isomerase; Provisional; Region:
FT                   PLN03067; cl11740"
FT                   /db_xref="CDD:175363"
FT                   /locus_tag="SLGD_00239"
FT   gene            complement(258566..259480)
FT                   /db_xref="GeneID:8817946"
FT                   /locus_tag="SLGD_00240"
FT   CDS_pept        complement(258566..259480)
FT                   /locus_tag="SLGD_00240"
FT                   /gene_family="HOG000075136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hydroxymethylpyrimidine ABC transporter,
FT                   substrate-binding component"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549611"
FT                   /db_xref="GeneID:8817946"
FT                   /translation="MDTLTVGLEWFLNPDHMPLIIGIEKGWFADAQLDVHMIEPEAHFD
FT                   ALSEIENNKMDIAITEPIHLVEDRANAKDVVGFARFLHTNGGVMFNKDKAITRPRDLIG
FT                   KRLTYPGAPGSGGIAIVKTMIEADGATYQEGDLIPVNNSFYHTDALEKDKADAATLIFE
FT                   NFEIIEAKLRGLNVDFFALKDYNVPDFCQLILITSPQHLKIQHDKLSRFITVIKKAIDY
FT                   IHQHLDEAIAIYCAYTQTDVYDALNQQTIQATAHCFTNDLSMSSDYYNDLQLWLHENDK
FT                   IVQPIDSQLYFTNELLFPRYHRH"
FT                   /protein_id="YP_003470515.1"
FT   misc_feature    complement(258791..259444)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="SLGD_00240"
FT   gene            259556..259672
FT                   /db_xref="GeneID:8817947"
FT                   /locus_tag="SLGD_00241"
FT   CDS_pept        259556..259672
FT                   /locus_tag="SLGD_00241"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549612"
FT                   /db_xref="GeneID:8817947"
FT                   /translation="MSKGLRINDAQGSLSYAGTNHQVQGLKQSFSQQRLLHP"
FT                   /protein_id="YP_003470516.1"
FT   gene            259808..260173
FT                   /db_xref="GeneID:8817948"
FT                   /locus_tag="SLGD_00242"
FT   CDS_pept        259808..260173
FT                   /locus_tag="SLGD_00242"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549613"
FT                   /db_xref="GeneID:8817948"
FT                   /translation="MLISNDYLYYLTIIIEVFILVIILWAYLRLSRQWQSKQRRILVIS
FT                   YQLGLMAAFLIELLDALLPENIFGNVVFDDLWGFSTMIGLIELKRQHFTKVWWLMPTTF
FT                   LSAVLFIIFILLGPFDY"
FT                   /protein_id="YP_003470517.1"
FT   gene            complement(260489..260722)
FT                   /db_xref="GeneID:8817949"
FT                   /locus_tag="SLGD_00243"
FT   CDS_pept        complement(260489..260722)
FT                   /locus_tag="SLGD_00243"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549614"
FT                   /db_xref="GeneID:8817949"
FT                   /translation="MKSIFNFSFVLGLMLIIVGIVRLFNGIDIVSIFAIALGIMEIFLS
FT                   LGQRKQIKRQNQHASNDSKHEKPSFKHTQDKE"
FT                   /protein_id="YP_003470518.1"
FT   gene            260950..262056
FT                   /db_xref="GeneID:8817950"
FT                   /locus_tag="SLGD_00244"
FT   CDS_pept        260950..262056
FT                   /locus_tag="SLGD_00244"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putativetranscriptional regulator"
FT                   /transl_table="11"
FT                   /note="truncated"
FT                   /db_xref="GI:289549615"
FT                   /db_xref="GeneID:8817950"
FT                   /translation="MIKINKVIKAQRTKLGLTQDKLAAYLDITKPTISKWENGSLMPDI
FT                   QLLPKLAKLFNMSVDELLDYQDVLTKEDATHLCQHLSKQLTNHSYGTFLTAVKESCHNN
FT                   NNEYSFLLSIIALLMNHIYYAENEEQCLDTIQFAQTLCDIVEEKSDSDELIKYAKCYRL
FT                   AFQLYSADYSTIIDTVPDCSIKEGTAFFLADAYAQQGNLAKASSVIQVDMYQSLMLMSQ
FT                   QLQLILVRDLYEEISDIEQRFKALQQGFNTNQLFPYINIGINLSLAKYYYQQTEYEQAL
FT                   EYLEDYCQCYERVVRNCNYQQDHFFNDIDMFLAKMPFGERLNIQNDRVARDFYRVVADE
FT                   QRFAELWHNPQFQQIVKRLDFIYRQGIE"
FT                   /protein_id="YP_003470519.1"
FT   misc_feature    <260953..261408
FT                   /note="hypothetical protein; Provisional; Region: PRK04140"
FT                   /db_xref="CDD:167713"
FT                   /locus_tag="SLGD_00244"
FT   misc_feature    260965..261135
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00244"
FT   misc_feature    order(260974..260976,260986..260988,261061..261063)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00244"
FT   misc_feature    order(260983..260985,261058..261060)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00244"
FT   misc_feature    order(261004..261009,261040..261042,261049..261051,
FT                   261061..261066)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00244"
FT   gene            262058..262834
FT                   /db_xref="GeneID:8817951"
FT                   /locus_tag="SLGD_00245"
FT   CDS_pept        262058..262834
FT                   /locus_tag="SLGD_00245"
FT                   /gene_family="HOG000009662" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="OxaI/YidC membrane insertion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549616"
FT                   /db_xref="GeneID:8817951"
FT                   /translation="MKKWYVTILLLGISLLSGCNYSDTHQRTGLVYQLVVGPMDGLLHY
FT                   LGLHLNHNYGLAIVIIVCLVRLILMPLMLHNQKQMAITSMKMKELQPKIEPIQQKMKAA
FT                   ATQQLKNEAYQELQQLYQQHQLNPLTTMFGCLPMLIQIPILFGLYATLKWPTSGGILSY
FT                   PTFMWFHLTSPDSMIAMIAGFMYFVQSWLSARQMPKEQRMMGYVMMIVSPLFILYIAFQ
FT                   SPSALALYWFVNAALLILQAIISQRQTHHIRQSKTM"
FT                   /protein_id="YP_003470520.1"
FT   misc_feature    262133..262789
FT                   /note="60Kd inner membrane protein; Region: 60KD_IMP;
FT                   cl00489"
FT                   /db_xref="CDD:174237"
FT                   /locus_tag="SLGD_00245"
FT   gene            263638..265806
FT                   /db_xref="GeneID:8817952"
FT                   /locus_tag="SLGD_00246"
FT   CDS_pept        263638..265806
FT                   /product="Ornithine decarboxylase"
FT                   /gene_family="HOG000164393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00246"
FT                   /EC_number="4.1.1.17"
FT                   /db_xref="GI:289549617"
FT                   /db_xref="GeneID:8817952"
FT                   /translation="MKFLKVASSEEARKYFTSEREIVSIHDKDEDIIDLGAVVLMEEDM
FT                   DFVNKLKEAKLDIPVFVVSDYENDKDAANAVDLKEVDFIIDVNNSNFEYNSKKLEYAIS
FT                   KYENNVLPPFFNTLADYVERGNVQFDCPGHQGGQYFAKHPAGRQFYKFFGENIFRADIC
FT                   NADVDLGDLLIHEGPAVDAQKHAAKVYNADKTYFVMNGSTTSNNITITSAIMPDDLVLF
FT                   DRNNHKSVYISALVKDGGRPVYMQTARDSYGFIGGIHEHDFDEEYLRQEVAKVDPERAK
FT                   WDRPFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPLMKKSSPLL
FT                   LDLDENDPGIFVVQSTHKQQAGFSQASQIHKKDKHIKGQKRYINHKRFNNAYMQYASTS
FT                   PFYPMFASLDINARMQEGPMGEKLWNDCLTVSTNARKEILAKCKYIKPFLPEKVNGKKW
FT                   SDAPTEEIISNLDYWKFNPEESWHGFNGYGKDQYFVDPNKFLLTTPGINPEDDSYMDFG
FT                   IPAVILANYLRENGIIPEKNDLNSILFLMTPASDEAKMNNLIAKLIKFESLIDQDAPLD
FT                   KVLPRLYHQNFERYQGYTIRQLCQELHDFYKEHNTKEFQKKMFLKDYLPEQSMKPYDAN
FT                   IQLLKNNAKLVELDNIVGEIALEGALPYPPGIFCVVPGEKWSETAKSYFKILEEGINKF
FT                   PGFAPEIQGVYFEEVDGKIKAFGYVLES"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470521.1"
FT   misc_feature    263638..265797
FT                   /note="ornithine decarboxylase; Provisional; Region:
FT                   PRK13578"
FT                   /db_xref="CDD:172147"
FT                   /locus_tag="SLGD_00246"
FT   misc_feature    263647..263955
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="SLGD_00246"
FT   misc_feature    263974..264951
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="SLGD_00246"
FT   misc_feature    order(264241..264246,264253..264255,264511..264513,
FT                   264595..264597,264604..264606,264700..264702,
FT                   264709..264711)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="SLGD_00246"
FT   misc_feature    264709..264711
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="SLGD_00246"
FT   misc_feature    265372..265773
FT                   /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
FT                   Region: OKR_DC_1_C; pfam03711"
FT                   /db_xref="CDD:112521"
FT                   /locus_tag="SLGD_00246"
FT   gene            265821..267149
FT                   /db_xref="GeneID:8817953"
FT                   /locus_tag="SLGD_00247"
FT   CDS_pept        265821..267149
FT                   /locus_tag="SLGD_00247"
FT                   /gene_family="HOG000164507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amino acid permease-associated region"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549618"
FT                   /db_xref="GeneID:8817953"
FT                   /translation="MAQKKKMSVTQLTIVTAVNMMGSGIIMLPTNLAQVGTMSILSWIV
FT                   TTVGAVMLAFIFARAGLYSSKGGGMGGYAEYSFGKAGAFLTNYTYGLSLVIANAAIAIS
FT                   AVGYTAELLHIHMSPVATALWTILALWVATSLNFGGASITGKISSFTVWGVILPVVFIS
FT                   IIGWFWFSGSNFASSWNPHHFGFFEGMGKSISITLWAFLGLESAAANSDAVDNPKKNVP
FT                   IAVMGGTIGAAVMYIISTNVILGISPIKDLAHSNAPFGLAFSHMFNPTVGSIVIGLMII
FT                   SCFGSLIGWQFTIAEVFRTSAVEKYFPKVFAKTIGNGTPLIGMLIITCLQTLISLMTIS
FT                   PSLSKQFTILVNLAVVTNAVPYVLTMASIKTMQKEAGSVSAKGMKWTNFIAVIAGLYTL
FT                   YAIYSSGGIAVYYGAIVTFAGWTLYGLISYRFDVNKPHENITK"
FT                   /protein_id="YP_003470522.1"
FT   misc_feature    265821..267134
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="SLGD_00247"
FT   misc_feature    265821..267128
FT                   /note="Amino acid transporters [Amino acid transport and
FT                   metabolism]; Region: PotE; COG0531"
FT                   /db_xref="CDD:30877"
FT                   /locus_tag="SLGD_00247"
FT   gene            267298..268218
FT                   /db_xref="GeneID:8817954"
FT                   /locus_tag="SLGD_00248"
FT   CDS_pept        267298..268218
FT                   /locus_tag="SLGD_00248"
FT                   /gene_family="HOG000218440" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Cobalt-zinc-cadmium resistance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549619"
FT                   /db_xref="GeneID:8817954"
FT                   /translation="MKKADHSVSRILVISTIGALIFSVVGIFLGIVSNSDMVLLDGLYA
FT                   VLSLLISSLSLFTSIAIKKPNHESFPFGKYVFQPLTIIFNSSIMLLLCILSLVSSVYAI
FT                   LQGGRDINANIGLFYGIFSFVGCGLVCLMLSRNRKRSDLIYAEMLQWLLDTVVSFGLVF
FT                   GFVLMFVLKYTPLAWLIPYIDPGMVLLAGIILITMPIRLLYNNGKELISMSASEEVQYE
FT                   IFTIVKELNLKYNIREEDLRISKMGQAIYIDLQNIVDSKSAIRTIEQADVYRDELIHNI
FT                   NEAFTNYDKWLNISFTEQYYLRQLN"
FT                   /protein_id="YP_003470523.1"
FT   misc_feature    267325..268188
FT                   /note="Cation efflux family; Region: Cation_efflux;
FT                   cl00316"
FT                   /db_xref="CDD:174105"
FT                   /locus_tag="SLGD_00248"
FT   gene            268392..268778
FT                   /db_xref="GeneID:8817955"
FT                   /locus_tag="SLGD_00249"
FT   CDS_pept        268392..268778
FT                   /locus_tag="SLGD_00249"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549620"
FT                   /db_xref="GeneID:8817955"
FT                   /translation="MNADMELYNKKFGTEAQLYNTKVKYVYNQNGKKTFVESTLILSRR
FT                   HIVIISNKEHFFKEIIIRNIKGYTLSDKFMSAVVELIYGDNQFEFNATIAFKNKKEREI
FT                   VLNFLSVLFDNNFLKNKLQNKTDR"
FT                   /protein_id="YP_003470524.1"
FT   gene            268894..269334
FT                   /db_xref="GeneID:8817956"
FT                   /locus_tag="SLGD_00250"
FT   CDS_pept        268894..269334
FT                   /locus_tag="SLGD_00250"
FT                   /gene_family="HOG000134271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative 6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549621"
FT                   /db_xref="GeneID:8817956"
FT                   /translation="MYNDISEVQLPQQFKYGSQQDIVVRSYYQFTADNRIYFDAHHYRD
FT                   LIDHEYRLTIDIQSPVNAYGLAIDFFDIDEIDYQYIHPKLDGQLINNTLISMNTTAENI
FT                   ANWFWEQFKHHLPSGHHICRLELAETAQHSVILDSRLNYKRV"
FT                   /protein_id="YP_003470525.1"
FT   misc_feature    268996..269301
FT                   /note="Tunnelling fold (T-fold). The five known T-folds are
FT                   found in five different enzymes with different functions:
FT                   dihydroneopterin-triphosphate epimerase (DHNTPE),
FT                   dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I
FT                   (GTPCH-1),  6-pyrovoyl...; Region: TFold; cl00263"
FT                   /db_xref="CDD:174076"
FT                   /locus_tag="SLGD_00250"
FT   gene            complement(269319..269528)
FT                   /db_xref="GeneID:8817957"
FT                   /locus_tag="SLGD_00251"
FT   CDS_pept        complement(269319..269528)
FT                   /locus_tag="SLGD_00251"
FT                   /gene_family="HOG000134752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549622"
FT                   /db_xref="GeneID:8817957"
FT                   /translation="MLKKQDEMERHHFSIASKWTIGYFFIALFIYSVYTKITTGQFDII
FT                   WLILMVGLVLFWGILTWHKYHTRL"
FT                   /protein_id="YP_003470526.1"
FT   gene            complement(269546..269737)
FT                   /db_xref="GeneID:8817958"
FT                   /locus_tag="SLGD_00252"
FT   CDS_pept        complement(269546..269737)
FT                   /locus_tag="SLGD_00252"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, PBSX family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549623"
FT                   /db_xref="GeneID:8817958"
FT                   /translation="MKNKIKAYRKKIGMSQETLSKNVNVSRQTINAIENNKYDPTLMLA
FT                   FKLAKQFDTTVDDLFSTK"
FT                   /protein_id="YP_003470527.1"
FT   misc_feature    complement(269561..269731)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00252"
FT   misc_feature    complement(order(269633..269635,269708..269710,
FT                   269720..269722))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00252"
FT   misc_feature    complement(order(269636..269638,269711..269713))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00252"
FT   misc_feature    complement(order(269630..269635,269645..269647,
FT                   269654..269656,269687..269692))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00252"
FT   gene            complement(269750..270091)
FT                   /db_xref="GeneID:8817959"
FT                   /locus_tag="SLGD_00253"
FT   CDS_pept        complement(269750..270091)
FT                   /locus_tag="SLGD_00253"
FT                   /gene_family="HOG000022964" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549624"
FT                   /db_xref="GeneID:8817959"
FT                   /translation="MKILAYIGFFIFSVSWSIVTTALLPAESVDGRKKDDTKYDERQRR
FT                   MFLEIFARTFVWIVYIMLSSVFLRLFGIYKKVSESLFIFKDYPELLYILLGLLFLVMNY
FT                   FSVKKKYTT"
FT                   /protein_id="YP_003470528.1"
FT   gene            complement(270349..271371)
FT                   /db_xref="GeneID:8817960"
FT                   /locus_tag="SLGD_00254"
FT   CDS_pept        complement(270349..271371)
FT                   /locus_tag="SLGD_00254"
FT                   /gene_family="HOG000260593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Lipoate-protein ligase A"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549625"
FT                   /db_xref="GeneID:8817960"
FT                   /translation="MYLIEPIRNGKYIADGAVNLAMQVYVNQHIFLDEDILLPYYCDPK
FT                   IEIGRFQNTAIEINQEYVDKHGIQVVRRDTGGGAVYVDKGAVNVCCILEQDTSIYGDFQ
FT                   RFYRPAIKALHHLGATDVIQSGRNDLTLHGKKISGAAMTVINNRIYGGYSLLLDVDYDA
FT                   MVQSLNPNRKKIESKGIKSVRARVGNIRDSLAPEYQDITIQAFKDLIIKQIMGIDDISD
FT                   AKRYTLTDEDWAGIDQLVADKYANWEWNYGHSPRYEYNRNARFACGTIDISLSVTQNRI
FT                   SGCSIFGDFFGQGDIHDVETHLVGTRMVKQDLIARLEDIDLNYYFGSLSAEELTQLILS
FT                   "
FT                   /protein_id="YP_003470529.1"
FT   misc_feature    complement(270616..271371)
FT                   /note="Lipoate-protein ligase A [Coenzyme metabolism];
FT                   Region: LplA; COG0095"
FT                   /db_xref="CDD:30444"
FT                   /locus_tag="SLGD_00254"
FT   misc_feature    complement(270892..271230)
FT                   /note="Biotin/lipoate A/B protein ligase family; Region:
FT                   BPL_LplA_LipB; cl14057"
FT                   /db_xref="CDD:176437"
FT                   /locus_tag="SLGD_00254"
FT   misc_feature    complement(270361..270615)
FT                   /note="Bacterial lipoate protein ligase C-terminus; Region:
FT                   Lip_prot_lig_C; pfam10437"
FT                   /db_xref="CDD:151014"
FT                   /locus_tag="SLGD_00254"
FT   gene            complement(271383..272273)
FT                   /db_xref="GeneID:8817961"
FT                   /locus_tag="SLGD_00255"
FT   CDS_pept        complement(271383..272273)
FT                   /locus_tag="SLGD_00255"
FT                   /gene_family="HOG000235377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent protein deacetylase, SIR2 family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549626"
FT                   /db_xref="GeneID:8817961"
FT                   /translation="MSHNKWAALQLAREDAAQVDILLRAIYEADAVVVGIGAGMSAADG
FT                   FTYIGERFTQNFPDFIEKYGFFDMLQASLHPFDSWQEYWAFESRFVVLNYLDQPVGASY
FT                   LALKSLLAQKAYHIITTNADNAFLAADYDLNKVFHIQGEYILWQCSQYCHAKTYRDDDA
FT                   IRQMVAEQQDMKIPWTLIPHCPKCDAPMEINKRKAQVGMVEDADFHAQLERYNAFLAEH
FT                   QHGKILYLEIGIGYTTPQFVKHPFQRMTRHNPDALFMTLNKKAYRIPQNIKARTIHLNE
FT                   DIATLMTTAQQKMNN"
FT                   /protein_id="YP_003470530.1"
FT   misc_feature    complement(<271701..272180)
FT                   /note="SIR2 superfamily of proteins includes silent
FT                   information regulator 2 (Sir2) enzymes which catalyze
FT                   NAD+-dependent protein/histone deacetylation, where the
FT                   acetyl group from the lysine epsilon-amino group is
FT                   transferred to the ADP-ribose moiety of NAD+...; Region:
FT                   SIR2; cd00296"
FT                   /db_xref="CDD:29373"
FT                   /locus_tag="SLGD_00255"
FT   gene            complement(272263..273060)
FT                   /db_xref="GeneID:8817962"
FT                   /locus_tag="SLGD_00256"
FT   CDS_pept        complement(272263..273060)
FT                   /locus_tag="SLGD_00256"
FT                   /gene_family="HOG000086960" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549627"
FT                   /db_xref="GeneID:8817962"
FT                   /translation="MLQTQSKRLAYLTHYLWQEAHGSEPLNYPTDSTAQWELYRGLANV
FT                   RPPEPISQEYLDIQDAYLSALSTERQPIHMDALTPVENQQLYVWQGDITRLAVDGIVNA
FT                   ANSSLLGCMQANHDCIDNIIHTKAGVQLRLDCAQIIKQQGRKEGIGKAKITPAYNLPCR
FT                   YVLHTVGPQIRKYPVSQMNKELLARCYTSCLELAEQHGLQHIAFCCIATGVFGFPQEEA
FT                   CHIAIKTVSDYLTTHPSSIKVIFNVFTDKDAQLYTEVLQTHES"
FT                   /protein_id="YP_003470531.1"
FT   misc_feature    complement(272371..272805)
FT                   /note="Macro domain, Unknown family 1. The macro domain is
FT                   a high-affinity ADP-ribose binding module found in a
FT                   variety of proteins as a stand-alone domain or in
FT                   combination with other domains like in histone macroH2A and
FT                   some PARPs (poly ADP-ribose...; Region: Macro_1; cd02906"
FT                   /db_xref="CDD:28846"
FT                   /locus_tag="SLGD_00256"
FT   misc_feature    complement(order(272416..272424,272428..272430,
FT                   272698..272703,272707..272709,272743..272745,
FT                   272782..272787))
FT                   /note="putative ADP-ribose binding site; other site"
FT                   /db_xref="CDD:28846"
FT                   /locus_tag="SLGD_00256"
FT   gene            complement(273061..273393)
FT                   /db_xref="GeneID:8817963"
FT                   /locus_tag="SLGD_00257"
FT   CDS_pept        complement(273061..273393)
FT                   /locus_tag="SLGD_00257"
FT                   /gene_family="HOG000239392" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glycine cleavage system H protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549628"
FT                   /db_xref="GeneID:8817963"
FT                   /translation="MAKLANYLLVQKEGNQYVYYMTPELQDDIGTVGYVEFMTANDVAK
FT                   NDEIVSIEASKTVLDVQTPLAGTIVARNTKAEDEPTILNSEKPEDNWLVKLENVDEDAY
FT                   NALPEA"
FT                   /protein_id="YP_003470532.1"
FT   misc_feature    complement(273106..273378)
FT                   /note="Glycine cleavage H-protein. Glycine cleavage
FT                   H-proteins are part of the glycine cleavage system (GCS)
FT                   found in bacteria, archea and the mitochondria of
FT                   eukaryotes. GCS is a multienzyme complex consisting of 4
FT                   different components (P-, H-, T- and L-...; Region: GCS_H;
FT                   cd06848"
FT                   /db_xref="CDD:133457"
FT                   /locus_tag="SLGD_00257"
FT   misc_feature    complement(273226..273228)
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133457"
FT                   /locus_tag="SLGD_00257"
FT   gene            complement(273415..274419)
FT                   /db_xref="GeneID:8817964"
FT                   /locus_tag="SLGD_00258"
FT   CDS_pept        complement(273415..274419)
FT                   /locus_tag="SLGD_00258"
FT                   /gene_family="HOG000190695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Luciferase-like monooxygenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549629"
FT                   /db_xref="GeneID:8817964"
FT                   /translation="MVELNVLDYAMIDEGKNAEQALHDTIRLAQLADRLRFKRFWITEH
FT                   HNVPAFACSSPELLMMHILGKTSHIKVGSGGIMLPHYSPYKVAENFRMLEAFYPGRVDL
FT                   GIGNNPGTPAVKRAMDEDKSEYLDYQQSIVDLRHYLTNQQSEQRFSSVMAQPNISHHPD
FT                   MWLLSISQRSAKMAAQQGMGFAVGTFLLPDTDSIRATQHSIAAYRQHFEITSLQMSPSV
FT                   MLTVFVIVTDTEKEATRLLQALDVWLLGKRYFAEFERFPSYETALQYQPTARDKARMQA
FT                   SHSKILAGTITQVTPKLDAMIQDFQADEVLVVPLLPNIENRCRTLELLAQAYL"
FT                   /protein_id="YP_003470533.1"
FT   misc_feature    complement(<274102..274380)
FT                   /note="Flavin-utilizing monoxygenases; Region:
FT                   Flavin_utilizing_monoxygenases; cl07892"
FT                   /db_xref="CDD:174883"
FT                   /locus_tag="SLGD_00258"
FT   misc_feature    complement(273418..274377)
FT                   /note="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Energy production and
FT                   conversion]; Region: COG2141"
FT                   /db_xref="CDD:32324"
FT                   /locus_tag="SLGD_00258"
FT   gene            274637..275848
FT                   /db_xref="GeneID:8817965"
FT                   /locus_tag="SLGD_00259"
FT   CDS_pept        274637..275848
FT                   /locus_tag="SLGD_00259"
FT                   /gene_family="HOG000116234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Probable NADH-dependent flavin oxidoreductase
FT                   yqiG"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549630"
FT                   /db_xref="GeneID:8817965"
FT                   /translation="MKEDDTDMEDYTPLLQPITLPNGVQLNNRFVLSPMTTNSSTHDGH
FT                   ITQEDLRYAERRAGSAGLQVTGAAYIEPYGQLFEYGFNISDDTCIPGLKKLAQVMKQDG
FT                   NKAIIQLAHAGRFSNQAIRNFGEVYGPSPMSLHSPTPHKVIEMSQEKIKDVIQQYADAT
FT                   SRAIQAGFDGVEISVAQRLLIQTFFSTFSNQRHDDYGVDSLENRARFGLQVMQAVQNVI
FT                   DQQAPADFILGYRATPEETRGSDLGYTIDEFNQHLDWVMDVANIHYLAIASWGRHIYQN
FT                   TSRTPGQHFGKRVNQVVYDHLSGRLPMIASGGINSVESALDAMRQADMVGMSSPFVTEP
FT                   DFVTKLAAGQPECIDLHITQDDLEELAIPHAAFKDIVKMMDYGEGLALKTRDELRKLEQ
FT                   NYDD"
FT                   /protein_id="YP_003470534.1"
FT   misc_feature    274664..275770
FT                   /note="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family [Energy production and conversion]; Region: NemA;
FT                   COG1902"
FT                   /db_xref="CDD:32086"
FT                   /locus_tag="SLGD_00259"
FT   misc_feature    274676..275755
FT                   /note="Old yellow enzyme (OYE)-related FMN binding domain,
FT                   group 4.  Each monomer of OYE contains FMN as a
FT                   non-covalently bound cofactor, uses NADPH as a reducing
FT                   agent with oxygens, quinones, and alpha,beta-unsaturated
FT                   aldehydes and ketones, and can act as...; Region:
FT                   OYE_like_4_FMN; cd04735"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00259"
FT   misc_feature    order(274736..274738,274742..274744,274838..274840,
FT                   274964..274966,275180..275182,275351..275353,
FT                   275633..275638)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00259"
FT   misc_feature    order(274736..274738,274742..274744,274838..274840,
FT                   274964..274966,275351..275353,275633..275638)
FT                   /note="putative FMN binding site; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00259"
FT   misc_feature    order(275174..275176,275180..275182)
FT                   /note="putative substrate binding site; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00259"
FT   misc_feature    275180..275182
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73397"
FT                   /locus_tag="SLGD_00259"
FT   gene            complement(275904..276515)
FT                   /db_xref="GeneID:8817966"
FT                   /locus_tag="SLGD_00260"
FT   CDS_pept        complement(275904..276515)
FT                   /locus_tag="SLGD_00260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549631"
FT                   /db_xref="GeneID:8817966"
FT                   /translation="MSADILTTDVLQARLNLMPQIHDELEAQIKEQLQGQNRKDIAHIK
FT                   EATIVLIKLHITKMIKNQARYGETSTNDNHLHFIEGRHAYQLFYALDSSMHVEELELSE
FT                   DLLAKYDADIERLLNVRGQLTPFINVAIETFDSFSEDLDLTIEYLFKTYPDILTMVQDK
FT                   EFRLHKFDSLIEEAFKQLATTHQYGDFGTAMAQASIVDTP"
FT                   /protein_id="YP_003470535.1"
FT   gene            276683..276820
FT                   /db_xref="GeneID:8817967"
FT                   /locus_tag="SLGD_00261"
FT   CDS_pept        276683..276820
FT                   /locus_tag="SLGD_00261"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549632"
FT                   /db_xref="GeneID:8817967"
FT                   /translation="MFSVKIATLIVKDDTWVAIMASLDGLPWVLRIFKSDYGAEATPET
FT                   "
FT                   /protein_id="YP_003470536.1"
FT   gene            complement(277145..278761)
FT                   /db_xref="GeneID:8817968"
FT                   /locus_tag="SLGD_00262"
FT   CDS_pept        complement(277145..278761)
FT                   /locus_tag="SLGD_00262"
FT                   /gene_family="HOG000053240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glycine betaine transporter OpuD"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549633"
FT                   /db_xref="GeneID:8817968"
FT                   /translation="MSDKRKKNNNFVYAFSVLIILIITAIAGLFPKAFGSRAQAIYNFL
FT                   TNSFGWLFLLIIFILDVFLISLAVSRYGRFKLGDNDEAPEFSTISWIGMLFSAGLGVGI
FT                   VFWGVAEPLTHYLHSPFPGKITSESASSARLAMGYTFFHWGISQWSIFAIAGLIVAFFQ
FT                   FRKKRNGLISTAMEPVFGEAYKRPFRNIIDILAIIATVMGIATSIGLGILQIGGGLNYV
FT                   FHIPNTNVTKIGITILMVCIFLGSALTGLNRGVKWLSNINIGLGALLLIFMLIFGDLKF
FT                   IVESYTLAIGDYITHFVEYSLRINPYQGDNSWVQKWTVFYWAWVISWSPFIGGFVARVS
FT                   RGRTIREFVVGVLLVPPLISFSWIAGFGGTALKIALGGDPIANVVDKDYTVALFELLSK
FT                   FPISDITSALAITLIFIFIVTSADSTTHIVASMATGGKENPKVKHKVIWGLLIGAISVA
FT                   MTIAGGLTSLQSAAVVTGLPFSIILLLMIFSLMRALRREHTKHFAMTYINDDKDYTISL
FT                   EEREDQQDKQHDSTNNINKKK"
FT                   /protein_id="YP_003470537.1"
FT   misc_feature    complement(277271..278728)
FT                   /note="BCCT family transporter; Region: BCCT; cl00569"
FT                   /db_xref="CDD:174291"
FT                   /locus_tag="SLGD_00262"
FT   gene            279021..280190
FT                   /db_xref="GeneID:8817969"
FT                   /locus_tag="SLGD_00263"
FT   CDS_pept        279021..280190
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /gene_family="HOG000275009" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00263"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="GI:289549634"
FT                   /db_xref="GeneID:8817969"
FT                   /translation="MSKYALINGKIYTEQQVIEHGYVVINDGRIEQIESGKYDGMLETV
FT                   DAQGQHVLPGFIDIHIHGGYGADAMDASYEGLKHLAENLLSEGTTSFLATTMTQSDENI
FT                   IKALANIAKYHQEQQQGTAAEIVGIHLEGPFISEHKVGAQNPQYVQRPSVDKIQQFQQS
FT                   AQGLIKVITFAPEVEGAQETLAALHHDIIFSIGHTVADFDQTNEAVTCGAKHITHLYNA
FT                   ATGFEHRKPGVFGAAWTNSGLNTEVIVDGIHSHPTAVKLAYQLKGHEHFYLITDAMRAK
FT                   GMSDGEYDLGGQNVIVKGSEARLASGSLAGSILKMNDGLKNVMTFTGQGLDQVWRVASL
FT                   NQAIALKIDDQKGSIAVGKDADLVIVDDDIQVLTTIKAGCMHRYRSLGE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470538.1"
FT   misc_feature    279036..280097
FT                   /note="N-acetylglucosamine-6-phosphate deacetylase, NagA,
FT                   catalyzes the hydrolysis of the N-acetyl group of
FT                   N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to
FT                   glucosamine 6-phosphate and acetate. This is the first
FT                   committed step in the biosynthetic pathway to...; Region:
FT                   NagA; cd00854"
FT                   /db_xref="CDD:30034"
FT                   /locus_tag="SLGD_00263"
FT   misc_feature    order(279198..279200,279204..279206,279414..279416,
FT                   279447..279449,279609..279611,279672..279674,
FT                   279681..279686,279777..279779,279846..279848,
FT                   279945..279947)
FT                   /note="active site"
FT                   /db_xref="CDD:30034"
FT                   /locus_tag="SLGD_00263"
FT   misc_feature    order(279678..279680,279696..279698,279702..279707,
FT                   279711..279713,279732..279737,279774..279785,
FT                   279789..279794,279798..279803,279810..279812)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:30034"
FT                   /locus_tag="SLGD_00263"
FT   gene            280233..280478
FT                   /db_xref="GeneID:8817970"
FT                   /locus_tag="SLGD_00264"
FT   CDS_pept        280233..280478
FT                   /locus_tag="SLGD_00264"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549635"
FT                   /db_xref="GeneID:8817970"
FT                   /translation="MQSNYRFPNAIFFFNMLLLAATLAIIALAIVNFISNSIITKAGVV
FT                   FEMAWQETEIIFVSACGICILISLIALFILKLFEYK"
FT                   /protein_id="YP_003470539.1"
FT   gene            complement(280575..281309)
FT                   /db_xref="GeneID:8817971"
FT                   /locus_tag="SLGD_00265"
FT   CDS_pept        complement(280575..281309)
FT                   /product="Glucosamine-6-phosphate deaminase"
FT                   /gene_family="HOG000064978" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00265"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="GI:289549636"
FT                   /db_xref="GeneID:8817971"
FT                   /translation="MRILNLGDQQTASRYVAIELIKLLQDKPDAILGLATGATMTSVYP
FT                   YFTDLLDLNHIDVSQVHTFNLDEYVGLDAHHEHSYHHYMHERLFDNYSGWNKAFIHIPN
FT                   GAADNLESEALRYETLLQSVGQRDIQLLGIGQNGHIGFNEPGTPFDSHTRVVNLTTSTI
FT                   QANSVHFSKLADVPKQAISMGLDNITRAKRIILLAFGDKKHDALQRLIDGHITEDLPAS
FT                   ILHQHERVDVIVDNALYQSLNI"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470540.1"
FT   misc_feature    complement(280599..281282)
FT                   /note="GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P)
FT                   deaminase subfamily; GlcN6P deaminase catalyzes the
FT                   reversible conversion of GlcN6P to D-fructose-6-phosphate
FT                   (Fru6P) and ammonium. The reaction is an aldo-keto
FT                   isomerization coupled with an amination...; Region:
FT                   GlcN6P_deaminase; cd01399"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="SLGD_00265"
FT   misc_feature    complement(order(280701..280703,280806..280808,
FT                   280887..280889,280893..280895,280908..280913,
FT                   281109..281114,281193..281204))
FT                   /note="active site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="SLGD_00265"
FT   misc_feature    complement(order(280629..280637,280659..280679,
FT                   280839..280841,280863..280868,280872..280874))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="SLGD_00265"
FT   misc_feature    complement(order(280839..280850,280866..280871))
FT                   /note="allosteric site; other site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="SLGD_00265"
FT   misc_feature    complement(order(280779..280787,280794..280826,
FT                   280833..280835))
FT                   /note="active site lid"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="SLGD_00265"
FT   misc_feature    complement(order(280602..280604,280695..280697,
FT                   280707..280709,280818..280820))
FT                   /note="hexamer (dimer of trimers) interface; other site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="SLGD_00265"
FT   gene            complement(281357..282028)
FT                   /db_xref="GeneID:8817972"
FT                   /locus_tag="SLGD_00266"
FT   CDS_pept        complement(281357..282028)
FT                   /product="N-acetylmannosamine-6-phosphate 2-epimerase"
FT                   /gene_family="HOG000236669" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00266"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="GI:289549637"
FT                   /db_xref="GeneID:8817972"
FT                   /translation="MLPQGLIVSCQALPDEPLHSSFIMSKMALAAYQGGAVGIRANTKE
FT                   DILAIKREVNLPVIGIVKRDYANSDVFITATSKEVDELIASGCDVIALDATKQTRPKET
FT                   LSELVDYIRQHAPNVEIMADISTLDEAQQADKLGFDYIGTTLRGYTSYTKGHILYENEF
FT                   AFLKDVLNSVSAKVIAEGNVITPEMYKQVSDLGVYCTVVGGAITRPKQITERFIKAIAE
FT                   D"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470541.1"
FT   misc_feature    complement(281369..282028)
FT                   /note="N-acetylmannosamine-6-phosphate 2-epimerase;
FT                   Provisional; Region: PRK01130"
FT                   /db_xref="CDD:167164"
FT                   /locus_tag="SLGD_00266"
FT   misc_feature    complement(281381..282028)
FT                   /note="N-acetylmannosamine-6-phosphate epimerase (NanE)
FT                   converts N-acetylmannosamine-6-phosphate to
FT                   N-acetylglucosamine-6-phosphate. This reaction is part of
FT                   the pathway that allows the usage of sialic acid as a
FT                   carbohydrate source. Sialic acids are a family...; Region:
FT                   NanE; cd04729"
FT                   /db_xref="CDD:73391"
FT                   /locus_tag="SLGD_00266"
FT   misc_feature    complement(order(281420..281422,281483..281491,
FT                   281582..281584,281594..281596,281657..281659,
FT                   281747..281749,281840..281842,281846..281848,
FT                   281909..281911,281996..281998,282002..282004))
FT                   /note="putative active site cavity; other site"
FT                   /db_xref="CDD:73391"
FT                   /locus_tag="SLGD_00266"
FT   gene            282192..282992
FT                   /db_xref="GeneID:8817973"
FT                   /locus_tag="SLGD_00267"
FT   CDS_pept        282192..282992
FT                   /locus_tag="SLGD_00267"
FT                   /gene_family="HOG000279775" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Sialic acid utilization regulator, RpiR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549638"
FT                   /db_xref="GeneID:8817973"
FT                   /translation="MMKFDNRVQRSRHILTKMDRKIVTFIQEQELDDRFSTINSLAYAI
FT                   GTSPATITRFSNKLGYDNFQDMKFSVQHEKSEKIVENAPLVQQIHRYHQRIIQQTGEFI
FT                   SEEKIKRFAHNLKTRRQINYAGLGSSGLTASEFYYRTMRMGLKGMVSTDAHQMKISASL
FT                   LSAQDMFVAISNSGETIELIEAAAIAHDQGAYVAVITNYEGSSITEKADLVLITTDQSR
FT                   INDSQFINTQIATFFLMDIVSYLLLNDPHMNQLYQHTRQTILGK"
FT                   /protein_id="YP_003470542.1"
FT   misc_feature    282192..282932
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   RpiR; COG1737"
FT                   /db_xref="CDD:31923"
FT                   /locus_tag="SLGD_00267"
FT   misc_feature    282510..282926
FT                   /note="RpiR-like protein. RpiR contains a SIS (Sugar
FT                   ISomerase) domain, which is found in many phosphosugar
FT                   isomerases and phosphosugar binding proteins. In E. coli,
FT                   rpiR negatively regulates the expression of rpiB gene. Both
FT                   rpiB and rpiA are ribose...; Region: SIS_RpiR; cd05013"
FT                   /db_xref="CDD:88408"
FT                   /locus_tag="SLGD_00267"
FT   misc_feature    order(282579..282581,282711..282713)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:88408"
FT                   /locus_tag="SLGD_00267"
FT   gene            complement(283088..283951)
FT                   /db_xref="GeneID:8817974"
FT                   /locus_tag="SLGD_00268"
FT   CDS_pept        complement(283088..283951)
FT                   /product="N-acetylmannosamine kinase"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00268"
FT                   /EC_number="2.7.1.60"
FT                   /db_xref="GI:289549639"
FT                   /db_xref="GeneID:8817974"
FT                   /translation="MYKIAVDIGGTNIKIAVFNTDLDMLAHESIKTPDNKKTLIIDTVH
FT                   DLIAKYIQHYQLERPHIGISTAGVVDTERKAIIYAGPTIANYNGTDFQQHLGDLSDHIT
FT                   VHNDVDAALLGELVLHKYPESHIFCLTLGTGIGGAFYTQQHGLYTGARYHANEIGYLLY
FT                   RSSDGLTYEQRASTSALKALIKAYGLDANISVPALFDLAEADDKQSVQLLNDWGNAVAE
FT                   GIAQIQIIYDPDLILIGGGISSQGDRLIQYIEPHIQHYLPHGYGGARLQTTRTKNHAAL
FT                   YGALVE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470543.1"
FT   misc_feature    complement(283094..283951)
FT                   /note="Transcriptional regulator/sugar kinase
FT                   [Transcription / Carbohydrate transport and metabolism];
FT                   Region: NagC; COG1940"
FT                   /db_xref="CDD:32123"
FT                   /locus_tag="SLGD_00268"
FT   misc_feature    complement(283466..283939)
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:175010"
FT                   /locus_tag="SLGD_00268"
FT   gene            284193..285074
FT                   /db_xref="GeneID:8817975"
FT                   /locus_tag="SLGD_00269"
FT   CDS_pept        284193..285074
FT                   /product="N-acetylneuraminate lyase"
FT                   /gene_family="HOG000173608" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00269"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="GI:289549640"
FT                   /db_xref="GeneID:8817975"
FT                   /translation="MDNNLKGIFAALLVPFDEQGQVKEEGLKQIARNAIETEGLDGLYV
FT                   NGSSGENFLISKEQKKQIFRLAKEAVGDKAKLIAQVGSLDLNEAIELGQYATELGYDAL
FT                   SAVTPFYYPFSFEEIKQYYFDIIEATQNNMIIYAIPDLTGVNISIEQFGELFNHDKVIG
FT                   VKYTAPNFFLLERIRKAFPNKLILSGFDEMLVQATVSGVDGAIGSTYNVNGRRARQIFE
FT                   LAQQGNVSEAYKIQHETNDIIQNVLAMGIYPTLKEILKTRGIDGGLPKRPFAPFNEAHR
FT                   ATLDNLINKYNL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470544.1"
FT   misc_feature    284205..285062
FT                   /note="N-Acetylneuraminic acid aldolase, also called
FT                   N-acetylneuraminate lyase (NAL), which catalyses the
FT                   reversible aldol reaction of N-acetyl-D-mannosamine and
FT                   pyruvate to give N-acetyl-D-neuraminic acid (D-sialic
FT                   acid). It has a widespread application as...; Region: NAL;
FT                   cd00954"
FT                   /db_xref="CDD:29947"
FT                   /locus_tag="SLGD_00269"
FT   misc_feature    284205..285011
FT                   /note="N-acetylneuraminate lyase; Region: nanA; TIGR00683"
FT                   /db_xref="CDD:129766"
FT                   /locus_tag="SLGD_00269"
FT   misc_feature    order(284223..284225,284322..284324,284331..284339,
FT                   284601..284603,284685..284687)
FT                   /note="inhibitor site; inhibition site"
FT                   /db_xref="CDD:29947"
FT                   /locus_tag="SLGD_00269"
FT   misc_feature    order(284322..284324,284331..284339,284601..284603,
FT                   284685..284687,284808..284810)
FT                   /note="active site"
FT                   /db_xref="CDD:29947"
FT                   /locus_tag="SLGD_00269"
FT   misc_feature    order(284334..284336,284349..284354,284445..284450,
FT                   284520..284525,284544..284546,284556..284558,
FT                   285003..285008)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29947"
FT                   /locus_tag="SLGD_00269"
FT   misc_feature    284685..284687
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29947"
FT                   /locus_tag="SLGD_00269"
FT   gene            285108..286637
FT                   /db_xref="GeneID:8817976"
FT                   /locus_tag="SLGD_00270"
FT   CDS_pept        285108..286637
FT                   /locus_tag="SLGD_00270"
FT                   /gene_family="HOG000279774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted sialic acid transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549641"
FT                   /db_xref="GeneID:8817976"
FT                   /translation="MQQIGFGFWNWVAVLLYLLIMLAVGAYFTKRASQSTDSFFTASGR
FT                   LPSWAVGFSIYATTLSAITFMSTPEKAFLTDWAYIAGNIAIVAIIPILIAFYVPFFKKL
FT                   KVTSAYEYLEARFGPSVRVIGSLLFVIFHLGRIAIVIYLPTLAITSVSDMNPFLVASLV
FT                   GILCILYTFLGGFEGVVWSDFIQGVILLGGALMIILIGAFEIKGGFGTIIHDAIANKKI
FT                   MSADNWKWNSAAASIPIIFLGNIFNNLHQYTASQDVVQRYQASDSMEETKKSLWTNGVL
FT                   ALISAPIFYGMGTMMYSFYQHQDSLPKGFNTSSVVPYFILTEMPPFVGGLLIAAIFAAA
FT                   QSTISSSLNSISACISEDIKHRFFGKGRDKDEVNFARIVIIIAGLLSYGISMYLIAADS
FT                   NNLWDLFLLVTGLFGVPLAGIFAVGIFTKRANTFGVFVGLISGVIFAYFFNGIGGGNSP
FT                   FYVSIISFMIAFIFGYLISLVVPAKYAKDITGLTIYDKDKPSNYVSKVANK"
FT                   /protein_id="YP_003470545.1"
FT   misc_feature    285123..286574
FT                   /note="Sodium:solute symporter family; Region: SSF;
FT                   cl00456"
FT                   /db_xref="CDD:174215"
FT                   /locus_tag="SLGD_00270"
FT   misc_feature    285138..286556
FT                   /note="putative symporter YidK; Provisional; Region:
FT                   PRK10484"
FT                   /db_xref="CDD:170475"
FT                   /locus_tag="SLGD_00270"
FT   gene            286986..287138
FT                   /db_xref="GeneID:8817977"
FT                   /locus_tag="SLGD_00271"
FT   CDS_pept        286986..287138
FT                   /locus_tag="SLGD_00271"
FT                   /gene_family="HOG000284803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transposase for IS1272"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549642"
FT                   /db_xref="GeneID:8817977"
FT                   /translation="METSILISTNNISRYVNEIVETIPDNEFDEFKHYRGTTSYPPKMI
FT                   TSCIL"
FT                   /protein_id="YP_003470546.1"
FT   gene            complement(287430..288650)
FT                   /db_xref="GeneID:8817978"
FT                   /locus_tag="SLGD_00272"
FT   CDS_pept        complement(287430..288650)
FT                   /locus_tag="SLGD_00272"
FT                   /gene_family="HOG000267657" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Probable pyrimidine nucleoside transport protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549643"
FT                   /db_xref="GeneID:8817978"
FT                   /translation="MSILFGMLGVAFALIVAFIFSFNRKAIDYKKPLIMLVIQVLLVLF
FT                   MMNTTIGLHILTAMGTFFEGLMNISKAGIDFVFGDLQNKGGYNFFLNVLLPLVFISVLI
FT                   GILNYFKILPFIIKVVGYIINKITRMGKLESYIAISTSMLGQPEVYLTVKDIIPKLSKE
FT                   KLYTITTSGMSAVSMAMLGSYMQMIEPKYVVTAVMLNIFSALIIASIINPYHSDDKEVD
FT                   LNVIDTQATNKKTVNGSTKAKKPAFFQMIGDSAIDGFKIAVTVAIMLLAFISLMKGITI
FT                   VFDLVGLDFKQIIGYIFAPIAFIMGVPWEEAIRAGSIMATKLITNEFVAMLDFQKIASS
FT                   LSPKTQGIISVYLVSFANFGTVGIMVGAIKGISSEQGNKVATFALRLLLGATLASIVSA
FT                   SLIGLVL"
FT                   /protein_id="YP_003470547.1"
FT   misc_feature    complement(287433..288650)
FT                   /note="Nucleoside permease [Nucleotide transport and
FT                   metabolism]; Region: NupC; COG1972"
FT                   /db_xref="CDD:32155"
FT                   /locus_tag="SLGD_00272"
FT   misc_feature    complement(288408..288629)
FT                   /note="Na+ dependent nucleoside transporter N-terminus;
FT                   Region: Nucleos_tra2_N; pfam01773"
FT                   /db_xref="CDD:145105"
FT                   /locus_tag="SLGD_00272"
FT   misc_feature    complement(287433..288077)
FT                   /note="Na+ dependent nucleoside transporter C-terminus;
FT                   Region: Nucleos_tra2_C; pfam07662"
FT                   /db_xref="CDD:148972"
FT                   /locus_tag="SLGD_00272"
FT   gene            complement(288660..289571)
FT                   /db_xref="GeneID:8817979"
FT                   /locus_tag="SLGD_00273"
FT   CDS_pept        complement(288660..289571)
FT                   /locus_tag="SLGD_00273"
FT                   /gene_family="HOG000064311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549644"
FT                   /db_xref="GeneID:8817979"
FT                   /translation="MKQYLEFSSEVAEAKKHNQPIVALESTIISHGMPYPQNIEMAKNV
FT                   EQIIRDHGAVPATIALINGKIKIGLNEADLETLAHSENVAKVSRRDLPEIIATKRIGAT
FT                   TVASTMICAALADIPFFVTGGIGGVHKGAEETMDISADLDEFAKTNVSVICAGAKSILD
FT                   LPKTMEYLETKGVPVIGYQTDELPAFFTRESDVALTSRADTPEEIARIFKAKQDLHLEG
FT                   GMVIANPVPEKDELPKDYIDAIIDDAVKEAKVQGIHGKDSTPFLLKTIVEKTAGKSLQT
FT                   NIKLVENNAVVGAQIAVAFNQL"
FT                   /protein_id="YP_003470548.1"
FT   misc_feature    complement(288672..289544)
FT                   /note="Indigoidine synthase A like protein; Region:
FT                   Indigoidine_A; cl00983"
FT                   /db_xref="CDD:154124"
FT                   /locus_tag="SLGD_00273"
FT   gene            complement(289555..290661)
FT                   /db_xref="GeneID:8817980"
FT                   /locus_tag="SLGD_00274"
FT   CDS_pept        complement(289555..290661)
FT                   /locus_tag="SLGD_00274"
FT                   /gene_family="HOG000064422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Hypothetical sugar kinase in cluster with
FT                   indigoidine synthase indA, PfkB family of kinases"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549645"
FT                   /db_xref="GeneID:8817980"
FT                   /translation="MNKNEQAIFNLVKENPYITQLELAERIGLSRPAVANIISGLMRQR
FT                   YILGKAYVINEESPIVCIGAANVDRKFYIDTPLQPKTSNPVFSSRSIGGVGRNIAENLG
FT                   RLGEKVTFLTASGNDSEWDMINRMSSPFMDLSAIQPIENASTGSYTAVIKDGDMEYGFA
FT                   DMEIYEQITPDFLARYAQILTKAKCLVADLNLPKSALEFLSAFAQKNHIKFVIVPVSSP
FT                   KMVRMPQSLHAVDWLIINRDESETYLNMSIRNISDMQRAAEKWVELGVSNVIITNGLEP
FT                   LIFKNCHTEHIVPISPAQHFVDATGAGDSFTSAVIYSWLNDFSLQDIIKSGMVNSLKTV
FT                   ETNYTVRQNLDNEQLKRDMEEYNYEAIS"
FT                   /protein_id="YP_003470549.1"
FT   misc_feature    complement(289663..290661)
FT                   /note="hypothetical protein; Provisional; Region: PRK09954"
FT                   /db_xref="CDD:170177"
FT                   /locus_tag="SLGD_00274"
FT   misc_feature    complement(<290437..290643)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00274"
FT   misc_feature    complement(289636..290487)
FT                   /note="YeiC-like sugar kinase.  Found in eukaryotes and
FT                   bacteria, YeiC-like kinase is part of the ribokinase/pfkB
FT                   sugar kinase superfamily. Its oligomerization state is
FT                   unknown at this time; Region: YeiC_kinase_like; cd01941"
FT                   /db_xref="CDD:29363"
FT                   /locus_tag="SLGD_00274"
FT   misc_feature    complement(order(289735..289737,289744..289746,
FT                   290368..290370))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:29363"
FT                   /locus_tag="SLGD_00274"
FT   misc_feature    complement(order(289654..289656,289663..289665,
FT                   289729..289731,289738..289743,289750..289752,
FT                   289834..289836,289942..289944))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29363"
FT                   /locus_tag="SLGD_00274"
FT   gene            290962..291780
FT                   /db_xref="GeneID:8817981"
FT                   /locus_tag="SLGD_00275"
FT   CDS_pept        290962..291780
FT                   /locus_tag="SLGD_00275"
FT                   /gene_family="HOG000134751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549646"
FT                   /db_xref="GeneID:8817981"
FT                   /translation="MNYIKILGMFVLAFLMIIVAQALGAIFDEMIPFLGIGIIISALIY
FT                   CIVIYFFVRLMIEKGLKQRRVDYRIVSPHFDIRAVILGIILPLSVILFYLIFVPGEFKI
FT                   SHFKTQDTLFRSLFWDIFQVAVAGAIVEELVFRGLLMGYIEKKTNIVVAILTTSIFFGA
FT                   IHVLNGALNVGSFLQLLVGGSLAGVMFGLTAYVFRSIWASATLHFFWNISQVFYITEKQ
FT                   VDDKVFQYILDSHNFALTGGEFGFEASIISILGYVSVIVVLVMLRRRLRQ"
FT                   /protein_id="YP_003470550.1"
FT   misc_feature    291316..291609
FT                   /note="CAAX amino terminal protease family; Region: Abi;
FT                   cl00558"
FT                   /db_xref="CDD:163875"
FT                   /locus_tag="SLGD_00275"
FT   gene            291800..292381
FT                   /db_xref="GeneID:8817982"
FT                   /locus_tag="SLGD_00276"
FT   CDS_pept        291800..292381
FT                   /locus_tag="SLGD_00276"
FT                   /gene_family="HOG000084170" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549647"
FT                   /db_xref="GeneID:8817982"
FT                   /translation="MKKFVLILTLCLLSFIIVACDTEDDHDDDDDSVTKKKIPTQIFNK
FT                   QTTNDSISEKTMKQDIQLYLDTDRELTDAKFYYMDIIDSDDKLTTSQQDEFAKLMQLTD
FT                   QNDQNFARYIHNNVLPKGGYDKFTNKISEYTKASNKIDKKSYELSKKDDASVLDDIKQL
FT                   NEDRDVVNGREQKKIEKFLKAKGIKTKAYD"
FT                   /protein_id="YP_003470551.1"
FT   gene            complement(292540..293340)
FT                   /db_xref="GeneID:8817983"
FT                   /locus_tag="SLGD_00277"
FT   CDS_pept        complement(292540..293340)
FT                   /locus_tag="SLGD_00277"
FT                   /gene_family="HOG000134750" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549648"
FT                   /db_xref="GeneID:8817983"
FT                   /translation="MNDYHTSTEQRYNETNSTIESSTKNVKPRGNIILNILIFIGWMLL
FT                   SQMVILIIFGILKLSSIFNSFSGAILTCLFIVIATIITWLIRRYYIRHSYEERQKFKLK
FT                   DIGINIGWAVLLRVLALAFSYLLHITTGSGQSENDKMLLGDANHQISDASQLPQIFPFL
FT                   MFILTISILTPYLEELIYRGIFKETLFSRAAFWLPLILSSLIFALQHSVTDIISILMFM
FT                   FMGIIFYLAYSRRGNVRDSMMVHMIHNSTTGIILLIGYFYVLLH"
FT                   /protein_id="YP_003470552.1"
FT   misc_feature    complement(292573..292848)
FT                   /note="CAAX amino terminal protease family; Region: Abi;
FT                   cl00558"
FT                   /db_xref="CDD:163875"
FT                   /locus_tag="SLGD_00277"
FT   gene            293629..294276
FT                   /db_xref="GeneID:8817984"
FT                   /locus_tag="SLGD_00278"
FT   CDS_pept        293629..294276
FT                   /locus_tag="SLGD_00278"
FT                   /gene_family="HOG000134749" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549649"
FT                   /db_xref="GeneID:8817984"
FT                   /translation="MIETHQPLHQYQLSTKHYWKLLLQSIMFIILLFIAESLDFLFLKS
FT                   GYYYLLSLAFLVGIFGLMNAFNLHVFNFNKLTKRHLVYVVVGVIISIVCDYIAMFFIST
FT                   TANQEELDAYLSGVPLLLQLLSIGIVGPIIEECIFRAFIIKGIFRRIPIVGGIVSVIAF
FT                   AAVHGPSNVIEWIVYGISGIILVVAFLKTQRLEVPILIHICINVEATIVSFL"
FT                   /protein_id="YP_003470553.1"
FT   misc_feature    294019..294249
FT                   /note="CAAX amino terminal protease family; Region: Abi;
FT                   cl00558"
FT                   /db_xref="CDD:163875"
FT                   /locus_tag="SLGD_00278"
FT   gene            complement(294368..295006)
FT                   /db_xref="GeneID:8817985"
FT                   /locus_tag="SLGD_00279"
FT   CDS_pept        complement(294368..295006)
FT                   /product="Pyrrolidone-carboxylate peptidase"
FT                   /gene_family="HOG000242641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00279"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="GI:289549650"
FT                   /db_xref="GeneID:8817985"
FT                   /translation="MDILVTAFDPFGGEKINPALEVVKRLDTNIGAHTITKLEIPTVFH
FT                   ESKDVIAQKLAQQHFDAVLAIGQAGGRFEITPERVGINIDDARIADNKGNQPIDVAIQP
FT                   DGAPAYFSNLPVKTMTEAIKAEGIPAKLSNTAGTFVCNHVLYQLGYLADTQFTGLLFGF
FT                   IHVPFIPEQVTTKPETPSMSIDTMTKGLTAAIKAISYGDDQKIALGETH"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470554.1"
FT   misc_feature    complement(294425..295006)
FT                   /note="Pyroglutamyl peptidase (PGP) type I, also known as
FT                   pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes
FT                   responsible for cleaving pyroglutamate (pGlu) from the
FT                   N-terminal end of specialized proteins. The N-terminal pGlu
FT                   protects these proteins from...; Region: Peptidase_C15;
FT                   cd00501"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="SLGD_00279"
FT   misc_feature    complement(order(294584..294592,294881..294883,
FT                   294974..294976,294983..294985))
FT                   /note="putative substrate binding pocket; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="SLGD_00279"
FT   misc_feature    complement(order(294458..294460,294464..294469,
FT                   294488..294490,294494..294499,294614..294628,
FT                   294635..294637,294785..294793))
FT                   /note="AC domain interface; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="SLGD_00279"
FT   misc_feature    complement(order(294512..294514,294584..294586,
FT                   294773..294775))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="SLGD_00279"
FT   misc_feature    complement(order(294593..294595,294602..294607,
FT                   294656..294658,294674..294685,294710..294715,
FT                   294743..294745,294749..294751,294755..294757,
FT                   294767..294772))
FT                   /note="AB domain interface; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="SLGD_00279"
FT   misc_feature    complement(294458..294460)
FT                   /note="interchain disulfide; other site"
FT                   /db_xref="CDD:29606"
FT                   /locus_tag="SLGD_00279"
FT   gene            complement(295051..295977)
FT                   /db_xref="GeneID:8817986"
FT                   /locus_tag="SLGD_00280"
FT   CDS_pept        complement(295051..295977)
FT                   /locus_tag="SLGD_00280"
FT                   /gene_family="HOG000167650" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549651"
FT                   /db_xref="GeneID:8817986"
FT                   /translation="MSQTTINHILEFFYILIGLQFLYTAYRALRATDKQKRIGTALFWT
FT                   ILAILFIAGPYIPNALNGALVLCMGALTLFKQVQIKNIIDVTEKEAERGSDRYGNKLFI
FT                   PAVALAVIAVVVSNWTPLGGAIGLGISSVLGLIAAVWIIRPKLHYILYDSDRLTQQVGT
FT                   TGILPQFLAALGVLFTASGVGQVISKGISSFLPEGNHFIGAIAYILGMVIFTILMGNAF
FT                   AAFTVITASIGIPFVIAQGGDPVIAGALAMTGGFCGTLLTPMAANFNTLPVALLEMKHE
FT                   FGVIKAQAPIAIALIIVHIALMYLWAF"
FT                   /protein_id="YP_003470555.1"
FT   misc_feature    complement(295054..295950)
FT                   /note="Protein of unknown function (DUF979); Region:
FT                   DUF979; cl01572"
FT                   /db_xref="CDD:154479"
FT                   /locus_tag="SLGD_00280"
FT   gene            complement(295958..296674)
FT                   /db_xref="GeneID:8817987"
FT                   /locus_tag="SLGD_00281"
FT   CDS_pept        complement(295958..296674)
FT                   /locus_tag="SLGD_00281"
FT                   /gene_family="HOG000167539" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549652"
FT                   /db_xref="GeneID:8817987"
FT                   /translation="MEWLKLIGILIIILGFLFKFDTIAVILVAALITGLVSGLDFTEVL
FT                   SILGKAFVDNRLVTLFMLTLPMVGLIERFGLKQQASKLISNVKRVTAGRLLTLYLIIRE
FT                   IAGIASIRVGGHPQFVRPLINPMVQGALRTRYNLTDATIDAKDIEKLKAEASAMENYGN
FT                   FFGQNLFVGAAGVLLMVGTFSSLHIKVNAIDLVLASIPVAVITLLLIWIKNMMLDRYFN
FT                   KKYGRNEVKTHESNNN"
FT                   /protein_id="YP_003470556.1"
FT   misc_feature    complement(296006..296614)
FT                   /note="Protein of unknown function (DUF969); Region:
FT                   DUF969; cl01573"
FT                   /db_xref="CDD:154480"
FT                   /locus_tag="SLGD_00281"
FT   gene            296959..298332
FT                   /db_xref="GeneID:8817988"
FT                   /locus_tag="SLGD_00282"
FT   CDS_pept        296959..298332
FT                   /locus_tag="SLGD_00282"
FT                   /gene_family="HOG000263641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549653"
FT                   /db_xref="GeneID:8817988"
FT                   /translation="MSIKDHKFDLSLVLAACLAVLTYWMFAQSFINIGASVQHTFGAVD
FT                   TTLNLSISIVAFVTGIFMVGAGDVADKVGNLKMTKLGLMLSIIGCICLISTHLTAFLII
FT                   GRIFQGLSAAVLLPSTIGLVTDRFSGETLRKAYSYLMIATVGGIGFASYIGGTISQYLH
FT                   WQSIFVLSIILSVVALWILKNKQEVPRAERNHQPFDYVGMFIFGVFIAALMILMTQGFN
FT                   YGIGTFTITLVVVMIMALIIFYLYEKRQKVPFIDFSIIKNRAFLGSTINNFVVNTGTGT
FT                   TVVFNVYAQKQLGLTEMQTGLVIVPYTIMAVAMIRLGELAIKRYGGKSMLIAGPLFPTL
FT                   GIMLISMTSLTTHLYIAIVTIAYVICAIGNGLVATPGLTIAIFNMPEHKVSFATGLYKM
FT                   GATLGGAFGIAFNTTIFTVCLQFYTVETAAMVSFIAGAIVMILGVISAFVLIPRNVKA"
FT                   /protein_id="YP_003470557.1"
FT   misc_feature    297043..>297504
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SLGD_00282"
FT   misc_feature    297100..298263
FT                   /note="drug resistance transporter, EmrB/QacA subfamily;
FT                   Region: efflux_EmrB; TIGR00711"
FT                   /db_xref="CDD:129794"
FT                   /locus_tag="SLGD_00282"
FT   gene            complement(298450..299430)
FT                   /db_xref="GeneID:8817989"
FT                   /locus_tag="SLGD_00283"
FT   CDS_pept        complement(298450..299430)
FT                   /locus_tag="SLGD_00283"
FT                   /gene_family="HOG000039938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Choloylglycine hydrolase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549654"
FT                   /db_xref="GeneID:8817989"
FT                   /translation="MCTGFTFQSHNNEVILGRTMDYDWPLTGHPAVQPRHYEWKSRVDY
FT                   QGQTLYGFVGTGSDMEGFIFGDGMNEHGLAISTQYDRDYCSYASQCREDAMNISQNEVL
FT                   TWVLGYHQSIEELCAHADQVNVVAVTLNDINDVPPLHYHVSDASGRTVELTFDQGRVVI
FT                   HDNPIAVLTNNPDLNWHYENLKNYVAITPYRPSAKQFNDVELTTLGSEGGTRGLPGGFT
FT                   SPERFVRAAYLIRHLQPSDDDYAVLDAFRILDAVSIPKGAVRSQNDDLHYTLYQTVFNL
FT                   TSRTMFVKYYQSNQIIELSLTESLLNQSHLQLFEPISGISTTKLN"
FT                   /protein_id="YP_003470558.1"
FT   misc_feature    complement(298528..299427)
FT                   /note="Penicillin V acylase (PVA), also known as conjugated
FT                   bile salt acid hydrolase (CBAH), catalyzes the hydrolysis
FT                   of penicillin V to yield 6-amino penicillanic acid (6-APA),
FT                   an important key intermediate of semisynthetic penicillins.
FT                   PVA has an N-...; Region: Ntn_PVA; cd00542"
FT                   /db_xref="CDD:48435"
FT                   /locus_tag="SLGD_00283"
FT   misc_feature    complement(order(299011..299013,299026..299028,
FT                   299038..299040,299233..299235,299251..299253,
FT                   299353..299355,299371..299373,299377..299379,
FT                   299425..299427))
FT                   /note="active site"
FT                   /db_xref="CDD:48435"
FT                   /locus_tag="SLGD_00283"
FT   gene            299642..301573
FT                   /db_xref="GeneID:8817990"
FT                   /locus_tag="SLGD_00284"
FT   CDS_pept        299642..301573
FT                   /product="Putative transcriptional antiterminator, BglG
FT                   /gene_family="HOG000279789" [ FAMILY / ALN / TREE ]
FT                   family/PTS system, mannitol/fructose-specific IIA
FT                   component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00284"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549655"
FT                   /db_xref="GeneID:8817990"
FT                   /translation="MLNNRQSKIFDLLVKSEQYTTIADLATMFDVSQRTIQYDLEHIED
FT                   LQRERQFTLQRHKSYGVRIHNLQETLSKNDELIYTDVHLSKDERVLNIILKLFETSQPL
FT                   TSSDLAQAMAVSRRTIVNDLKAIQHWLTQYQLELAYIKNKGFMITGDEEAYRSAYANRI
FT                   QVYFKTMSPFITLDIFTDEELTKVRNTVIHTLTQMDYHLVQSAIDGLIYHLLIAIHRLK
FT                   GKFSFDVPSEQAETLKQTYQFQIASQLKDNLEGQFNIKFPDSEAIFITLHLLGSKVSTN
FT                   AEMRGTQEGLETVLRRFIYQVSAEIGIDMHKDDKLFDNLLLHMKPALHRLKYRMSQQNP
FT                   LQEEIYQQYHQLVGIIESQITLLEQTYDITFTVDELAFIVIHFASSIERIAQHQDQIKV
FT                   VLLCGSGIGTSQLLKNKLRNVYPEFDILDAYSIYQIDESQLLARGIDYIISTVPCEATQ
FT                   IPVIIVDPFLSLAAREKLNHIVNTHREQKVQRLDQEGYTLRQLLPIHRIQKCQQHMQRN
FT                   EAIAHATTALIQDGIVAQDYVEEMIAQLEKFGPYMVISPNIALVHASTAHVLQDAGFSM
FT                   CYFEHGVRFGHQHYDPVHIVIVLATKNPTFHLTALGQLSALITNDKDRQHILDGQLEVV
FT                   HRFIDDLD"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470559.1"
FT   misc_feature    299642..301096
FT                   /note="Transcriptional antiterminator [Transcription];
FT                   Region: BglG; COG3711"
FT                   /db_xref="CDD:33506"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    299906..>300025
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    <300260..300469
FT                   /note="PRD domain; Region: PRD; pfam00874"
FT                   /db_xref="CDD:144460"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    300527..300799
FT                   /note="PRD domain; Region: PRD; pfam00874"
FT                   /db_xref="CDD:144460"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    300830..301090
FT                   /note="PTS_IIB_bgl_like: the PTS (phosphotransferase
FT                   system) IIB domain of a family of sensory systems composed
FT                   of a membrane-bound sugar-sensor (similar to BglF) and a
FT                   transcription antiterminator (similar to BglG) which
FT                   regulate expression of genes involved...; Region:
FT                   PTS_IIB_bgl_like; cd05568"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    order(300848..300859,300863..300871)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    order(300848..300850,300854..300859,300866..300871)
FT                   /note="active site"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    300848..300850
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:99910"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    301145..301534
FT                   /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_fru;
FT                   cd00211"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    order(301271..301273,301325..301327)
FT                   /note="active site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00284"
FT   misc_feature    301325..301327
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00284"
FT   gene            301589..302035
FT                   /db_xref="GeneID:8817991"
FT                   /locus_tag="SLGD_00285"
FT   CDS_pept        301589..302035
FT                   /locus_tag="SLGD_00285"
FT                   /gene_family="HOG000227560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PTS system, IIA component"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549656"
FT                   /db_xref="GeneID:8817991"
FT                   /translation="MTLDLLTEDKVVVKTSTTDWSTAIHEAAQPLINANVINEGYVDAM
FT                   INSVNEFGPYIVIAPEIAIAHARPNGDVNEVGLSLLKLKEHVNFSEEGHYASLVFVLSA
FT                   VDGQSHLTVLQDLASVLGDKDTVQQLLATQDKAEILNLLKETDE"
FT                   /protein_id="YP_003470560.1"
FT   misc_feature    301604..302017
FT                   /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_fru;
FT                   cd00211"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00285"
FT   misc_feature    order(301730..301732,301784..301786)
FT                   /note="active site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00285"
FT   misc_feature    301784..301786
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="SLGD_00285"
FT   gene            302035..302319
FT                   /db_xref="GeneID:8817992"
FT                   /locus_tag="SLGD_00286"
FT   CDS_pept        302035..302319
FT                   /locus_tag="SLGD_00286"
FT                   /gene_family="HOG000081922" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549657"
FT                   /db_xref="GeneID:8817992"
FT                   /translation="MKILVVCGHGLGSSFMVEMNAQEALKNLAAPADIEVEHSDIMTAS
FT                   PEMADLFICGRDLAENAQRLGDVLVLDNILDKEELQQKLQQKLQALNMI"
FT                   /protein_id="YP_003470561.1"
FT   misc_feature    302038..302262
FT                   /note="PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of
FT                   the L-ascorbate-specific phosphoenolpyruvate:carbohydrate
FT                   phosphotransferase system (PTS). In this system, EII is an
FT                   L-ascorbate-specific permease with two cytoplasmic subunits
FT                   (IIA and IIB) and a...; Region: PTS_IIB_ascorbate; cd05563"
FT                   /db_xref="CDD:99905"
FT                   /locus_tag="SLGD_00286"
FT   misc_feature    order(302053..302064,302068..302076)
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:99905"
FT                   /locus_tag="SLGD_00286"
FT   misc_feature    order(302053..302055,302059..302064,302071..302076)
FT                   /note="active site"
FT                   /db_xref="CDD:99905"
FT                   /locus_tag="SLGD_00286"
FT   misc_feature    302053..302055
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:99905"
FT                   /locus_tag="SLGD_00286"
FT   gene            302334..303695
FT                   /db_xref="GeneID:8817993"
FT                   /locus_tag="SLGD_00287"
FT   CDS_pept        302334..303695
FT                   /locus_tag="SLGD_00287"
FT                   /gene_family="HOG000081811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Putative integral membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549658"
FT                   /db_xref="GeneID:8817993"
FT                   /translation="MHAILDFIVDILSQPAILVALIALIGLLVQKKSATAITTGTIKTM
FT                   LGFLILSAGAGVVSNSLEPFGKIFQHAFGVQGVVPNNEAIISLALKDYGTTAALIMVFG
FT                   MLINIVIARISNLKYIFLTGHHTFYMAAFLAILLTVGHIKGYLTVTIGAVLLGLLMSIL
FT                   PTLAQPTMRKITGNDQVALGHFGTISYWAAGEVGKLFKGKSKSTEEIKFPKGLSFLRES
FT                   TISISITMALLYLIACLFAGVGYVHDHISQGQNFIVFSVIQGVTFAAGVFIILTGVRLI
FT                   LAEIVPAFKGISEKLVPSSKPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFFTGG
FT                   IVILPGVVAHFFLGATSAVFGNARGGIKGAVAGAALNGILITFLPLLFIPFLGDLGLAT
FT                   TTFSDTDFLAVGIIFGNIVKYAGIIGSVIFIVILAAGAIFLKGKADKKYEQQQS"
FT                   /protein_id="YP_003470562.1"
FT   misc_feature    302334..303683
FT                   /note="PTS system sugar-specific permease component;
FT                   Region: EIIC-GAT; cl04451"
FT                   /db_xref="CDD:174821"
FT                   /locus_tag="SLGD_00287"
FT   misc_feature    302352..303683
FT                   /note="ascorbate-specific PTS system enzyme IIC; Reviewed;
FT                   Region: PRK12997"
FT                   /db_xref="CDD:171825"
FT                   /locus_tag="SLGD_00287"
FT   gene            complement(303757..304719)
FT                   /db_xref="GeneID:8817994"
FT                   /locus_tag="SLGD_00288"
FT   CDS_pept        complement(303757..304719)
FT                   /locus_tag="SLGD_00288"
FT                   /gene_family="HOG000034811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted sulfurtransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549659"
FT                   /db_xref="GeneID:8817994"
FT                   /translation="MDYNVLLYYKYTTIDDPETFAAEHLAFCKANNLKGRILVSTEGIN
FT                   GTLSGTKEDTENYMAHMHADERFADMTFKIDEAEGHAFKKMHVRPRNEIVALGLEDDVD
FT                   PRVTTGKYYSPSEFKKALEDDETIILDARNDYEFDLGHFRGAIRPDITRFRDLPNWIRE
FT                   NKDQLEGKNIVTYCTGGIRCEKFSGWLVKEGFENVGQLHGGIATYGKDPETKGAYWDGK
FT                   MYVFDERISVDINQIEKTVIGKEHFDGTPCERYINCANPECNKQILVSEENEAKYLGAC
FT                   SYDCAKHERNRYVAEHNISDEAWKHRLENFKDVPERAHA"
FT                   /protein_id="YP_003470563.1"
FT   misc_feature    complement(303793..304719)
FT                   /note="hypothetical protein; Provisional; Region: PRK00142"
FT                   /db_xref="CDD:166819"
FT                   /locus_tag="SLGD_00288"
FT   misc_feature    complement(304090..304392)
FT                   /note="Member of the Rhodanese Homology Domain superfamily.
FT                   This CD includes Escherichia coli YceA, Bacillus subtilis
FT                   YbfQ, and similar uncharacterized proteins; Region:
FT                   RHOD_YceA; cd01518"
FT                   /db_xref="CDD:29081"
FT                   /locus_tag="SLGD_00288"
FT   misc_feature    complement(304189..304191)
FT                   /note="active site residue"
FT                   /db_xref="CDD:29081"
FT                   /locus_tag="SLGD_00288"
FT   misc_feature    complement(303787..303870)
FT                   /note="Protein of unknown function (DUF3650); Region:
FT                   DUF3650; pfam12368"
FT                   /db_xref="CDD:152803"
FT                   /locus_tag="SLGD_00288"
FT   gene            304950..305927
FT                   /db_xref="GeneID:8817995"
FT                   /locus_tag="SLGD_00289"
FT   CDS_pept        304950..305927
FT                   /locus_tag="SLGD_00289"
FT                   /gene_family="HOG000280331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Lactonase Drp35"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549660"
FT                   /db_xref="GeneID:8817995"
FT                   /translation="MCEQALPTLKYIGASKSAVPIISEADLQTVTAEPWLKVSDDGLQL
FT                   EGLIFDQQGDLYLCEVFGGRVFKVDVAKKKLSTAFQAPKVNPAAVKIHKDGRLFTCYLG
FT                   DFKTTGGIFATDAHGQHFEDIISDIGNDYCIDDMVFDSKGGFYFTDFRGYSTQPQGGVY
FT                   YVSPDFQTVTPVIQNISVANGIALSTDEKILWVTETTTNRLHRIQLEDDGVTIAPFGAT
FT                   IPYYFTGHEGPDSCCIDSDDNLYVAMYGQGRVLVFNRRGYPIGQILMPGRDEGKMLRTT
FT                   HPQFIPGTNQLLICTNDIENNSESGSMIYTVNGFAKAHNSYQFQ"
FT                   /protein_id="YP_003470564.1"
FT   misc_feature    305016..305921
FT                   /note="Gluconolactonase [Carbohydrate transport and
FT                   metabolism]; Region: COG3386"
FT                   /db_xref="CDD:33193"
FT                   /locus_tag="SLGD_00289"
FT   misc_feature    <305424..305585
FT                   /note="Arylesterase; Region: Arylesterase; pfam01731"
FT                   /db_xref="CDD:145076"
FT                   /locus_tag="SLGD_00289"
FT   gene            306077..306643
FT                   /db_xref="GeneID:8817996"
FT                   /locus_tag="SLGD_00290"
FT   CDS_pept        306077..306643
FT                   /locus_tag="SLGD_00290"
FT                   /gene_family="HOG000220262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549661"
FT                   /db_xref="GeneID:8817996"
FT                   /translation="MNKIMAVTRGINHIGLTVPDIEQATTFFQTALDGKIAYDSQKLTD
FT                   EPRAGQFVERVLGIEKGAKIIKKRMMVFGHGPNIEMFEFKDASQASAITLQDMGYTHIS
FT                   FYVDDFPAALEKVKKAGGIPLSEPHANTRYEDTPGNQTVYIQTPWGSLLELQTVPQGFY
FT                   YPKDSEATLFTPEPIDLNQKDDTTP"
FT                   /protein_id="YP_003470565.1"
FT   misc_feature    306113..306541
FT                   /note="This domain superfamily is found in a variety of
FT                   structurally related metalloproteins, including the type I
FT                   extradiol dioxygenases, glyoxalase I and a group of
FT                   antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
FT                   cd06587"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="SLGD_00290"
FT   misc_feature    order(306113..306115,306125..306127,306215..306217,
FT                   306314..306316,306320..306322,306380..306382,
FT                   306506..306508,306530..306532,306536..306538)
FT                   /note="active site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="SLGD_00290"
FT   misc_feature    order(306113..306115,306380..306382,306536..306538)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:176657"
FT                   /locus_tag="SLGD_00290"
FT   gene            306657..307061
FT                   /db_xref="GeneID:8817997"
FT                   /locus_tag="SLGD_00291"
FT   CDS_pept        306657..307061
FT                   /locus_tag="SLGD_00291"
FT                   /gene_family="HOG000050458" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549662"
FT                   /db_xref="GeneID:8817997"
FT                   /translation="MELNAKMQINVEPDKAYEAFVDPAKIGRFWFSSSSERWETGKTIQ
FT                   LQYKEYDATTEIFIKETIPNEQIKFQWGTYQGEICFEPSAEGTIVSVREYPYHEQDVQM
FT                   MLDKTEGWVYMLTCLKSYLEFNAIIRGGLR"
FT                   /protein_id="YP_003470566.1"
FT   misc_feature    306684..307028
FT                   /note="Polyketide cyclase / dehydrase and lipid transport;
FT                   Region: Polyketide_cyc2; cl10449"
FT                   /db_xref="CDD:175214"
FT                   /locus_tag="SLGD_00291"
FT   gene            307184..308068
FT                   /db_xref="GeneID:8817998"
FT                   /locus_tag="SLGD_00292"
FT   CDS_pept        307184..308068
FT                   /product="Ribokinase"
FT                   /gene_family="HOG000235950" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00292"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="GI:289549663"
FT                   /db_xref="GeneID:8817998"
FT                   /translation="MKRIYVVGSMSMDLVVSTKRVSQKGETILGASFFTTPGGKGANQA
FT                   VAAARLGEQVYMVGRIGDDQLGEEIYENLQRNKVRVDYVKPVADSASGTAHITLCDNDN
FT                   SIIVVPSANNEVTSSYVSTALKHIKAGDIVLLQQEIPEDTVSEVITYCAEHDIITILNP
FT                   APYRDLTAEVIDQATYLTPNETESAAMFGTNIDAALEQFPNKLIVTLGHQGAVYHNGNI
FT                   KVMIPGFERQVVDTTGAGDTFNGAFAVGLQKGYDIDQALTFANLAASHAVTGMGAQGGM
FT                   PYFNDLVDEFDVK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470567.1"
FT   misc_feature    307184..308011
FT                   /note="6-phosphofructokinase 2; Provisional; Region:
FT                   PRK10294"
FT                   /db_xref="CDD:170354"
FT                   /locus_tag="SLGD_00292"
FT   misc_feature    307190..308032
FT                   /note="Ribokinase catalyses the phosphorylation of ribose
FT                   to ribose-5-phosphate using ATP. This reaction is the first
FT                   step in the ribose metabolism. It traps ribose within the
FT                   cell after uptake and also prepares the sugar for use in
FT                   the synthesis of...; Region: ribokinase; cd01174"
FT                   /db_xref="CDD:29358"
FT                   /locus_tag="SLGD_00292"
FT   misc_feature    order(307214..307216,307220..307222,307295..307303,
FT                   307310..307312,307466..307468,307472..307474,
FT                   307499..307501,307505..307507,307598..307600,
FT                   307892..307897,307904..307906,308012..308014)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:29358"
FT                   /locus_tag="SLGD_00292"
FT   misc_feature    order(307223..307225,307229..307231,307244..307264,
FT                   307301..307303,307463..307465,307469..307477,
FT                   307490..307513,307676..307678)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29358"
FT                   /locus_tag="SLGD_00292"
FT   misc_feature    order(307730..307732,307808..307816,307823..307825,
FT                   307862..307864,307880..307882,307889..307891,
FT                   307898..307903,307910..307912,307976..307978,
FT                   307985..307990,307997..307999)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29358"
FT                   /locus_tag="SLGD_00292"
FT   gene            complement(308158..308793)
FT                   /db_xref="GeneID:8817999"
FT                   /locus_tag="SLGD_00293"
FT   CDS_pept        complement(308158..308793)
FT                   /locus_tag="SLGD_00293"
FT                   /gene_family="HOG000095326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549664"
FT                   /db_xref="GeneID:8817999"
FT                   /translation="MKGLLLSSYYTSKKSLFTYLIVALASAIMFSFFNPIMTCFLAMIF
FT                   LISPVTDNIKHEKDSRWMYYVSTLPTGRATYVKSYFVYYGILILIGLIMGAGACFIVTQ
FT                   NINLTLISILVGIGGSGTYAIMFPLTFKFGPENSNVIMISTSFIVIGLFFFVFFGFVIP
FT                   SLSDNGSFDSVLSNLTTLWVLIIYGIIGCALLILSYIASLQIFKRQEL"
FT                   /protein_id="YP_003470568.1"
FT   gene            complement(308793..309635)
FT                   /db_xref="GeneID:8818000"
FT                   /locus_tag="SLGD_00294"
FT   CDS_pept        complement(308793..309635)
FT                   /locus_tag="SLGD_00294"
FT                   /codon_start="1"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549665"
FT                   /db_xref="GeneID:8818000"
FT                   /translation="MTQLLEVSNLNKSYTKSDFNLSDISLSIAPGEVLGLIGKNGSGKS
FT                   TLINTLVGNRFKDSGDIKFFGQSVTARNNQYKEHIGVVFDDLRVPNKLTLTDIDKVFTN
FT                   IYTTWDSNKFKSTLKDFDLPTSNAIKSFSRGMRMKAAIAIALAHDSQLLILDEATAGMD
FT                   VSGREEVMEILQDYVAKDYGIMISSHISEDIETLATKLVFMRDGKIVLHVDKSHLLSHY
FT                   GIVNVPLAEFNVSNDYIIASRKRNDRIEALIHDRNLVPEAEPLKSIDDATKIIMRGDK"
FT                   /protein_id="YP_003470569.1"
FT   misc_feature    complement(308970..309626)
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309009..309623)
FT                   /note="This family of ATP-binding proteins belongs to a
FT                   multisubunit transporter involved in drug resistance (BcrA
FT                   and DrrA), nodulation, lipid transport, and lantibiotic
FT                   immunity.  In bacteria and archaea, these transporters
FT                   usually include an ATP-binding...; Region:
FT                   ABC_DR_subfamily_A; cd03230"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309501..309524)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(order(309069..309071,309165..309170,
FT                   309381..309383,309498..309506,309510..309515))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309381..309392)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309213..309242)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309165..309182)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309147..309158)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   misc_feature    complement(309063..309083)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SLGD_00294"
FT   gene            complement(309694..310410)
FT                   /db_xref="GeneID:8818001"
FT                   /locus_tag="SLGD_00295"
FT   CDS_pept        complement(309694..310410)
FT                   /locus_tag="SLGD_00295"
FT                   /gene_family="HOG000279793" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549666"
FT                   /db_xref="GeneID:8818001"
FT                   /translation="MKVGRYIFFIIIGGIIGGLIGSNIERVGTFIASTNFSGSRLNLII
FT                   CVSTSLLILALMLYQWYVQQRSLKYKYMISNVDDGSDIDHYEKQATLDYNKVHIIAHLQ
FT                   LAIGFIAIFFIALGNAAPNEFFYALIPYLLTLIPSLMLGFYSRRFDARLPKIAEKHYTE
FT                   KALALLDDGERHIVLISMYKNYQVNIVLLIMAIVFIGIFSIYTGLNQTPGLLALIVIFI
FT                   YNSLGYLIKLRQFYKA"
FT                   /protein_id="YP_003470570.1"
FT   misc_feature    complement(309703..310341)
FT                   /note="Protein of unknown function (DUF3169); Region:
FT                   DUF3169; pfam11368"
FT                   /db_xref="CDD:151808"
FT                   /locus_tag="SLGD_00295"
FT   gene            complement(310407..310610)
FT                   /db_xref="GeneID:8818002"
FT                   /locus_tag="SLGD_00296"
FT   CDS_pept        complement(310407..310610)
FT                   /locus_tag="SLGD_00296"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, Cro/CI family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549667"
FT                   /db_xref="GeneID:8818002"
FT                   /translation="MRNRLKELRARDGYNQTQLAKKAGISRQTVSLIERNDFTPSILTA
FT                   MKIARIFGESVEDVFIIEEEDL"
FT                   /protein_id="YP_003470571.1"
FT   misc_feature    complement(310434..310604)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00296"
FT   misc_feature    complement(order(310506..310508,310581..310583,
FT                   310593..310595))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00296"
FT   misc_feature    complement(order(310509..310511,310584..310586))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00296"
FT   misc_feature    complement(order(310503..310508,310518..310520,
FT                   310527..310529,310560..310565))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="SLGD_00296"
FT   gene            311255..311626
FT                   /db_xref="GeneID:8818003"
FT                   /locus_tag="SLGD_00297"
FT   CDS_pept        311255..311626
FT                   /locus_tag="SLGD_00297"
FT                   /gene_family="HOG000247440" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549668"
FT                   /db_xref="GeneID:8818003"
FT                   /translation="MVTIKPHQIGSKNDNILSAIAYLSIFFAPVILPVVMWIMMEDTIK
FT                   YHAKYAFFNHIACLLCIFGIPGSGAFLFVSAMVVPEYIEIIQVIAPVIAFILFILLGIL
FT                   FVINIMRAVKLFMTIKVPR"
FT                   /protein_id="YP_003470572.1"
FT   gene            312798..313640
FT                   /db_xref="GeneID:8818004"
FT                   /locus_tag="SLGD_00298"
FT   CDS_pept        312798..313640
FT                   /locus_tag="SLGD_00298"
FT                   /gene_family="HOG000279809" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549669"
FT                   /db_xref="GeneID:8818004"
FT                   /translation="MKILLTGATGHLGTHITELAIKARIKDFNIGVRNLEKVPTHWKDN
FT                   VLIRQLDYFDVESMTQAFEHIDLVIFIPSIIHPSFKRLPEVENLVQAAQKAQVKQIFYI
FT                   GFYADQHNNPFHMSPYFAYAERLLASSRLNYTYIRMAMYMDPLKPYLPELVKMKKLIYP
FT                   VGDGRINYISRHDIAKGVIAILQQPEAWGGRYLLSGHSYSMPELATILSEAAGSTINYA
FT                   PVSLDTFASMYDEPKGFGALLASMYDAAARGLLDQHADDYQKLVNDTPQTFAQFLSQS"
FT                   /protein_id="YP_003470573.1"
FT   misc_feature    312798..313604
FT                   /note="Predicted nucleoside-diphosphate-sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG0702"
FT                   /db_xref="CDD:31046"
FT                   /locus_tag="SLGD_00298"
FT   misc_feature    312798..313364
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00298"
FT   gene            complement(313827..314186)
FT                   /db_xref="GeneID:8818005"
FT                   /locus_tag="SLGD_00299"
FT   CDS_pept        complement(313827..314186)
FT                   /locus_tag="SLGD_00299"
FT                   /gene_family="HOG000280320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549670"
FT                   /db_xref="GeneID:8818005"
FT                   /translation="MILRYVTNVKIAKELFEASKPKLKGDQEMKDTFSNVFGLDEKLVP
FT                   LVGGLEAASATLFSISFLNKNISRLASLTTIGVLGVAAYKHFEAGHGKAGAQHALDLLG
FT                   LATLSLLDTFDGKRR"
FT                   /protein_id="YP_003470574.1"
FT   gene            complement(314199..315251)
FT                   /db_xref="GeneID:8818006"
FT                   /locus_tag="SLGD_00300"
FT   CDS_pept        complement(314199..315251)
FT                   /locus_tag="SLGD_00300"
FT                   /gene_family="HOG000246934" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative N5,N10-methylenetetrahydromethanopterin
FT                   reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549671"
FT                   /db_xref="GeneID:8818006"
FT                   /translation="MKVELGLTSFADNSDIYMPDGKQEKISNAQRIRNIVEEIKLADQL
FT                   GLDIYGLGEHHREDYAVSDPVTVLAAAAATTSHIRLSSAVTVLSSDDPVRVYERFSTLD
FT                   AVSNGRAEIMIGRGSFIESFPLFGYNLNDYEDLFNEKLQLLLKINQQPVISWEGTLRPS
FT                   IDETGIYPRAEHGPIPISIATGGTPESSLRAGAFGLPITYAIIGGNPRRFKRHIEIYKS
FT                   VARSYGHNPEKLPIAVHSWGYIAETDEDARREFFPSLKAHQDVLGQERGWPEFDENAFE
FT                   REIGPQGAIYLGSPETVAQKIIETIETLGLSRFMIHTPVGSMPHENTMKSIRLFGERVK
FT                   PIVDKYFEDK"
FT                   /protein_id="YP_003470575.1"
FT   misc_feature    complement(<314493..315203)
FT                   /note="Flavin-utilizing monoxygenases; Region:
FT                   Flavin_utilizing_monoxygenases; cl07892"
FT                   /db_xref="CDD:174883"
FT                   /locus_tag="SLGD_00300"
FT   misc_feature    complement(314223..315155)
FT                   /note="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases [Energy production and
FT                   conversion]; Region: COG2141"
FT                   /db_xref="CDD:32324"
FT                   /locus_tag="SLGD_00300"
FT   gene            315897..317876
FT                   /db_xref="GeneID:8818007"
FT                   /locus_tag="SLGD_00301"
FT   CDS_pept        315897..317876
FT                   /locus_tag="SLGD_00301"
FT                   /gene_family="HOG000280313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Predicted cell-wall-anchored protein SasF (LPXAG
FT                   motif)"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549672"
FT                   /db_xref="GeneID:8818007"
FT                   /translation="MRLFKSSQGRQPFGTYIKLSCSALLISSVFVNYSSIENVHAETAE
FT                   NQSIDENHHKISQWISDAKQDINELNALNDSVRKQFEKQLDEATSRQEIKQIVADATDE
FT                   NQAREDGSEADNTSSQDTKHSAQSTTTTDITAELDKILADLNAVVDKDITDTPKASEAQ
FT                   RGTKDNEQYDSSKVQDKERQNDQKSTTVLDDLAHIKDHVKQADSAVTKDDKEQTEPNNK
FT                   ETKSNQQQTPTVKSHEKNEDQLKPQHRDANHSTRADKAIDSAASKQNTNSTHLMEKLDK
FT                   QLTPTEKIEAAVTKVQNDNHHNNKDYADKRLNQLATLKENVTNRVDIAQDKKKQIITDI
FT                   ERAANKTTANRQIIQNDLAQAEDKEAVVKDIVTTIFSPNEAQQILKNMSVKGKTDKEIA
FT                   DQLLQHIDKLALTSSDDILASMFDQTKDKSHLIETILGMKLSPEEAKKAAQRLTNAKLS
FT                   NKALVQQLKKEFGLNGKANADDILQSILDQSTNQKEAIKTILATKINEEKARLLADVIS
FT                   RVSKDKKDVLQLVKSALNGKADDLLQLKHRLDQAQHQADDILAPIKNRPSLLDRLHADA
FT                   QRHRSVLDQIDDIPNPTQGLSLGHINNQDNFLSGLFDDNGSLSLPASGQVLKTYWPVLA
FT                   IGMILIGGGLLLLARTRKQHNAKS"
FT                   /protein_id="YP_003470576.1"
FT   misc_feature    <316002..317312
FT                   /note="AAA ATPase containing von Willebrand factor type A
FT                   (vWA) domain [General function prediction only]; Region:
FT                   MDN1; COG5271"
FT                   /db_xref="CDD:34868"
FT                   /locus_tag="SLGD_00301"
FT   gene            complement(318382..320388)
FT                   /db_xref="GeneID:8818008"
FT                   /locus_tag="SLGD_00302"
FT   CDS_pept        complement(318382..320388)
FT                   /product="Peptidoglycan hydrolase, Autolysin2"
FT                   /gene_family="HOG000280311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00302"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="GI:289549673"
FT                   /db_xref="GeneID:8818008"
FT                   /translation="MSKQKIFIYLLSTTLIVPTFTSDIAHATELTNQSHNESNHASVDK
FT                   SDNDDTSDTNDEQTTKKQEKSAKTTKFKQYTRAKKASHDEDDLSIFNKLFSDDTLSSNY
FT                   LNPRGQQDSLSELLTAIFSSDSETTEHTAQDTSDDMEPAAEQQDKASTTDSTEQHSTTT
FT                   SEQNDQSAKDATTDDNKVSDALDELDNLDDASNHAQDTQRRHDSEASKDDDKETSSEEK
FT                   PHQEAPSHDTAQDKQNDSNKEATDSASDAVIDSILDEYSDNAKKTQQDYTQDKTSDKHK
FT                   QSNATTTTHQKYAHIDVKKDRETRHQIDNPQLPSKDSVSHATVPAQSFEEATKQANTRA
FT                   TSLFATMPQASDNASSTDDLSVVDSQQTRTFIKAIGTDAHQLGQENDIYASVMIAQAIL
FT                   ESDSGQSTLAKAPNFNLFGIKGAYKGESSEFNTLEATANNQLYSIQAAFRKYPNKKASL
FT                   EDYVQLIKEGIDGNATIYQPTWKSETSSYRDATAHLARTYATDPNYATKLNQLIKHYHL
FT                   TDFDHKKLPDLTHYNSSNPGMDNTGNDFKPFIDTNSTSPYPQGQCTWYVYKRMQQFDLA
FT                   IGGDLGDAHNWNNRAQSEGYHVDTTPKTHSAVVFEAGQAGASSYYGHVAFVERVNDDGS
FT                   IVISESNVKGLGIISYRTLDANTADQLSYISGK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470577.1"
FT   misc_feature    complement(318385..320388)
FT                   /note="N-acetylmuramoyl-L-alanine amidase; Validated;
FT                   Region: PRK08581"
FT                   /db_xref="CDD:169503"
FT                   /locus_tag="SLGD_00302"
FT   misc_feature    complement(318826..319326)
FT                   /note="Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosaminidase; Region: Glucosaminidase;
FT                   cl00743"
FT                   /db_xref="CDD:174371"
FT                   /locus_tag="SLGD_00302"
FT   misc_feature    complement(318394..318744)
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="SLGD_00302"
FT   gene            320697..323534
FT                   /db_xref="GeneID:8818009"
FT                   /locus_tag="SLGD_00303"
FT   CDS_pept        320697..323534
FT                   /locus_tag="SLGD_00303"
FT                   /gene_family="HOG000251183" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Phage infection protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549674"
FT                   /db_xref="GeneID:8818009"
FT                   /translation="MKNALKLFRFDLKRIAKTPAVWIIIAGLAILPSFYAWFNLWAMWD
FT                   PYSKTDHIKVAVVNEDQGDKVRNKEINVGNSIVNKLKKNGKFDWQFVSRAKADHEIKMG
FT                   KYTAGIYIPKEFSHEITGTLRKQPQKANVEYKVNQKNNAVAPKMTDTGSTVIVDEANKA
FT                   FDETVSKALLTEANKVGLKIEDEVPTINKIKNAVYAAKQSLPKINAIGDKILYLNDHQD
FT                   QLDQYADKFRGLGRYKGDIVSAQDKLNAVNASIPALNEKAKLVLALNAYMPNIERVLNV
FT                   ASNDVPQQFPKINRGVSLVNQGMNTAQSGLNDADRYLTIAKQRVGDYQEAAGRAQDANN
FT                   NINSRLQQGSVSQQSTQTSSNGVPYKVEQVSTSSYDVPQAGQIVSNNDVKSMNSALAEA
FT                   LLSLSKQADTQVEGNQSDLAALKNIAYGVIASDKPDEFKESLNHVSSRIEATTQYNRQF
FT                   IDTLKELEKSEHVDLSSQINKINNTNKQLNDLMRSVNQLSDALSNGSTGQAQAVDILRQ
FT                   LPNVNEQLKQFRSFIKQDLNQRLLDISNDITDVLNKGQQTLSTAQSKLTSIENVIEAGH
FT                   HILNNGQQTVSRIQSELPAIEQAYINAMQTAQAYFPTIKQNVAKAANFVRNDLPQLEQR
FT                   LANATATVNDNIPALFSRYDQLVGLLDKNQPQAKQALGNMAQFIEHKLPGIEKDLTKAD
FT                   KIFRQLDKDDAVDKVIDTLKNDLKKQADVIAHPISKKQIDIFPVKNYGSGMTPFYTALS
FT                   IWVGALLMVSLLSVDNKHQVLKGRLTTRQIYLGKAGLFLLLGVVQALIVTLGDLLILKA
FT                   SVESPILFVLIALFASLVFNTIVYTCVSLLGNPGKAIAIILLVLQIAGGGGTFPVVTAP
FT                   GFFQTISPYLPFTYAIDSLRETVGGIVPAILIPKLIILGLFGLGFLTIGLCLKPILDPM
FT                   MRKVTKKVNKSNVTE"
FT                   /protein_id="YP_003470578.1"
FT   misc_feature    320709..>322385
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1511"
FT                   /db_xref="CDD:31700"
FT                   /locus_tag="SLGD_00303"
FT   misc_feature    320727..321215
FT                   /note="YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm;
FT                   TIGR03061"
FT                   /db_xref="CDD:132105"
FT                   /locus_tag="SLGD_00303"
FT   misc_feature    321519..323393
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1511"
FT                   /db_xref="CDD:31700"
FT                   /locus_tag="SLGD_00303"
FT   misc_feature    <323043..323375
FT                   /note="ABC-2 type transporter; Region: ABC2_membrane;
FT                   cl11417"
FT                   /db_xref="CDD:164215"
FT                   /locus_tag="SLGD_00303"
FT   gene            complement(323597..324085)
FT                   /db_xref="GeneID:8818010"
FT                   /locus_tag="SLGD_00304"
FT   CDS_pept        complement(323597..324085)
FT                   /locus_tag="SLGD_00304"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549675"
FT                   /db_xref="GeneID:8818010"
FT                   /translation="MKKVLAAITILLLVVALGFSVFFAATTTHHSTSDQKDKVESTKKK
FT                   NDTHKDNSPEDDAQLDTPQSANNATTAPANNGQNVQQQAPQYHYQQQQPVKSQQSAEQQ
FT                   KSNETPKKNNNANSNHGNNAKSQQHSGQGSGGNDSDSNTTRSASHSSAASTTQSKTNH"
FT                   /protein_id="YP_003470579.1"
FT   gene            324426..324578
FT                   /db_xref="GeneID:8818011"
FT                   /locus_tag="SLGD_00305"
FT   CDS_pept        324426..324578
FT                   /locus_tag="SLGD_00305"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549676"
FT                   /db_xref="GeneID:8818011"
FT                   /translation="MKKVKDDTNRKDISLFVYKSTKKGLGVTCFVKHGKVVEVDMSDAR
FT                   FTTSK"
FT                   /protein_id="YP_003470580.1"
FT   gene            complement(324648..324932)
FT                   /db_xref="GeneID:8818012"
FT                   /locus_tag="SLGD_00306"
FT   CDS_pept        complement(324648..324932)
FT                   /locus_tag="SLGD_00306"
FT                   /gene_family="HOG000280136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549677"
FT                   /db_xref="GeneID:8818012"
FT                   /translation="MPEQYQQLRDYIEEQNKIDMPSLSEDQLTLINRNLTTKFVHQQLA
FT                   IISYWRSGYIHSISGYIKHLDTQQQYIVISNERGNETMNLDFNVLCNVE"
FT                   /protein_id="YP_003470581.1"
FT   misc_feature    complement(324654..324932)
FT                   /note="YolD-like protein; Region: YolD; pfam08863"
FT                   /db_xref="CDD:149808"
FT                   /locus_tag="SLGD_00306"
FT   gene            325117..326220
FT                   /db_xref="GeneID:8818013"
FT                   /locus_tag="SLGD_00307"
FT   CDS_pept        325117..326220
FT                   /locus_tag="SLGD_00307"
FT                   /gene_family="HOG000068240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tn554-related, transposase A"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549678"
FT                   /db_xref="GeneID:8818013"
FT                   /translation="MKIVNVNSNSGKNFMIIDSNLNPVEDVTYYLKYLESVDKSENTLK
FT                   TYAYCLKRYFMYLELIDKNHNDATFDDLVDFVMWLKSPQRYKKVIYKDRLLNSKSARTI
FT                   NLTITVVTNFYDYLFRTKKFNVDIAKSVLKESNRKSSYKSFLDHVNTNNLLFTNTLKVK
FT                   EPREKMKILSTSEIKELINASKNLRDKFMIQLLYETGLRIGELLSLYIDDIKYDLTNGH
FT                   QIILKTRKNKNGARLKSGERKIYISQSLIDLYDDYLYEVLDEVSTSSEFLFIKIRGKHV
FT                   GDPLDYNDVNSIFKRLRKKTGINVHPHLLRHTHATIFYNKSKNIKQVQERLGHSNIQTT
FT                   MNLYIHNDDQLIRENWEKVKDSFQIFE"
FT                   /protein_id="YP_003470582.1"
FT   misc_feature    325204..326190
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:166866"
FT                   /locus_tag="SLGD_00307"
FT   misc_feature    325204..325476
FT                   /note="Phage integrase, N-terminal SAM-like domain; Region:
FT                   Phage_integr_N; cl12235"
FT                   /db_xref="CDD:176623"
FT                   /locus_tag="SLGD_00307"
FT   misc_feature    325630..326190
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="SLGD_00307"
FT   misc_feature    order(325720..325725,325828..325830,326032..326040,
FT                   326146..326148)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="SLGD_00307"
FT   misc_feature    order(325720..325722,325828..325830,326038..326040,
FT                   326047..326049,326116..326118,326146..326148)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="SLGD_00307"
FT   misc_feature    order(325720..325722,326038..326040,326047..326049,
FT                   326116..326118,326146..326148)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="SLGD_00307"
FT   gene            326231..328303
FT                   /db_xref="GeneID:8818014"
FT                   /locus_tag="SLGD_00308"
FT   CDS_pept        326231..328303
FT                   /locus_tag="SLGD_00308"
FT                   /gene_family="HOG000262240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tn554-related, transposase B"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549679"
FT                   /db_xref="GeneID:8818014"
FT                   /translation="MNNSVQNTNEFFQSKFKKELCFLKSKSINSEGNITYTDIYSDYFY
FT                   KNDVWHVSNFKIFNQFHDDLKRYNGKRKNVFFNFKNKNLNLEFKYICLKFIVTEYWSLS
FT                   SLFNSGAVHINKIASFCNEIFPDLNSLLDYEFSSLEKEWIKWLENRNAPTWKRSKSVVF
FT                   GNYKVKAPLAASLKKFYRQFSKMVDDREEWDKDIWDIRNLEMYGLTYNKTLTGNYLNFK
FT                   SIGSFNIRNSVKRYLKQRLITGNLNFATGRVYVRVLSRFFNSIHNQEPNWNDLNNLERN
FT                   HMEVYIDSIFKYAKSKNVRSVKNFVREELKLVRRFLNDIIMEKYSIAPIEDIRFLFLPQ
FT                   DLPKHEKIEKNQIDYIPDFVLDQLFENINSLPEEIIPIIWIAFKTGLRISDVLTLKDNC
FT                   LTKINGKYSIVTDIAKTFVKGHRIPIDEQLADILAVLIASSKRQSTKDNNPNNYIFVIY
FT                   KGKRKGMPYTQHLVRSHLNYLAKTKNIIDEKGEIFHFKTHQFRHTYAVKLLNGGVDILT
FT                   IQELLAHASPEMTLRYAKLLDDTKRKAFESVIDQGAFTFDIDGKVKNIKHSSELSENAL
FT                   NSLWQEHKLNAMDNPYGTCHARLKGNCPYMEAPPCLTCNSGKPCKDLAIGFSNLDVEKY
FT                   ELLVKSTINSIEVAKNFNRDDMVEKHVNLLEKYEDILKNIKDGNVIFGRNNRMKT"
FT                   /protein_id="YP_003470583.1"
FT   misc_feature    326912..327829
FT                   /note="Site-specific recombinase XerD [DNA replication,
FT                   recombination, and repair]; Region: XerD; COG4974"
FT                   /db_xref="CDD:34580"
FT                   /locus_tag="SLGD_00308"
FT   misc_feature    327290..327865
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="SLGD_00308"
FT   misc_feature    order(327392..327397,327473..327475,327716..327724,
FT                   327827..327829)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="SLGD_00308"
FT   misc_feature    order(327392..327394,327473..327475,327722..327724,
FT                   327731..327733,327800..327802,327827..327829)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="SLGD_00308"
FT   misc_feature    order(327392..327394,327722..327724,327731..327733,
FT                   327800..327802,327827..327829)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="SLGD_00308"
FT   gene            328312..328677
FT                   /db_xref="GeneID:8818015"
FT                   /locus_tag="SLGD_00309"
FT   CDS_pept        328312..328677
FT                   /locus_tag="SLGD_00309"
FT                   /gene_family="HOG000262241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tn554-related, transposase C"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549680"
FT                   /db_xref="GeneID:8818015"
FT                   /translation="MGNYDRKNQMKEIHKRKKANTEIKVNSAIERLLKENIEINFNVVS
FT                   KYANVSKATLYNHKEIRNKIEELRKHNTQSNVIQAKNDGKNAIIESLKRKIKKLEKENK
FT                   ALKNEVNVLYNKMYENL"
FT                   /protein_id="YP_003470584.1"
FT   gene            complement(328779..329192)
FT                   /db_xref="GeneID:8818016"
FT                   /locus_tag="SLGD_00310"
FT   CDS_pept        complement(328779..329192)
FT                   /locus_tag="SLGD_00310"
FT                   /gene_family="HOG000280136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549681"
FT                   /db_xref="GeneID:8818016"
FT                   /translation="MLLNSNIPDEYKYETDYRKIPREYLNPKIPQGRGNIKWRAFATLP
FT                   EQYEILNEVMQSQNKIANPLLSDDALNQLDYIVNQKLQSNEPCTIEYWSNGDIKTYTGF
FT                   ILKFNVLEKSFSFFNTSNNKYYTLYREYINNIF"
FT                   /protein_id="YP_003470585.1"
FT   misc_feature    complement(328815..329063)
FT                   /note="YolD-like protein; Region: YolD; pfam08863"
FT                   /db_xref="CDD:149808"
FT                   /locus_tag="SLGD_00310"
FT   gene            329341..329532
FT                   /db_xref="GeneID:8818017"
FT                   /locus_tag="SLGD_00311"
FT   CDS_pept        329341..329532
FT                   /locus_tag="SLGD_00311"
FT                   /gene_family="HOG000050360" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549682"
FT                   /db_xref="GeneID:8818017"
FT                   /translation="MVNHAGTLSVDYFIGYLKLVMTSKDMCLNEAVAYMKSSFFKDNIE
FT                   TYGEITAHNFKQAVQELK"
FT                   /protein_id="YP_003470586.1"
FT   gene            329565..329885
FT                   /db_xref="GeneID:8818018"
FT                   /locus_tag="SLGD_00312"
FT   CDS_pept        329565..329885
FT                   /locus_tag="SLGD_00312"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Arsenical resistance operon repressor"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549683"
FT                   /db_xref="GeneID:8818018"
FT                   /translation="MEVIKVNPDVDEEEQLNFYEKMFEALADKIRLKILHSIRQSNTKS
FT                   LCVCDLEELLELKQSKLSYHLKKLVDANILIAEKHGTWNYYKINEQQIQVVLNEDTCCK
FT                   IS"
FT                   /protein_id="YP_003470587.1"
FT   misc_feature    329631..329834
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00312"
FT   misc_feature    order(329631..329636,329640..329642,329649..329651,
FT                   329658..329663,329670..329675,329682..329684,
FT                   329781..329783)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00312"
FT   misc_feature    order(329634..329639,329649..329657,329703..329711,
FT                   329736..329747,329751..329756,329763..329768,
FT                   329772..329777,329793..329801,329814..329822)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00312"
FT   misc_feature    order(329703..329705,329712..329714)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="SLGD_00312"
FT   gene            329973..330857
FT                   /db_xref="GeneID:8818019"
FT                   /locus_tag="SLGD_00313"
FT   CDS_pept        329973..330857
FT                   /locus_tag="SLGD_00313"
FT                   /gene_family="HOG000224670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549684"
FT                   /db_xref="GeneID:8818019"
FT                   /translation="MIDSIIEFIKTFLMLFFELLILFIIVSFIVSLIQQVVSEDKIKSM
FT                   LSKPNQGINYFFGMIFGAITPFCSCSTIPILAGLLNSKVPFGPAMSFLIASPLMNPLMV
FT                   FMLWVLLGWKVAIVYFIVLAIFSIFTGLVFSKMNLAESYKGVNVKGDGFFANKEGSRFK
FT                   QALNDAWAFLYPMLPYLFIGVFIGAFIYGFVPEAFITKYASGDGVISVFIGSVIGIPMY
FT                   IRPETMLPIAEALVSKGMSLGTVVALIIGGAGASIPEVVLLSKLFKKKFVVSFVIAILV
FT                   VAIATGLIVNTIV"
FT                   /protein_id="YP_003470588.1"
FT   misc_feature    330072..330854
FT                   /note="Predicted permease; Region: DUF318; cl00487"
FT                   /db_xref="CDD:119868"
FT                   /locus_tag="SLGD_00313"
FT   gene            330877..331932
FT                   /db_xref="GeneID:8818020"
FT                   /locus_tag="SLGD_00314"
FT   CDS_pept        330877..331932
FT                   /locus_tag="SLGD_00314"
FT                   /gene_family="HOG000229966" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549685"
FT                   /db_xref="GeneID:8818020"
FT                   /translation="MNQETSVINRYGNAAKKHEENLCCPVEYDTKYLKIIPDEIIEKDY
FT                   GCGDPLGKIKEGDTVLDLGSGGGKVPYIVSQIVGETGKVIGIDMNDDMLNLAKKYQNQM
FT                   IERIGYDNVIFHKGKIQNLKLDLEELDKYIQEHPANNLDTYQSIKQYINYLENEMTMIK
FT                   DNSIDVVISNCVLNLVSTDEKEALFREIYRVLKDGGKAVISDIVSNVEVPEKLRQDENL
FT                   WSGCYSGAIEEKSFVEAFEKVGFYGVEIDKREKTWTTIEGIDFRSMTIIAHKGKEGPCI
FT                   DKGQSVIYKGPFKHIEDDDDHIFERGERTFVCEKTFNILKQEPYKDVFEFIDENEEIIN
FT                   KSECCDTSCGC"
FT                   /protein_id="YP_003470589.1"
FT   misc_feature    331051..331497
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="SLGD_00314"
FT   misc_feature    order(331063..331083,331138..331143,331228..331230,
FT                   331252..331257,331393..331395)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="SLGD_00314"
FT   misc_feature    <331366..331746
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="SLGD_00314"
FT   gene            331957..332100
FT                   /db_xref="GeneID:8818021"
FT                   /locus_tag="SLGD_00315"
FT   CDS_pept        331957..332100
FT                   /locus_tag="SLGD_00315"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549686"
FT                   /db_xref="GeneID:8818021"
FT                   /translation="MEKNAFKKAISKLKPKEQACCSVEIEEKKEKIEENKEKNQHKNDG
FT                   CC"
FT                   /protein_id="YP_003470590.1"
FT   gene            complement(332215..332343)
FT                   /db_xref="GeneID:8818022"
FT                   /locus_tag="SLGD_00316"
FT   CDS_pept        complement(332215..332343)
FT                   /locus_tag="SLGD_00316"
FT                   /gene_family="HOG000137981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549687"
FT                   /db_xref="GeneID:8818022"
FT                   /translation="MIPKQYRHETDYRKIPREYLDSNIPQGRGIVKWAPFVICTNL"
FT                   /protein_id="YP_003470591.1"
FT   gene            332517..333755
FT                   /db_xref="GeneID:8818023"
FT                   /locus_tag="SLGD_00317"
FT   CDS_pept        332517..333755
FT                   /product="Arginine deiminase"
FT                   /gene_family="HOG000284535" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00317"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="GI:289549688"
FT                   /db_xref="GeneID:8818023"
FT                   /translation="MSHGPIQVNSEIGTLKTVLLKRPGKELENLIPDHLSGLLFDDIPY
FT                   LKVAQEEHDHFAQTLRDEGVEVLYLEQLAAEAIVEPNVRAQFIEEVLTECPETILGHEQ
FT                   EIKAYFATLTNEELIEKIMSGVRKEEIKLKSIHLVEYIDDLYPFYLDPMPNLYFTRDPQ
FT                   ASIGHGMTVNHMYFGARRRESIFMSYILKYHPRFKDEDIPVWLDRQTPFNIEGGDELVL
FT                   SKEVLAIGISERTSAQAIERLARQVLFNADATFTKVLAIEIPNSRTFMHLDTVFTMIDY
FT                   DKFTMHAAIFKKEQNMNIFTIEQNTQGDDIQITRSSDLKATLEQALGIEEIEFIPTGNG
FT                   DIIDGAREQWNDGSNTLCIRPGVVITYNRNYVSNQLLREKGIKVIEIRGSELVRGRGGP
FT                   RCMSQPLYREEID"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470592.1"
FT   misc_feature    332517..333749
FT                   /note="Amidinotransferase; Region: Amidinotransf; cl12043"
FT                   /db_xref="CDD:175395"
FT                   /locus_tag="SLGD_00317"
FT   misc_feature    332529..333749
FT                   /note="Arginine deiminase [Amino acid transport and
FT                   metabolism]; Region: ArcA; COG2235"
FT                   /db_xref="CDD:32416"
FT                   /locus_tag="SLGD_00317"
FT   gene            334038..334811
FT                   /db_xref="GeneID:8818024"
FT                   /locus_tag="SLGD_00318"
FT   CDS_pept        334038..334811
FT                   /locus_tag="SLGD_00318"
FT                   /gene_family="HOG000070117" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tributyrin esterase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549689"
FT                   /db_xref="GeneID:8818024"
FT                   /translation="MNIKMAYITLNYQSPTIGMNQNLTVILPEDTSFFKSDGIAKPLKT
FT                   VMLLHGLSSDATSYMRFTSIERYAESHQLAIIMPNADHSAYANMAYGHRYYDYILEVYH
FT                   YVHQIFPLSTRREDNFIAGHSMGGYGTMKFALTQSHLFSKAAPMSAVFQAQTLIDLEWT
FT                   DYHPQAITGEHTNVKGTNLDTYHLVDAAVAREETLPELFIQCGTEDFLYQDNLTFIDYL
FT                   ADKQIPYRFEPSPGDHDYTYWDKSIARALAWFVND"
FT                   /protein_id="YP_003470593.1"
FT   misc_feature    334038..334808
FT                   /note="Predicted esterase [General function prediction
FT                   only]; Region: COG0627"
FT                   /db_xref="CDD:30972"
FT                   /locus_tag="SLGD_00318"
FT   misc_feature    334071..>334487
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00318"
FT   misc_feature    <334278..334781
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00318"
FT   gene            335181..336320
FT                   /db_xref="GeneID:8818025"
FT                   /locus_tag="SLGD_00319"
FT   CDS_pept        335181..336320
FT                   /locus_tag="SLGD_00319"
FT                   /gene_family="HOG000134272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549690"
FT                   /db_xref="GeneID:8818025"
FT                   /translation="MQKYRIVCVIALVLMLIMSYLTLTTKVNASASVVAVGDNLIHPVV
FT                   YNDAKVGSNKYDFKPMYKHVKSNIQQADFAYVNQESPIGGDDKPYSGFKQFNTPSDVTK
FT                   AIVDSGFNIINGANNHSLDQGDSGVTNHINAWKPYRHDVLFSGVFKSQKESEAVHTITR
FT                   NGITVSLLCYTYGTNGQISQYPYTVKTFDEATIKKDVRKAKEHSDAVIVSAHWGNENHT
FT                   MPNEKQQKYAQLFADEGVDVVLGMHPHVIQPVKWVKGKNQHQTLVAYSLGNFLNGQYTS
FT                   TEWNQLLGRLNFNLEKTSKGVTVNNVKWRSMVNHYEQSKPMDKRTRKHFVLYNLHDYTP
FT                   ALAEKHALRQNIQSQWDIPHLQQMTKSIIDDEFLDAQSI"
FT                   /protein_id="YP_003470594.1"
FT   misc_feature    335274..336014
FT                   /note="Bacterial capsule synthesis protein PGA_cap; Region:
FT                   PGA_cap; smart00854"
FT                   /db_xref="CDD:129087"
FT                   /locus_tag="SLGD_00319"
FT   misc_feature    335277..336008
FT                   /note="CapA and related proteins, metallophosphatase
FT                   domain; Region: MPP_CapA; cd07381"
FT                   /db_xref="CDD:163624"
FT                   /locus_tag="SLGD_00319"
FT   misc_feature    order(335292..335294,335298..335300,335418..335420,
FT                   335535..335540,335823..335825,335919..335921,
FT                   335925..335927)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:163624"
FT                   /locus_tag="SLGD_00319"
FT   misc_feature    order(335292..335294,335298..335300,335418..335420,
FT                   335535..335537,335823..335825,335919..335921,
FT                   335925..335927)
FT                   /note="putative metal binding site; other site"
FT                   /db_xref="CDD:163624"
FT                   /locus_tag="SLGD_00319"
FT   gene            336495..337337
FT                   /db_xref="GeneID:8818026"
FT                   /locus_tag="SLGD_00320"
FT   CDS_pept        336495..337337
FT                   /locus_tag="SLGD_00320"
FT                   /gene_family="HOG000012004" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549691"
FT                   /db_xref="GeneID:8818026"
FT                   /translation="MSPQKAKQRTNNKKIFLFVMILITIICVCLAIFYHRTTAELHHGV
FT                   FNRGELAQLAPDKVPVPDVRRPDYFKSMTQLFAHTKEGRDWKKEVIHTKSDAIIIAPHG
FT                   GNIEKGTTELSRLVARKNHYNFYSFIALRHHAERLHVTSAHYNDPQLLKMLQKQEYAVA
FT                   IHGAKGNHPIVYIGGLDTPLKLAIQKQLIKSHFVVKPAPTYLGGELTGNFVNKDLKHAG
FT                   VQLELTTALRKSFFVNDNFNHIAKDKHQDFTKRMYVFADAIDRAIDEIEHKKSTSDSD"
FT                   /protein_id="YP_003470595.1"
FT   misc_feature    336702..337283
FT                   /note="Protein of unknown function (DUF867); Region:
FT                   DUF867; cl01713"
FT                   /db_xref="CDD:154548"
FT                   /locus_tag="SLGD_00320"
FT   gene            complement(337369..337995)
FT                   /db_xref="GeneID:8818027"
FT                   /locus_tag="SLGD_00321"
FT   CDS_pept        complement(337369..337995)
FT                   /locus_tag="SLGD_00321"
FT                   /gene_family="HOG000247892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549692"
FT                   /db_xref="GeneID:8818027"
FT                   /translation="MSKLLYITAHPLDELASNSMAAGKAFLNAYKEQHAQDEIVHIDLF
FT                   NTYIPLIDKDVLTGWGKAANGETLNGDEKEKIERLAEILDEFLSADKYVFVSPMWNLSF
FT                   PPVLKAYIDAITVAGKTFKYTAEGPQGLLTDKKVLHIQSRGGYYSEGPAAEMESGDRYL
FT                   KTIMTFLGVPSYENVIIEGHNAEPEKTEEIKAASLAKATEVAKNF"
FT                   /protein_id="YP_003470596.1"
FT   misc_feature    complement(337372..337995)
FT                   /note="hypothetical protein; Provisional; Region: PRK09739"
FT                   /db_xref="CDD:170077"
FT                   /locus_tag="SLGD_00321"
FT   misc_feature    complement(337378..337995)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="SLGD_00321"
FT   gene            338206..338340
FT                   /db_xref="GeneID:8818028"
FT                   /locus_tag="SLGD_00322"
FT   CDS_pept        338206..338340
FT                   /locus_tag="SLGD_00322"
FT                   /gene_family="HOG000134744" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549693"
FT                   /db_xref="GeneID:8818028"
FT                   /translation="MNFDLPKGVTRMKGLFITIILGAVGFVAFKKYQEKVNKMPNIEY"
FT                   /protein_id="YP_003470597.1"
FT   misc_feature    338239..338337
FT                   /note="Protein of unknown function (DUF2648); Region:
FT                   DUF2648; pfam10855"
FT                   /db_xref="CDD:151304"
FT                   /locus_tag="SLGD_00322"
FT   gene            338607..339269
FT                   /db_xref="GeneID:8818029"
FT                   /locus_tag="SLGD_00323"
FT   CDS_pept        338607..339269
FT                   /locus_tag="SLGD_00323"
FT                   /gene_family="HOG000056186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="capsular polysaccharide synthesis enzyme CapA"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549694"
FT                   /db_xref="GeneID:8818029"
FT                   /translation="MEKTLDLSMFITALKKNWKLFILIPVVFVVISLLITIFLMKPKYE
FT                   ANTQVLVNQKESNEQYRAQEVQSNIQLVNTYSEILKSPRILEDVAKKDKNLSASEIGNM
FT                   LTVTKQADSQILNVSVENHSKADAERIANEIVSVFSKDMPKIMDIDNVSILSKADGTAS
FT                   KVSPNLSQNLAIGLVLGLVLTIVIIIFKELFDRRIKTEEDVIRELDIPVLGSIHKLK"
FT                   /protein_id="YP_003470598.1"
FT   misc_feature    338607..339263
FT                   /note="Chain length determinant protein; Region: Wzz;
FT                   cl01623"
FT                   /db_xref="CDD:174654"
FT                   /locus_tag="SLGD_00323"
FT   gene            339281..339976
FT                   /db_xref="GeneID:8818030"
FT                   /locus_tag="SLGD_00324"
FT   CDS_pept        339281..339976
FT                   /product="Putative tyrosine-protein kinase capB"
FT                   /gene_family="HOG000004334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00324"
FT                   /EC_number="2.7.10.2"
FT                   /db_xref="GI:289549695"
FT                   /db_xref="GeneID:8818030"
FT                   /translation="MTKKNEKRKNLNTPLFTEDNSKSIVSEKVRGIRSNIMFSGVEEVQ
FT                   SIIVTSEKPAAGKSIISANIAITYAQAGYKTLIIDGDMRKPTQHYHFETTNYDGLSNLI
FT                   IGKSNFDKSIIKTRVKNLDLMTAGPTPPNPSELIGSAAFENILRDLNEIYDFILIDTPP
FT                   VISVTDAQVYLRYVPECVMIIDVQNNNKNEVKKAKELIEKVGGRVIGAVLNKTPKEKSS
FT                   SYYYYGDDE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470599.1"
FT   misc_feature    339359..339964
FT                   /note="capsular exopolysaccharide family; Region: eps_fam;
FT                   TIGR01007"
FT                   /db_xref="CDD:130080"
FT                   /locus_tag="SLGD_00324"
FT   misc_feature    339419..>339940
FT                   /note="Ras-like GTPase superfamily. The Ras-like
FT                   superfamily of small GTPases consists of several families
FT                   with an extremely high degree of structural and functional
FT                   similarity. The Ras superfamily is divided into at least
FT                   four families in eukaryotes: the Ras; Region:
FT                   Ras_like_GTPase; cl10444"
FT                   /db_xref="CDD:175213"
FT                   /locus_tag="SLGD_00324"
FT   gene            339977..340744
FT                   /db_xref="GeneID:8818031"
FT                   /locus_tag="SLGD_00325"
FT   CDS_pept        339977..340744
FT                   /product="Capsular polysaccharide synthesis enzyme Cap5C;
FT                   /gene_family="HOG000007624" [ FAMILY / ALN / TREE ]
FT                   Manganese-dependent protein-tyrosine phosphatase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00325"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="GI:289549696"
FT                   /db_xref="GeneID:8818031"
FT                   /translation="MIDIHNHILINVDDGPKTKEDAITLLTQAKNEGVTEIVATPHHLS
FT                   PQYDNSYSQVKESLEQLLDMDEVKDLGIKLYPGQEIRITDQILSLLQKGDAIGLNNSNY
FT                   LLIELPSNSVPHYTKRLFFDLQSNGYIPIIAHPERNKVITQDLDVLYELINSGAFSQLT
FT                   SASLMGKLGKKVQKLSIQMIENNLSHFIASDAHHVTQRPFIMNSLFSNKNLQKYEENIK
FT                   NFMNNAKSVIKNENIVKKQPLQEYKHKKLFGLF"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470600.1"
FT   misc_feature    339977..340741
FT                   /note="Capsular polysaccharide biosynthesis protein
FT                   [Carbohydrate transport and metabolism / Cell envelope
FT                   biogenesis, outer membrane]; Region: CapC; COG4464"
FT                   /db_xref="CDD:34142"
FT                   /locus_tag="SLGD_00325"
FT   gene            340779..342578
FT                   /db_xref="GeneID:8818032"
FT                   /locus_tag="SLGD_00326"
FT   CDS_pept        340779..342578
FT                   /locus_tag="SLGD_00326"
FT                   /gene_family="HOG000257078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap8D"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549697"
FT                   /db_xref="GeneID:8818032"
FT                   /translation="MNKLNARVRLFALIIIDSLIVAFSVFICYNILEPFFKGYANKILI
FT                   LTSILLLIAHHVFAYIFNLYHRAWEYASVNELLIIVESVTCSILATVILVPVFTGHPPF
FT                   FRLYLITWMMVLILIGGSRISWRVTRKFVVGKHQKKKPTLIVGAGRGGSLLIRQMLRSP
FT                   EMGLEPVLAVDDDPQKRKLTIADGVKVQGTIDDIPNLVNKFRIKRIIIAIPTLKPNRLK
FT                   EINDICNSTGIELFKMPSIEQVLVGELEVNQLKRVEVEDLLGREPVELDMAMISKELTH
FT                   KTIMVTGAGGSIGSEICRQVCKFEPDCILLLGHGENSIYLIHQELNAIYKDKIRIIPII
FT                   ADVQNPERIQDVMNRYKPYAVYHAAAHKHVPLMEYNPIEAFRNNVLGTRNVAIAAKTAG
FT                   VRKFVMISTDKAVNPPNVMGASKRLAEMVVQSLNEENSKTDFVAVRFGNVLGSRGSVIP
FT                   LFKKQIEAGGPVTVTHPDMTRYFMTIPEASRLVLQAGALAQGGEIFVLDMGEPVKIVDL
FT                   AKNLIRLSGKSEDDIQIKFTGIRPGEKMYEELLNENEIHPEQVYEKIYRGKVRNFSKDE
FT                   VEAIINDLVKDFKKEKIIKIAND"
FT                   /protein_id="YP_003470601.1"
FT   misc_feature    340812..342572
FT                   /note="Predicted nucleoside-diphosphate sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG1086"
FT                   /db_xref="CDD:31283"
FT                   /locus_tag="SLGD_00326"
FT   gene            342589..343611
FT                   /db_xref="GeneID:8818033"
FT                   /locus_tag="SLGD_00327"
FT   CDS_pept        342589..343611
FT                   /locus_tag="SLGD_00327"
FT                   /gene_family="HOG000257079" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap8E"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549698"
FT                   /db_xref="GeneID:8818033"
FT                   /translation="MFKDKVLLITGGTGSFGNAVMERFLDTDIKEIRVFSRDEKKQDDM
FT                   RKKYNNAKLKFYIGDVRDSHSVETAMRDVDYVFHAAALKQVPSCEFFPMEAVKTNIIGT
FT                   ENVLQNAIRNKVKKVICLSTDKAAYPINAMGISKAMMEKVFVSKSRNVDGEQSLICGTR
FT                   YGNVMASRGSVIPLFIEKIKTGEPLTITDPNMTRFLMSLEEAVELVVHAFKYAKTGDIM
FT                   VQKAPSSTVGDLAEALLQLFEADNEIKIIGTRHGEKKAETLLTREEYAQCEDMGDYFRI
FT                   PADSRDLNYSNYYEDGNKEITEAYEYNSDNTNILTVEEIKEKLLSLEYVRTELSNYKQG
FT                   "
FT                   /protein_id="YP_003470602.1"
FT   misc_feature    342595..>343005
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00327"
FT   misc_feature    342607..343437
FT                   /note="Polysaccharide biosynthesis protein; Region:
FT                   Polysacc_synt_2; pfam02719"
FT                   /db_xref="CDD:145720"
FT                   /locus_tag="SLGD_00327"
FT   misc_feature    343438..343581
FT                   /note="Polysaccharide biosynthesis protein C-terminal;
FT                   Region: Polysacc_syn_2C; pfam08485"
FT                   /db_xref="CDD:149510"
FT                   /locus_tag="SLGD_00327"
FT   gene            343623..344732
FT                   /db_xref="GeneID:8818034"
FT                   /locus_tag="SLGD_00328"
FT   CDS_pept        343623..344732
FT                   /locus_tag="SLGD_00328"
FT                   /gene_family="HOG000229727" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="capsular polysaccharide synthesis enzyme CapF"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549699"
FT                   /db_xref="GeneID:8818034"
FT                   /translation="MKIVITGSNGFVGKNLKADLKATTDNDILEINRQTDAEDVKKYLL
FT                   EADSVVHLAGINRPQNEVEFKEGNVDFLKEVLDILKDNPKKPDIILSSSVQAENDNPYG
FT                   NSKRQGEAVLEQFSKDNGNNVLIYRLPNLFGKWCKPNYNSVIATFCYKIARDEEIQVND
FT                   KNVILKLNYIDDVVKEFENAINGKPNIENGEPKVANVYEVKLGKIAELLFQYKEIPNDK
FT                   ALPNTEDPFERALYSTFLSYLPKEDFSYPLKMNVDHRGSFTEVFKTKDRGQVSVNISKP
FT                   GIVKGNHWHHTKNEKFLVVSGQGVIRFRKVDDDDVIEYYVSGDKLEVVDIPVGYTHNIE
FT                   NLGDTDMVTIMWVNEIFDPNNPDTYFLEV"
FT                   /protein_id="YP_003470603.1"
FT   misc_feature    343623..344345
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="SLGD_00328"
FT   misc_feature    344373..344717
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="SLGD_00328"
FT   gene            344737..345864
FT                   /db_xref="GeneID:8818035"
FT                   /locus_tag="SLGD_00329"
FT   CDS_pept        344737..345864
FT                   /product="Capsular polysaccharide synthesis enzyme Cap5G;
FT                   /gene_family="HOG000076047" [ FAMILY / ALN / TREE ]
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00329"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="GI:289549700"
FT                   /db_xref="GeneID:8818035"
FT                   /translation="MKKLKLMTIVGTRPEIIRLSATIKACDKYFNQVLVHTGQNYDYTL
FT                   NQVFFEDLELREPDYYLEAVGNHLGETMGNILAKSYEVLAKERPDALLILGDTNSCLAA
FT                   VSAKRLKIPVFHMEAGNRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFPKQ
FT                   NIFVTGSPMKEVLEEYLYKIEESDILTKLELEPQNYILVSAHREENIDNEANFLSLMNA
FT                   INDIAENYQIPVIYSTHPRSWKKIEEREFKFHPLVRQLKPFGFFDYNALQKNAFVVLSD
FT                   SGTLSEESSILKFPGVLIRTSTERPEVLDKGTVIVGGIAFNNLVQSVELAKAMEENNEP
FT                   MIDAIDYKDTNVSTKVVKIIQSYKDIINRNTWRKL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470604.1"
FT   misc_feature    344737..345858
FT                   /note="UDP-N-acetylglucosamine 2-epimerase [Cell envelope
FT                   biogenesis, outer membrane]; Region: WecB; COG0381"
FT                   /db_xref="CDD:30730"
FT                   /locus_tag="SLGD_00329"
FT   misc_feature    344749..345819
FT                   /note="Bacterial members of the UDP-N-Acetylglucosamine
FT                   (GlcNAc) 2-Epimerase  family are known to catalyze the
FT                   reversible interconversion of UDP-GlcNAc and
FT                   UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
FT                   produce an activated form of ManNAc residues...; Region:
FT                   GT1_UDP-GlcNAc_2-Epimerase; cd03786"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="SLGD_00329"
FT   misc_feature    order(344773..344775,345523..345525,345529..345531,
FT                   345538..345540,345586..345588,345598..345600)
FT                   /note="active site"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="SLGD_00329"
FT   misc_feature    order(344947..344949,344953..344958,344977..344979,
FT                   345058..345063,345067..345069,345073..345075,
FT                   345124..345126,345136..345138,345205..345207)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="SLGD_00329"
FT   gene            345861..346484
FT                   /db_xref="GeneID:8818036"
FT                   /locus_tag="SLGD_00330"
FT   CDS_pept        345861..346484
FT                   /locus_tag="SLGD_00330"
FT                   /gene_family="HOG000049433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap5H;
FT                   O-acetyl transferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549701"
FT                   /db_xref="GeneID:8818036"
FT                   /translation="MINKLMGLLKSSSSKEKNVKINRLAYVTNSTFKGNNYVDRFCKIR
FT                   NSTIGKYSYIGFGSDFNHVEIGNYCSISSDVKMGLGKHPLEFFSSSPIFYSNNNPFGIK
FT                   EAYFKFDDSPNKTIVGHDVWIGANVIVLDGIQIGNGAVIAAGAIVTRNVEPYEIVGGVP
FT                   AKTIKKRFDDETINKLLESKWWLMSPNELKSKNFSLTNLKVSRE"
FT                   /protein_id="YP_003470605.1"
FT   misc_feature    345996..346415
FT                   /note="Xenobiotic acyltransferase (XAT): The XAT class of
FT                   hexapeptide acyltransferases is composed of a large number
FT                   of microbial enzymes that catalyze the CoA-dependent
FT                   acetylation of a variety of hydroxyl-bearing acceptors such
FT                   as chloramphenicol and...; Region: LbH_XAT; cd03349"
FT                   /db_xref="CDD:100040"
FT                   /locus_tag="SLGD_00330"
FT   misc_feature    order(346014..346016,346020..346022,346071..346073,
FT                   346107..346112,346125..346127,346131..346133,
FT                   346140..346142,346224..346226,346230..346232,
FT                   346239..346241,346296..346298,346344..346346,
FT                   346368..346370)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:100040"
FT                   /locus_tag="SLGD_00330"
FT   misc_feature    order(346020..346022,346026..346028,346104..346109,
FT                   346113..346115,346143..346148,346230..346232,
FT                   346239..346241,346290..346295,346308..346310,
FT                   346332..346334,346338..346343,346347..346349,
FT                   346359..346361)
FT                   /note="active site"
FT                   /db_xref="CDD:100040"
FT                   /locus_tag="SLGD_00330"
FT   misc_feature    order(346020..346022,346026..346028,346104..346106,
FT                   346143..346148)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:100040"
FT                   /locus_tag="SLGD_00330"
FT   misc_feature    order(346107..346109,346113..346115,346197..346199,
FT                   346230..346232,346239..346241,346254..346256,
FT                   346290..346295,346308..346310,346332..346334,
FT                   346338..346343,346347..346349,346359..346361)
FT                   /note="CoA binding site; other site"
FT                   /db_xref="CDD:100040"
FT                   /locus_tag="SLGD_00330"
FT   gene            346495..347610
FT                   /db_xref="GeneID:8818037"
FT                   /locus_tag="SLGD_00331"
FT   CDS_pept        346495..347610
FT                   /locus_tag="SLGD_00331"
FT                   /gene_family="HOG000279721" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap5I"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549702"
FT                   /db_xref="GeneID:8818037"
FT                   /translation="MKILNIVSSNIVQDPRILKQMETIKGITNTHLMIGMNNKNVTKER
FT                   LDKLDFQYKLFGEKSEITSIFSKLLKRINFTKNVIKQIKKYQPDVIHANDFDVLLMVYL
FT                   SGYKNANIIFDAHEIYAKNAFINKYAMISKIVEIIEKHIVAKRVDAFVTVSHAAKSYYL
FT                   KKGYKKTPHVITNAPILDETIKSSDNNNDIKEVIYQGQIVSNRGYEEFVKAAAIQDNTK
FT                   VNYVIRGFGPQEDEIKKLINSEAANVRLDKPVEMKDLVKKLTESDIGVVLTKPVSINYE
FT                   YTVSNKIFECIHAGLPVILSPVKEHYYLNDKYNFGIVIDDVTPEKIAEAVNKLATDDKL
FT                   YHELRQNAIKASKILSWQNESEKLKELYLNI"
FT                   /protein_id="YP_003470606.1"
FT   misc_feature    346609..347586
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:176609"
FT                   /locus_tag="SLGD_00331"
FT   gene            347627..348808
FT                   /db_xref="GeneID:8818038"
FT                   /locus_tag="SLGD_00332"
FT   CDS_pept        347627..348808
FT                   /locus_tag="SLGD_00332"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap5K"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549703"
FT                   /db_xref="GeneID:8818038"
FT                   /translation="MNKSKDFIFSILSNVILMILLQLVLLPIYAKIHTPQEFGAFILLL
FT                   TLVNIISPILGNTLNNIRLINKTNFNLIESEYLCLVIIGSFIVMIITMIYSFVNVFSLM
FT                   DTIFSGLWAAFLLIRSYLFVYYRLDFRFKSLLYISIAVSFVMLIGGVSMYFMHVSIFIV
FT                   LFASEFIMTILMIIDYRRKFENFRLKFLNNEDFKNYIELIGANSVLNLINYSDRILLNL
FT                   FLGTIYVPLFFVATTIGKISNLLINPIVTVLLSYEVDSKGQDTIENVKKVFKIIMVVSI
FT                   MMSIVISIVSWVFIYVFYNEYISKVQALIFLANLGVILMSSTAVLQIKLVANSQFRNNL
FT                   MINVMTLIIIVLFSAILVQFFNVYGYAIALIISAMYKHFAIYHKVMKIIPNKG"
FT                   /protein_id="YP_003470607.1"
FT   misc_feature    347705..348388
FT                   /note="Polysaccharide biosynthesis protein; Region:
FT                   Polysacc_synt; cl10513"
FT                   /db_xref="CDD:175223"
FT                   /locus_tag="SLGD_00332"
FT   gene            348814..350076
FT                   /db_xref="GeneID:8818039"
FT                   /locus_tag="SLGD_00333"
FT   CDS_pept        348814..350076
FT                   /locus_tag="SLGD_00333"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549704"
FT                   /db_xref="GeneID:8818039"
FT                   /translation="MTIFLFVIISAVYAVFLLRSNFRFISLLFLAVFSISFLLPVIVDK
FT                   PFNYQVYLDAGGYSYTNKLYLLALIVFVISNIIVHFMNIKFKVRNVLIMKKENINNIYP
FT                   IYIVATIIVIMLTGLNIITSGSTSTLESSSIVKMLQGSVLMGYLYLSYLYLFNSKNMND
FT                   RIKSLILVLISVALVAIFIFGRRILIYPTIAIVVLYIYKRGKTPSLVKLSTIALGIILI
FT                   ILPLMMSIRTLGIKKGFVNFKDILFGDYNKYLDYLALGTDVTYSYSLASILTNYHVHIS
FT                   ILTLFKPLFIFIPRSIWPNKPGALSEEIVKQLNLPFDKGMSIPPGFVGESYLYLGVFGI
FT                   ILASVIFGVFCGLADQYSLSLRATKDGCHSINLILITIISIQLIMGSVRGDTATNIQEA
FT                   FYLFIPMSLMFWLSKFKIKYK"
FT                   /protein_id="YP_003470608.1"
FT   gene            350100..351308
FT                   /db_xref="GeneID:8818040"
FT                   /locus_tag="SLGD_00334"
FT   CDS_pept        350100..351308
FT                   /locus_tag="SLGD_00334"
FT                   /gene_family="HOG000279725" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap5L"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549705"
FT                   /db_xref="GeneID:8818040"
FT                   /translation="MKKKKLLILCQYFYPEYVSSATLPTQMAEDLVKKGMYVDVICGWP
FT                   YEYSNEKQVEKNENYKGINIKRLRYSKFNNKSKFGRICNFFSLFLMFIFKMPKMLKYNH
FT                   ILVYSNPPILPLIPDILHRVFKKQYSFVVYDIAPDNALKTGTTRPGSLIDRLMKYINKH
FT                   VYSNAENVIVLGTEMKNYLLQNKISSKPDRIHVIPNWYTESEDDKVHNIEFRDLRNQYD
FT                   KILLYSGNMGQLQDMDTIIDFLKLNKEDNKTLTILCGHGKKYQKVKNSIEFNHISNVKI
FT                   YKFLTGTDYTDVLKIADACFASLVKEGVGLGVPSKNYGYLANKKPLILIMDKQSDIVKQ
FT                   VEAYNAGIQIDNGAAQDIYNFVTRHSREELKELGVNAYQLFKDKYTREHNTTKYYNLLN
FT                   GGN"
FT                   /protein_id="YP_003470609.1"
FT   misc_feature    350109..351296
FT                   /note="Glycosyltransferase [Cell envelope biogenesis, outer
FT                   membrane]; Region: RfaG; COG0438"
FT                   /db_xref="CDD:30787"
FT                   /locus_tag="SLGD_00334"
FT   misc_feature    350112..351281
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. wbuB in E. coli is involved
FT                   in the biosynthesis of the O26 O-antigen.  It has been
FT                   proposed to function as an N-acetyl-L-fucosamine (L-FucNAc)
FT                   transferase; Region: GT1_wbuB_like; cd03794"
FT                   /db_xref="CDD:99968"
FT                   /locus_tag="SLGD_00334"
FT   gene            351310..351867
FT                   /db_xref="GeneID:8818041"
FT                   /locus_tag="SLGD_00335"
FT   CDS_pept        351310..351867
FT                   /locus_tag="SLGD_00335"
FT                   /gene_family="HOG000153661" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap8M"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549706"
FT                   /db_xref="GeneID:8818041"
FT                   /translation="MKRAFDLFCSIYGLIVAGPFLLIIALLIKLESPGPAIFKQKRPTL
FT                   NNELFNIYKFRSMKMDTPNVATDLMDPADFITKTGKFIRKTSIDELPQLLNVLKGDMSI
FT                   VGPRPALYNQYELIEKRTKVNVHTIRPGVTGLAQVMGRDNNTDDQKVMFDKYYLENQSF
FT                   LLDMYIIYKTVINTISSEGVSH"
FT                   /protein_id="YP_003470610.1"
FT   misc_feature    351313..351834
FT                   /note="Bacterial sugar transferase; Region: Bac_transf;
FT                   cl00939"
FT                   /db_xref="CDD:154099"
FT                   /locus_tag="SLGD_00335"
FT   gene            351867..352736
FT                   /db_xref="GeneID:8818042"
FT                   /locus_tag="SLGD_00336"
FT   CDS_pept        351867..352736
FT                   /locus_tag="SLGD_00336"
FT                   /gene_family="HOG000167991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide synthesis enzyme Cap8N"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549707"
FT                   /db_xref="GeneID:8818042"
FT                   /translation="MSKNILITGTGGYVGSHLANSLEKSGNKVSRLSVRNSLWENQSFT
FT                   DYDVIIHTAALVHNNDPSAQLEDYFRINMHLPNKLANKAKKDGVNQFIFMSTMAVFGED
FT                   GVIGKNIEITDPMKIKPITDYGKSKAKAEEKLLNISSSSFKVVIIRPPMIYGEDSPGNF
FT                   TKLKKVAKLLPIIPNIHNYRSALYIKHLEQYVNEIITHKKAGIYHPKDEFEFNTTNVIK
FT                   EIRKNENKSTILLPVPKTIYPLLNKVKFITKLYGNLVYGKDLYLSEEKININQQEFENI
FT                   IKDIMNKD"
FT                   /protein_id="YP_003470611.1"
FT   misc_feature    351879..>352028
FT                   /note="conserved hypothetical protein TIGR01777; Region:
FT                   yfcH"
FT                   /db_xref="CDD:162529"
FT                   /locus_tag="SLGD_00336"
FT   misc_feature    <352008..352349
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00336"
FT   gene            352798..354069
FT                   /db_xref="GeneID:8818043"
FT                   /locus_tag="SLGD_00337"
FT   CDS_pept        352798..354069
FT                   /locus_tag="SLGD_00337"
FT                   /gene_family="HOG000153774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549708"
FT                   /db_xref="GeneID:8818043"
FT                   /translation="MKLTVVGLGYIGLPTSIMFAKHDVDVLGVDINDKTIDSLQKGKVN
FT                   IEEPGLQEVFEEVLEKGTLKVSTKPAEADAFIISVPTPNNDDEYESCDISIVLNAVNSV
FT                   LPYLKKGDTIIVESTIAPRTMDDHVKPLIEDKGFTVGEDIYLVHCPERVLPGKILEELI
FT                   YNNRIIGGVTPNCVEAGKRVYSTFVKGELIETNARTAEMSKLMENTYRDLNIALANEIT
FT                   KISNHLDINVLDVIEMANKHPRVNIHSPGPGVGGHCLAVDPYFIIAKDPEHSPLIQTGR
FT                   KVNRSMPHYVVEHVKRILSGINHAKIAVFGLTYKGDVDDIRESPALDIYHLLQEENFEV
FT                   TAYDPHVELDFVERDINKATEDASLVLILSDHSEFKELSDDDFKLMKNKIIFDTKNVVK
FT                   SNFNDLSYFNYGNLYKARDIELNN"
FT                   /protein_id="YP_003470612.1"
FT   misc_feature    352798..353997
FT                   /note="UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell
FT                   envelope biogenesis, outer membrane]; Region: WecC;
FT                   COG0677"
FT                   /db_xref="CDD:31021"
FT                   /locus_tag="SLGD_00337"
FT   misc_feature    353386..353664
FT                   /note="UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain; Region: UDPG_MGDP_dh; pfam00984"
FT                   /db_xref="CDD:144540"
FT                   /locus_tag="SLGD_00337"
FT   misc_feature    353719..353994
FT                   /note="UDP-glucose/GDP-mannose dehydrogenase family, UDP
FT                   binding domain; Region: UDPG_MGDP_dh_C; pfam03720"
FT                   /db_xref="CDD:146384"
FT                   /locus_tag="SLGD_00337"
FT   gene            354112..355251
FT                   /db_xref="GeneID:8818044"
FT                   /locus_tag="SLGD_00338"
FT   CDS_pept        354112..355251
FT                   /product="UDP-GlcNAc 2-epimerase"
FT                   /gene_family="HOG000076048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00338"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="GI:289549709"
FT                   /db_xref="GeneID:8818044"
FT                   /translation="MKKIMTIFGTRPEAIKMAPLVKELQKSKNLKPVVVITAQHREMLD
FT                   SVLNIFDVIPDHDLNIMKSNQTLAELTSRITTKLDAVIKEEEPDMVLVHGDTTSTFVGG
FT                   LTAFYNQIPIGHVEAGLRTWNKYSPFPEEMNRVMVGNMADLNFAPTDKAAENLKKENKT
FT                   EESIVVTGNTAIDAMKTTIKDNYQSEIIERHSDKKIILLTAHRRENIGTPMHNIFKAIQ
FT                   KLVNEYEDIVVIYPMHKNPKVREIAHQYLKNNARIELIEPLDVIDFHNFANKAYLILTD
FT                   SGGVQEEAPSLGKPVLVLRDTTERPEGVSAGTLKVIGTTFDSVLKETKNLLENKDEYIK
FT                   MSKASNPYGDGEASRRICENIEFYFGLRKALPAPFKSIY"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470613.1"
FT   misc_feature    354118..355206
FT                   /note="UDP-N-acetylglucosamine 2-epimerase; Region: wecB;
FT                   TIGR00236"
FT                   /db_xref="CDD:129339"
FT                   /locus_tag="SLGD_00338"
FT   misc_feature    354118..355197
FT                   /note="Bacterial members of the UDP-N-Acetylglucosamine
FT                   (GlcNAc) 2-Epimerase  family are known to catalyze the
FT                   reversible interconversion of UDP-GlcNAc and
FT                   UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to
FT                   produce an activated form of ManNAc residues...; Region:
FT                   GT1_UDP-GlcNAc_2-Epimerase; cd03786"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="SLGD_00338"
FT   misc_feature    order(354142..354144,354898..354900,354904..354906,
FT                   354913..354915,354961..354963,354973..354975)
FT                   /note="active site"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="SLGD_00338"
FT   misc_feature    order(354319..354321,354325..354330,354349..354351,
FT                   354433..354438,354442..354444,354448..354450,
FT                   354499..354501,354511..354513,354586..354588)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99962"
FT                   /locus_tag="SLGD_00338"
FT   gene            complement(355437..356885)
FT                   /db_xref="GeneID:8818045"
FT                   /locus_tag="SLGD_00339"
FT   CDS_pept        complement(355437..356885)
FT                   /product="Alkaline phosphatase"
FT                   /gene_family="HOG000099116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00339"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="GI:289549710"
FT                   /db_xref="GeneID:8818045"
FT                   /translation="MRVFNKIGKATLATTIAAAALLSTSQLSEASGSGEGPANPQNDMM
FT                   AMGNTKNPKNVIFMVGDGMGPAYNTAYRYYADNPKTKELDQTAFDKYLKGTNRTNPDDP
FT                   KENVTDSAAGGTAFATGHKTYNGAISVDTNKKPLKSVLEQAKENGKSTGLVTTAEVTDA
FT                   TPAVYAAHIDSRDKKDEIAQQFYNDKINGQHKVDVILGGGSKYFGKNNGNLTKKFQNDG
FT                   YDYVTNKTDLAHSQSNQVLGLFAEKDMPLQIDAPQQNPLLVDMENSALSKLEKNNKGFF
FT                   LMVEGASIDKSGHPNDITGVMSEMSGFDKAFQNAINYANTHKDTLVVATADHSTGGLSI
FT                   AKGKDYVWNPEAIRKMKHSGSYMTKQIADGKDPETVIKEGYGINFPDNQLDKVKEAAKE
FT                   LKEVKSKVKNEKDPKLAAATTKLQDAIQKPINDESHTGWTTYGHTGEDVNTYAYGPGED
FT                   KFLGNKDNTDSAKNIFAFLANNAN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470614.1"
FT   misc_feature    complement(355863..356744)
FT                   /note="Alkaline phosphatase homologues; alkaline
FT                   phosphatases are non-specific phosphomonoesterases that
FT                   catalyze the hydrolysis reaction via a phosphoseryl
FT                   intermediate to produce inorganic phosphate and the
FT                   corresponding alcohol, optimally at high pH...; Region:
FT                   alkPPc; cd00016"
FT                   /db_xref="CDD:73179"
FT                   /locus_tag="SLGD_00339"
FT   misc_feature    complement(order(355863..355874,355878..355880,
FT                   356472..356474,356487..356489,356517..356525,
FT                   356562..356564,356580..356582,356586..356588,
FT                   356592..356594,356598..356606,356610..356612,
FT                   356616..356618,356664..356669,356676..356678,
FT                   356685..356690,356736..356744))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:73179"
FT                   /locus_tag="SLGD_00339"
FT   misc_feature    complement(355455..356726)
FT                   /note="Alkaline phosphatase homologues; Region: alkPPc;
FT                   smart00098"
FT                   /db_xref="CDD:128409"
FT                   /locus_tag="SLGD_00339"
FT   misc_feature    complement(order(355887..355892,356004..356006,
FT                   356013..356018,356031..356033,356361..356363,
FT                   356394..356396,356400..356402,356553..356558,
FT                   356700..356702))
FT                   /note="active site"
FT                   /db_xref="CDD:73179"
FT                   /locus_tag="SLGD_00339"
FT   misc_feature    complement(355455..>355571)
FT                   /note="Alkaline phosphatase homologues; alkaline
FT                   phosphatases are non-specific phosphomonoesterases that
FT                   catalyze the hydrolysis reaction via a phosphoseryl
FT                   intermediate to produce inorganic phosphate and the
FT                   corresponding alcohol, optimally at high pH...; Region:
FT                   alkPPc; cl12039"
FT                   /db_xref="CDD:175394"
FT                   /locus_tag="SLGD_00339"
FT   gene            357104..357352
FT                   /db_xref="GeneID:8818046"
FT                   /locus_tag="SLGD_00340"
FT   CDS_pept        357104..357352
FT                   /locus_tag="SLGD_00340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549711"
FT                   /db_xref="GeneID:8818046"
FT                   /translation="MILVMLSPILIILFIVMGIFEERRRNKKRKEQQDKTVSKFEQGPP
FT                   PKDGEFASRYYKNEETTQTAHNKEENQPEESTKNQEK"
FT                   /protein_id="YP_003470615.1"
FT   gene            357424..358089
FT                   /db_xref="GeneID:8818047"
FT                   /locus_tag="SLGD_00341"
FT   CDS_pept        357424..358089
FT                   /locus_tag="SLGD_00341"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Two-component response regulator YvcP"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549712"
FT                   /db_xref="GeneID:8818047"
FT                   /translation="MRIMIVEDDVVIRESLAGELMKWNYDVVAVDTFDDIVSWFVKYEP
FT                   DLVLLDINLPTLNGFHWCQEIRKSSNVPIIFISSRTDNMDQIMAIQMGGDDFIEKPFNL
FT                   SLTITKIQALLRRTYDLTVNHNETTVRDCKLIIDEATLYYKEESVHLSFTELQIIKMLF
FT                   DNQGKYVSRTALIEKCWESEHFIDDNTLAVNMTRLRKKLNSIGLEDFIETKKNIGYKV"
FT                   /protein_id="YP_003470616.1"
FT   misc_feature    357424..358083
FT                   /note="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain
FT                   [Signal transduction mechanisms / Transcription]; Region:
FT                   OmpR; COG0745"
FT                   /db_xref="CDD:31088"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    357433..357768
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    order(357442..357447,357574..357576,357598..357600,
FT                   357655..357657,357712..357714,357721..357726)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    357574..357576
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    order(357583..357588,357592..357600)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    357721..357729
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    357808..358083
FT                   /note="Effector domain of response regulator. Bacteria and
FT                   certain eukaryotes like protozoa and higher plants use
FT                   two-component signal transduction systems to detect and
FT                   respond to changes in the environment. The system consists
FT                   of a sensor histidine kinase...; Region: trans_reg_C;
FT                   cd00383"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00341"
FT   misc_feature    order(357877..357879,357934..357939,357991..357993,
FT                   358000..358002,358024..358029,358060..358062,
FT                   358075..358077)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29475"
FT                   /locus_tag="SLGD_00341"
FT   gene            358095..359003
FT                   /db_xref="GeneID:8818048"
FT                   /locus_tag="SLGD_00342"
FT   CDS_pept        358095..359003
FT                   /locus_tag="SLGD_00342"
FT                   /gene_family="HOG000032012" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Putative two-component sensor histidine kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549713"
FT                   /db_xref="GeneID:8818048"
FT                   /translation="MTMFFDTIKRELIITAMALVVFLVIFFVFNLPYYAYFLGSGIMLF
FT                   IMVIYWFIALSEFKKQQRLTSQLKVLEQEVQQLKSKQTQYQNDIESYFLTWVHQIKTPI
FT                   TASKLLLERNEDNVVNRVRQEIIQIDNYTSLALSYLKLMNHETDMSFTKVTVNELVKPL
FT                   IMKYSIQFIDQHTRIHYDRSDEEVLTDVQWASIMIEQILNNALKYARGKDIWLTFDKDI
FT                   NVLSIKDNGVGISTADLPKIFDKGYSGYNGRLNEQSTGIGLFIVKHISNHIHHQVEVDS
FT                   KLGQGTTFKIYFPKVDKMNEL"
FT                   /protein_id="YP_003470617.1"
FT   misc_feature    <358344..359000
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: BaeS; COG0642"
FT                   /db_xref="CDD:30987"
FT                   /locus_tag="SLGD_00342"
FT   misc_feature    358683..358973
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00342"
FT   misc_feature    order(358692..358694,358704..358706,358713..358715,
FT                   358773..358775,358779..358781,358785..358787,
FT                   358791..358796,358872..358883,358929..358931,
FT                   358935..358937,358950..358955,358959..358961)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00342"
FT   misc_feature    358704..358706
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00342"
FT   misc_feature    order(358785..358787,358791..358793,358872..358874,
FT                   358878..358880)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="SLGD_00342"
FT   gene            359109..359858
FT                   /db_xref="GeneID:8818049"
FT                   /locus_tag="SLGD_00343"
FT   CDS_pept        359109..359858
FT                   /locus_tag="SLGD_00343"
FT                   /codon_start="1"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549714"
FT                   /db_xref="GeneID:8818049"
FT                   /translation="MLLEVKNVKKIYGKGLHKTTALNGMTFNVQQGEFVAIMGESGSGK
FT                   TTLLNVIATFDKINEGSIRIDNRQLNHIRHKEVAHFRRETLGFVFQDFNMLPTMSNKDN
FT                   IIMPLVLANRSHKTIDARLAPLSQQLGIEHILDQFPYQSSGGEQQRVGIARALINQPKL
FT                   LLADEPTGALDSKTSKQIMRLFQKINQRQQTILMVTHSNIDASYANRVLFIKDGRVYHE
FT                   IYRGEETQSDFQRRIADSLAMLNERGE"
FT                   /protein_id="YP_003470618.1"
FT   misc_feature    359112..359777
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359115..359765
FT                   /note="This family is comprised of MJ0796 ATP-binding
FT                   cassette, macrolide-specific ABC-type efflux carrier
FT                   (MacAB), and proteins involved in cell division (FtsE), and
FT                   release of liporoteins from the cytoplasmic membrane
FT                   (LolCDE).  They are clustered together...; Region:
FT                   ABC_MJ0796_Lo1CDE_FtsE; cd03255"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359223..359246
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    order(359232..359237,359241..359249,359379..359381,
FT                   359607..359612,359706..359708)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359370..359381
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359535..359564
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359595..359612
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359619..359630
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   misc_feature    359694..359714
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73014"
FT                   /locus_tag="SLGD_00343"
FT   gene            359842..361842
FT                   /db_xref="GeneID:8818050"
FT                   /locus_tag="SLGD_00344"
FT   CDS_pept        359842..361842
FT                   /locus_tag="SLGD_00344"
FT                   /gene_family="HOG000280304" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter permease protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549715"
FT                   /db_xref="GeneID:8818050"
FT                   /translation="MKEVNDLTFKMLVMMTTRQFKAQRHMIIPYMLALSAMFGMEFILL
FT                   SLGFNDDVRRHHSVLPYFIYIGNAFMSIFIVIFVLYANRFVMRHRQHEFALNMILGMEK
FT                   KHIRVLLFIEAIYQTFVIALLSIIGGYLFGAISFMLLNKLMKQTTTRLIIYPFDITAMS
FT                   YMLVVLIGTMILLFIINNVRLTMQSPIELIQAQHKREKPLSKFVTFILLLIGLLTLGLS
FT                   YYSVLEPKTLLGSFNRIFIAIIYLIISMYCLFLSLMPLILQVLQRYKRLYYQQKYFFTL
FT                   SGLVVRMRSNAVSLASMTLLCTFLLATLSMCVAAYRGVEDRIDSLMTNQYRVDFLGDMY
FT                   QSEKIKDTVTRFEQDVRKKAKVDQFKPIVSSMQDVKVNEATIEYNQQKNVYKNGISRFT
FT                   IAQLSDFNRFTKQQITLKDNEIAIDGMGPLIKKKKLTIAGHTYQVKHVKLNGFGINRIA
FT                   DGYNIIVKNERQFNSIVNLLAKNKQSYHAPATEDVTTSIEFNLLTDNKSQFNQMIPKLE
FT                   HKYKNATIQRKDEFTNIFYQVNGGLVFIGIVVSIILLIGTFLMMYFKQIAEGYEDREDF
FT                   RTMQQLGIEDKRIQQTIQQQMRYIFIVPLIVGTFHTLIAYRLIKQLMTGIGIEGWDLFA
FT                   TSYVAVLVVFVGIYGIIYRITSKIYYKMIKI"
FT                   /protein_id="YP_003470619.1"
FT   misc_feature    <360025..360378
FT                   /note="Predicted permease; Region: FtsX; cl11418"
FT                   /db_xref="CDD:175245"
FT                   /locus_tag="SLGD_00344"
FT   gene            361884..362333
FT                   /db_xref="GeneID:8818051"
FT                   /locus_tag="SLGD_00345"
FT   CDS_pept        361884..362333
FT                   /locus_tag="SLGD_00345"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549716"
FT                   /db_xref="GeneID:8818051"
FT                   /translation="MDRVAETTLTSIGIVLHILYMLMILLIKAVLPLFLSSILIFLLPF
FT                   YLLLYNNWDGFNDGVEHIANSLLVMGMIITILSLIAVFIIAKKPKFASAILFFTTLLAL
FT                   FNMNWISGLLWLISAIMLLSRKPKDIKKRQYALQQEKQQTIDRLQ"
FT                   /protein_id="YP_003470620.1"
FT   gene            362420..362899
FT                   /db_xref="GeneID:8818052"
FT                   /locus_tag="SLGD_00346"
FT   CDS_pept        362420..362899
FT                   /locus_tag="SLGD_00346"
FT                   /gene_family="HOG000160578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549717"
FT                   /db_xref="GeneID:8818052"
FT                   /translation="MIKRTVETVLTWSGIILHAVYFFILLLMSLIFTNDDFKKFMIMKE
FT                   IQRPDENVTLSEAVMSVNVLSTLVTIQAIINIVILVLAIIGVIFIHRRTNVSAILLIIA
FT                   AALCLLNASWVAFVLWLIASIMLFARKPKTQYDYSYNNMSNPSQEDANDNEHSQS"
FT                   /protein_id="YP_003470621.1"
FT   gene            363172..363768
FT                   /db_xref="GeneID:8818053"
FT                   /locus_tag="SLGD_00347"
FT   CDS_pept        363172..363768
FT                   /locus_tag="SLGD_00347"
FT                   /gene_family="HOG000160578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549718"
FT                   /db_xref="GeneID:8818053"
FT                   /translation="MIKRTGEKVLTWIGFILHTLYVIFLVLIQMMVSDSDFKEQLANEL
FT                   QKNPDSNVSRDQTIEAVNSVATNSSGWIMIGIVILGLTLVAAIMLSKHPTISAILLIIA
FT                   VVLSVFNVSWVAGILWLIAAIMLLVRRPKNQYAYNSGTTTDIPPEENERYNNYSENHND
FT                   EYRHQQQDVEVDNHDHHQSHSTNDKDVSDVYAIIK"
FT                   /protein_id="YP_003470622.1"
FT   gene            complement(363944..365254)
FT                   /db_xref="GeneID:8818054"
FT                   /locus_tag="SLGD_00348"
FT   CDS_pept        complement(363944..365254)
FT                   /locus_tag="SLGD_00348"
FT                   /gene_family="HOG000190807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Nitrilotriacetate monooxygenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549719"
FT                   /db_xref="GeneID:8818054"
FT                   /translation="MYQQQQRQMHIGVLVYGCGHHQAAWQMPDSAVERLGDVSYYQELA
FT                   QLAERGCLDIVFFADNQSFNANDSSAMPAFWFDPLINLTAISQVTQYVGLVPTISSTFS
FT                   DPYTVARQLLSLDHMTGGRVGWNLVTSMTDIEAQNHSMTELPNHEARYARAQEFAAVMQ
FT                   HLFTNWKATDIVADKERGVLMNASQIKPIEFNGNYFQVRGPISTPQSPQGRPVNMQAGA
FT                   SKQGIALAARYADAVYAVSWNLTQAKRYRERLKQALSQTAEPQRHIKVFPGLVTYVGQT
FT                   KEEALAKKKRLDAQLPVKTALKQLSFFIQQDCQDWNLDGPVPELPPIETFEGPTGRYET
FT                   VLEIIKDKQPTVRELLGYLNAGGGHLTLIGTPKEIVDEMELWFNEGVADGFNLMPPSLP
FT                   HSLNDFVTYIVPELQQRGLYRKRYQSHTLKSHLDINY"
FT                   /protein_id="YP_003470623.1"
FT   misc_feature    complement(363998..365230)
FT                   /note="nitrilotriacetate monoxygenase oxidizes
FT                   nitrilotriacetate utilizing reduced flavin mononucleotide
FT                   (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin
FT                   mononucleotide (FMN) oxidorductase that uses NADH to reduce
FT                   FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase;
FT                   cd01095"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="SLGD_00348"
FT   misc_feature    complement(363962..365221)
FT                   /note="FMN-dependent oxidoreductase, nitrilotriacetate
FT                   monooxygenase family; Region: FMN_nitrolo; TIGR03860"
FT                   /db_xref="CDD:163572"
FT                   /locus_tag="SLGD_00348"
FT   misc_feature    complement(order(364580..364585,364802..364804,
FT                   364868..364870,365027..365029,365201..365203,
FT                   365213..365215))
FT                   /note="active site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="SLGD_00348"
FT   misc_feature    complement(364958..364963)
FT                   /note="non-prolyl cis peptide bond; other site"
FT                   /db_xref="CDD:73245"
FT                   /locus_tag="SLGD_00348"
FT   gene            complement(365346..366095)
FT                   /db_xref="GeneID:8818055"
FT                   /locus_tag="SLGD_00349"
FT   CDS_pept        complement(365346..366095)
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00349"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="GI:289549720"
FT                   /db_xref="GeneID:8818055"
FT                   /translation="MAKTVLVTGASRGLGSVIARTLVAKGFQVVINYNQSQTAAEQLMQ
FT                   ELGTQTIALQADVRNREQVNAMVASAIDHFGHIDAVVNNALVNFKFDPDAQKSFKDLSW
FT                   DDYQAQLDGTLKASFNVIQSVLPQFIEHKQGSVVNIGTNLYQNPVVPYHEYTTAKASII
FT                   GFTRNIAAELGQYGITANVVSGGLLKTTDASAVTTPEVFDLIASTTPLHQVTSPQDVAN
FT                   MVVYLCSDEAKQITGQNITVDGGLTMN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470624.1"
FT   misc_feature    complement(365349..366095)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00349"
FT   misc_feature    complement(365349..366089)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:168093"
FT                   /locus_tag="SLGD_00349"
FT   gene            complement(366512..366628)
FT                   /db_xref="GeneID:8818056"
FT                   /locus_tag="SLGD_00350"
FT   CDS_pept        complement(366512..366628)
FT                   /locus_tag="SLGD_00350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549721"
FT                   /db_xref="GeneID:8818056"
FT                   /translation="MLKITKSTYLSNFSFNNTAQIAQAKIEMADTNYRILKF"
FT                   /protein_id="YP_003470625.1"
FT   gene            366968..378367
FT                   /db_xref="GeneID:8818057"
FT                   /locus_tag="SLGD_00351"
FT   CDS_pept        366968..378367
FT                   /locus_tag="SLGD_00351"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell wall associated biofilm protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549722"
FT                   /db_xref="GeneID:8818057"
FT                   /translation="MKKGVSVINPEEKRQQLHSIRKFKVGTASILIGVTLIFGVPKVAY
FT                   AEEMQAIQSNKQANDSSEETKSNNKQQNNLHGQTTEEQQNISTITETSVDNSKALNTAD
FT                   SSTSEQQDNDITTDATTKSIQSNENVIHQNTTNDAKNEKSNANIIKSKNETTTNENINP
FT                   QNSVKENLTAKFKNTTETTNQQAAQIQSTTQKSTSAQTTLKQSRKLVQEKSQQDTTVTS
FT                   KNNSNNSDQNTTLSGVTPFTNSNGDKTNEEKVVTTQPITVKQRRALMVKSNYAADTSIS
FT                   DPKVIDYPTPKNSKYSYMLHELGYNATTVSDESSLRFAGITQNKNSNGSTITLNLTKWN
FT                   SATTNLNNGKINLSFSQSKFFSQIESISFDGTNMITDNNGQNWYTPASNANLGLIGSVT
FT                   NSPIIITLKNNQSLTSLGYSNTNPVYFTHTWTLNDGSIAPESIQNALITPTLNPKVPQS
FT                   TQSSGFTTGRLINKIDISRTDNTIKSIHSFKPDENFLQTDYNWVLYVKEQIPKELMPYI
FT                   DRGSINIYVSDIFGNPISSDRNVQGFVDDNGFIDSSKINEISIKDNNTTSHLNSARGSL
FT                   DHNVFYGTLGQSRNYTISYKLKDGVTIEQLQRELSDRLTFSSWLETDYLDSRDNGSANN
FT                   RLMGSYASSYVDLIDRVPPEKPVANNITTDDKAIIGTAEANTKINLAFSDGHILTGTVD
FT                   SNGNFSVSIPSGFNLTGKETISITAIDKGLNVSQPTTITVTDTTPPSLEDINSQVVLIN
FT                   TAINNVKINATDNSGDPIKITISQLPNGVSYNSDTQEISGKPTQVGVYPITVTATDASG
FT                   NVSTTSFAITARDITAPDVKPIENQTIEINTAISNILINATDDSGLPVNNTVSGLPDGV
FT                   TFDSTTNTISGIPTTLGTYPIEVMSKDNENNVTKTKFTIFVQDTTSPVVNAIQSQTVEI
FT                   NTPINSIKIDAKDNSLGSVVNTVSGLPDGITFDSETNTISGTPTQTGTSKIVIISTDAS
FT                   GNQTVTNTTIVVRDTIKPVVNPISNQKKEVNTPIDDIKIVASDNSNQDVTIVVTGLPRG
FT                   VIFDTTTNTISGSPKEVGKYEFKVTVEDNAKNSTETRFTIEVVDTTAPTVKGINDQTKE
FT                   VNTAIDNIKIDASDNSGQAVTNTVNGLPEGVTFDPKTNTISGVATKVGIYPIVVTSTDN
FT                   QGNKVDTTFTIKIVDTTAPTVKEISDQTKEVNTAIDEIVIDATDNSGQAVTNKVRGLPE
FT                   GVTFNPTTNTISGVATKVGTYPIVVISTDAEGNNVETKFSIKVVDTTAPTVKEISDQTK
FT                   EVNTEIDNIKIDAKDNSGQPVTNTVSGLPSGVTFDPTTNTISGIATKVGTYPIVVTSKD
FT                   TDGNSVEIKFTIKVVDTTVPTVKGISDQTKEVNTAIDNIEIIATDNSGQPVTNTVSGLP
FT                   SGVTFDPTTNTISGIATKVGTYPIVVTSTDTEGNSVETKFSIKVVDTTAPTVKEISDQT
FT                   KEVNTAIDNIEISATDNSGEVVTNRVSGLPEGVTFDPLTNTISGIATKVGTYPIVVTST
FT                   DVEGNSIETKFTIKVVDTTVPTVKGISDQTKEVNTAIDDIEIRATDNSGQVVTNKVSGL
FT                   PKGVTFDPRTSTISGVATKVGTYPIVVTSTDAEGNSVETKFSIKVVDTTAPTVKEISDQ
FT                   TKEVNTEIDNIKIDAKDNSGQEVTNTVRGLPSGVTFDPRTNTISGVATKVGTYPIIVTS
FT                   TDAEGNSTETKFSIKVVDTTAPTVKGISDQTKEVNTAIDDIEIRATDNSGEVVTNRVSG
FT                   LPEGVTFDSRTNTISGVATKVGTYPIVVISTDAEGNSVETKFIIKVVDTTAPTVKGISD
FT                   QTKEVNTEIDNIEISATDNSGEVVTNKVSGLPEGVTFDPRTNTISGVATKVGTYPIVVI
FT                   STDTEGNSVETKFSIKVVDTTAPTVKEISDQTKEVNTEIDNIKIDAKDNSGQEVTNTVR
FT                   DLPSGVTFDPSTNTISGIAKKVGTYPIVVTSTDAEGNSIETKFSIKVVDTTAPTVKGIS
FT                   DQTKEVNTEIDNIEISATDNSGEVVTNKVSGLPEGVTFNPTTNTISGVATKVGTYPIVV
FT                   TSTDAEGNSVETKFSIKVVDTTAPTVKEISDQTKEVNTEIDNIEISATDNSGEVVTNKV
FT                   SGLPEGVTFNPTTNTISGVATKVGIYPIVVTSTDNQGNKVDTTFTIKIVDTTAPTVKEI
FT                   SDQTKEVNTAIDEIVIDATDNSGQAVTNKVSGLPEGVTFNPTTNTISGIATKVGTYPIV
FT                   VTSTDAEGNSIETKFSIKVVDTTAPTVKGISDQTKEVNTEIDNIEISATDNSGQAVTNK
FT                   VSGLPQGVTFDPSTNTISGVATKVGTYPIVVTSTDADGNSVEMKFNIKVVDTTAPTVKE
FT                   ISDQTKEVNTAIDDIEISATDNSGQPVTNTVSGLPEGVTFDPRTSTISGVATKVGTYPI
FT                   VVTSIDGDGNRTDTKFNIKVVDTTAPTVKGISDQTKEVNTAIDDIEISATDNSGQAVTN
FT                   KVSGLPQGVTFDPRTSTISGVATKVGTYPIVVISTDADGNSVEMKFNIKVVDTTAPTVK
FT                   EISDQTKEVNTAIDNIEIRATDNSGQAVTNTVRGLPEGVTFDPRTNTISGVATKVGTYP
FT                   IVVTSTDADGNSVETKFNIKVVDTTAPTVKEISDQTKEVNTEIDNIEISATDNSGQPVT
FT                   NTVRGLPEGVAFDPRTSTISGVATKVGTYPIVVTSTDADGNSVEMKFNIKVVDTTAPTV
FT                   KEISDQTKEVNTEIDNIKIDAKDNSGQAVTNTVRGLPNGVTFDPRTNTISGVVTKVGTY
FT                   PIVVTSTDADGNSIETKFSIKVVDTTAPTVKGISDQTKEVNTSIDEIVIDATDNSGQTV
FT                   TNTVSGLPSGVTFDSRTNTISGVATKVGTYPIVVTSTDAEGNSTDTKFIIKVVDTTAPT
FT                   VKEISDQTKEVNTAIDSIKIDAKDNSGQAVTNKVSGLPNGVTFDSRTNTISGVVTKVGT
FT                   YPIVVTSTDADGNSIETKFIIKVVDTTAPTVKGISNQTKEVNTEIDEIVIDATDNSGQT
FT                   MTNTVSGLPEGITFDPSTNTISGVATKVGTYPIVITSTDADGNSVETKFNIKVVDTTAP
FT                   TVKGISNQTKEVNTAIDDIEISAKDNSGQPVTTKVSGLPNGVTFDSRTNTISGVATKVG
FT                   TYPIVVTSTDADGNRTETKFIIKVVDTTAPTVKEISDQTKEVNTEIDNIKIDARDNSGQ
FT                   AVTNTVRGLPEGVTFDPRTNTISGVATKVGTYPIVVTSTDVEGNSIETKFSIKVVDTTA
FT                   PTVKEISDQTKEVNTAIDSIEIRATDNSGQAVTNKVSGLPQGVTFDPSTNTISGVATKV
FT                   GTYPIVVTSTDADGNRTDTKFSIKVVDTTAPTVKGISDQTKEVNTAIDDIEISVTDNSG
FT                   QAVTNKVSGLPQGVTFDSRTNTISGVATKVGTYPIVVTSTDAEGNSIETKFSIKVVDTT
FT                   APTVKGISDQTKEVNTEIDNIKIDARDNSGQAVTNTVNGLPEGVTFDSRTNTISGVVTK
FT                   VGTYPIIVTSTDADGNSVETKFIIKVVDTTAPTVKEISNQTKEVNTAIDNIEIRATDNS
FT                   GQPVTTKVSGLPEGVTFDSRTNIISGVATKVGTYPIVVTSTDADGNSVETKFIINVIDE
FT                   DKLEIQPIPNQIVKINTHIKDVKIIITGGLGSTIISVSGLPKGLEFKSETLTISGIPKE
FT                   PGRYDIIVTVIDSNSNQADVHFVIEVINDDNNKKPDKNSHIDDPEKPVIDNSHKNGIAI
FT                   HGKTNSSKHVIIDLPSELTKTVNINNPGNYTIWVSGAHKMHKESYRIVERDKDNDIYVL
FT                   PDTGNNSKSSTGIVATVLAMIGGILLLFKRRKNDEEK"
FT                   /protein_id="YP_003470626.1"
FT   misc_feature    367004..367081
FT                   /note="YSIRK type signal peptide; Region: YSIRK_signal;
FT                   cl04650"
FT                   /db_xref="CDD:164062"
FT                   /locus_tag="SLGD_00351"
FT   misc_feature    <369257..369442
FT                   /note="Putative Ig domain; Region: He_PIG; cl09256"
FT                   /db_xref="CDD:158466"
FT                   /locus_tag="SLGD_00351"
FT   gene            378784..382194
FT                   /db_xref="GeneID:8818058"
FT                   /locus_tag="SLGD_00352"
FT   CDS_pept        378784..382194
FT                   /locus_tag="SLGD_00352"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549723"
FT                   /db_xref="GeneID:8818058"
FT                   /translation="MTNRKRNSSQRMDFIPNKLNKYSIRKFTVGTASILVGATLFLGHH
FT                   EAEAAEKQQSISQNHSDEQESSQADTTVTTEQTTNNNVSSQTNATSPSTQDKTTIDHTE
FT                   NPSSTNQQITENQSLHAKDLQTSNQNNVSHKDTANKSTEKEARQHQNHKSTIQQQESSE
FT                   KLVTAAQNASATNQAVSTNTNETHVQYADKKLSQIGVNHQTKEQVKASLVTKKAFKPRS
FT                   KRDLDNTIVAEALKADITNPDYGVRTPATPVTAAASTSPTTRALSSNYRVRALAAATPT
FT                   GKDVSDKIKFSNIDIAVEGRTAHTNASGQRELWVTSGDILSLKADYTVDNSVKSGDTFT
FT                   IGYGQYIRPGGFSLPSSDTELRDANGAIIAKGKYDSNTNKTTYTFTNYVDQYDNIQGSF
FT                   KIAATAKRENAINDKGSYNMDVKIGNVSFNKNIIVDYGDNKNNPLNASTLYRDPKTNQQ
FT                   YRIIYINEPGKTYKNVKYHSTTMNGKLIDGTDAIKVYKVNDPSAMVNSFAPDLTSSKVT
FT                   DVTSSKTITYDNNRSTVNVSLGNLDGKTRYIIAEKVEPTTDNGNLSSTFSITNDDKNNP
FT                   TIWAASTTQGSAGDNSTGSGQQTGKYSLGDIVWNDKNRNGIQDIGEEGIPNVYVTLKDA
FT                   NGNEIDRVTTDENGNYKFKNLKNGEYTLEYSTPNGGYSLTKADQSNNDAVDSDAQLVNG
FT                   KYVAKATIQDDDNMTVDAGFYKSVYNIGDFVWNDTNKNGIQDDGEKGLAGVTVLLKDEQ
FT                   GRTIATTVTDKNGKYGFYELESGNYTVQFITPDGYILSPSKVGTDVTKDSNGDEVPIKL
FT                   TENDYSNDLGLYKPDAPKLDDYEITVEDKSYENTVRVNTKLPKNTIQLAQQGKDGRDRV
FT                   YYKQLGYHPDLTGKDASKLLQIDGYYFEEVRRDHIYQSQDAIFEYNLDNNTGVKNITYN
FT                   PTTNTYTVTYQDGSTKELPGQQPKGLTINNSYINQNGDTIVEFSDGTTITIPKGKDGVD
FT                   GKKGEDGKTPKIEQTPITDSSGKQIGVTITVKDGDGKVINTQKVLNGQDGAKGNPGEKG
FT                   EKGDPGTKGDKGEKGDTGAAGRDGQNGQDGKSVIANTERGTKDGQEGAYIRIYEVNPDG
FT                   SRGTMISETFIKDGVKGQDGKDGRSPSIQ"
FT                   /protein_id="YP_003470627.1"
FT   misc_feature    378829..378909
FT                   /note="YSIRK type signal peptide; Region: YSIRK_signal;
FT                   cl04650"
FT                   /db_xref="CDD:164062"
FT                   /locus_tag="SLGD_00352"
FT   misc_feature    380086..380550
FT                   /note="C-terminus of bacterial fibrinogen-binding adhesin;
FT                   Region: SdrG_C_C; pfam10425"
FT                   /db_xref="CDD:151005"
FT                   /locus_tag="SLGD_00352"
FT   misc_feature    380656..380847
FT                   /note="Collagen-binding protein B domain, mediates
FT                   bacterial adherence to collagen; the primary sequence has a
FT                   non-repetitive, collagen-binding A region, followed by the
FT                   repetitive B region; the B region has one to four 23 kDa
FT                   repeat units (B1-B4). The B...; Region: CollagenBindB;
FT                   cl14619"
FT                   /db_xref="CDD:176629"
FT                   /locus_tag="SLGD_00352"
FT   misc_feature    381007..381201
FT                   /note="Collagen-binding protein B domain, mediates
FT                   bacterial adherence to collagen; the primary sequence has a
FT                   non-repetitive, collagen-binding A region, followed by the
FT                   repetitive B region; the B region has one to four 23 kDa
FT                   repeat units (B1-B4). The B...; Region: CollagenBindB;
FT                   cl14619"
FT                   /db_xref="CDD:176629"
FT                   /locus_tag="SLGD_00352"
FT   gene            382318..384834
FT                   /db_xref="GeneID:8818059"
FT                   /locus_tag="SLGD_00353"
FT   CDS_pept        382318..384834
FT                   /locus_tag="SLGD_00353"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="collagen-like surface protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549724"
FT                   /db_xref="GeneID:8818059"
FT                   /translation="MTTITERGRQNDQTGSYVRTYERNPDGSRGKLISETFISDGQNGK
FT                   DGQNGMNGKSITAETRPGTDADGNTGAWIRVYELNPDGTKGQLISETFIKNGAKGEKGE
FT                   DGKTPKIEQTPIRDSSGNQIGVTITVTDGDGNVVSKENILNGKDGAKGENGKTPSVEQQ
FT                   AIQDKDGKQIGVTIIIKDGDGKEISRQNILNGQDGKNGTPGKDGQTPTVETMPALDKDG
FT                   KQIGVTIITRDGDGKEIGRQTVTNGQDGKSITAVTARGEQNNQTGSWIRVYEVNPDGTR
FT                   GKLISETFVADGQKGADGKNGVDGKDGKTPTIEQQPIRDKDGKQIGVTIIIKDGDGKEI
FT                   SRQKILNGQDGQKGANGQDGKSVTAITERGTQDGHKGSYIRIYEMNPDGTRGKLISETF
FT                   IADGEKGRDGKSVTAETTRGDKDGQTGAYVRIYLTNPDGTRGKLISETFIADGQKGKNG
FT                   QDGKTPTIEQLPILDKNGKQVGVTVIVKDGNGKEISRQDIYNGRDGQDGKDGKTPSIEQ
FT                   QPILDKNGKQIGTTVIIKDGNGKEISRQDIHNGQDGKTPTIEQVPSLDKEGKQNGIIVI
FT                   IKDGDGKEISRQNIYNGEKGQDGKDGKDGVDGKSITAITERGTKDGKSGSYIYIYEMNS
FT                   DGSRGKLISQTFIEDGQDGKTPSIEQQPVKDEKGNQVGVVIIVKDGDGKEISRQVIVNG
FT                   KDGKDGKTPSIEQQPIKDENGKQIGITIIVKDGNGKEVSRQNIYNTSNITNIYVNVEGN
FT                   IVFVFKDGTTCICKCEPNKPNEPGKPSEPGKPNEPNKPSEPSKPSEPNNQMSQASQASQ
FT                   PSQVSQTNRANQVSQANRTNQFILEQ"
FT                   /protein_id="YP_003470628.1"
FT   gene            384831..385034
FT                   /db_xref="GeneID:8818060"
FT                   /locus_tag="SLGD_00354"
FT   CDS_pept        384831..385034
FT                   /locus_tag="SLGD_00354"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549725"
FT                   /db_xref="GeneID:8818060"
FT                   /translation="MKHVNYKTTSHLQQVHDTTQSNNDKKQQELPATGAVDDNGYQAPF
FT                   FGSLFAISGTILFLARRRKHHQ"
FT                   /protein_id="YP_003470629.1"
FT   misc_feature    384894..385016
FT                   /note="Gram positive anchor; Region: Gram_pos_anchor;
FT                   pfam00746"
FT                   /db_xref="CDD:109789"
FT                   /locus_tag="SLGD_00354"
FT   gene            385350..386081
FT                   /db_xref="GeneID:8818061"
FT                   /locus_tag="SLGD_00355"
FT   CDS_pept        385350..386081
FT                   /product="Phosphoadenylyl-sulfate reductase
FT                   /gene_family="HOG000249397" [ FAMILY / ALN / TREE ]
FT                   (thioredoxin)/Adenylyl-sulfate reductase (thioredoxin)"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00355"
FT                   /EC_number="1.8.4.10"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="GI:289549726"
FT                   /db_xref="GeneID:8818061"
FT                   /translation="MSVPKITYDVFSEDPFIEKLTLDEGTKGAYDILKWAYDTYGESIV
FT                   YACSFGAESMVLIHIISQIKPDAQIVFLDTDLHFQETYDLIEDVKQRFPQLRIEMKKPD
FT                   LTLEEQAEKYQPALWKANPNQCCYIRKIKPLEEVLSGAVAWISGLRRAQSPTRAHTNFI
FT                   NKDERFKSIKICPLIYWTEEEVWDYINDNHLPYNALHDQHYPSIGCIPCTSPVFDSDDS
FT                   RAGRWSSFSKTECGLHVADKP"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470630.1"
FT   misc_feature    385479..385973
FT                   /note="This domain is found in phosphoadenosine
FT                   phosphosulphate (PAPS) reductase enzymes or PAPS
FT                   sulphotransferase. PAPS reductase is part of the adenine
FT                   nucleotide alpha hydrolases superfamily also including N
FT                   type ATP PPases and ATP sulphurylases. A highly...; Region:
FT                   PAPS_reductase; cd01713"
FT                   /db_xref="CDD:30168"
FT                   /locus_tag="SLGD_00355"
FT   misc_feature    order(385740..385742,385818..385820,385857..385859,
FT                   385866..385868)
FT                   /note="Active Sites; active site"
FT                   /db_xref="CDD:30168"
FT                   /locus_tag="SLGD_00355"
FT   gene            386214..388058
FT                   /db_xref="GeneID:8818062"
FT                   /locus_tag="SLGD_00356"
FT   CDS_pept        386214..388058
FT                   /product="Sulfite reductase [NADPH] flavoprotein
FT                   /gene_family="HOG000282025" [ FAMILY / ALN / TREE ]
FT                   alpha-component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00356"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="GI:289549727"
FT                   /db_xref="GeneID:8818062"
FT                   /translation="MSLSVTNSPFTAEQAKQLSEVIATLTPEQKVWLSGYLIANQQTIQ
FT                   TNSSVQSEQLSTKAEAVIQSNEQEIEPTQRSITVLYGSETGNAQGVAEIFSECLTNLGH
FT                   NVVISSMDTFKTKELKKVEDLFIVTSTHGEGDPPDNALEFHEFLHSRKAPKLEGVRFSV
FT                   LALGDQTYEFFCQTGKDFDKKLAELGAERLYERIDCDIDYDEDAEKWMANVIKAIDTES
FT                   RGTESEQVISESIKAAKERKYSKSNPYEAEILDNINLNGKGSNKETRHVELLLDNFGEE
FT                   YEPGDCIVVLPQNDPQVVDLLIATLGWDPEEQIPVSEDGDTLTLSDALTRHFEITKLTK
FT                   PLLQQAAAIFDNDDLSDKVQDNEWVQQYINGRDFIDLLNDFGTDELLPVNLSQLLRKLP
FT                   PREYSISSSYKATPDEVHITVGAVRYQSHGRDRSGVCSVQFAERLQPGDTVPIYLKRNP
FT                   NFKFPTEADTPIIMIGPGTGVAPFRACMQEREELGFKGNTWLFFGDQHFTTDFLYQTEW
FT                   QAWLKEGYLEKMDVAFSRDTDHKIYVQHRIMERSAQFNAWLEKGASIYICGDEKHMAKD
FT                   VHQAIKDVLVKEQGLSQDEAEAYLKQLKKDKRYQRDVY"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470631.1"
FT   misc_feature    386226..388055
FT                   /note="sulfite reductase [NADPH] flavoprotein,
FT                   alpha-component; Region: cysJ; TIGR01931"
FT                   /db_xref="CDD:162611"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    386448..386843
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    386967..388055
FT                   /note="Cytochrome p450- like alpha subunits of E. coli
FT                   sulfite reductase (SiR) multimerize with beta subunits to
FT                   catalyze the NADPH dependent reduction of sulfite to
FT                   sulfide. Beta subunits have an Fe4S4 cluster and a
FT                   siroheme, while the alpha subunits (cysJ...; Region: SiR;
FT                   cd06199"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    order(387072..387074,387414..387425,387468..387470,
FT                   387474..387476,387513..387524)
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    order(387414..387416,387420..387425)
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    order(387423..387425,387912..387914,388047..388049,
FT                   388053..388055)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    order(387474..387485,387636..387638,387642..387644,
FT                   387723..387728,387813..387818,387837..387839,
FT                   387843..387845,387930..387932)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    order(387513..387515,387522..387524,387531..387533)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   misc_feature    order(387627..387629,387639..387650,387654..387656)
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99796"
FT                   /locus_tag="SLGD_00356"
FT   gene            388079..389797
FT                   /db_xref="GeneID:8818063"
FT                   /locus_tag="SLGD_00357"
FT   CDS_pept        388079..389797
FT                   /product="Sulfite reductase [NADPH] hemoprotein
FT                   /gene_family="HOG000218418" [ FAMILY / ALN / TREE ]
FT                   beta-component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00357"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="GI:289549728"
FT                   /db_xref="GeneID:8818063"
FT                   /translation="MAKSNEQLEQELNQKLDQLEYIKDDSNYLRGTIEQGLADPLTGAI
FT                   SDDDTKLLKFHGSYQQDDRDLRDERRKQKLEPAYSFMIRVRLPGGTATPEQWIAMDDIS
FT                   NQYGNHTMKLTTRQTFQFHGILKRNLKASMRHINDALLDTIAACGDVNRNTMCNPNPYQ
FT                   SRFHQEMNDYAAAISNHLLPQTNAYHEIWLDGEKVLDSSEEVEPMYGKTYLPRKFKIGI
FT                   ALPPSNDIDVYSQDIGLIAIVDHDELIGFNVLVGGGMGMTHGNKNTYPQIGRLLGYIPK
FT                   EEVVDVCEKILTIQRDYGNRVDRKNARFKYTVDRLGLERVKTELNQRLGWEIQEPKAFK
FT                   FEHNGDRLGWIQGEHNWNFTLFIQNGRIKDLEDYKLKTALREIAEVHQGDFRLSPNQNL
FT                   IIANVSPEHKKDIQDIIERYQLTDGRHYSGLRRNSMACVAFPTCGLAMAESERYLPSLI
FT                   GKIEDLLDEAGVSEEDITIRMTGCPNGCARPALAEIAFIGKAPGKYNMYLGGGFKGERL
FT                   NKLYKENIDEQQILASLRPILMDYGKSRLEGEHFGDFVIRSGVIAEVHSGQDFHS"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470632.1"
FT   misc_feature    388115..389794
FT                   /note="sulfite reductase subunit beta; Provisional; Region:
FT                   PRK13504"
FT                   /db_xref="CDD:172091"
FT                   /locus_tag="SLGD_00357"
FT   misc_feature    388319..388498
FT                   /note="Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain; Region: NIR_SIR_ferr; pfam03460"
FT                   /db_xref="CDD:146216"
FT                   /locus_tag="SLGD_00357"
FT   misc_feature    389132..389335
FT                   /note="Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain; Region: NIR_SIR_ferr; pfam03460"
FT                   /db_xref="CDD:146216"
FT                   /locus_tag="SLGD_00357"
FT   gene            389821..390600
FT                   /db_xref="GeneID:8818064"
FT                   /locus_tag="SLGD_00358"
FT   CDS_pept        389821..390600
FT                   /product="Uroporphyrinogen-III methyltransferase"
FT                   /gene_family="HOG000290519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00358"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="GI:289549729"
FT                   /db_xref="GeneID:8818064"
FT                   /translation="MGKVYLVGAGPGDPELITVKGLKAIKQADVILYDRLVNRELLDYA
FT                   TAGTKLFYCGKDPNRQSLPQSETNKMLVSLAKKGHTVTRLKGGDPFVFGRGGEEAEILA
FT                   QHHIAFEIIPGITAGIAAPAYAGIPVTHRDFSSSVAFVTAVNKPGMTKAAYWEHLAHGP
FT                   ETLCIYMGVKRLSEICGLLIKYGKPIDTPVALIHLGTTAYQQTVTGTLSTITEVAKNIK
FT                   NPAMIVIGQVVQMHDKIQWFTEQTEQMRMDYSQVNSK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470633.1"
FT   misc_feature    389821..390564
FT                   /note="Tetrapyrrole (Corrin/Porphyrin) Methylases; Region:
FT                   TP_methylase; cl00304"
FT                   /db_xref="CDD:174096"
FT                   /locus_tag="SLGD_00358"
FT   gene            390621..391232
FT                   /db_xref="GeneID:8818065"
FT                   /locus_tag="SLGD_00359"
FT   CDS_pept        390621..391232
FT                   /product="Siroheme synthase/Precorrin-2 oxidase"
FT                   /gene_family="HOG000285944" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00359"
FT                   /EC_number="1.3.1.76"
FT                   /db_xref="GI:289549730"
FT                   /db_xref="GeneID:8818065"
FT                   /translation="MNMPLMVDLAGQRIVIVGGGQVAARRASNFIDYCQDIHIISPQVH
FT                   SSLEDLINAGQITWHQKEFDAADIAGAFLVVAATNNKAVNQQVKALVPPGCLFNNAEDA
FT                   TSGNVTIPNILKRGKLTLSVATQGASPKLGIQIIEQLSHTYDERYEQYVEFLYQCRQTL
FT                   KRINIEPSYRQALLAKIVSDDYLDLDKQQAFLRWLQAQAE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470634.1"
FT   misc_feature    390624..391223
FT                   /note="precorrin-2 dehydrogenase; Reviewed; Region:
FT                   PRK06718"
FT                   /db_xref="CDD:136015"
FT                   /locus_tag="SLGD_00359"
FT   misc_feature    390624..391046
FT                   /note="precorrin-2 dehydrogenase; Validated; Region:
FT                   PRK06719"
FT                   /db_xref="CDD:136016"
FT                   /locus_tag="SLGD_00359"
FT   gene            391250..392149
FT                   /db_xref="GeneID:8818066"
FT                   /locus_tag="SLGD_00360"
FT   CDS_pept        391250..392149
FT                   /locus_tag="SLGD_00360"
FT                   /gene_family="HOG000077936" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549731"
FT                   /db_xref="GeneID:8818066"
FT                   /translation="MKKLLIFALAGFLAQLVDGSLGMGFGASSSSILLTYGITPAIVSA
FT                   TVHFSEIATTAASGTSHWKFDNVHRSTMLKLAIPGAIFGFLGAAFLTHIHSSVIKPYIA
FT                   IFLLAMGFYILYQFLFRRQHETHEHVGQLSGWKLIPQGAIAGLLDAIGGGGWGPVNTPI
FT                   LLSSKKIQPRYAIGTVSASEFFVTLATSLSFILFLGITQINWWLVVALSIGGMAAAPIS
FT                   AYLTKILPINILAICVGGLIIFTNSNALLSYFVDNSTIINVIRFAIICSILVLIIFVAI
FT                   RNRLLSFSYKKNRVNKYN"
FT                   /protein_id="YP_003470635.1"
FT   misc_feature    391268..391984
FT                   /note="Sulfite exporter TauE/SafE; Region: TauE; cl00498"
FT                   /db_xref="CDD:174246"
FT                   /locus_tag="SLGD_00360"
FT   gene            392172..393350
FT                   /db_xref="GeneID:8818067"
FT                   /locus_tag="SLGD_00361"
FT   CDS_pept        392172..393350
FT                   /product="Sulfate adenylyltransferase, dissimilatory-type"
FT                   /gene_family="HOG000069044" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00361"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="GI:289549732"
FT                   /db_xref="GeneID:8818067"
FT                   /translation="MSVSKDILHYTIKPHGGVLINRVVEGIERTQLSQAAQSYKAITLN
FT                   PWAISDLELIAIGGFSPLTGFMGQEDYNQVIEKTHLTDGSVWSIPITLPVTEDVASKLE
FT                   IGDHIALYGEDGALYGTLKLTEKYTYDKKREAQLVYGTTDVKHPGVKKVYDKGNVYLAG
FT                   PIQLLKRPQHNKFADYHLDPHETRQLFHDLGWKTVVGFQTRNPVHRAHEYIQKSALEIV
FT                   DGLLLNPLVGETKADDIPADVRMESYETILKHYYPKNRARLVIYPAAMRYAGPKEAVLH
FT                   AIVRKNYGCTHFIVGRDHAGVGDYYGTYEAQQFISQFEDELDIQILKFEHAFYCEACGN
FT                   MATAKTCPHDATQHVHLSGTKVREKLRNGEALPTKFSRPEVAEVLIKGLQQH"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470636.1"
FT   misc_feature    392289..393332
FT                   /note="ATP-sulfurylase; Region: ATPS; cd00517"
FT                   /db_xref="CDD:173895"
FT                   /locus_tag="SLGD_00361"
FT   misc_feature    order(392772..392786,392802..392804,393057..393062,
FT                   393066..393071,393162..393167)
FT                   /note="active site"
FT                   /db_xref="CDD:173895"
FT                   /locus_tag="SLGD_00361"
FT   misc_feature    392865..392897
FT                   /note="flexible loop; other site"
FT                   /db_xref="CDD:173895"
FT                   /locus_tag="SLGD_00361"
FT   gene            393367..393966
FT                   /db_xref="GeneID:8818068"
FT                   /locus_tag="SLGD_00362"
FT   CDS_pept        393367..393966
FT                   /product="Adenylylsulfate kinase"
FT                   /gene_family="HOG000228204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00362"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="GI:289549733"
FT                   /db_xref="GeneID:8818068"
FT                   /translation="MSQSSHITWHDSEVTKADRQKQNGHKSAVIWFTGLSGSGKSTVSV
FT                   ALEQALFELGKHAYRLDGDNVRHGLNKNLGFSPEDRKENIRRIGEVSKLLVDAGTIAIT
FT                   AFISPYRVDRDDVRNILEDGEFIEVYTQCSVEECEKRDPKGLYAKARSGEIKEFTGINA
FT                   PYEAPYHPEITINTEQQSVEQAVAHILNYLTDNKYL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470637.1"
FT   misc_feature    393451..393897
FT                   /note="Adenosine 5'-phosphosulfate kinase (APSK) catalyzes
FT                   the phosphorylation of adenosine 5'-phosphosulfate to form
FT                   3'-phosphoadenosine 5'-phosphosulfate (PAPS). The
FT                   end-product PAPS is a biologically 'activated' sulfate form
FT                   important for the assimilation...; Region: APSK; cd02027"
FT                   /db_xref="CDD:30200"
FT                   /locus_tag="SLGD_00362"
FT   misc_feature    393466..393948
FT                   /note="Gluconate kinase [Carbohydrate transport and
FT                   metabolism]; Region: GntK; COG3265"
FT                   /db_xref="CDD:33076"
FT                   /locus_tag="SLGD_00362"
FT   misc_feature    order(393472..393477,393481..393492,393565..393567,
FT                   393592..393594,393607..393609,393616..393618,
FT                   393685..393693,393787..393789,393838..393843)
FT                   /note="ligand-binding site; other site"
FT                   /db_xref="CDD:30200"
FT                   /locus_tag="SLGD_00362"
FT   gene            394271..395491
FT                   /db_xref="GeneID:8818069"
FT                   /locus_tag="SLGD_00363"
FT   CDS_pept        394271..395491
FT                   /product="Acetylornithine deacetylase"
FT                   /gene_family="HOG000221335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00363"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="GI:289549734"
FT                   /db_xref="GeneID:8818069"
FT                   /translation="MTVLSEQERIDILADIVNINTENNNEIEVCYYLKELLQRYDIESK
FT                   IIEIEGKRSNLVAEIGSGRPVIGISGHMDVVDAGDEAQWMYPPFELHEQDGKLYGRGTS
FT                   DMKGGLAALVIAMIEIKASNLLQQGTIRLLATAAEEKEMSGSMLFRDKGYVDDLDGLII
FT                   GEPSDHYINYANKGSMGIKIKAKGVAAHSSLPNLGHNAIDDIIRYIQKIKEKYEDIKNN
FT                   DNKHSLDVSPLIKDYFGDKFNDKELRKLENVAEGLVIVNSIIYGGEQFNTVPESAYAEF
FT                   NIRTIPEYDNEAIIQLFEETLYEVDQAQLSMEITTNHAPVYSNKDNLLVKSFTEYKDDL
FT                   TVTALVGATDASELLKGIDNVDLTIIGPGFMRQAHRANEYIDKQHYLDFIDLYQHVIVD
FT                   YLNKKSN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470638.1"
FT   misc_feature    394286..395476
FT                   /note="succinyl-diaminopimelate desuccinylase; Reviewed;
FT                   Region: PRK08588"
FT                   /db_xref="CDD:169506"
FT                   /locus_tag="SLGD_00363"
FT   misc_feature    394364..395443
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="SLGD_00363"
FT   gene            395880..396650
FT                   /db_xref="GeneID:8818070"
FT                   /locus_tag="SLGD_00364"
FT   CDS_pept        395880..396650
FT                   /locus_tag="SLGD_00364"
FT                   /gene_family="HOG000279823" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Secretory antigen precursor SsaA"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549735"
FT                   /db_xref="GeneID:8818070"
FT                   /translation="MKKIATATIATAGFATIALAGGHDAHAAEQNNNGYNPNDPYSYSY
FT                   SYTIDQQGNYHYTWQGNWSPNQAQQGQYYSYNYTNTAGTQNYNYNTQYSQNYQPQTQAY
FT                   HANNGGGLGASYSTSDRNVKVTTTQAPSSHASNTSGGSAFSGKSGSSSNLYTAGQCTYY
FT                   VFDKVGGKIGSTWGNASNWASAAASEGYNVSNSPKQGAVMQTSQGAYGHVAYVEKVNSD
FT                   GSVKVSEMNYNGGPGVVSTRTISASQASSYNYIS"
FT                   /protein_id="YP_003470639.1"
FT   misc_feature    396336..396644
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="SLGD_00364"
FT   gene            396849..398696
FT                   /db_xref="GeneID:8818071"
FT                   /locus_tag="SLGD_00365"
FT   CDS_pept        396849..398696
FT                   /product="Ribonucleotide reductase of class III
FT                   /gene_family="HOG000222474" [ FAMILY / ALN / TREE ]
FT                   (anaerobic), large subunit"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00365"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="GI:289549736"
FT                   /db_xref="GeneID:8818071"
FT                   /translation="MKQLEAELQGLITKDPAIVNENANKDSNTFSTMRDLTAGVVSKSY
FT                   ALQHLLPKRVAQAHKNGDIHFHDLDYHPFQPLTNCCLIDATSMLQHGFEIGNANVTTPK
FT                   SIQTASAQLVQIIANVSSSQYGGCTVDRVDELLSTYARHNEAHHRKVAETFVRADAIED
FT                   YVDQQVTKDVNDAIESLEYEINTLYTSNGQTPFVTLGFGLGTDKLSRKIQQAILNTRIK
FT                   GLGKNRITAIFPKLVFTIKKGVNFSEEDPNYDVKQLALKCSTKRMYPDVLNYDTLVDIL
FT                   GDFKAPMGCRSFLPAWRDAQGQFENSGRCNLGVVTLNIPRIAIESQGDKLTFWRLFHER
FT                   MDILHEALLYRIERVAQAVPENAPILYKSGAFKYKLQEGEDVTDLFKHRRATISMGYIG
FT                   LYEAATVFYGPNWETNPDAKAFTLDILKEMKDYQLEWTEETDVWFSIYSTPSESLTDRF
FT                   CRLDYERFGSIPDITDKGYYQNSFHYDVRKDITPFEKIDFEKDYPYYASGGFIHYCEYP
FT                   KLNHNLKALEAVWDYAYDKVGYLGTNIPIDRCYECGYEGDFETTAQGYTCPHCGNHDPK
FT                   TVDVVKRTCGYLGNPVQRPVIEGRQKEICARVKHMKEPK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470640.1"
FT   misc_feature    396906..398678
FT                   /note="anaerobic ribonucleoside-triphosphate reductase;
FT                   Region: NrdD; TIGR02487"
FT                   /db_xref="CDD:162883"
FT                   /locus_tag="SLGD_00365"
FT   misc_feature    396909..398618
FT                   /note="Class III ribonucleotide reductase; Region: RNR_III;
FT                   cd01675"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="SLGD_00365"
FT   misc_feature    order(397041..397043,397047..397052,397146..397160,
FT                   397170..397172,397179..397184,397191..397193,
FT                   397335..397337,398199..398210,398217..398219)
FT                   /note="effector binding site; other site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="SLGD_00365"
FT   misc_feature    order(397086..397088,397227..397229,397434..397436,
FT                   397713..397718,397785..397787,398193..398195,
FT                   398202..398204)
FT                   /note="active site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="SLGD_00365"
FT   misc_feature    order(398493..398495,398502..398504,398547..398549,
FT                   398556..398558)
FT                   /note="Zn binding site; other site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="SLGD_00365"
FT   misc_feature    398595..398609
FT                   /note="glycine loop; other site"
FT                   /db_xref="CDD:153084"
FT                   /locus_tag="SLGD_00365"
FT   gene            398698..399234
FT                   /db_xref="GeneID:8818072"
FT                   /locus_tag="SLGD_00366"
FT   CDS_pept        398698..399234
FT                   /product="Ribonucleotide reductase of class III
FT                   /gene_family="HOG000222587" [ FAMILY / ALN / TREE ]
FT                   (anaerobic), activating protein"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00366"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="GI:289549737"
FT                   /db_xref="GeneID:8818072"
FT                   /translation="MSVLDVTEGRGYIAKIEQHSFVDGEGVRVSMYVSGCPFLCEGCYN
FT                   VAAQRFTYGEPFNDETLEAILHYCEPDYIAGLSILGGEPFCNVDITLKVARAFRQKFGH
FT                   RKSLWVWTGFLYEYLSHDAGIRHQLLSLIDVLVDGPFIQALFQPNLAYKGSLNQRVINV
FT                   PASLKKGTPVIYVED"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470641.1"
FT   misc_feature    398731..399189
FT                   /note="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; Region: NrdG; TIGR02491"
FT                   /db_xref="CDD:162885"
FT                   /locus_tag="SLGD_00366"
FT   misc_feature    398761..399177
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="SLGD_00366"
FT   gene            399300..399422
FT                   /db_xref="GeneID:8818073"
FT                   /locus_tag="SLGD_00367"
FT   CDS_pept        399300..399422
FT                   /locus_tag="SLGD_00367"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549738"
FT                   /db_xref="GeneID:8818073"
FT                   /translation="MKLIIIIGQWLIAIGLIVGSILEERHYRKQRQKKQSSQNK"
FT                   /protein_id="YP_003470642.1"
FT   gene            399591..400883
FT                   /db_xref="GeneID:8818074"
FT                   /locus_tag="SLGD_00368"
FT   CDS_pept        399591..400883
FT                   /locus_tag="SLGD_00368"
FT                   /gene_family="HOG000090066" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549739"
FT                   /db_xref="GeneID:8818074"
FT                   /translation="MILFAIEIGIMIAAILLGLRTAGALGCGIFAIVAQLIMIFVFQLP
FT                   PGSAPVTAVLIILSIGIAGGTLQSTGGIDYLVYLASKVIEKYPKSIIFISPIIVFIFVF
FT                   GIGTANIALSLEPIIAKTAMKAGIQPRRPLIASVLTANLALLCSPAAAATAYIISVLAG
FT                   YDISMGKYLSVVFPTAILTMLLLSVFCTLAGRKKEQAQRFELKDLEVKVPTTFPSKVKL
FT                   GVASFLLCVVGILTFGIFPQLMPSFNIDGKSVEVTMTEIVQFFMYLAAAINLLLNKIDT
FT                   TDILSSHITQSAIGALFAVLGPGWLGATVFNAPQNLKILKEDVGAVIQVAPWLVILLVS
FT                   IVAIVVISQTATASIMFPIVLSIGIPPMFFVAMVQTINVNFVIPAQPTLLFAVDLDETK
FT                   RTKVTSFIIPGFFMITVSVLIGFSIKAILGY"
FT                   /protein_id="YP_003470643.1"
FT   misc_feature    399657..400877
FT                   /note="Anaerobic c4-dicarboxylate membrane transporter;
FT                   Region: DcuA_DcuB; cl01040"
FT                   /db_xref="CDD:174501"
FT                   /locus_tag="SLGD_00368"
FT   gene            401806..403431
FT                   /db_xref="GeneID:8818075"
FT                   /locus_tag="SLGD_00369"
FT   CDS_pept        401806..403431
FT                   /locus_tag="SLGD_00369"
FT                   /gene_family="HOG000053240" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="High-affinity choline uptake protein BetT"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549740"
FT                   /db_xref="GeneID:8818075"
FT                   /translation="MKKEKIMDWPTFIGTVVILLLAVIPMMAFPSASEKVITDINSAIS
FT                   NSIGSLYLFIGLAILCFVLYIAFGKYGNVTLGKASDKPEFSNFSWASMLFCAGIGSDIL
FT                   YWGVIEWAYYYQVPPNGAKPMSDQALTFATQYGMFHWGPIAWAIYVLPALPIGYLVFVK
FT                   KQPIYKISQACRPVLKGQTDKFLGKLVDVLFIFGLLGGAATSLALGVPMISAGVEKLTG
FT                   LDGQNMVLRSIILFTITVIFAISSYTGLKKGIQKLSDVNVWLSFLLLGFVFIVGPTIFI
FT                   METTITGFGNMLRDFFHMATWMEPFGGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFI
FT                   ARISKGRRLKEVILGTIVYGTLGCVLFFGIFGNYAVYLQISEQFNVIQYLNSHGTEATI
FT                   IEVMHQLPFPTTVIVLFLLSAFLFLATTFDSGSYILAAATQKKVLGEPLKANRLFWAFA
FT                   LCLLPFSLMLVGGERALEVLKTASILASVPLIVIFICMMVSFIITLSKDRIKLETRADK
FT                   LKEVERRSLRIVQVRENNDEDDNL"
FT                   /protein_id="YP_003470644.1"
FT   misc_feature    401836..403326
FT                   /note="BCCT family transporter; Region: BCCT; cl00569"
FT                   /db_xref="CDD:174291"
FT                   /locus_tag="SLGD_00369"
FT   gene            complement(403484..404044)
FT                   /db_xref="GeneID:8818076"
FT                   /locus_tag="SLGD_00370"
FT   CDS_pept        complement(403484..404044)
FT                   /locus_tag="SLGD_00370"
FT                   /gene_family="HOG000262826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549741"
FT                   /db_xref="GeneID:8818076"
FT                   /translation="MVHSQSNEEKLEAAKDLVINSIGQTMDLYGTNRSVGNLFGTMVFE
FT                   GSMTLDEMREHLQMSKPSMSAGVKKLQEFDLVKQQFTRGSRKQHFIAEKDFFTFFRNFF
FT                   TKKWEREVDTNMAAIIEAEKIITSVLNDEAIDDEIKQDALNIEQQLKHTKIYCQWLSNL
FT                   TTALETGEIFDYFPIPNSQENNN"
FT                   /protein_id="YP_003470645.1"
FT   misc_feature    complement(403505..404014)
FT                   /note="Predicted transcriptional regulators
FT                   [Transcription]; Region: COG1510"
FT                   /db_xref="CDD:31699"
FT                   /locus_tag="SLGD_00370"
FT   gene            404412..405902
FT                   /db_xref="GeneID:8818077"
FT                   /locus_tag="SLGD_00371"
FT   CDS_pept        404412..405902
FT                   /product="Betaine aldehyde dehydrogenase"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00371"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="GI:289549742"
FT                   /db_xref="GeneID:8818077"
FT                   /translation="MKLVEKLSQRQYIDGKWVESSNKNTREIINPYNQEVVFTVTEGTA
FT                   EDAEQAILAARRAFEDGEWSLETSEVRGKKVRAIADKITEHRDELAQLETLDTGKTLGE
FT                   SYADMDDIANVFNYFAGLADKDGGEIINTPIPNTESKVVKEPVGVVTQITPWNYPLLQA
FT                   SWKIAPALATGCSLVMKPSEITPLTTIRVFELMEEVGFPKGVINLILSSGEEVGDTLSG
FT                   HKEVDLVSFTGGIETGKHIMKNAANNVTNIALELGGKNPNIIFADADFDLAVDQALNGG
FT                   YFHAGQVCSAGSRILVHNDIKGDFEKALIDRVGKIKLGNGFDDDTEMGPVISTEHRDKI
FT                   ESYMEIAKKEGATIAIGGKRPDREDLQNGLFFEPTVITNCDTSMRIVQEEVFGPVVTIE
FT                   EFDSEEEVIELANDSIYGLAGAVFTKDLGKAQRVANKLKLGTVWINDFHPYFAQAPWGG
FT                   FKQSGIGRELGKEGLEEYLISKHILTNTKPEPINFFSK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470646.1"
FT   misc_feature    404412..405800
FT                   /note="1-pyrroline-5-carboxylate dehydrogenase;
FT                   Provisional; Region: PRK03137"
FT                   /db_xref="CDD:167499"
FT                   /locus_tag="SLGD_00371"
FT   misc_feature    404445..405893
FT                   /note="Bacillus subtilis NAD+-dependent betaine aldehyde
FT                   dehydrogenase-like; Region: ALDH_BADH-GbsA; cd07119"
FT                   /db_xref="CDD:143437"
FT                   /locus_tag="SLGD_00371"
FT   misc_feature    order(404589..404591,404619..404621,404631..404633,
FT                   404652..404654,404712..404714,404751..404753,
FT                   404763..404765,404793..404795,404799..404801,
FT                   404826..404828,404832..404834,404844..404846,
FT                   405126..405128,405135..405140,405147..405149,
FT                   405156..405161,405234..405236,405246..405248,
FT                   405345..405347,405354..405356,405390..405392,
FT                   405711..405713,405720..405743,405747..405749,
FT                   405762..405764,405768..405773,405786..405788,
FT                   405792..405794,405807..405809,405843..405860,
FT                   405864..405866,405885..405893)
FT                   /note="tetramerization interface; other site"
FT                   /db_xref="CDD:143437"
FT                   /locus_tag="SLGD_00371"
FT   misc_feature    order(404868..404882,404949..404951,404958..404960,
FT                   405048..405050,405060..405062,405102..405104,
FT                   405108..405113,405120..405122,405129..405131,
FT                   405174..405176,405180..405182,405276..405278,
FT                   405426..405428,405579..405581)
FT                   /note="NAD(P) binding site; other site"
FT                   /db_xref="CDD:143437"
FT                   /locus_tag="SLGD_00371"
FT   misc_feature    order(404880..404882,405174..405176,405267..405269,
FT                   405276..405278)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:143437"
FT                   /locus_tag="SLGD_00371"
FT   gene            405994..407700
FT                   /db_xref="GeneID:8818078"
FT                   /locus_tag="SLGD_00372"
FT   CDS_pept        405994..407700
FT                   /product="Choline dehydrogenase"
FT                   /gene_family="HOG000139600" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00372"
FT                   /EC_number="1.1.99.1"
FT                   /db_xref="GI:289549743"
FT                   /db_xref="GeneID:8818078"
FT                   /translation="MSENKSYDYVIIGGGSAGSVLGARLSEDKDKNVLVLEAGRSDYPW
FT                   DLFIQMPAALMFPSGNPFYDWRYQTEEEPHMGRKVDHARGKVLGGSSSINGMIYQRGNP
FT                   LDYEGWAEPEGMESWDFAHCLPYFKKLEKTFGAAPHDQFRGHQGPIKLKRGPATNPLFK
FT                   SFFNAGVEAGYHKTEDVNGFRQEGFGPFDSQVHHGRRMSASRAYLRPAMKRKNLTVKTR
FT                   AFVTELHFEGNKATGVTFKRNGKNHTVNAGEVILSGGAFNTPQLLQLSGIGDADFLKSK
FT                   GIEPRVHLPGVGENFEDHLEVYIQHECKEPVSLQPSLDVKRMPWIGLQWIFARKGAAAS
FT                   NHFEGGAFVRSNDQVAYPNLMFHFLPIAVRYDGQKAPVAHGYQVHVGPMYSNSRGSLKI
FT                   KSKDPFEKPSIVFNYLSTKEDEQEWVEAIRVARNILSQKAMDSFNGGEISPGPSVQTDE
FT                   EILDWVRKDGETALHPSCSAKMGPATDPMAVVDPLTMKVHGMENLRVVDASAMPRTTNG
FT                   NIHAPVLMLAEKAADIIRGKKPLEPQYVDYYIHGKHDPNDGAMEHNPYYPY"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470647.1"
FT   misc_feature    406006..407664
FT                   /note="choline dehydrogenase; Validated; Region: PRK02106"
FT                   /db_xref="CDD:167312"
FT                   /locus_tag="SLGD_00372"
FT   misc_feature    406216..406896
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_N; pfam00732"
FT                   /db_xref="CDD:109776"
FT                   /locus_tag="SLGD_00372"
FT   misc_feature    407170..407583
FT                   /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
FT                   /db_xref="CDD:147408"
FT                   /locus_tag="SLGD_00372"
FT   gene            407948..409126
FT                   /db_xref="GeneID:8818079"
FT                   /locus_tag="SLGD_00373"
FT   CDS_pept        407948..409126
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /gene_family="HOG000241404" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00373"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="GI:289549744"
FT                   /db_xref="GeneID:8818079"
FT                   /translation="MGETLVERLKAKEQRMIDIRRYLHEHPELSFHETETPKYIAEFYK
FT                   DKACDVQTNVGPNGVKVTIDSGKPGKTIAIRADFDALPIQEDTGLSYASQNEGVMHACG
FT                   HDAHTAYMLVLAETLIEMKDQFSGKVVVIHQPAEEMPPGGAKGMIEDGVLEGVDHVLGI
FT                   HVMTNMTSGKIYYHEGNTQTGRAYFKLTIHGEGGHGSSPHTAKDAIVAGANFVTTAQNV
FT                   VSRRLSPFETGVVTIGSFDGKGQFNVIKDTVEIEGDVRALTDATRDTIKYELERIVQGI
FT                   ATSFDVQYDFEFQPDYPALYNDPQFTSYIVETLRQAQLPDVIGVEECEPQPPSEDFAYY
FT                   AQALPSTFLYSGAAPQQGHAYPHHHPKFNIDESSMLVAAEAVGTIVLDYLQG"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470648.1"
FT   misc_feature    407954..409120
FT                   /note="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase [General function
FT                   prediction only]; Region: AbgB; COG1473"
FT                   /db_xref="CDD:31662"
FT                   /locus_tag="SLGD_00373"
FT   misc_feature    <408002..409117
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="SLGD_00373"
FT   gene            409265..409534
FT                   /db_xref="GeneID:8818080"
FT                   /locus_tag="SLGD_00374"
FT   CDS_pept        409265..409534
FT                   /locus_tag="SLGD_00374"
FT                   /gene_family="HOG000279903" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549745"
FT                   /db_xref="GeneID:8818080"
FT                   /translation="MTFYDYMQNFVGDQTPLGELAHYLNKDCQFPKHEKTTDNILSYFI
FT                   DEIELDDEHLETVKRSLSLYEQQTVHFSLVDHIKTEPKENVNED"
FT                   /protein_id="YP_003470649.1"
FT   misc_feature    409322..409459
FT                   /note="Protein of unknown function (DUF1250); Region:
FT                   DUF1250; cl11485"
FT                   /db_xref="CDD:175284"
FT                   /locus_tag="SLGD_00374"
FT   gene            409524..409973
FT                   /db_xref="GeneID:8818081"
FT                   /locus_tag="SLGD_00375"
FT   CDS_pept        409524..409973
FT                   /locus_tag="SLGD_00375"
FT                   /gene_family="HOG000280302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549746"
FT                   /db_xref="GeneID:8818081"
FT                   /translation="MKINEKAPYYALEATSPQTMRIYKNHQHFEYMILESINELIDNGY
FT                   CMLNHLYVNKGQEGAFEQKFLQRQQHLASVPGFRALRFLRPNEQGQHYVIITQWLNHQS
FT                   FKNWQQSSAYSQTHQKRGTSQGADVRLVNRKLSYHIGIICERYTS"
FT                   /protein_id="YP_003470650.1"
FT   misc_feature    409665..409946
FT                   /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
FT                   cl10022"
FT                   /db_xref="CDD:175061"
FT                   /locus_tag="SLGD_00375"
FT   gene            410610..412202
FT                   /db_xref="GeneID:8818082"
FT                   /locus_tag="SLGD_00376"
FT   CDS_pept        410610..412202
FT                   /locus_tag="SLGD_00376"
FT                   /gene_family="HOG000229982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Acyl-coenzyme A synthetase/AMP-(fatty) acid
FT                   ligase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549747"
FT                   /db_xref="GeneID:8818082"
FT                   /translation="MKQSSLLAPETYNIVSEIEKHVSDQDKNAIIYENGHNDPIAVTYA
FT                   DLMKQANQVGHVLLNHGLKKGDKILIMMPRSISTYRIYIAALKLGIAIIPSSEMLRTKD
FT                   LQYRISHGEIDAVITMPEFIKEFLNIEEYTSLTKFVVAGHHEAWISIDDERLNQSEELD
FT                   MAPTSRDDIAILSYTSGTTGNPKAVTHTHGWGFAHMKMAPKHWLSIKEDDLVWATAAPG
FT                   WQKWVWTPFLSIMGSGATAFVYNGKFNPTRYLELLQNFKINVLCCTPTEYRMMAKLSNL
FT                   DKYDIHHLHSAVSAGEPLNKEVVNQFEAHFGLTVRDGYGQTESTLLIGFLKDTKPRPGS
FT                   MGKAIPGSDTTVVDDEGRQVAPGVKGNIGVPLDLPALFKGYYKDEARTKAAHAGKYYIT
FT                   GDLAHIDEDGYFWFEGRSDDIIISSGYTIGPFEVEDALTHHPAVKECAVVASPHEIRGN
FT                   IVKAFVILNEGYKASDDLVKTLQDFTKKTVAPYKYPRAIEFVEDLPKTNSGKIRRVELR
FT                   DAERQKYNQQFKQ"
FT                   /protein_id="YP_003470651.1"
FT   misc_feature    410631..412169
FT                   /note="Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
FT                   [Lipid metabolism]; Region: Acs; COG0365"
FT                   /db_xref="CDD:30714"
FT                   /locus_tag="SLGD_00376"
FT   misc_feature    410721..>411203
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="SLGD_00376"
FT   misc_feature    <411564..412184
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="SLGD_00376"
FT   gene            412451..415075
FT                   /db_xref="GeneID:8818083"
FT                   /locus_tag="SLGD_00377"
FT   CDS_pept        412451..415075
FT                   /product="Pyruvate,phosphate dikinase"
FT                   /gene_family="HOG000039664" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00377"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="GI:289549748"
FT                   /db_xref="GeneID:8818083"
FT                   /translation="MTKYIYAFDEGQRTMKDLLGGKGANLSEMKRLGLPVPDGFTITTE
FT                   ACIEYLRQHAQLPTEVKTQLVDHLAAFTKRTGKAFSSDTNLLLVSVRSGAKISMPGMMD
FT                   TILNLGLNDDNVETLASKTGDVRFAYDCYRRLLQMFGEVVYNIPMVAFDTYFEDYKQRH
FT                   GFENDAAISADGLKDICERFKTIYLEEARKPFPQEPLKQLEEAIEAVFKSWDNDRARVY
FT                   RDLNEIPHDIGTAVNIQEMVFGNSGDKSGTGVAFTRNPVTGENRLFGEYLLNAQGEDVV
FT                   AGIRTPQDIQTLYDQMPDVHQAFVKVTKQLEAHYKDMQDIEFTIENGKLYLLQTRNGKR
FT                   TAKAAVKIAVDLANEGLITQQEAMRKVDVKAIDQLLHPNFDDKALAEATTISTLGLPAS
FT                   PGAATGQIVFSAEDAKVQADSGKKVILMRPETSPEDIEGMVASEAIITTHGGMTSHAAV
FT                   VARGMGKCCVTGCSDLEINTSAKTVYYPDGELHEGDTISVDGSKGDIYFGEIKTVNAEH
FT                   SEDFDQFMTWAEDTARLSVRMNAETPQDIEAGYQFGAKGIGLVRTEHMFFGAERLVEMR
FT                   RFILASSYDERVDALNAIEKYQVEDFEAIFRLSGERPTIVRLLDPPLHEFLPNSAEDIQ
FT                   HVAQQLNISEDILKKRIVDLHEVNPMLGHRGCRLAVTYPELYEMQVEAIISSVIRLKKE
FT                   GINCKPEIMIPLVSTVEEFTVLKEDLVETIHKLEQQAGEKVDYLVGTMIETPRACLIAG
FT                   ELAEHCDFFSFGTNDLTQLAYGFSRDDAGKFINVYTERNILKLDPFQTLDKDGVGRLIQ
FT                   IAVEQAKRVNSNIKIGVCGELGGDAKSIHQFNKLSIDYVSCSPFRVPGAIIATAQSQVE
FT                   ESE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470652.1"
FT   misc_feature    412451..415072
FT                   /note="pyruvate phosphate dikinase; Provisional; Region:
FT                   PRK09279"
FT                   /db_xref="CDD:169769"
FT                   /locus_tag="SLGD_00377"
FT   misc_feature    412487..413533
FT                   /note="Pyruvate phosphate dikinase, PEP/pyruvate binding
FT                   domain; Region: PPDK_N; pfam01326"
FT                   /db_xref="CDD:144793"
FT                   /locus_tag="SLGD_00377"
FT   misc_feature    413714..413956
FT                   /note="PEP-utilising enzyme, mobile domain; Region:
FT                   PEP-utilizers; cl01586"
FT                   /db_xref="CDD:154486"
FT                   /locus_tag="SLGD_00377"
FT   misc_feature    413996..415060
FT                   /note="Malate synthase catalyzes the Claisen condensation
FT                   of glyoxylate and acetyl-CoA to malyl-CoA , which
FT                   hydrolyzes to malate and CoA. This reaction is part of the
FT                   glyoxylate cycle, which allows certain organisms, like
FT                   plants and fungi, to derive their...; Region: malate_synt;
FT                   cl09155"
FT                   /db_xref="CDD:175021"
FT                   /locus_tag="SLGD_00377"
FT   gene            415068..415895
FT                   /db_xref="GeneID:8818084"
FT                   /locus_tag="SLGD_00378"
FT   CDS_pept        415068..415895
FT                   /locus_tag="SLGD_00378"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549749"
FT                   /db_xref="GeneID:8818084"
FT                   /translation="MSSIVKQHVLKLFIVSDSIGETAQRMIQATLTQFPDLTQVEIKKF
FT                   PYIKNEEEFLNVLNLAHEQGAIVATTLVNPSFNSLGHRFAEEKALPYVDYMSELISIVQ
FT                   EQTQTEPLLESGALRKLNDEYFKRIKAIEYSVKYDDGKHFSDIGEADALIVGVSRTSKT
FT                   PLSMYLANKGYKIANIPLVPEVAIPESVFKQKGLKVFGLTASPQYIANIRKNRVETLGL
FT                   TQESQYNSLERIKKELSYAEEVFKKLNATVINTEYKSIEESAFYIEKFLQPKY"
FT                   /protein_id="YP_003470653.1"
FT   misc_feature    415083..415889
FT                   /note="Domain of unknown function (DUF299); Region: DUF299;
FT                   cl00780"
FT                   /db_xref="CDD:174387"
FT                   /locus_tag="SLGD_00378"
FT   gene            416201..417700
FT                   /db_xref="GeneID:8818085"
FT                   /locus_tag="SLGD_00379"
FT   CDS_pept        416201..417700
FT                   /product="Malate:quinone oxidoreductase"
FT                   /gene_family="HOG000109379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00379"
FT                   /EC_number="1.1.99.16"
FT                   /db_xref="GI:289549750"
FT                   /db_xref="GeneID:8818085"
FT                   /translation="MANSQPKDVILIGAGVLSTTFGSMLKELEPNWNIKLYERMDRPAL
FT                   ESSNERHNAGTGHAALCELNYTVEQPDGSIDIEKAKEINEEFEISKQFWGHLVKSGSID
FT                   NPREFINPLPHISFVRGVNNQKFLKKRYEAMKDFPMFDNIEYTEDIETLRKWVPLMMEG
FT                   RVDDGKMAASKIDEGTDVNFGELTRKMTKNIEAHPNAEVHFNHEVLDFNRLKDGKWEVK
FT                   IRNRATGQVQTQVTDYVFIGAGGAAIPLLQKTGIPESKHLGGFPITGQFLACTNPQVIE
FT                   QHDAKVYGKEPPGTPPMTVPHLDARYIDGQRTLLFGPFANVGPKFLKNGSNLDLFKSIK
FT                   PHNITTMLAAAVKNLPLLKYSFDQIIMTKEGCMNHLRTFYPEARDEDWELYTAGKRVQV
FT                   IKDTKEHGKGFIQFGTEVVNSQDHTVIALLGESPGASTSVSVALEVLERNFPEYADDWK
FT                   PKVKEMIPSYGESLITDVDLMRKTRRQTSKDLELGYYDDEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470654.1"
FT   misc_feature    416201..417691
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00379"
FT   misc_feature    416213..417616
FT                   /note="Predicted dehydrogenase [General function prediction
FT                   only]; Region: COG0579"
FT                   /db_xref="CDD:30924"
FT                   /locus_tag="SLGD_00379"
FT   gene            complement(417980..418684)
FT                   /db_xref="GeneID:8818086"
FT                   /locus_tag="SLGD_00380"
FT   CDS_pept        complement(417980..418684)
FT                   /locus_tag="SLGD_00380"
FT                   /gene_family="HOG000279750" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549751"
FT                   /db_xref="GeneID:8818086"
FT                   /translation="MLKYEHVAHEITAAIANGKYKVGDKLPSLAELKIAYQVSKSTIVK
FT                   ALELLEKDGIIYQTRGSGIYVRNSKKSGYINLLKTKGFSDNLQGHRVTSKVLNIDIIPP
FT                   NEETQKHLQIKDKDTQVYLVERIRYLDDKPLCIETSYFNKALVTTLDKEVAQASIFDYL
FT                   QTRLKINIGFSDIYFYIDFLNDNEANYLDLNAQDPCMRHELTFYTSKGEPFDYSNIVYH
FT                   YKHANFFIPIES"
FT                   /protein_id="YP_003470655.1"
FT   misc_feature    complement(417995..418684)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PhnF; COG2188"
FT                   /db_xref="CDD:32371"
FT                   /locus_tag="SLGD_00380"
FT   misc_feature    complement(418484..418678)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="SLGD_00380"
FT   misc_feature    complement(order(418493..418504,418508..418513,
FT                   418541..418543,418550..418555,418559..418573,
FT                   418595..418600,418604..418606,418673..418675))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="SLGD_00380"
FT   misc_feature    complement(418010..418423)
FT                   /note="UTRA domain; Region: UTRA; cl06649"
FT                   /db_xref="CDD:176600"
FT                   /locus_tag="SLGD_00380"
FT   gene            418829..420736
FT                   /db_xref="GeneID:8818087"
FT                   /locus_tag="SLGD_00381"
FT   CDS_pept        418829..420736
FT                   /product="PTS system, beta-glucoside-specific IIB
FT                   /gene_family="HOG000102023" [ FAMILY / ALN / TREE ]
FT                   component/PTS system, beta-glucoside-specific IIC
FT                   component/PTS system, beta-glucoside-specific IIA
FT                   component"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00381"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:289549752"
FT                   /db_xref="GeneID:8818087"
FT                   /translation="MSERDRKLAIHILEAVGGKENIVNYTHCATRLRIVLKRSIPDAKK
FT                   KVASMDGVVTVVENNGQFQVVIGNAVASVYQEFEGLLGEENQQSSDEDSEKGTIINRII
FT                   ATMSAVFAPFIYVLAAAGILQGILIIAKMLFSSFEKTGTYEVFNFISWAPFTFLPIFIA
FT                   ITAAKHFKVNTYIAVACCAALVSPDLAGIVERIGSGHTFTFIGIPLSETSYTSSVLPPL
FT                   LLVWVLSYVEKYLNKYIHEVIRPLFVPFFSIVIMVPLTLLIIGPLASGAAHGIAQGFNW
FT                   LVAVAPWLAGLLIGAFWQVFVIFGVHWGITPMVLANFEQYKSDAFQAFQTIAVIAQFGA
FT                   VMGVFFKTRNKDLKRVSLSAGITGIFGITEPSMYGVNLRFKKPFIIACISGGIGALVAS
FT                   FFNPKYYAYAGLPGPITIVNGYSPDNISSIWGILLGSAVAIILPIILIQVLGYGEDVTE
FT                   QVEGVDVEEGHEINEQTRLTTTSDQLETEIHAPLKGLVVALSEVDDPIFAEGMMGKGLA
FT                   IQPESYEVTAPLKGVISMVAVSKHAIGITSPEGIELLVHVGLDTVQLNGQGFELLVAEN
FT                   DQVEEGQPLLRFDANYIKEQGYELITPVIITNSDEFEDIIIADSQNITSREKIMTVIKK
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_003470656.1"
FT   misc_feature    418847..419077
FT                   /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIB_glc;
FT                   cd00212"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    418850..420727
FT                   /note="PTS system, beta-glucoside-specific IIABC component;
FT                   Region: PTS-II-ABC-beta; TIGR01995"
FT                   /db_xref="CDD:162649"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    418907..418927
FT                   /note="active site turn"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    418910..418912
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    419249..420229
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    420290..420661
FT                   /note="PTS_IIA, PTS system, glucose/sucrose specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_glc;
FT                   cl00162"
FT                   /db_xref="CDD:174012"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    order(420338..420349,420359..420364,420428..420433,
FT                   420437..420442,420458..420466,420482..420490,
FT                   420494..420496,420506..420508,420512..420517,
FT                   420551..420553,420647..420649,420656..420658)
FT                   /note="HPr interaction site; other site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    order(420338..420340,420344..420349,420353..420355,
FT                   420359..420364,420431..420433,420437..420439,
FT                   420449..420451,420488..420490,420494..420496,
FT                   420506..420508,420512..420517,420521..420523,
FT                   420647..420649)
FT                   /note="glycerol kinase (GK) interaction site; other site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    order(420443..420445,420449..420451,420494..420496,
FT                   420500..420502)
FT                   /note="active site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00381"
FT   misc_feature    420494..420496
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29265"
FT                   /locus_tag="SLGD_00381"
FT   gene            420757..422196
FT                   /db_xref="GeneID:8818088"
FT                   /locus_tag="SLGD_00382"
FT   CDS_pept        420757..422196
FT                   /product="6-phospho-beta-glucosidase"
FT                   /gene_family="HOG000088631" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00382"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="GI:289549753"
FT                   /db_xref="GeneID:8818088"
FT                   /translation="MAKLPQDFLWGGALAANQFEGGYDQGGKGLSVIDVMTAGAHGQAR
FT                   EITQDIEPDKYYPNHMGIDFYHRYKEDVALFAEMGLKCLRTSIAWTRIFPNGNETEPNE
FT                   AGLQFYDDLFDELLKYDIQPVITLSHFEMPLHLAREYGGFRNRKVADYFAYFAETVFKR
FT                   YKDKVKYWMTFNEINNQMDINNPIFLWTNSGVSLTDDDNKLEVLYQVAHNELIASAKAV
FT                   KIGKEINPDFEIGAMISHVPIYPYSCNPQDIMEAEIASRMRFFFPDVQARGYYPGYATK
FT                   MFEREGFDIGWQEGDDVILREGKVDYIGFSYYMSTAVKSDNEASVEDNIVNGGLPNSVD
FT                   NPYIKKSDWGWAIDPVGLRYTLNALYNRYQIPLFIVENGFGAVDEFDDKGKIHDEYRIE
FT                   YLREHIEAAIDAVDQDGVELMGYTPWGIIDIVSFTTGEMKKRYGLIHVDRDNDGNGSLE
FT                   RTKKDSFDWYRKVIESNGEVL"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470657.1"
FT   misc_feature    420757..422193
FT                   /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
FT                   cl01046"
FT                   /db_xref="CDD:174504"
FT                   /locus_tag="SLGD_00382"
FT   gene            complement(422369..424210)
FT                   /db_xref="GeneID:8818089"
FT                   /locus_tag="SLGD_00383"
FT   CDS_pept        complement(422369..424210)
FT                   /locus_tag="SLGD_00383"
FT                   /gene_family="HOG000090016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Esterase/lipase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549754"
FT                   /db_xref="GeneID:8818089"
FT                   /translation="MKKTFISLLSATVILSGCGVGEHQNNNSNHDAKGVNTSNVKIKNY
FT                   NQASSALQIDNSKWKYDSKNNVYYQLNISYVSNPQAKNVEKLGIYVPAAYFKGKKNHNG
FT                   TYTVTVNDAKKVNGYSARTAPIVYPVNTPGYAEQSAPTSYRYSNISKYMKAGFIYVEAG
FT                   LRGRSMSMGNNSSNASTKSYETGSPWGVTDLKAAIRYYRFNDSSLPGNSSKIYTFGHSG
FT                   GGAQSAIAGASGDSKLYYKYLEQIGAAMTDKNGKYISDKIDGAMAWCPITSLDQADAAY
FT                   EWQMGQYGNEGNRKKNSFQKQLSTDLASSYASYLNKLNLKNGNTTLSLTKSKNGQYTEG
FT                   SYAKYLKKEIEDSATEFLNNTTFPYKQNSTEQAGMGNGGPSGGKPSGKMGSMPQMRKQS
FT                   SNKTYKTMDAYLKDLNKKGTWITYDKKTKRAHITSLKDFAKYYKQPSKSVSAFDDLKRS
FT                   QAENEVFGTSGSDSKLHFDQSLAKLLTENKSNYSKLNGWNSNYVSSYKNDLTKTDKLGT
FT                   SMSTRMNMYNPMYYLSDYYSGYGKSNVANHWRIRTGIQQGDTALNTETNLSLALKERVG
FT                   SKNVDFKTVWDQGHTMAETSGNSDSNFIKWVESINKK"
FT                   /protein_id="YP_003470658.1"
FT   gene            complement(424350..425228)
FT                   /db_xref="GeneID:8818090"
FT                   /locus_tag="SLGD_00384"
FT   CDS_pept        complement(424350..425228)
FT                   /locus_tag="SLGD_00384"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LysR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549755"
FT                   /db_xref="GeneID:8818090"
FT                   /translation="MEISYLNEFIVLAKYQNYFKASQELYIAQSTLSKHIVSLENECGY
FT                   RLIDRANKQFELTESGKLFLHYAKIICQNYKDLSKQLEQQENDNLITINLGASRLMIEY
FT                   GITNLISKCVQKFSNVRFRIHEGSEQELAQLINEGKIDISFLRSPHPPHDNHSFTYIEE
FT                   SLCAIVHESHPLAYVSQIDLSMLENEQLYLPPEFALEHQAFLNYCEEQQFYPLISFTAP
FT                   RIENLLEMVNTNNGVALIMEQQANYYVTSPLKIVQLNSPIKLYINVNVHNHLIASKEVA
FT                   YLLELAKKHRN"
FT                   /protein_id="YP_003470659.1"
FT   misc_feature    complement(424356..425228)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="SLGD_00384"
FT   misc_feature    complement(425043..425204)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00384"
FT   misc_feature    complement(424368..424955)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cd05466"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="SLGD_00384"
FT   misc_feature    complement(order(424530..424535,424539..424544,
FT                   424560..424577,424851..424871,424875..424877,
FT                   424887..424889,424896..424901,424905..424910))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176102"
FT                   /locus_tag="SLGD_00384"
FT   gene            425347..425478
FT                   /db_xref="GeneID:8818091"
FT                   /locus_tag="SLGD_00385"
FT   CDS_pept        425347..425478
FT                   /locus_tag="SLGD_00385"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549756"
FT                   /db_xref="GeneID:8818091"
FT                   /translation="MFDYEACIYHQMIEDWKRNLSNFKHENLINQILINAMLTGLLV"
FT                   /protein_id="YP_003470660.1"
FT   gene            425590..426168
FT                   /db_xref="GeneID:8818092"
FT                   /locus_tag="SLGD_00386"
FT   CDS_pept        425590..426168
FT                   /locus_tag="SLGD_00386"
FT                   /gene_family="HOG000221100" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549757"
FT                   /db_xref="GeneID:8818092"
FT                   /translation="MFRRHLEGMRQGMAHFEQFDAGRGPRGFGNFGGFGGRHGGRDRFF
FT                   KKGNLQFVILKMLEEESRHGYQIIKDLEERFKGFYSPSPGSVYPILQMLEDRDFVSISK
FT                   DGNKKVYTITDEGKKFLEDNVDQDAFTKRLEQFKNVDFEELKAVREQMQTLFHEFMKAS
FT                   QQTLQDDKKKAEFDVFIQETKERLQQFYK"
FT                   /protein_id="YP_003470661.1"
FT   misc_feature    425734..425958
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00386"
FT   gene            426189..427358
FT                   /db_xref="GeneID:8818093"
FT                   /locus_tag="SLGD_00387"
FT   CDS_pept        426189..427358
FT                   /locus_tag="SLGD_00387"
FT                   /gene_family="HOG000179205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="monooxygenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549758"
FT                   /db_xref="GeneID:8818093"
FT                   /translation="MNIKDIRRVGIIGGGPGGLMLGLLLQHQGFEVNIFEKAGLNVNTD
FT                   RGGSLDIHDDSGQLPLQQAGIIDKFKARARFDGEDTRVLDKNGNVYYEALVDPQIEGGR
FT                   PEIDRGELCDIIFEQLKPETVVYGKAFKSLTHIDNEQIEVTFDDYSTRIFDFVIGSDGA
FT                   FSKVRPYLANTDVEYNGISMVELNVEDVFHQYPDLAEFNKNGKMMAFGDHKAILGQVNG
FT                   DGRIKVYMSYKMDYDEFDQFKAMNRQEIKEQLLHDFRDWDVNLKKYIDYASDDLLLRRI
FT                   YKLPIGFKWDNQANLTLIGDAAHLMSPFAGEGVNMALYDAYLLAEAIKSHVTLQDALKA
FT                   YETDMYQTSEQSARESQANLEEMFGEGNPAKKFGDFFKQVGNLFDVHQA"
FT                   /protein_id="YP_003470662.1"
FT   misc_feature    426270..427178
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00387"
FT   misc_feature    <427074..427307
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00387"
FT   gene            complement(427463..428353)
FT                   /db_xref="GeneID:8818094"
FT                   /locus_tag="SLGD_00388"
FT   CDS_pept        complement(427463..428353)
FT                   /product="Fructose-bisphosphate aldolase class I"
FT                   /gene_family="HOG000073502" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00388"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="GI:289549759"
FT                   /db_xref="GeneID:8818094"
FT                   /translation="MNKEQLEKVKNGKGFIAALDQSGGSTPKALKEYGVGEDQYNNEDE
FT                   MFQLVHDMRTRVVTSPSFTSDKILGAILFEQTMDREVEGKYTGDYLADKGVVPFLKVDK
FT                   GLAEQQNGVQLMKPIDNLDETLDRAVERHIFGTKMRSNILELNEQGIRDVVEQQFEIGK
FT                   QIIAKGLVPIIEPEVNINAKDKAEIEEVLKAELKKGLDALNDDQLVMLKLTIPTKANLY
FT                   KELADHPNVVRVVVLSGGYSRDEANKLLKDNDELIASFSRALASDLRYSQSKEEFDKAL
FT                   GEAVDSIYDASVNKN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470663.1"
FT   misc_feature    complement(427475..428347)
FT                   /note="TIM barrel proteins share a structurally conserved
FT                   phosphate binding motif and in general share an eight
FT                   beta/alpha closed barrel structure. Specific for this
FT                   family is the conserved phosphate binding site at the edges
FT                   of strands 7 and 8. The phosphate...; Region:
FT                   TIM_phosphate_binding; cl09108"
FT                   /db_xref="CDD:176427"
FT                   /locus_tag="SLGD_00388"
FT   misc_feature    complement(427718..427720)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29940"
FT                   /locus_tag="SLGD_00388"
FT   gene            complement(429071..429643)
FT                   /db_xref="GeneID:8818095"
FT                   /locus_tag="SLGD_00389"
FT   CDS_pept        complement(429071..429643)
FT                   /locus_tag="SLGD_00389"
FT                   /gene_family="HOG000134740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LPXTG protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549760"
FT                   /db_xref="GeneID:8818095"
FT                   /translation="MKQMVQIILSVFALFLVLTATSVCVTQADTMSQQDAITTAKQAMA
FT                   RSGGNPDLQNFNTVIDKGNYFKIKITLKTNDSVGTYKVYKNGQVEYKNGKFGVYNLLNP
FT                   NQTYAASEIANTSTHMAQQEQQNNPVDCKKELNRYYVGNIKSTELPQQNASLPETGHTS
FT                   NNIITLAFGILALMSGLALTFMRNSKH"
FT                   /protein_id="YP_003470664.1"
FT   gene            complement(429840..430259)
FT                   /db_xref="GeneID:8818096"
FT                   /locus_tag="SLGD_00390"
FT   CDS_pept        complement(429840..430259)
FT                   /locus_tag="SLGD_00390"
FT                   /gene_family="HOG000280298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549761"
FT                   /db_xref="GeneID:8818096"
FT                   /translation="MYYLKYHLTSACLISMLLLFILFIIDLLTDTTQLAQLLINIDFII
FT                   PKQFTPLWLEILIHLIIGIVVYMMLLLLYRVRKQWYAIGYVASMLSFIVLYPFLIHIAV
FT                   RPIFHFSWSEYSLWLLAHIIFIVCVARSIPFIDKR"
FT                   /protein_id="YP_003470665.1"
FT   gene            430610..431425
FT                   /db_xref="GeneID:8818097"
FT                   /locus_tag="SLGD_00391"
FT   CDS_pept        430610..431425
FT                   /locus_tag="SLGD_00391"
FT                   /gene_family="HOG000222927" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Methionine ABC transporter substrate-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549762"
FT                   /db_xref="GeneID:8818097"
FT                   /translation="MKKWVIMISVLIITLALSACGKDNKEASKTITVAATPAPHGDVLK
FT                   HAQEAMKKKGYDLKVKIVNDYKVPNKLLDKGDVDANFFQHVPYLKAERKSHGYKIEEVG
FT                   KVFTTPMGVYSKKYKHIKDIPDGSTIYVSNNPAEEGRFLSFFVNEGLIKLKKGVKIEDA
FT                   KFEDIAENKKHLKFNNQQGAEFLPKTYNNSEGAAVIMNSNYAIDNGLKPSKDAIAFEGK
FT                   SSPFANIIAVQEGHKKDKKFQELLKVLQSKEIKAYIKKQYGDDVIPYEN"
FT                   /protein_id="YP_003470666.1"
FT   misc_feature    430610..431413
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="SLGD_00391"
FT   gene            431634..432971
FT                   /db_xref="GeneID:8818098"
FT                   /locus_tag="SLGD_00392"
FT   CDS_pept        431634..432971
FT                   /locus_tag="SLGD_00392"
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549763"
FT                   /db_xref="GeneID:8818098"
FT                   /translation="MSKAAQLIEEDGKYFAKSGRIKYYPLVIDHGYGATLVDVDGKSYI
FT                   DLLSSASSQNVGHAPKKVSDAIKAQVDKFIHYTPAYMYHESAVKLSKKLCEIAPGNFEK
FT                   RVTFGLSGSDANDGVIKFARAYTGRPYIISFTNAYHGSTFGSLSMSAISLNMRKHYGPL
FT                   LNGFYHIPFPDNYRGMFEQPTANTVAEYLAPLKEMFAKYVPADEVACIVVETIQGDGGL
FT                   LEPVAGYFEALAALCREHGILIAVDDIQQGLGRTGTWSSVEHFNFIPDMITFGKSLAGG
FT                   LPMSALVARKEIIDSLEAPAHLFTTGANPVSCEAALATIEMLEEDDLLSESVNKGRYVR
FT                   QRMEQWTSRYEYVGDVRGIGLSIGIDIVSNKQNKTRDPEAALKICNYCFEHGVVIIAVA
FT                   GNVLRFQPPLVITYEQLDEALATLEQALQGLQDGQLDTLDIDGQGW"
FT                   /protein_id="YP_003470667.1"
FT   misc_feature    431634..432911
FT                   /note="4-aminobutyrate aminotransferase; Provisional;
FT                   Region: PRK08593"
FT                   /db_xref="CDD:169509"
FT                   /locus_tag="SLGD_00392"
FT   misc_feature    431652..432911
FT                   /note="Acetyl ornithine aminotransferase family. This
FT                   family belongs to pyridoxal phosphate (PLP)-dependent
FT                   aspartate aminotransferase superfamily (fold I). The major
FT                   groups in this CD correspond to ornithine aminotransferase,
FT                   acetylornithine aminotransferase; Region: OAT_like;
FT                   cd00610"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="SLGD_00392"
FT   misc_feature    order(431964..431972,432048..432053,432057..432059,
FT                   432273..432275,432372..432374,432378..432383,
FT                   432459..432461)
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="SLGD_00392"
FT   misc_feature    order(431967..431972,432048..432053,432273..432275,
FT                   432372..432374,432381..432383,432459..432461)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="SLGD_00392"
FT   misc_feature    432459..432461
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99735"
FT                   /locus_tag="SLGD_00392"
FT   gene            433283..434644
FT                   /db_xref="GeneID:8818099"
FT                   /locus_tag="SLGD_00393"
FT   CDS_pept        433283..434644
FT                   /locus_tag="SLGD_00393"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase, family 2"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549764"
FT                   /db_xref="GeneID:8818099"
FT                   /translation="MFSIIIPTYNSEKYIAHTLDKLLSCLYFEEDEIIVINDGSTDSTA
FT                   QILKGYQNHAQIKIINQTNKGVSAARNLGMSLMSPETKLVTFIDDSDYVSTNFFKEASR
FT                   FFLKYPYIKLASAPILIRKGHTLSAQNLNYRFQQRRHVVDITQQYQDIQYHIGGMVFRK
FT                   SLFTHHKYTFDETIDFWEDAKFINTILLDVKSYGLIKHVNYFYNRDDYRSLSINSWKDQ
FT                   NRYAPHIVKNYLELIQRSTDLYGRVLPYIQYLVVLHYLNYILEHNQGYLNLKYIQDNTR
FT                   FNIETKVLLQYISIEMIDALPIDNCYKHILYQHKGMVFPAEKDYKKINIIVHRYHWCSR
FT                   ELHFSLSQEAFDMSDSTQIYIDSHGKLKARAMLIHDKPLIILGVKVKNFSRKTFQIRLP
FT                   RYRLLIGGYFRIIDNERGIKMSIYNPSLGIRMLKKLMYSIKYYSVSSRRNKEVS"
FT                   /protein_id="YP_003470668.1"
FT   misc_feature    433283..434143
FT                   /note="Glycosyltransferases involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane];
FT                   Region: WcaA; COG0463"
FT                   /db_xref="CDD:30811"
FT                   /locus_tag="SLGD_00393"
FT   misc_feature    433292..>433651
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="SLGD_00393"
FT   misc_feature    order(433301..433303,433307..433309,433388..433390,
FT                   433547..433549,433553..433555)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="SLGD_00393"
FT   gene            434644..435768
FT                   /db_xref="GeneID:8818100"
FT                   /locus_tag="SLGD_00394"
FT   CDS_pept        434644..435768
FT                   /locus_tag="SLGD_00394"
FT                   /gene_family="HOG000160579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyltransferase, GT2 family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549765"
FT                   /db_xref="GeneID:8818100"
FT                   /translation="MLISVILPVYNVSDYIEACLDSLLHQSIGQEKIEVILIDDCSTDD
FT                   SVAKMRNYEQQFSHFKLYQCPVNYGAPGKPRNIGVAQATGDFLHFMDPDDILASDAYEQ
FT                   LLASMGDQDDFAMGKMVSFNEDGSTFQHVTFKEYKLNKTYEHVKLDDVPFFSQVKVGVV
FT                   LKLIRKSFYDAHHISFVEGLRNGEDKLVDTLLYTQAQSFSYTPQIIYYYRNRDTGDNKS
FT                   ITHQDVMRSIENDIAAYHICKPFYNKEQLQFFKINALRSIFWKVLDQEFYLIDNSQKLK
FT                   IFTELFDIVNHYEPRIFNLYLRHELPIIHLIQQREYELAISYAALLEARRRYFYSATAL
FT                   QAKAAEIKRFKSSKSYKLHRLVTTIKRTIGLKQR"
FT                   /protein_id="YP_003470669.1"
FT   misc_feature    434656..>434994
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cd00761"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="SLGD_00394"
FT   misc_feature    order(434665..434667,434671..434673,434755..434757,
FT                   434917..434919,434923..434925)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="SLGD_00394"
FT   gene            435765..437792
FT                   /db_xref="GeneID:8818101"
FT                   /locus_tag="SLGD_00395"
FT   CDS_pept        435765..437792
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   glycerophosphotransferase"
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00395"
FT                   /EC_number="2.7.8.12"
FT                   /db_xref="GI:289549766"
FT                   /db_xref="GeneID:8818101"
FT                   /translation="MNILLVLFKTRNMNVQQYKALKHCEAFKHVETIYIADEKSINIDI
FT                   KGYDYILFANPNFTFNHVELEQAIQTLQSSDATAVQWTLRDVKYLKQMPYTYNNYREWF
FT                   ATILIRRDETQEHCDLMTYFQATATITSKAYISANYIGRNTQNKEYKHDIIDLTIDLLE
FT                   SLSTAQIIGGFASKKDLIHFLDFVIDNQVFERDVDKEKQLKLMKIIAQKFSGLKELRER
FT                   KQTRLYLFYGLVFKRYFDEALSALTLYRSRRYWYQVNQNLEQNRDNEFEQLRTSDAWIK
FT                   TQKYRDARIKLQLILKYLEKYSLKCFAHLFKMIIHKPIWLISERKDSASDNSYFLFKYL
FT                   TQQCSEIKAYYILDKHAKHARAKVKNLGKVINFGSIKHKLLMLAADNYITSFTAEETLL
FT                   PYNNQLYKHIYQQELAQKKIISIQHGMIIHNISPYLSKNNYLVNYITANNQFEKQIITE
FT                   TLGYDEHEVLITGMARHDNLLETSVEISESQKVLFMPTWQRGLQYLTTAQFLSSEYYHK
FT                   MVELLNNSTVLDFLQRYNLTLRVLLHPQFDKYSKYLMSEHAEIEFCSMSDVEIPTAIAQ
FT                   SKFLITDFSSVAVDFLFQQKNVIFYQYNKYLSHHVPSKQIQYRDIGQVVTTIEQVTEAL
FT                   QKLAANDFKLLPQYQIAYDKLFEVKHHINQTLVDTIKQLK"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470670.1"
FT   misc_feature    436638..437738
FT                   /note="Putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC
FT                   [Cell envelope biogenesis, outer membrane]; Region: TagB;
FT                   COG1887"
FT                   /db_xref="CDD:32071"
FT                   /locus_tag="SLGD_00395"
FT   misc_feature    437196..437747
FT                   /note="CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase; Region: Glyphos_transf;
FT                   pfam04464"
FT                   /db_xref="CDD:113242"
FT                   /locus_tag="SLGD_00395"
FT   gene            437872..439644
FT                   /db_xref="GeneID:8818102"
FT                   /locus_tag="SLGD_00396"
FT   CDS_pept        437872..439644
FT                   /locus_tag="SLGD_00396"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Putative major teichoic acid biosynthesis protein
FT                   C"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549767"
FT                   /db_xref="GeneID:8818102"
FT                   /translation="MYQFEDRIGIFLQKFPLTFEINNHMVTLDLKHHFSSGIISGLKIK
FT                   MALDVEAREPIILDDINPLYIVTIHVDKEALYITLTAKDTLVTIHCQGNQLQLISDYKC
FT                   TTYLGQLVAGTMLPTAKYFVTKDKHIIMEDMLTMMQHLAIRQQRWSVYVQLKDDCGNQH
FT                   VEKVQLTDWIHQNKALLAQYSVDYHQKDNFLLYGNVQQQVTSLPISIQAVNQRLYSLTC
FT                   DRELAHDTIYLALRSRQGNPFHYREYVEFPTIKQSAIIDLGQLHKIYTKDGDNFDVLIG
FT                   KNFETARFVIPTNHKQIDTRYVTLSNTMNAKFYINGRGGLSLYVLEKTQSQAYEVPKIA
FT                   VLGTCFSRNGLNTSPYFNPDYKKYMNCVFTQFHSRLDALNAVPAPASLMQQYKQHHEFE
FT                   HIARDMAKTFYDELRQSGAEILVIDLYADALLTSLKLNNGSKITYNYLIKDNPNLGDYV
FT                   SEWNAHEFDNDTDYYNEWLAELHKFMHHITNIIPESHIILNRGRLAEKYSEEGQLKTFS
FT                   TIQQIKKANEIWENLDNLLLQHYPQVKVIDLTGKQYHADKNHPFGFSYSHYESQYYKDY
FT                   FSELVKQVLLIKAL"
FT                   /protein_id="YP_003470671.1"
FT   gene            complement(440017..441225)
FT                   /db_xref="GeneID:8818103"
FT                   /locus_tag="SLGD_00397"
FT   CDS_pept        complement(440017..441225)
FT                   /locus_tag="SLGD_00397"
FT                   /gene_family="HOG000250622" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Amino acid transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549768"
FT                   /db_xref="GeneID:8818103"
FT                   /translation="MSSAMPFAGSAYSWVNVLFGEFFGWVAGWALLAEYFIAVAFVASG
FT                   FSANLRGLISPLGIKLPTSLSAPFGANGGIIDIIAAVVIILTALLLSRGMTEAARIENI
FT                   LVVLKIFAILLFVVVGLTALHVQNYIPFIPEHKVTDTGDFGGWQGVYAGVSMIFLAYIG
FT                   FDSIAANSAEAINPSKTMPRGILGSLVVAIILFVAVALVLVGMFHYSQYANNAEPVGWA
FT                   LRQSGHGVVAAIVQGISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLAKLNHKHLPN
FT                   RSLIILTIIVVIIGSMFPFAFLAQLISAGSLVAFMFVSIAMYRLRKREGNDLPVPGFKV
FT                   PLYPVLPAITFVLVFLVFWGLSYEAKLYTLIWFVVGIVIYLFYGVRHSKKNEEPEYIVP
FT                   KQK"
FT                   /protein_id="YP_003470672.1"
FT   misc_feature    complement(440077..441225)
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="SLGD_00397"
FT   gene            441883..442764
FT                   /db_xref="GeneID:8818104"
FT                   /locus_tag="SLGD_00398"
FT   CDS_pept        441883..442764
FT                   /locus_tag="SLGD_00398"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LysR family regulatory protein CidR"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549769"
FT                   /db_xref="GeneID:8818104"
FT                   /translation="MEIKQIKYFVEVVRQGEMTQASEHLYIAQSTISKAIKSIENEYNI
FT                   TLFDRSQKQIKLTDIGQTFYDNSLEFLALFEKLSLEMNDVVNLQKGHIRIGLSPMMNVQ
FT                   MFTDSLNQFHQQYPKVTYEVIEGGGKVVEHNIDNDEIDIGITTLPVDSSVYHSYSLYDE
FT                   ELLLVVSKAHPLSQRTKVDFAELEDEEFILFHDDFYLKDQIIENCKRIGFYPKTVANIS
FT                   QINFIENMISQGLGISVVPQSLYNMMGDEVTALKLENARLSWHLGVIWRKDTYLSHVTR
FT                   EWIQTIGHLSPK"
FT                   /protein_id="YP_003470673.1"
FT   misc_feature    441883..442743
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   LysR; COG0583"
FT                   /db_xref="CDD:30928"
FT                   /locus_tag="SLGD_00398"
FT   misc_feature    441889..442068
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="SLGD_00398"
FT   misc_feature    442156..442743
FT                   /note="The C-terminal substrate binding domain of LysR-like
FT                   transcriptional regulator CidR, contains the type 2
FT                   periplasmic binding fold; Region: PBP2_CidR; cd08438"
FT                   /db_xref="CDD:176129"
FT                   /locus_tag="SLGD_00398"
FT   misc_feature    order(442201..442206,442210..442215,442222..442224,
FT                   442234..442236,442240..442260,442534..442551,
FT                   442567..442572,442576..442581)
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:176129"
FT                   /locus_tag="SLGD_00398"
FT   gene            443216..444880
FT                   /db_xref="GeneID:8818105"
FT                   /locus_tag="SLGD_00399"
FT   CDS_pept        443216..444880
FT                   /product="Acetolactate synthase, catabolic"
FT                   /gene_family="HOG000258447" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00399"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="GI:289549770"
FT                   /db_xref="GeneID:8818105"
FT                   /translation="MTKKNYSAADMVIDTLKNNNVDYVFGIPGAKIDYLFNALEDDGPE
FT                   LIVTRHEQNAAMMAQGIGRITGKPGVALVTSGPGVSNLTTGLLTATSEGDPVLAIGGQV
FT                   KRNDLLRLTHQAVDNVDLLKSSTKYSAEVQDPESLSEVMTNAIRTATSGKNGATFISIP
FT                   QDVIQSPVNNKAIALCQKPTLGVPSLQDIKDVITKISNAKFPVLLAGMRSSSEAETEAI
FT                   RHLVEKSNLPVVETFQGAGVISRDLENHFFGRVGLFRNQVGDQLLKKADLVVTIGYDPI
FT                   EYEASNWNHELDTEIINIDEVAAEITNHLRPEKELIGNIAGTIELISENIDAPIIDDKH
FT                   LNDLEKLRAEVIETSGIKCTHVDGVLHPLEIIETMQKSLSDDTTVTVDVGSHYIWMARK
FT                   FRSYNPRHLLFSNGMQTLGVALPWAIAAALVRPNTQVVSVAGDGGFLFSGQDLETAVRK
FT                   KLNIIQLIWNDGKYNMVEFQEEMKYKRSAGVEFGPVDYVKYAESMGAKGMRVTTQEELE
FT                   AAIKEGYETEGPVLIDIPVNYQDNIKLSTNVLPDSLN"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470674.1"
FT   misc_feature    443219..444877
FT                   /note="acetolactate synthase; Reviewed; Region: PRK08617"
FT                   /db_xref="CDD:169518"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    443243..443707
FT                   /note="Pyrimidine (PYR) binding domain of POX and related
FT                   proteins; Region: TPP_PYR_POX_like; cd07035"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    order(443282..443284,443297..443302,443312..443314,
FT                   443324..443326,443348..443368,443375..443377,
FT                   443384..443389,443396..443401,443405..443413,
FT                   443447..443449,443468..443470,443480..443482,
FT                   443489..443494)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    order(443297..443305,443312..443314,443324..443326,
FT                   443351..443353,443357..443368,443372..443374,
FT                   443447..443449,443456..443461,443465..443470,
FT                   443477..443479,443579..443581,443588..443590)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    order(443297..443299,443369..443371,443447..443449,
FT                   443459..443461)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132918"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    443789..444196
FT                   /note="Thiamine pyrophosphate enzyme, central domain;
FT                   Region: TPP_enzyme_M; pfam00205"
FT                   /db_xref="CDD:143962"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    444317..444847
FT                   /note="Thiamine pyrophosphate (TPP) enzyme family,
FT                   TPP-binding module; found in many key metabolic enzymes
FT                   which use TPP (also known as thiamine diphosphate) as a
FT                   cofactor. These enzymes include, among others, the E1
FT                   components of the pyruvate, the acetoin...; Region:
FT                   TPP_enzymes; cl01629"
FT                   /db_xref="CDD:174655"
FT                   /locus_tag="SLGD_00399"
FT   misc_feature    order(444464..444466,444536..444547,444620..444622,
FT                   444626..444628)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48162"
FT                   /locus_tag="SLGD_00399"
FT   gene            444913..445617
FT                   /db_xref="GeneID:8818106"
FT                   /locus_tag="SLGD_00400"
FT   CDS_pept        444913..445617
FT                   /product="Alpha-acetolactate decarboxylase"
FT                   /gene_family="HOG000047087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00400"
FT                   /EC_number="4.1.1.5"
FT                   /db_xref="GI:289549771"
FT                   /db_xref="GeneID:8818106"
FT                   /translation="MSHVLYQHGTLGTLMAGLLEGTATIDELLKHGDSGLATLTGSNGE
FT                   VIFLNGEAFHANEYKEFTKLKGDEKTPYATITHFEADETYQTSDKSSEEVLNEVESHML
FT                   SKNMFSAVKISGTFKKMHVRMMPKQEPPYTRLIDSARRQPEETAENIKGTIIGFYTPEL
FT                   FHGIGSAGFHIHFANDDRNLGGHVLDFIVDDVTVEIQNFETFEQHFPINNKTFTETEID
FT                   YGDVADEIREAE"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470675.1"
FT   misc_feature    444925..445581
FT                   /note="Alpha-acetolactate decarboxylase; Region:
FT                   AAL_decarboxy; cl01408"
FT                   /db_xref="CDD:163978"
FT                   /locus_tag="SLGD_00400"
FT   gene            445635..447236
FT                   /db_xref="GeneID:8818107"
FT                   /locus_tag="SLGD_00401"
FT   CDS_pept        445635..447236
FT                   /locus_tag="SLGD_00401"
FT                   /gene_family="HOG000253321" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="L-lactate permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549772"
FT                   /db_xref="GeneID:8818107"
FT                   /translation="MLVESFNPFNNMLISAIVAAVPIILFLLCLTVFKMKGVYAALTTL
FT                   IVTALVAMICFKLPARIAGGATFEGFYQGIIPIGFIVIMAVWLYKIATESGQFNIVQDS
FT                   IASISQDQRIQLLLIGYLFNGFLEGAAGFGVPIAICAVLLMQLGFKALPAAMYCLVANA
FT                   AAGAYGAVGIPIAITDTLNLAGGVKASQVALIGNLTLGLISFFVPFLLMFIIDGLKGVK
FT                   ETFPATLIAASVFTGLQVLIAAFAGPELADIIPGLGAMVALALFSRKFQPKNIFRLEDN
FT                   EAVGKVEKHSIKQIVYGWSPFIILTVIVMVWSLPAFKALFEKGGALSALVVNFNAPGTM
FT                   NNVTHHPNVLTFNFIAQTGTAILVTAIITILIAKHMSFKTAGKLLGVTVKELWVSVLTI
FT                   CFILAVSKITTYGGLSNAMGQGIAKTGAIFPLLSPVLGWIGVFMTGSVVNNNSLFAPIQ
FT                   ASVATQIGTKGSLLVAANVAGGVTAKIVSPQSIAIATAAVNKVGKESELMKMAMRFSIG
FT                   LLIFACIWTFMLSLFV"
FT                   /protein_id="YP_003470676.1"
FT   misc_feature    445644..447206
FT                   /note="L-lactate permease; Provisional; Region: PRK10420"
FT                   /db_xref="CDD:170425"
FT                   /locus_tag="SLGD_00401"
FT   misc_feature    445665..447230
FT                   /note="L-lactate permease; Region: Lactate_perm; cl00701"
FT                   /db_xref="CDD:163899"
FT                   /locus_tag="SLGD_00401"
FT   gene            447425..447925
FT                   /db_xref="GeneID:8818108"
FT                   /locus_tag="SLGD_00402"
FT   CDS_pept        447425..447925
FT                   /locus_tag="SLGD_00402"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549773"
FT                   /db_xref="GeneID:8818108"
FT                   /translation="MNKFKNKMINSLLGTIGDKDEREIAIINAKFTTVFLTAYVLLFCL
FT                   LLLGVILDAMHDTISVLTMAITIVFLIINIQTLVLMRKEKLDDLTVYSDKEYVQLIKKL
FT                   KRQSVVGGFFFGALTTLFDMVFRFFNDTDVTVWFAVSKNILPGLVFGVLAYFFAKSKVR
FT                   KDY"
FT                   /protein_id="YP_003470677.1"
FT   gene            447943..448440
FT                   /db_xref="GeneID:8818109"
FT                   /locus_tag="SLGD_00403"
FT   CDS_pept        447943..448440
FT                   /locus_tag="SLGD_00403"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549774"
FT                   /db_xref="GeneID:8818109"
FT                   /translation="MSRLNDFLIKWFTNSSTDKDEREKIQLNERLANMYMITTILIALL
FT                   LLLSVIDIIHTQQIMMTHVAVFILFFGLNIISLVIMGKGGLDHSRVNSKAEYRHLIKKY
FT                   AVICIGFAIYFGLALFGLDLLFDAVGGIKTYGGNPINYIVGGIVMGILMYIMRVVKIKK
FT                   EY"
FT                   /protein_id="YP_003470678.1"
FT   gene            448512..449234
FT                   /db_xref="GeneID:8818110"
FT                   /locus_tag="SLGD_00404"
FT   CDS_pept        448512..449234
FT                   /locus_tag="SLGD_00404"
FT                   /gene_family="HOG000011198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF208"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549775"
FT                   /db_xref="GeneID:8818110"
FT                   /translation="MIDAEPIVLKMKNQKINYDRVLKKLIQQWKRAEQKPKILLHSCCA
FT                   PCSTYTLEYLTQFADIGVYFANPNIHPKNEYLRRAKVQEQFIADFNERTGNHVQYIEAP
FT                   YEPQTFMKMAKSRGLMDEPEGGLRCSACFEMRLDLVADAAQRFGYNYFGSALTLSPKKN
FT                   AQLINELGMKVQETYDVYYLPSDFKKNKGYERSLEMCRDYNVYRQCYCGCVFAAMRQGI
FT                   DFKEVNKEAKVFLEQYQS"
FT                   /protein_id="YP_003470679.1"
FT   misc_feature    448608..449231
FT                   /note="Uncharacterized BCR, COG1636; Region: DUF208;
FT                   cl00708"
FT                   /db_xref="CDD:153948"
FT                   /locus_tag="SLGD_00404"
FT   gene            complement(449327..450391)
FT                   /db_xref="GeneID:8818111"
FT                   /locus_tag="SLGD_00405"
FT   CDS_pept        complement(449327..450391)
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /gene_family="HOG000225103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SLGD_00405"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="GI:289549776"
FT                   /db_xref="GeneID:8818111"
FT                   /translation="MYKLIKPLLFKIEPEKAHGLTIDALKLLQKAPFIFPIVKKLFVYE
FT                   DPSLKQTIQGNTYDNPVGLAPGFDKSCEVPKALEYLGFGALELGGITPKPQDGNPKPRM
FT                   YRLLEDDALINRMGFNNIGMNRALFNIRRHAYSIPVGLNVGVNKTTPYEERDQDYIKVM
FT                   DTFKADVDFFTVNISSPNTENLQSFHDKDEFTMLCNALKEFKAQTDIQVPIYLKLTSDL
FT                   NLDDFKNILPSITETFDGMILANTTRRREGLSSDNKNEEGGLSGRPLFKRNLELVKWAY
FT                   QQTKGQFLIIGTGGIFSTDDAIQMMRNGASLIQIYSSLVIEGPGLTKKINKGIAQYLTK
FT                   NNYTNVKDIIGLDA"
FT                   /transl_table="11"
FT                   /protein_id="YP_003470680.1"
FT   misc_feature    complement(449390..450376)
FT                   /note="Dihydroorotate dehydrogenase (DHOD) class 2. DHOD
FT                   catalyzes the oxidation of (S)-dihydroorotate to orotate.
FT                   This is the fourth step and the only redox reaction in the
FT                   de novo biosynthesis of UMP, the precursor of all
FT                   pyrimidine nucleotides. DHOD...; Region: DHOD_2_like;
FT                   cd04738"
FT                   /db_xref="CDD:73400"
FT                   /locus_tag="SLGD_00405"
FT   misc_feature    complement(order(450074..450076,450338..450340))
FT                   /note="quinone interaction residues; other site"
FT                   /db_xref="CDD:73400"
FT                   /locus_tag="SLGD_00405"
FT   misc_feature    complement(449333..450250)
FT                   /note="Dihydroorotate dehydrogenase [Nucleotide transport
FT                   and metabolism]; Region: PyrD; COG0167"
FT                   /db_xref="CDD:30516"
FT                   /locus_tag="SLGD_00405"
FT   misc_feature    complement(order(449441..449446,449507..449509,
FT                   449594..449596,449654..449662,449741..449743,
FT                   449849..449851,449855..449857,449864..449866,
FT                   450035..450043,450047..450049,450122..450124,
FT                   450182..450184,450194..450196))
FT                   /note="active site"
FT                   /db_xref="CDD:73400"
FT                   /locus_tag="SLGD_00405"
FT   misc_feature    complement(order(449741..449743,449855..449857,
FT                   450182..450184))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:73400"
FT                   /locus_tag="SLGD_00405"
FT   misc_feature    complement(order(449441..449446,449507..449509,
FT                   449594..449596,449657..449662,449741..449743,
FT                   449864..449866,450047..450049,450122..450124))
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73400"
FT                   /locus_tag="SLGD_00405"
FT   misc_feature    complement(order(449654..449659,449858..449860,
FT                   449864..449866,450047..450049))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73400"
FT                   /locus_tag="SLGD_00405"
FT   gene            450701..451555
FT                   /db_xref="GeneID:8818112"
FT                   /locus_tag="SLGD_00406"
FT   CDS_pept        450701..451555
FT                   /locus_tag="SLGD_00406"
FT                   /gene_family="HOG000023913" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fructosamine-3-kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549777"
FT                   /db_xref="GeneID:8818112"
FT                   /translation="MNQQWIDQLPLDNIRDVAPVSGGDVNEAFKVTTKDSTYFLLVQRN
FT                   RDQSFYAAEIAGLNAFEAADITAPRVIDNGSINGDAFLILSYLDEGRTGSQRELGQLVA
FT                   KMHSEQQSNGQFGFDLPHEGGDISFDNSWTDSWIELFVARRMDHLRDELMHKGLWNEED
FT                   DKVYQQVRMVMINELEAHQSKPSLLHGDLWGGNYMFLTDGRPALFDPAPLYGDREFDLG
FT                   ITTVFGGFTDEFYDEYAKHYPMAKGAEKRLEFYRLYLFMVHLLKFGGMYANSVNRSMAE
FT                   ILK"
FT                   /protein_id="YP_003470681.1"
FT   misc_feature    450707..451453
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="SLGD_00406"
FT   misc_feature    450746..451465
FT                   /note="Phosphotransferase enzyme family; Region: APH;
FT                   pfam01636"
FT                   /db_xref="CDD:145007"
FT                   /locus_tag="SLGD_00406"
FT   misc_feature    order(450770..450772,450782..450784,450815..450817,
FT                   450821..450823,450905..450907,450953..450964,
FT                   451271..451273,451283..451288,451292..451294,
FT                   451322..451327,451379..451381)
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SLGD_00406"
FT   misc_feature    order(450770..450772,451271..451273,451379..451381)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SLGD_00406"
FT   misc_feature    order(450782..450784,450815..450817,450821..450823,
FT                   450905..450907,450953..450964,451271..451273,
FT                   451283..451288,451292..451294,451322..451327)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SLGD_00406"
FT   gene            complement(451917..452753)
FT                   /db_xref="GeneID:8818113"
FT                   /locus_tag="SLGD_00407"
FT   CDS_pept        complement(451917..452753)
FT                   /locus_tag="SLGD_00407"
FT                   /gene_family="HOG000280291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549778"
FT                   /db_xref="GeneID:8818113"
FT                   /translation="METLKLQGAKLRYHKVGNGPLLILIPGANGTGDIFMPLAQQLKDT
FT                   FTIVAVDRRGYGESELTEPLPDEAINPNSRYRIKRDAQDIAELAKSLSNEPVYILGSSS
FT                   GSIVAMHVLKDYPDIVKRIAFHEPPINTFLPDAKYWQDKNAEIIDVAINEGMPQAMKLF
FT                   GETLHISQLDAEYMSKPAQSSDDAESKKVFEQMMNWFKYEIRQYTESDISIEDFSKHKE
FT                   LITLLNGTDSKGSFPQDVNFYISKHTGIDIIDIPGGHLGYAQKPEGFANVLREMWG"
FT                   /protein_id="YP_003470682.1"
FT   misc_feature    complement(451929..452753)
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="SLGD_00407"
FT   misc_feature    complement(451929..452618)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="SLGD_00407"
FT   gene            complement(452799..453800)
FT                   /db_xref="GeneID:8818114"
FT                   /locus_tag="SLGD_00408"
FT   CDS_pept        complement(452799..453800)
FT                   /locus_tag="SLGD_00408"
FT                   /gene_family="HOG000254104" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549779"
FT                   /db_xref="GeneID:8818114"
FT                   /translation="MKSINFEEHYVIEDIQQETMKYMSPDPNGVPLKTMLDGLALKSGF
FT                   TDADKLSYHDKRIGFMDKHDVQMQVLSYGNGSPSNLQGERAIELCQQANDTLADYIKQY
FT                   PERFVGFATLPINEPEAAIEELKRCITELGFKGALIMGHPNGGFLNQDAYEGLFAAAEE
FT                   LNAPIYLHPSPVQSDVYQAYYKGNYPEVTAATFACFGYGWHVDVGIHAIHLVLSGIFDR
FT                   YPNLNIIIGHWGEFIPFFLERMDTILVAEHLAHPISYYFKNNFYITPSGMLTKPQFDLV
FT                   KAELGVDRILYSADYPYVEPEELGTFLSDLGLTKEEQEKISYTNGAKLLGIE"
FT                   /protein_id="YP_003470683.1"
FT   misc_feature    complement(452805..453797)
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="SLGD_00408"
FT   gene            complement(453832..454536)
FT                   /db_xref="GeneID:8818115"
FT                   /locus_tag="SLGD_00409"
FT   CDS_pept        complement(453832..454536)
FT                   /locus_tag="SLGD_00409"
FT                   /codon_start="1"
FT                   /product="Short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549780"
FT                   /db_xref="GeneID:8818115"
FT                   /translation="MERIVLITGGNKGLGFETAKVLQQKGYNVYIGSRDAERGRQAADE
FT                   LGVKYVQLDVTDDISIQQAYLQIQDREGRLDILINNAGISGGFKKPADLTVNDVQQVYN
FT                   TNVFGIVRMMHTFIPLLEKSEQPVVVNVSSGLGSFGMVTNPNTQESKVNSLAYCSSKSA
FT                   VTMITLQYAKGLPHIQINAADPGSTNTDLVGDFSNNAKPASEGIIPIVKLATIDKDGPT
FT                   GTFIDSNGSMPW"
FT                   /protein_id="YP_003470684.1"
FT   misc_feature    complement(453835..454536)
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]; Region: FabG; COG1028"
FT                   /db_xref="CDD:31231"
FT                   /locus_tag="SLGD_00409"
FT   misc_feature    complement(<453925..454530)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00409"
FT   gene            complement(454536..455093)
FT                   /db_xref="GeneID:8818116"
FT                   /locus_tag="SLGD_00410"
FT   CDS_pept        complement(454536..455093)
FT                   /locus_tag="SLGD_00410"
FT                   /gene_family="HOG000280290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549781"
FT                   /db_xref="GeneID:8818116"
FT                   /translation="MRKDALKNRQRIESKALELFNAEGVEHISMNRIAKELNIGMGTLY
FT                   RHFKDKGDLCYHIIEHDFDDIMQDMLTIKQQYTSARDIMQYSLDIFLAFKTDKSDLLNC
FT                   IEGNDNTKLFRDSNFFKNLNQFYFELFYDYNDTSWAIFKTDMFLKSLTTTTFEFQKSER
FT                   QLSNETFRDNLIKLYLPNEVTK"
FT                   /protein_id="YP_003470685.1"
FT   misc_feature    complement(454932..455048)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="SLGD_00410"
FT   gene            455223..455522
FT                   /db_xref="GeneID:8818117"
FT                   /locus_tag="SLGD_00411"
FT   CDS_pept        455223..455522
FT                   /locus_tag="SLGD_00411"
FT                   /gene_family="HOG000280289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549782"
FT                   /db_xref="GeneID:8818117"
FT                   /translation="MSLNKEQRRVTSAELKAHFHQSTLTIEALAQTLNISAAEVRNVLD
FT                   MHAPNGIFGNKLHTFIHLVWDVRDLINENIRQNGNEPKAYSYLKGEKEDYWFLQ"
FT                   /protein_id="YP_003470686.1"
FT   misc_feature    455223..455516
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2316); Region: DUF2316; cl01805"
FT                   /db_xref="CDD:154598"
FT                   /locus_tag="SLGD_00411"
FT   gene            455534..456352
FT                   /db_xref="GeneID:8818118"
FT                   /locus_tag="SLGD_00412"
FT   CDS_pept        455534..456352
FT                   /locus_tag="SLGD_00412"
FT                   /gene_family="HOG000280288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549783"
FT                   /db_xref="GeneID:8818118"
FT                   /translation="MKKSILVIGATGKQGNAVVKQLLHEGWQVRAYTRNKQNDKLTTIK
FT                   HKNLEIFEGDLGNLDSLKQAMEDQFGVYSVQPIILDNVTEEIRQGKMIINTAYQQGIEH
FT                   IIYSTAGGVNRNRTGPHFEALAQIENELQNSPLNYTIIKPAFFMDNFLRIITVEDGVIY
FT                   IPEFINKAVKFAMISSIDIAKIAAHIFKNTKQFNHRAIEIASDERTLEEVVKTFATVTG
FT                   KPAQIKGSYSSGTAEREWLEDKGYEIDFNQMENINPQQLSLQQWIDKAGF"
FT                   /protein_id="YP_003470687.1"
FT   misc_feature    455543..>456091
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="SLGD_00412"
FT   misc_feature    455546..456208
FT                   /note="NmrA-like family; Region: NmrA; pfam05368"
FT                   /db_xref="CDD:114110"
FT                   /locus_tag="SLGD_00412"
FT   gene            456380..456754
FT                   /db_xref="GeneID:8818119"
FT                   /locus_tag="SLGD_00413"
FT   CDS_pept        456380..456754
FT                   /locus_tag="SLGD_00413"
FT                   /gene_family="HOG000232012" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:289549784"
FT                   /db_xref="GeneID:8818119"
FT                   /translation="MQSMWFNLHVKDLKRSEQFYENLGFKINKNPDMLDKMVGISIGET
FT                   IVILIENNHFENITHDKTLAQPNEVIISLGVKTNSEVDVLVQKVEQAGGTIIDKPGFYQ
FT                   GYYGAMFADPDGHKYNFLVC"
FT                   /protein_id="YP_003470688.1"
FT   misc_feature    456386..456751
FT                   /note="This conserved domain belongs to a superfamily
FT