(data stored in SCRATCH zone)

HOGENOMDNA: STCOE1_1

ID   STCOE1_1; SV 3; empty ; DNA; empty ; UNC; 8667507 BP.
XX
AC   NC_003888;
XX
PR   Project: 57801;
XX
DE   Streptomyces coelicolor A3(2) chromosome, complete genome.
XX
OS   Streptomyces coelicolor A3(2)
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Streptomycineae; Streptomycetaceae; Streptomyces.
XX
RN   [1]
RP   1-8667507
RX   PUBMED; 17588127.
RA   Hsiao,N.H. and Kirby,R.;
RT   "Comparative genomics of Streptomyces avermitilis, Streptomyces cattleya,
RT   Streptomyces maritimus and Kitasatospora aureofaciens using a Streptomyces
RT   coelicolor microarray system";
RL   Antonie Van Leeuwenhoek 93 (1-2), 1-25 (2008)
XX
RN   [2]
RP   1-8667507
RX   PUBMED; 12000953.
RA   Bentley,S.D., Chater,K.F., Cerdeno-Tarraga,A.M., Challis,G.L.,
RA   Thomson,N.R., James,K.D., Harris,D.E., Quail,M.A., Kieser,H., Harper,D.,
RA   Bateman,A., Brown,S., Chandra,G., Chen,C.W., Collins,M., Cronin,A.,
RA   Fraser,A., Goble,A., Hidalgo,J., Hornsby,T., Howarth,S., Huang,C.H.,
RA   Kieser,T., Larke,L., Murphy,L., Oliver,K., O'Neil,S., Rabbinowitsch,E.,
RA   Rajandream,M.A., Rutherford,K., Rutter,S., Seeger,K., Saunders,D.,
RA   Sharp,S., Squares,R., Squares,S., Taylor,K., Warren,T., Wietzorrek,A.,
RA   Woodward,J., Barrell,B.G., Parkhill,J. and Hopwood,D.A.;
RT   "Complete genome sequence of the model actinomycete Streptomyces
RT   coelicolor A3(2)";
RL   Nature 417 (6885), 141-147 (2002)
XX
RN   [3]
RP   1-8667507
RX   PUBMED; 8843436.
RA   Redenbach,M., Kieser,H.M., Denapaite,D., Eichner,A., Cullum,J., Kinashi,H.
RA   and Hopwood,D.A.;
RT   "A set of ordered cosmids and a detailed genetic and physical map for the
RT   8 Mb Streptomyces coelicolor A3(2) chromosome";
RL   Mol. Microbiol. 21 (1), 77-96 (1996)
XX
RN   [4]
RP   1-8667507
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (28-MAY-2002) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [5]
RP   1-8667507
RA   Bentley,S.D.;
RT   "Direct Submission";
RL   Submitted (09-MAY-2002) Sanger Institute, Wellcome Trust Genome Campus,
RL   Hinxton, Cambridge CB10 1SA, United Kingdom
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AL645882.
CC   On Jun 22, 2003 this sequence version replaced gi:31340543.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..8667507
FT                   /db_xref="taxon:100226"
FT                   /serovar="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /organism="Streptomyces coelicolor A3(2)"
FT   misc_feature    1..21653
FT                   /note="TIR-L. Left hand chromosome end terminal inveretd
FT                   repeat."
FT   RBS             435..440
FT   gene            446..1123
FT                   /db_xref="GeneID:1095448"
FT                   /locus_tag="SCO0001"
FT                   /gene_synonym="SCEND.02c"
FT   CDS_pept        446..1123
FT                   /locus_tag="SCO0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCEND.02c"
FT                   /note="SCEND.02c, unknown, doubtful CDS, len: 225aa"
FT                   /db_xref="GI:21218583"
FT                   /db_xref="GeneID:1095448"
FT                   /translation="MTGHHESTGPGTALSSDSTCRVTQYQTAGVNARLRLFALLERRAC
FT                   PRARRTTWWPGRSARWWSWTAWRRLLGVCCVRGRLGRRRDGGERGPGGHRGPGLATARR
FT                   RSGGATELAVHCADVRQRERADLVRLEGFVRESVLPRAHPHTTARRRVLEVLGEAGSLC
FT                   TARTVNSDEDYILCTLGVGHYDPDDQPPFKDGKPGWQRAGASIWNGSGAACIPHAAIEG
FT                   PRK"
FT                   /transl_table="11"
FT                   /protein_id="NP_624362.1"
FT   RBS             1238..1243
FT   gene            1252..3813
FT                   /db_xref="GeneID:1095447"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   CDS_pept        1252..3813
FT                   /locus_tag="SCO0002"
FT                   /gene_family="HOG000146492" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT                   /note="SCEND.01c, unknown, partial CDS, len: >27aa;
FT                   strongly similar to TR:AAF36550 (EMBL:AF194023)
FT                   helicase-like protein from Streptomyces lividans (881 aa)
FT                   fasta scores; opt: 114, z-score: 206.0, E(): 0.00052, 80.0%
FT                   identity in 25 aa overlap.; SCJ24.01c, unknown, partial
FT                   CDS, len: >457aa; strongly similar to TR:AAF36550
FT                   (EMBL:AF194023) helicase-like protein from Streptomyces
FT                   lividans (881 aa) fasta scores; opt: 2191, z-score: 2490.1,
FT                   E(): 0, 72.5% identity in 458 aa overlap.; SC8E7.42c,
FT                   partial CDS, unknown, len:> 431 aa. Highly similar to
FT                   Streptomyces lividans TR:AAF36550(EMBL:AF194023)
FT                   helicase-like protein found in the chromosome terminal
FT                   region (881 aa), fasta scores opt: 1940 z-score: 2170.3
FT                   E():0 66.9% identity in 438 aa overlap."
FT                   /db_xref="GI:21218584"
FT                   /db_xref="GeneID:1095447"
FT                   /translation="MGVSATGSGKTITTAACALEYFPEGRILVMVPTLDLIVQSAQSWR
FT                   RVGHRAPMVAVCSVDKDEVLEQLGVRTTTNPIQLALWAGTGPVVVFATYASLVDREDPA
FT                   DVTGRRTVPGPLESALAGGERLYGQRMAPFDLAILDEGHMTAGDMGRPWAAIHDNSRIP
FT                   VDFRLYLTATPRILAAPRPQRGRDGRELVIASMEDDSSTYGTRIFDLGLAEAVERSILA
FT                   GFEIDVLEIRDPDPILGLSEDALRGRRMALLQAALLEHAAQQNLHTTMVFHQRVEEAAA
FT                   FAEQMPRTAAELYTAEASAAALAEAAELPASSIDAELYELEEGRHVPPDRVWADWLCGD
FT                   HPIAHRRAVIQRFANGIDAQNRRVHRAFLSSVRALGVGVDIAGLRGVEAVCIVGSRSSQ
FT                   VDVVQNIGRALRPNPDGTTKTARIIIPVFLQPGEDPKDMVASASYQPLVDILQALRSHS
FT                   ERMVDQLASRALTRGTERRRIHVRPAPAAGPENGDMPEETSQTQQEVDRVTSVVVNFAS
FT                   PRDAADIAALTRCRVIRPQSLVWLEGYQALVRWRAENGITGLYAVPYDIETEVGTTKGY
FT                   PLGRWVHQQRRAHRAGELDPHRKELLDDAGMVWEPGDEAWENKLAAFRSYRRAHGHLAP
FT                   RQDAVWGEGEAMVPIGQHLANLRRKGAKNGLGKDPERAAERAAQLAAIDPDWNCPWPLD
FT                   WQRHYRVLADLVDADGVLPAIDPGVLFEGDDIGRWLTRQREASTWTQLSAEQQERLTAL
FT                   GVTPVERPAPAPAAPRSTKGPSKAKQSFQRGLAALAQWVEREGADRPVPRGHAEEIAVD
FT                   GEADPVIIKLGVWVSNTRARRDKLTAEQLNALRGLGMEWAA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624363.1"
FT   misc_feature    1252..1773
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    1270..1284
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    1669..1680
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    2260..2490
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cl12029"
FT                   /db_xref="CDD:175389"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    <2356..>2640
FT                   /note="Predicted helicase [General function prediction
FT                   only]; Region: COG4889"
FT                   /db_xref="CDD:34498"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    2851..3075
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    3076..3258
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    3313..3519
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   misc_feature    3574..3801
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0002"
FT                   /gene_synonym="SC8E7.42c; SCEND.01c; SCJ24.01c"
FT   gene            3869..6220
FT                   /db_xref="GeneID:1095446"
FT                   /locus_tag="SCO0003"
FT                   /gene_synonym="SC8E7.41c"
FT   CDS_pept        3869..6220
FT                   /locus_tag="SCO0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding protein"
FT                   /gene_synonym="SC8E7.41c"
FT                   /note="SC8E7.41c, possible DNA-binding protein, len: 783
FT                   aa. Contains a helix-turn-helix motif situated between
FT                   residues 69..90 (+3.17 SD)."
FT                   /db_xref="GI:21218585"
FT                   /db_xref="GeneID:1095446"
FT                   /translation="MTDPFSPWPVAGVVRLAPLAGETTMSFVNRLAARYNVTVTGLLSA
FT                   MAGPGVRGVWGRGCLVGEVFLASAVRHQLASLCQVSESHLSRALPSWDEGADAKANGEQ
FT                   PNVRFASGSAVPAVMLGCRLCTAARTGAACSARLYSDLRSRICIRHQCWSLDSLALDRV
FT                   TLVEGQVGLAGLPEVIRAHQSLLPLLRRKGSCENAFAVAQAVVASWWDVHWRDEVLWPA
FT                   RLGRVCADLPEGEVAVLARDVVTYPEAVAVTTVLCDRLWRQRVLEDTHGQMPHTLAEVP
FT                   RLLTELARRLGRPWLVEQLAASSAGALFAWVRACVRRERGAVPEEDVWAVPVAHRPRGL
FT                   AAQVRELRLQHAGNAPVGGSLSRAEQAYRVGLAHAHSYAARHGHLAVPKYGRHEGFALG
FT                   AWLANQRTGVAALPIERAQALHRIDPWWNGPWPISWRRTYHRALVHVRKHGLVDATAGF
FT                   PGTSLALGEWLHEQCSRYDDLHVGQQRLLADLGIRPAHARSAHPRRKSLALAFAAGLDY
FT                   ARAFAAVHGHLATSKSTRQDGFPLGQWLMSQRSRARMAEKETDRSRALSAIDPWWNPPW
FT                   PLAWQRAYHHARKQCGSNQLLVPGDGFAGVGAAAASWLYAQCALFEELHPRQQGLLREI
FT                   GITAEAAQARQTARYHRTGARIDFAVGLAHARDYINIHGHLALPHPVQHNGFPLGRWLA
FT                   SKRGEAGAHARRTPAPWPGMQALAALDPWWFPPWAFAWQRDYHRLRLLLAAGLEPPPKL
FT                   RSWISEQLTQRHTLLPGQQRLLQELKDLPV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624364.1"
FT   misc_feature    4952..5146
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0003"
FT                   /gene_synonym="SC8E7.41c"
FT   misc_feature    5150..5341
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0003"
FT                   /gene_synonym="SC8E7.41c"
FT   misc_feature    5381..5581
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0003"
FT                   /gene_synonym="SC8E7.41c"
FT   misc_feature    5831..>5959
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0003"
FT                   /gene_synonym="SC8E7.41c"
FT   gene            6226..7173
FT                   /db_xref="GeneID:1095445"
FT                   /locus_tag="SCO0004"
FT                   /gene_synonym="SC1C9.01; SC8E7.40c"
FT   CDS_pept        6226..7173
FT                   /locus_tag="SCO0004"
FT                   /gene_family="HOG000266358" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SC1C9.01; SC8E7.40c"
FT                   /note="SC8E7.40c, unknown, len: 315 aa.; SC1C9.01,
FT                   hypothetical protein (fragment), len: >64 aa; identical to
FT                   C-terminal part of TR:Q9FBV5 (EMBL:AL391338) Streptomyces
FT                   coelicolor hypothetical 33.7 kDa protein SC8E7.40c, 315 aa,
FT                   situated on the opposite end of the chromosome"
FT                   /db_xref="GI:21226092"
FT                   /db_xref="GeneID:1095445"
FT                   /translation="MRHGIAAAVHPFGWRIRITAFSSPPWTWLLSVEGHEHSRRVQQAA
FT                   AGGDGAGIEAAFVTAAGRLTQLQWDQAAASVQFEDVAPVSAFPVVPGRRWGPGWWWSAT
FT                   TGRHVVHGLAAMRTQLMVLDRNPDVTGLAARPVRLLWRDTDGRVRSWVPQLFARYADGT
FT                   GLLADCPSSPTAGGDGAQRARMVLEAACALVGWAYRRLEPPPPVVAANLRWLAGYRHPR
FT                   NQGPPGLRAALAEAFAGLRPLADGAAAVGDPLQVLPAVYHALWCGHLTTPLDEPLHEET
FT                   LVCADAERGGGGVEERLGAGGGRGRGERSGRHPR"
FT                   /transl_table="11"
FT                   /protein_id="NP_631871.1"
FT   gene            7187..9307
FT                   /db_xref="GeneID:1095444"
FT                   /locus_tag="SCO0005"
FT                   /gene_synonym="SC1C9.02"
FT   CDS_pept        7187..9307
FT                   /locus_tag="SCO0005"
FT                   /gene_family="HOG000266361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /gene_synonym="SC1C9.02"
FT                   /note="SC1C9.02, possible transposase, len: 706 aa;
FT                   identical to TR:Q9FBV6 (EMBL:AL391338) Streptomyces
FT                   coelicolor transposase SC9E7.39c, 706 aa, situated on the
FT                   opposite end of the chromosome. Contains Pfam match to
FT                   entry PF00665 rve, Integrase core domain"
FT                   /db_xref="GI:32141096"
FT                   /db_xref="GeneID:1095444"
FT                   /translation="MVEVGAHVAYRGQTWQVAALQGQQVYLLQEDGTETRLLLGRLFAD
FT                   PGFEVVGARAPDTVPQWGLFETVPLAAQQRALAWLPHIREVETGWPHPEGSREGQAMRP
FT                   EYDPERWTLAQRDAAKAKELAALGFARVTRTTVERMRHGYRKQGLWGLVDKRAVPARGR
FT                   HPTGYADERVVAAVLEALRRQRGRSKGTVKGLQVLVGQILEDTHGRGVVEMPSRSTFYR
FT                   LVSVLADPADRPGRPARTATAPARASSAPVVLRPGEQVQIDTTRLDIMAILEDGSLGRP
FT                   ELTIAVDVATRSILAAVLRPYSTKAVDAALLLAEMAVPHPARPTWPSALHLSRAEVPYE
FT                   RMLSLDERLEGAAARPVVVPETIVVDRGKIYLSQGFVAACEMLGVSVQPAPPRRPQAKA
FT                   VVERTFGAINDLFCQHVAGHTGSNPQRRGLTTAAETRWTIPQLQDFLDEWITCGWQNRP
FT                   HDGLRHPVLPKTALTPNQMWAALITVSGYVPVPLSGADYLELLPVRWQPITERGIRLDY
FT                   RTYNHDILDPHRGQRSPVASKDGKWEVHHNPHDARQIFVRLTDGQLHEIPWIHRDHVHQ
FT                   PFNEAIWRHVQAEVEQRGDRDQHEADLADALDQLLRRTRHLAETEQKTRRRRATRSGTA
FT                   AQLPDLPGQRRPFDAETAPAPAPDWSESLDDLISVDTAAQTGTSEMEGASVPPAEAGGY
FT                   GLWDAEAEAEQW"
FT                   /transl_table="11"
FT                   /protein_id="NP_733487.1"
FT   misc_feature    7949..8422
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="SCO0005"
FT                   /gene_synonym="SC1C9.02"
FT   misc_feature    8231..8623
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 47.20, E-value 1.8e-12"
FT                   /locus_tag="SCO0005"
FT                   /gene_synonym="SC1C9.02"
FT   gene            9304..10410
FT                   /db_xref="GeneID:1095443"
FT                   /locus_tag="SCO0006"
FT                   /gene_synonym="SC1C9.03; SCJ30.01"
FT   CDS_pept        9304..10410
FT                   /locus_tag="SCO0006"
FT                   /gene_family="HOG000266360" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP/GTP-binding protein"
FT                   /gene_synonym="SC1C9.03; SCJ30.01"
FT                   /note="SC1C9.03, possible ATP/GTP-binding protein
FT                   (fragment), len: >223 aa; identical to N-terminal part of
FT                   TR:Q9FBV7 (EMBL:AL391338) Streptomyces coelicolor
FT                   ATP/GTP-binding protein, 368 aa; situated on the opposite
FT                   end of the chromosome. Contains match to Prosite entry
FT                   PS00017 ATP/GTP-binding site motif A (P-loop); SCJ30.01,
FT                   partial CDS, unknown, len: >183 aa; weakly similar to the
FT                   C-terminal half of suspected transposition related
FT                   nucleotide binding proteins eg. TR:Q57461 (EMBL:U49101)
FT                   TniB delta1 from plasmid pVS1 (286 aa) fasta scores; opt:
FT                   133, z-score: 170.1, E(): 0.041, (29.7% identity in 148 aa
FT                   overlap)."
FT                   /db_xref="GI:21226090"
FT                   /db_xref="GeneID:1095443"
FT                   /translation="MNASPGTSDTPAGGSPSTAHRPPSAAASTDGDAPDAQPQAVATWD
FT                   GFQAFATTPAAAPPPPGTPHRSLEERLAYHSRFVTVRTPAIDALAKNVRTLMILGRHQA
FT                   VTARPSLIVTGPAGAGKTTALLQVGRACHLAHTRRHGAAATAGQAPVAYVLVPPAASAK
FT                   TLAIEFARYLGIPVTAGMSQAQITGAVCHTYTAARVQLVMIDEIHRLNPRTTTGAQSAD
FT                   LIKDLTERIGATFVYAGIDVTTTPLFTGVRGAQLAGRASLIDCAAFPSRLGDQEPFRDL
FT                   ITAMESALDLRHHRPGTLPRLAPYLHERTAGRIGSLARLIRQAAITALLDGTERITKTT
FT                   LDAIRLDHLAEQHYQPRARPRSRNTSTP"
FT                   /transl_table="11"
FT                   /protein_id="NP_631869.1"
FT   misc_feature    <10144..10326
FT                   /note="Bacterial TniB protein; Region: TniB; pfam05621"
FT                   /db_xref="CDD:114349"
FT                   /locus_tag="SCO0006"
FT                   /gene_synonym="SC1C9.03; SCJ30.01"
FT   misc_feature    9646..9669
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /locus_tag="SCO0006"
FT                   /gene_synonym="SC1C9.03; SCJ30.01"
FT   gene            complement(10554..11000)
FT                   /db_xref="GeneID:1095442"
FT                   /locus_tag="SCO0007"
FT                   /gene_synonym="SCJ30.02c"
FT   CDS_pept        complement(10554..11000)
FT                   /locus_tag="SCO0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.02c"
FT                   /note="SCJ30.02c, unknown, len: 148 aa"
FT                   /db_xref="GI:21218589"
FT                   /db_xref="GeneID:1095442"
FT                   /translation="MCVVRGDKLRHGPGADGGSEPRVGGCLLVAWAHQPLWRRVGPGGV
FT                   GGVVAAVAGAQGAGADGLLFGLEPLPVRGGLGAVGVARQGEVGQGARQVGEWESGEGGQ
FT                   APGRVVIEVEFGCWQGAVAVEGDADAVKELGQRQLVGVGEPLPV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624368.1"
FT   gene            complement(11010..11360)
FT                   /db_xref="GeneID:1095440"
FT                   /locus_tag="SCO0008"
FT                   /gene_synonym="SCJ30.03c"
FT   CDS_pept        complement(11010..11360)
FT                   /locus_tag="SCO0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.03c"
FT                   /note="SCJ30.03c, unknown, len: 116 aa"
FT                   /db_xref="GI:21218590"
FT                   /db_xref="GeneID:1095440"
FT                   /translation="MACVGEEDAEWVVRVACQAGQSEAVGDEGEGLAGVAVWPVREGGE
FT                   CAGEGDGFRVDHQVAGHQGGGGAARGGQAGVGRAEPGQAGVPAVGEMLLVVVPAGGDSA
FT                   RGGPGGEGAWVP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624369.1"
FT   gene            complement(11617..11952)
FT                   /db_xref="GeneID:1095441"
FT                   /locus_tag="SCO0009"
FT                   /gene_synonym="SCJ30.04c"
FT   CDS_pept        complement(11617..11952)
FT                   /locus_tag="SCO0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.04c"
FT                   /note="SCJ30.04c, improbable CDS, function unknown, len:
FT                   111 aa; predicted by GC frameplot and amino acid usage."
FT                   /db_xref="GI:21218591"
FT                   /db_xref="GeneID:1095441"
FT                   /translation="MCGRRPFETQLSECCQLLLGELVPPRPGVRYPYTQFHDYRLHPAV
FT                   DHDLFAVAARNRPMAFPFDPLCESRETSLESLLRLSRALRRATSCRTGQRCFGGLDTQC
FT                   GQPLPLL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624370.1"
FT   repeat_region   12078..12122
FT                   /note="Inverted and repeated at 3791-3835bp."
FT   gene            12366..13457
FT                   /db_xref="GeneID:1095439"
FT                   /locus_tag="SCO0010"
FT                   /gene_synonym="SCJ30.05"
FT   CDS_pept        12366..13457
FT                   /locus_tag="SCO0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.05"
FT                   /note="SCJ30.05, unknown (secreted protein), len: 362 aa;
FT                   region of similarity to TR:CAB41280 (EMBL:AL049707)
FT                   transferase from Streptomyces coelicolor (448 aa) fasta
FT                   scores; opt: 411, z-score: 409.4, E(): 1.9e-15, (32.8%
FT                   identity in 274 aa overlap). Contains leucine TTA codon,
FT                   possible target for bldA regulation. Note large overlap
FT                   with downstream CDS."
FT                   /db_xref="GI:21218592"
FT                   /db_xref="GeneID:1095439"
FT                   /translation="MTGRTLRFLGYALATGCGSLLLKHFVIAPGPPVGHIPWVLRLLIM
FT                   LGILEGGWLVFRASRRVVVRGRRHRVRVLTGFEELRGERYILYLRPFALDIRMSLPPPE
FT                   APGWWMRSPYELPGLTMEDFLVRQFTRHGRVVAVGEPGEELPLLGAQRGYLPLEGWERT
FT                   VSELIQGAHSVLMSVAPGPGTVWEFTEALRTMPPERLVLMVCCGPEEYDAFRSAVVEKY
FT                   AVRKSEEPGSTWAPLPRLPDCPARPPASKREWQSPLRAFVTFDQQWQPSLHWFVVTVPR
FT                   IRHVWTMRRLVRERIDALVGAWAALPQRQASPGTIPPPAPVVTTPPPPPVLSPLPQQPL
FT                   LGSTVVGLNVRPPERRTRRRGRQ"
FT                   /transl_table="11"
FT                   /protein_id="NP_624371.1"
FT   gene            complement(13214..14023)
FT                   /db_xref="GeneID:1095438"
FT                   /locus_tag="SCO0011"
FT                   /gene_synonym="SCJ30.06c"
FT   CDS_pept        complement(13214..14023)
FT                   /locus_tag="SCO0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.06c"
FT                   /note="SCJ30.06c, unknown, len: 269 aa; predicted amino
FT                   acid usage. Note large overlap with downstream CDS."
FT                   /db_xref="GI:21218593"
FT                   /db_xref="GeneID:1095438"
FT                   /translation="MHRELTPRAARAEGEAPPSIPTLHRAIRRDLTPGERTGLAGGERE
FT                   ACKHDEFLARTRGWPEPGVGDRPHADPGAGRCDGKPPRPSITWFTDCATNAITGVAVTP
FT                   GHPSRKSVLAALRSADLRDGPHRRCGARFVMVRSNWQLNAAKFEAIGAFEQRLPAYAHS
FT                   KAEWAALGEGRDLPPTHVEQWVPVNFHCRPRRRVLRSGGLTFSPTTVLPSRGCCGSGER
FT                   TGGGGGVVTTGAGGGIVPGEACRCGRAAHAPTNASMRSRTSLRMVQT"
FT                   /transl_table="11"
FT                   /protein_id="NP_624372.1"
FT   misc_feature    13260..13262
FT                   /note="Leucine tta codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCO0010"
FT                   /gene_synonym="SCJ30.05"
FT   repeat_region   13648..13692
FT                   /note="Inverted and repeated at 2221-2265bp."
FT   gene            complement(14044..14454)
FT                   /db_xref="GeneID:1095452"
FT                   /locus_tag="SCO0012"
FT                   /gene_synonym="SCJ30.07c"
FT   CDS_pept        complement(14044..14454)
FT                   /locus_tag="SCO0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.07c"
FT                   /note="SCJ30.07c, unknown, len: 136 aa; predicted by GC
FT                   Frameplot, Hidden Markov model and amino acid usage."
FT                   /db_xref="GI:21218594"
FT                   /db_xref="GeneID:1095452"
FT                   /translation="MEACAPWRPISAGEARERDAAGLPHVVVYREPGREAPLEVRLVSR
FT                   QDHHVGLWAYDAQDRRSHDLDMRLLDDPSRLLRRYSVSWHCTGPETAEFDKAGPRITVD
FT                   LMQEHQRLHGDVLTGLRAPPEPPPSLRPLPHR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624373.1"
FT   gene            complement(14739..15029)
FT                   /db_xref="GeneID:1095453"
FT                   /locus_tag="SCO0013"
FT                   /gene_synonym="SCJ30.09c"
FT   CDS_pept        complement(14739..15029)
FT                   /locus_tag="SCO0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.09c"
FT                   /note="SCJ30.09c, unknown, len: 96 aa; predicted by GC
FT                   Frameplot, Hidden Markov model and amino acid usage;
FT                   similar to the C-terminal region of the SCP1 plasmid borne
FT                   TR:Q9ACW6 (EMBL:AL590464) Streptomyces coelicolor conserved
FT                   hypothetical protein SCP1.185, 184 aa; fasta scores: opt:
FT                   442 Z-score: 592.9 E(): 2.1e-25; 84.615% identity in 78 aa
FT                   overlap"
FT                   /db_xref="GI:21218595"
FT                   /db_xref="GeneID:1095453"
FT                   /translation="MRRLPRRHASNIALPGNDFWLLDDRLVQFHHFTGTGTGDRAPDGK
FT                   ERTTDPAAVALCHAAFETVWERAVPHEKYPVQAHRVEHRERIPVVQCTGGP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624374.1"
FT   gene            complement(15317..15595)
FT                   /db_xref="GeneID:1095449"
FT                   /locus_tag="SCO0014"
FT                   /gene_synonym="SCJ30.10c"
FT   CDS_pept        complement(15317..15595)
FT                   /locus_tag="SCO0014"
FT                   /gene_family="HOG000014530" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.10c"
FT                   /note="SCJ30.10c, unknown, len: 92 aa; predicted by GC
FT                   Frameplot, Hidden Markov model and amino acid usage; highly
FT                   similar to the SCP1 plasmid borne TR:Q9ACW7 (EMBL:AL590464)
FT                   Streptomyces coelicolor conserved hypothetical protein
FT                   SCP1.184, 92 aa; fasta scores: opt: 499 Z-score: 653.4 E():
FT                   9.2e-29; 81.522% identity in 92 aa overlap. Contains
FT                   leucine TTA codon, possible target for bldA regulation"
FT                   /db_xref="GI:21218596"
FT                   /db_xref="GeneID:1095449"
FT                   /translation="MALRFVGIAPRTGGEGSPTVWVEEESADLVLQGEEAGALLQALVG
FT                   STEWVAGHRTGIPAYERVIRIPFRMVQILREACDAAERASADHRDVR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624375.1"
FT   misc_feature    complement(15587..15589)
FT                   /note="Leucine tta codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCO0014"
FT                   /gene_synonym="SCJ30.10c"
FT   gene            complement(16070..17302)
FT                   /db_xref="GeneID:1095436"
FT                   /locus_tag="SCO0015"
FT                   /gene_synonym="SCJ30.11c"
FT   CDS_pept        complement(16070..17302)
FT                   /locus_tag="SCO0015"
FT                   /gene_family="HOG000218489" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Na+/H+ antiporter"
FT                   /gene_synonym="SCJ30.11c"
FT                   /note="SCJ30.11c, possible Na+/H+ antiporter, len: 410 aa;
FT                   similar to many eg. TR:Q56580 (EMBL:D25214) Na+/H+
FT                   antiporter from Vibrio alginolyticus (383 aa) fasta scores;
FT                   opt: 536, z-score: 594.7, E(): 9.1e-26, (38.5% identity in
FT                   384 aa overlap). Also similar to TR:CAB38501
FT                   (EMBL:AL035636) Na+/H+ antiporter from Streptomyces
FT                   coelicolor (474 aa) fasta scores; opt: 968, z-score:
FT                   1067.2, E(): 0, (52.2% identity in 404 aa overlap).
FT                   Contains possible hydrophobic membrane spanning regions"
FT                   /db_xref="GI:21218597"
FT                   /db_xref="GeneID:1095436"
FT                   /translation="MSAPSRITAALRSDAVGGSLLIGAAVIALIWANSPLSHSYEALRS
FT                   FTFGPSALHLNLSVETWAADGLLAVFFFIVGNELKQELVHGELRDPRRAALPIAAALGG
FT                   VAVPALVFLAFTLGSGGEAAGGWGIPMATGIAFAVAVLAVVGRHLPTPLRTFLLTLATV
FT                   DDMSAVLVIAVACTSGINFTALALAAVGLAVFGYLQNGSGRAVARVRAMVPAWLLFVPL
FT                   AAVVWALMHACGVHATIAGVVMGLLMRTRPQGAERVSPSHRAEEVLRPFSAGIALPLFA
FT                   LMSAGVSLAGAGGFVTSAITWNVLAGLLVGKVVGIFGGTWPTSRLTSAHLNPLLGWADI
FT                   AGIAVLGGIGFTVSLPIAELSSTSQAHLTDAKGAILLASTTAALLAALLLGRRSRHHQR
FT                   LARQAAQQATT"
FT                   /transl_table="11"
FT                   /protein_id="NP_624376.1"
FT   misc_feature    complement(16190..17287)
FT                   /note="Na+/H+ antiporter 1; Region: Na_H_antiport_1;
FT                   cl01133"
FT                   /db_xref="CDD:186351"
FT                   /locus_tag="SCO0015"
FT                   /gene_synonym="SCJ30.11c"
FT   gene            17715..17918
FT                   /db_xref="GeneID:1095450"
FT                   /locus_tag="SCO0016"
FT                   /gene_synonym="SCJ30.12"
FT   CDS_pept        17715..17918
FT                   /locus_tag="SCO0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.12"
FT                   /note="SCJ30.12, unknown, len: 67 aa; predicted by GC
FT                   Frameplot, Hidden Markov model and amino acid usage."
FT                   /db_xref="GI:21218598"
FT                   /db_xref="GeneID:1095450"
FT                   /translation="MTTPSDDTARPVPAVLPAGPVPGHPQQEAAARLWRRRQTHTGRVY
FT                   LLGPPSHRGIEDGGVEAAEHRV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624377.1"
FT   gene            17919..18263
FT                   /db_xref="GeneID:1095451"
FT                   /locus_tag="SCO0017"
FT                   /gene_synonym="SCJ30.13"
FT   CDS_pept        17919..18263
FT                   /locus_tag="SCO0017"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.13"
FT                   /note="SCJ30.13, unknown, len: 114 aa; predicted by GC
FT                   Frameplot, Hidden Markov model and amino acid usage."
FT                   /db_xref="GI:21218599"
FT                   /db_xref="GeneID:1095451"
FT                   /translation="MRAPEHVRPVDGVDYNQVSTGPLPPAPPTPTGREGLWERRPSGWV
FT                   LAKVRSGRGPARGVPHAPECAEAPEGVPLLDVRRALDVAEKPGTQLCTLCGCAQELTPL
FT                   LSAFDHITDS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624378.1"
FT   gene            complement(18485..19351)
FT                   /db_xref="GeneID:1095454"
FT                   /locus_tag="SCO0018"
FT                   /gene_synonym="SCJ30.14c"
FT   CDS_pept        complement(18485..19351)
FT                   /locus_tag="SCO0018"
FT                   /gene_family="HOG000153431" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.14c"
FT                   /note="SCJ30.14c, hypothetical protein, len: 228 aa;
FT                   predicted by GC Frameplot, Hidden Markov model and amino
FT                   acid usage. Has regions of similarity to SCJ4.39
FT                   hypothetical protein from the overlapping Streptomyces
FT                   coelicolor cosmid J4 (EMBL:AL109950) fasta scores; opt:
FT                   334, z-score: 359.9, E(): 8.2e-15, (41.6% identity in 245
FT                   aa overlap)."
FT                   /db_xref="GI:21218600"
FT                   /db_xref="GeneID:1095454"
FT                   /translation="MGQSSCRPKEVTAQVTSQAPWPGTGGVYWSREELEARNRRLAHQG
FT                   VAAAEDVLVKRYGLGVVGEGFELLRAVSQQFNVKLHTLADAVVRVPAPDAEVRVWFPGR
FT                   RRYSPPRLPALALEPGSRGSQGAVLKAVLHRVLSITQTPMGNVQLKDGHRLHLTRHTGL
FT                   NTYFTEFFAFVDNDTTSCAQAAAQHRQVTVRDVAGADVFDEASRYAILQSGSRAAHSVP
FT                   LTSSRGAVMGMVSSHHERPLTAFSTAQLAALQQTGTDAGRWLSWHWNTVVLDALERLHT
FT                   TAIRRLH"
FT                   /transl_table="11"
FT                   /protein_id="NP_624379.1"
FT   gene            complement(19517..19771)
FT                   /db_xref="GeneID:1095455"
FT                   /locus_tag="SCO0019"
FT                   /gene_synonym="SCJ30.15c"
FT   CDS_pept        complement(19517..19771)
FT                   /locus_tag="SCO0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ30.15c"
FT                   /note="SCJ30.15c, improbable CDS, function unknown, len:
FT                   115 aa; predicted by amino acid usage."
FT                   /db_xref="GI:21218601"
FT                   /db_xref="GeneID:1095455"
FT                   /translation="MSQPEAAHYLGIALTRVGMLIANASPDTGRRPGRAGRSDNRQRRG
FT                   REDLASGRVNPCESHPPPEGHNQLVLIDDPQVLTIAPGL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624380.1"
FT   misc_feature    19911..21168
FT                   /note="possible insertion sequence."
FT   repeat_region   19911..19973
FT                   /note="possible inverted repeat bounding insertion
FT                   sequence."
FT   gene            19974..21620
FT                   /db_xref="GeneID:1095437"
FT                   /locus_tag="SCO0020"
FT                   /gene_synonym="SCJ30.16; SCJ4.01"
FT   CDS_pept        19974..21620
FT                   /locus_tag="SCO0020"
FT                   /gene_family="HOG000121685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /gene_synonym="SCJ30.16; SCJ4.01"
FT                   /note="SCJ4.01, partial CDS, possible transposase, len:
FT                   >183 aa; similar to TR:Q9R2U8(EMBL:AL133236) transposase
FT                   from Streptomyces coelicolor (501 aa) fasta scores, opt:
FT                   267 z-score: 317.3 E(): 3.4e-10 33.9% identity in 168 aa
FT                   overlap and TR:O69919 (EMBL:AL023861) hypothetical protein
FT                   from Streptomyces coelicolor (188 aa) fasta scores; opt:
FT                   419, z-score: 501.4, E(): 1.4e-20, (45.9% identity in 159
FT                   aa overlap). Overlaps and extends into CDS SCJ30.16 on the
FT                   adjoining cosmid.; SCJ30.16, partial CDS, possible
FT                   transposase, len: >397 aa; varying regions and lengths of
FT                   similarity to many eg. SW:TRA1_BORPA transposase from
FT                   IS1001 of Bordetella parapertussis (406 aa) fasta scores;
FT                   opt: 203, z-score: 236.1, E(): 8.7e-06, (28.4% identity in
FT                   215 aa overlap). Also contains short region of similarity
FT                   to TR:O69919 (EMBL:AL023861) hypothetical protein from
FT                   Streptomyces coelicolor (188 aa) fasta scores; opt: 248,
FT                   z-score: 292.3, E(): 6.4e-09, (68.1% identity in 47 aa
FT                   overlap). Contains possible helix-turn-helix motif (+4.11
FT                   SD) 308-329 aa. Also contains TTA leucine, possible target
FT                   for bldA regulation."
FT                   /db_xref="GI:32141097"
FT                   /db_xref="GeneID:1095437"
FT                   /translation="MGSLLLCSVELVSLLPQLSDVHVVSVEVSDAVVAVYARTRSGEPA
FT                   GCTGCGRLSEWCHSRYARRLADVTLAGRPLRIDLSVRRLYCENTTCPKVTFTEQVPGLT
FT                   VRYQRRTSRLQSLVEDVGVVLAGRGGSRMLRILGIKLSRVALLSQLMRVPLPPLVTPQV
FT                   LGVDDFALDGGTYGTLLVDATTRLPLTLWEGRDAKQLGRWLREHPGIDIVCRDGSLTYR
FT                   QGITAGAPEAVQVSDRFHLWQGLSRRVQDIASAHRGCLPAALPTVSEDDHPPVEETTQN
FT                   AAADSRAGRHAQSLFEAIQALTCTGRSHSSVARELGLDRRTVRKYARARTWQEVMRRPP
FT                   RKPSMLDPYLDYLRQRWDDGQHSAKILHEELQTKGYLGHYQRVKMAVAPLRRGLPIDEP
FT                   CERPPSPRETARWITTHPHRRSPHVNERLPRLLDHCPELKLTHDLVRRFATMLDNRDAA
FT                   PLPGWLGDLKKSGLGPLVGFAGALHEDRHAVAQGITTPYNSGVNEGRITDVKLQKRLMA
FT                   GRAGVRLLRHRVVLIAHLRRRHADRPTVPPR"
FT                   /transl_table="11"
FT                   /protein_id="NP_733488.1"
FT   misc_feature    20091..>20720
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="SCO0020"
FT                   /gene_synonym="SCJ30.16; SCJ4.01"
FT   misc_feature    20472..20741
FT                   /note="Transposase; Region: Transposase_12; pfam01610"
FT                   /db_xref="CDD:110601"
FT                   /locus_tag="SCO0020"
FT                   /gene_synonym="SCJ30.16; SCJ4.01"
FT   misc_feature    <20886..21566
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3464"
FT                   /db_xref="CDD:33267"
FT                   /locus_tag="SCO0020"
FT                   /gene_synonym="SCJ30.16; SCJ4.01"
FT   misc_feature    20016..20018
FT                   /note="tta leucine, possible target for bldA regulation."
FT                   /locus_tag="SCO0020"
FT                   /gene_synonym="SCJ30.16; SCJ4.01"
FT   misc_feature    <21068..21650
FT                   /note="possible insertion sequence."
FT   misc_feature    21588..21650
FT                   /note="possible inverted repeat bounding insertion
FT                   sequence."
FT   gene            21617..22210
FT                   /db_xref="GeneID:1095456"
FT                   /locus_tag="SCO0021"
FT                   /gene_synonym="SCJ4.02"
FT   CDS_pept        21617..22210
FT                   /locus_tag="SCO0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.02"
FT                   /note="SCJ4.02, unknown, len: 197 aa"
FT                   /db_xref="GI:21218602"
FT                   /db_xref="GeneID:1095456"
FT                   /translation="MISAYENLARATFLPQLRTDERPQLWPQAAGQSISVEIDDPSRDT
FT                   HAMSPSTSSEPIERGWDQPWYRVRTENFQASFLPSDGEDLNEVCNVDVFVTLKDGSCWT
FT                   ATVFTVAEVERLMKLWADTDEALGGRYFWVSDGLIVKDPGIDGMTGVIAGLIENGEFSE
FT                   IFQRVIRRSAAGSVVGGQATSFSRSMALRRFLSR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624381.1"
FT   gene            complement(22156..22761)
FT                   /db_xref="GeneID:1095457"
FT                   /locus_tag="SCO0022"
FT                   /gene_synonym="SCJ4.03c; SCJ4.04c; SCJ4.05c; SCO0023;
FT                   SCO0024"
FT   CDS_pept        complement(join(22156..22299,22290..22430,22624..>22761))
FT                   /locus_tag="SCO0022"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS element ATP-binding protein"
FT                   /gene_synonym="SCJ4.03c; SCJ4.04c; SCJ4.05c; SCO0023;
FT                   SCO0024"
FT                   /note="SCJ4.03c, partial CDS, possible IS element
FT                   ATP-binding protein, len: 47 aa; similar to regions of many
FT                   eg. SW:ISTB_ECOLI IS element ATP-binding protein from
FT                   Escherichia coli (265 aa) fasta scores; opt: 132, z-score:
FT                   207.1, E(): 0.00035, (53.8% identity in 39 aa overlap).
FT                   Also similar to TR:O69925 (EMBL:AL023861) IS element
FT                   ATP-binding protein from Streptomyces coelicolor (256 aa)
FT                   fasta scores; opt: 224, z-score: 343.7, E(): 8.7e-12,
FT                   (72.3% identity in 47 aa overlap); SCJ4.04c, partial CDS,
FT                   possible IS element ATP-binding protein, len: 47aa; similar
FT                   to regions of many eg. SW:ISTB_ECOLI IS element ATP-binding
FT                   protein from Escherichia coli (265 aa) fasta scores; opt:
FT                   193, z-score: 314.5, E(): 3.7e-10, (55.3% identity in 47 aa
FT                   overlap). Also similar to TR:O69925 (EMBL:AL023861) IS
FT                   element ATP-binding protein from Streptomyces coelicolor
FT                   (256 aa) fasta scores; opt: 273, z-score: 440.0, E():
FT                   3.8e-17, (91.5% identity in 47 aa overlap).; SCJ4.05c,
FT                   partial CDS, possible IS element ATP-binding protein, len:
FT                   46aa; similar to regions of many eg. SW:ISTB_ECOLI IS
FT                   element ATP-binding protein from Escherichia coli (265 aa)
FT                   fasta scores; opt: 150, z-score: 245.0, E(): 2.7e-06,
FT                   (43.5% identity in 46 aa overlap). Also similar to
FT                   TR:O69925 (EMBL:AL023861) IS element ATP-binding protein
FT                   from Streptomyces coelicolor (256 aa) fasta scores; opt:
FT                   250, z-score: 400.5, E(): 6e-15, (78.3% identity in 46 aa
FT                   overlap)."
FT                   /db_xref="GI:21218603"
FT                   /db_xref="GeneID:1095457"
FT                   /translation="RLSRSSHHKTLDEYDFSFQPDLDPRKVRDLATLSFVEGRANAALL
FT                   GVLVADEVGYQPLERAEARLVFQVISKRYEKGSIILASNKTFSEWGQVGPGFGDEVLAT
FT                   ALLGRLLDHCDVISINGPGYRLRNRLKAIERENDVA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624382.1"
FT   misc_feature    complement(join(22228..22299,22290..22430,22624..22761))
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SCO0022"
FT                   /gene_synonym="SCJ4.03c; SCJ4.04c; SCJ4.05c; SCO0023;
FT                   SCO0024"
FT   gene            22843..23061
FT                   /db_xref="GeneID:1095458"
FT                   /locus_tag="SCO0025"
FT                   /gene_synonym="SCJ4.06"
FT   CDS_pept        22843..23061
FT                   /locus_tag="SCO0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS element ATP-binding protein"
FT                   /gene_synonym="SCJ4.06"
FT                   /note="SCJ4.06, partial CDS, possible IS element
FT                   ATP-binding protein, len: 46aa; similar to regions of many
FT                   eg. TR:BAA78797 (EMBL:AP000342) NTP-binding protein from IS
FT                   element of plasmid R100 (261 aa) fasta scores; opt: 113,
FT                   z-score: 154.6, E(): 0.3, (36.4% identity in 55 aa
FT                   overlap). Contains PS00017 ATP/GTP-binding site motif A
FT                   (P-loop)"
FT                   /db_xref="GI:21218604"
FT                   /db_xref="GeneID:1095458"
FT                   /translation="MDPAVIHTPATCEWGKEGLPLCLIGDSGTGKSHLLSALGTEASMA
FT                   GYRASGTFRTRGDRALPGLGFLEHVPV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624383.1"
FT   misc_feature    22843..>22992
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SCO0025"
FT                   /gene_synonym="SCJ4.06"
FT   misc_feature    22915..22938
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /locus_tag="SCO0025"
FT                   /gene_synonym="SCJ4.06"
FT   gene            23316..23831
FT                   /db_xref="GeneID:1095459"
FT                   /locus_tag="SCO0026"
FT                   /gene_synonym="SCJ4.07"
FT   CDS_pept        23316..23831
FT                   /locus_tag="SCO0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /gene_synonym="SCJ4.07"
FT                   /note="SCJ4.07, possible secreted protein, len: 171 aa;
FT                   Contains possible N-terminal signal sequence. Also contains
FT                   PS00013 Prokaryotic membrane lipoprotein lipid attachment
FT                   site."
FT                   /db_xref="GI:21218605"
FT                   /db_xref="GeneID:1095459"
FT                   /translation="MRRLGLSAVMISILAVTGCGGSQDGDAAAAKPAKSKAASASPATQ
FT                   KSKAPERNLQQVERDLRFAVAPHKPQMQPLQSGSCIVHGVAPTRRVLSKAEFEAIVGRL
FT                   QKRGWSPLGPLRYSDDETYGKMSYLRLQSGEWEISLGSAPMPSEMREAYAPNEGSIIAA
FT                   ISWKCTGA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624384.1"
FT   misc_feature    23340..23372
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /locus_tag="SCO0026"
FT                   /gene_synonym="SCJ4.07"
FT   gene            complement(23977..24345)
FT                   /db_xref="GeneID:1095460"
FT                   /locus_tag="SCO0027"
FT                   /gene_synonym="SCJ4.08c"
FT   CDS_pept        complement(23977..24345)
FT                   /locus_tag="SCO0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.08c"
FT                   /note="SCJ4.08c, doubtful CDS, function unknown, len: 122
FT                   aa"
FT                   /db_xref="GI:21218606"
FT                   /db_xref="GeneID:1095460"
FT                   /translation="MGRAHRKDVFSVASSSRRMTWSAWGAREFCGVPDLPRTPVVAAAG
FT                   LHVQPAAPGCPDPSQPFGHGVLVVGTTIGGRGSWPTPPAPAKVRRRAAVYEMPSRAVRP
FT                   RAARLACGAPHVVPPWRR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624385.1"
FT   gene            complement(24378..24521)
FT                   /db_xref="GeneID:1095461"
FT                   /locus_tag="SCO0028"
FT                   /gene_synonym="SCJ4.09c"
FT   CDS_pept        complement(24378..24521)
FT                   /locus_tag="SCO0028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.09c"
FT                   /note="SCJ4.09c, doubtful CDS, function unknown, len: 47
FT                   aa"
FT                   /db_xref="GI:21218607"
FT                   /db_xref="GeneID:1095461"
FT                   /translation="MRRCGRAVQWLPGRVDSRQGVRLDGGPQPCPVQQQLGCQFGRSVS
FT                   IA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624386.1"
FT   gene            24644..24943
FT                   /db_xref="GeneID:1095462"
FT                   /locus_tag="SCO0029"
FT                   /gene_synonym="SCJ4.10"
FT   CDS_pept        24644..24943
FT                   /locus_tag="SCO0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.10"
FT                   /note="SCJ4.10, unknown, len: 99 aa"
FT                   /db_xref="GI:21218608"
FT                   /db_xref="GeneID:1095462"
FT                   /translation="MDRLVGQWHRTWEPTVRNASGVLEPPGVLWVAVKGWLDALLVGRH
FT                   GATHPAPGSASATASCRGVRRGVGRGRSAPRPPGAGAGARQARTNGPPGAGPDE"
FT                   /transl_table="11"
FT                   /protein_id="NP_624387.1"
FT   gene            25251..25871
FT                   /db_xref="GeneID:1095463"
FT                   /locus_tag="SCO0030"
FT                   /gene_synonym="SCJ4.11"
FT   CDS_pept        25251..25871
FT                   /locus_tag="SCO0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.11"
FT                   /note="SCJ4.11, unknown, len: 206 aa; similar in its
FT                   N-terminal region to the SCP1 plasmid borne TR:Q9ACQ7
FT                   (EMBL:AL590464) Streptomyces coelicolor secreted protein
FT                   SCP1.261c, 167 aa; fasta scores: opt: 478 Z-score: 480.3
FT                   E(): 4e-19; 74.766% identity in 107 aa overlap"
FT                   /db_xref="GI:21218609"
FT                   /db_xref="GeneID:1095463"
FT                   /translation="MRSLRWVARAVEGHAATPGAAAPGLAAAVPAQAAGYSSALKIKGM
FT                   QYDAPGRGPNKYSGGNTKNKYLTIKNYSKTAAVNLKDYTVKDAAGNACTFKNSHALQHG
FT                   DYASQESQRPRRQHHLPRLTNQPERMTGRRTDTQQPAPPPRPGPLQLEANAPGQHAMTA
FT                   ARAPYAREQAILGGWPGERGCSPATAAVAGAHLPVSGWRRRWR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624388.1"
FT   gene            complement(25843..26385)
FT                   /db_xref="GeneID:1095464"
FT                   /locus_tag="SCO0031"
FT                   /gene_synonym="SCJ4.12c"
FT   CDS_pept        complement(25843..26385)
FT                   /locus_tag="SCO0031"
FT                   /gene_family="HOG000153430" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.12c"
FT                   /note="SCJ4.12c, unknown, len: 180 aa"
FT                   /db_xref="GI:21218610"
FT                   /db_xref="GeneID:1095464"
FT                   /translation="MSDAFTVLWTHDVCRALRRAGRVGERPPVAFIGVHSSLPAWTGAG
FT                   AGDEVYALHVNRREVFVVSRMRVIDRERHGCCGTAPATWEDPAYPGHHDWSMLGAEGCG
FT                   ADPVHVDATPVRFDTPISGDLLARLTWRNRRGQTRQLKYVVDGRLENSVSLQGFYRLTP
FT                   ESSAELADVTASAVSSR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624389.1"
FT   gene            complement(26393..26452)
FT                   /db_xref="GeneID:1095465"
FT                   /locus_tag="SCO0032"
FT                   /gene_synonym="SCJ4.13c"
FT   CDS_pept        complement(26393..26452)
FT                   /locus_tag="SCO0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.13c"
FT                   /note="SCJ4.13c, unknown, len: 19 aa"
FT                   /db_xref="GI:21218611"
FT                   /db_xref="GeneID:1095465"
FT                   /translation="MLMSHGGEVEEGACQCSFI"
FT                   /transl_table="11"
FT                   /protein_id="NP_624390.1"
FT   gene            complement(26527..28773)
FT                   /db_xref="GeneID:1095466"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   CDS_pept        complement(26527..28773)
FT                   /locus_tag="SCO0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted neuraminidase"
FT                   /gene_synonym="SCJ4.14c"
FT                   /note="SCJ4.14c, possible secreted neuraminidase
FT                   (sialidase), len: 748 aa; similar to many, both prokaryote
FT                   and eukaryote, egs. SW:NANH_MICVI sialidase precusor from
FT                   Micromonospora viridifaciens (647 aa) fasta scores; opt:
FT                   274, z-score: 299.9, E(): 2.4e-09, (28.6% identity in 587
FT                   aa overlap) and TR:O35657 (EMBL:Y11412) G9 sialidase
FT                   precusor from Mus musculus (Mouse) (409 aa) fasta scores;
FT                   opt: 325, z-score: 358.5, E(): 1.3e-12, (26.6% identity in
FT                   425 aa overlap). Also similar to TR:Q9ZBW1 (EMBL:AL034443)
FT                   neuraminidase from Streptomyces coelicolor (648 aa) fasta
FT                   scores; opt: 479, z-score: 524.0, E(): 7.9e-22, (33.5%
FT                   identity in 638 aa overlap). Contains possible N-terminal
FT                   signal sequence."
FT                   /db_xref="GI:21218612"
FT                   /db_xref="GeneID:1095466"
FT                   /translation="MGAVGMTARPGPPRRVRRSSGGRRAASLTTVVAAVWAVLSALLLP
FT                   AGVAAAAPVTRSQTTVFTEGEREAGATASYVCFRAPAVVKAADGTLLAFAEGRIGSCSD
FT                   TASIDIVVKRYVNGAWSALQVVARHSAGHIYHNVTPVVDAASGRVVVLYTENYDHIHRI
FT                   ASEDDGLHWTAADDISADVWSTAWGALYAGQMATGPASAIQLTHGRHAGRLVAGMTVRV
FT                   APGAAPANLGGALIYSDDGGLTWRLGASSLGAEPAVGAQELSLFERGDGSLFVTARNEE
FT                   GDSGTRDRAVYAVSGDQGLSFTSDFALLPDMDLPGTGIQASTLALREKNRDGYDRALFA
FT                   APVGPNREDLTIRSSFDGGLTWQDAADGALVKDGYSAYSSMTVLGGGTFGILYEAGTTK
FT                   QYQDIRFATFTEADLDLPAGAGSLTLNQNTGALATTSPEQLHLFAPTPAGDLGHWFEED
FT                   DGTLKRGTWGTGIAGKTVAFNDAVQQHVLARGTDGSLIHRFWSTTGLSSQTWLAAGTVA
FT                   GAPTGFVASGQQHAWVRMTDGRLLHTWWDAGTASLKQQAWAAAGTLAGDPVAVRYGEQQ
FT                   HVWATGTDGRLHHWWWTKGPGIRHELWPGSARGAATALVQKGQLHVYAADPENRLTHWW
FT                   WDSTDQVVKGQVLSTPTALAGPPISFVHGGQQHVFARITGNTLAHWWWDPTTGNNYAVW
FT                   PGPISSDPVAQVVGDTQHVYGAASDGTLSHWWWNSAEGTKRETWGGSIATTSAW"
FT                   /transl_table="11"
FT                   /protein_id="NP_624391.1"
FT   misc_feature    complement(27544..28566)
FT                   /note="Sialidases or neuraminidases function to bind and
FT                   hydrolyze terminal sialic acid residues from various
FT                   glycoconjugates as well as playing roles in pathogenesis,
FT                   bacterial nutrition and cellular interactions. They have a
FT                   six-bladed, beta-propeller fold...; Region: Sialidase;
FT                   cd00260"
FT                   /db_xref="CDD:29333"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(order(27592..27594,27640..27642,27733..27735,
FT                   27940..27942,27988..27990,28462..28464,28537..28539))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:29333"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(order(28039..28047,28054..28062))
FT                   /note="Asp-box motif; other site"
FT                   /db_xref="CDD:29333"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(27343..27462)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(27208..27327)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(27067..27195)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(26935..27054)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(26815..26922)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(26662..26781)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   misc_feature    complement(26530..26649)
FT                   /note="Repeat of unknown function (DUF346); Region: DUF346;
FT                   pfam03984"
FT                   /db_xref="CDD:146556"
FT                   /locus_tag="SCO0033"
FT                   /gene_synonym="SCJ4.14c"
FT   gene            29040..29519
FT                   /db_xref="GeneID:1095467"
FT                   /locus_tag="SCO0034"
FT                   /gene_synonym="SCJ4.15"
FT   CDS_pept        29040..29519
FT                   /locus_tag="SCO0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.15"
FT                   /note="SCJ4.15, unknown, len: 159 aa"
FT                   /db_xref="GI:21218613"
FT                   /db_xref="GeneID:1095467"
FT                   /translation="MPDLAGDLAAVLPPRPDTPGGEALPTDSGDVLRQGDILGRRVQSV
FT                   RLGWDQLTSVQLWMCEQVLGIESAAEDEKPRRTRADKWALNYQAAKQFYEREGHLQVAR
FT                   KWVERIVIGGDGDGGDDKEEREHKLGARIGIQRSRAATPTPERMELLSAIGMRWS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624392.1"
FT   misc_feature    29265..29507
FT                   /note="Helicase associated domain; Region: HA; pfam03457"
FT                   /db_xref="CDD:146213"
FT                   /locus_tag="SCO0034"
FT                   /gene_synonym="SCJ4.15"
FT   gene            complement(29605..30054)
FT                   /db_xref="GeneID:1095468"
FT                   /locus_tag="SCO0035"
FT                   /gene_synonym="SCJ4.16c"
FT   CDS_pept        complement(29605..30054)
FT                   /locus_tag="SCO0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.16c"
FT                   /note="SCJ4.16c, unknown, len: 149 aa"
FT                   /db_xref="GI:21218614"
FT                   /db_xref="GeneID:1095468"
FT                   /translation="MLDRTSAALRQLKHAYKQVETIAALITSKNPKFSHIAANRPVQGL
FT                   VVTREPFHTANAPFQKEMQPNTDTPVTVCSVAELEHLVALRDPSVSQLLGERLADPLAS
FT                   TYSLDIAFRGRNLARNAILDAGWDSYPWKWHADLCRGAAADPRVA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624393.1"
FT   gene            complement(30116..30355)
FT                   /db_xref="GeneID:1095469"
FT                   /locus_tag="SCO0036"
FT                   /gene_synonym="SCJ4.17c"
FT   CDS_pept        complement(30116..30355)
FT                   /locus_tag="SCO0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.17c"
FT                   /note="SCJ4.17c, unknown, len: 79 aa; weak similarity to
FT                   TR:Q48505 (EMBL:M63292;) beta-lactamase (fragment) from
FT                   Lactococcus lactis subsp. lactis (87 aa) fasta scores; opt:
FT                   91, z-score: 133.7, E(): 4.4, (31.8% identity in 66 aa
FT                   overlap)."
FT                   /db_xref="GI:21218615"
FT                   /db_xref="GeneID:1095469"
FT                   /translation="MSAHGVTSRPPRCHGPSKPVVLGEGPNDRNKHGNHRTRLSTAVLV
FT                   IGTGGAGPRAAIELAEAGTDVLDRFESEMPLASR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624394.1"
FT   misc_feature    complement(<30155..30247)
FT                   /note="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit [Energy production and conversion];
FT                   Region: SdhA; COG1053"
FT                   /db_xref="CDD:31253"
FT                   /locus_tag="SCO0036"
FT                   /gene_synonym="SCJ4.17c"
FT   gene            complement(30379..31131)
FT                   /db_xref="GeneID:1095470"
FT                   /locus_tag="SCO0037"
FT                   /gene_synonym="SCJ4.18c"
FT   CDS_pept        complement(30379..31131)
FT                   /locus_tag="SCO0037"
FT                   /gene_family="HOG000220478" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma factor"
FT                   /gene_synonym="SCJ4.18c"
FT                   /note="SCJ4.18c, possible sigma factor, len: 250 aa;
FT                   similar to many proposed sigma factors e.g. TR:CAB44418
FT                   (EMBL:AL078610) sigma factor from Streptomyces coelicolor
FT                   (223 aa) fasta scores; opt: 419, z-score: 506.3, E():
FT                   7.7e-21, (44.3% identity in 183 aa overlap) and
FT                   SW:SIGY_BACSU RNA polymerase sigma factor, SigY from
FT                   Bacillus subtilis (178 aa) fasta scores; opt: 111, z-score:
FT                   142.5, E(): 1.4, (23.9% identity in 117 aa overlap). Note
FT                   possible framshift from previous CDS as similar to all but
FT                   the N-terminus of TR:CAB42013 (EMBL:AL049754) RNA
FT                   polymerase sigma factor from Streptomyces coelicolor (294
FT                   aa) fasta scores; opt: 270, z-score: 327.8, E(): 6.7e-11,
FT                   (26.9% identity in 238 aa overlap) while SCJ4.19c is
FT                   similar to the N-terminus. Contains possible
FT                   helix-turn-helix motif (+3.23 SD) 91-112 aa"
FT                   /db_xref="GI:21218616"
FT                   /db_xref="GeneID:1095470"
FT                   /translation="MAEGRPRGHPRTGAFLATVTTRLAISTARSARVRREAYVGPWLPE
FT                   PVDTSADPQLGAERAEAVEMAVLLLLERLNPVERAAYVLREAFDYSYRQVAAILETSEG
FT                   NARQLVSLARKHLATERREQVSRGEHQRLLEVFLTAAQTGDLRTLEEALAADVVSYADG
FT                   GGIRGASRIPVVGRSYVSKYLTAFAPRFWPGAQVRWVEANDRPAVLVHSDGKAVALLSI
FT                   DASTQGIDRLMWVTNPGKLASYAASSSC"
FT                   /transl_table="11"
FT                   /protein_id="NP_624395.1"
FT   misc_feature    complement(30397..31092)
FT                   /note="RNA polymerase sigma-70 factor, TIGR02957 family;
FT                   Region: SigX4"
FT                   /db_xref="CDD:132002"
FT                   /locus_tag="SCO0037"
FT                   /gene_synonym="SCJ4.18c"
FT   misc_feature    complement(30781..>30906)
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:186312"
FT                   /locus_tag="SCO0037"
FT                   /gene_synonym="SCJ4.18c"
FT   gene            complement(31146..31274)
FT                   /db_xref="GeneID:1095471"
FT                   /locus_tag="SCO0038"
FT                   /gene_synonym="SCJ4.19c"
FT   CDS_pept        complement(31146..31274)
FT                   /locus_tag="SCO0038"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma factor"
FT                   /gene_synonym="SCJ4.19c"
FT                   /note="SCJ4.19c, partial CDS, possible sigma factor, len:
FT                   24 aa; similar to the N-terminus of TR:CAB42013
FT                   (EMBL:AL049754) RNA polymerase sigma factor from
FT                   Streptomyces coelicolor (294 aa) fasta scores; opt: 105,
FT                   z-score: 185.5, E(): 0.0056, (50.0% identity in 32 aa
FT                   overlap) and may frameshift into the downstream CDS
FT                   (SCJ4.18c) which is similar to the remainder."
FT                   /db_xref="GI:21218617"
FT                   /db_xref="GeneID:1095471"
FT                   /translation="MHAGQDLGSIEEATRQFVDARPKLFGIAYRVLGSTVEAEDVL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624396.1"
FT   misc_feature    complement(<31149..31232)
FT                   /note="RNA polymerase sigma-70 factor, TIGR02957 family;
FT                   Region: SigX4"
FT                   /db_xref="CDD:132002"
FT                   /locus_tag="SCO0038"
FT                   /gene_synonym="SCJ4.19c"
FT   gene            31520..32137
FT                   /db_xref="GeneID:1095472"
FT                   /locus_tag="SCO0039"
FT                   /gene_synonym="SCJ4.20"
FT   CDS_pept        31520..32137
FT                   /locus_tag="SCO0039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.20"
FT                   /note="SCJ4.20, unknown, len: 205 aa; similar to the
FT                   N-terminal region of TR:O53411 (EMBL:AL021897) hypothetical
FT                   protein from Mycobacterium tuberculosis (360 aa) fasta
FT                   scores; opt: 165, z-score: 190.9, E(): 0.0028, (34.1%
FT                   identity in 135 aa overlap)."
FT                   /db_xref="GI:21218618"
FT                   /db_xref="GeneID:1095472"
FT                   /translation="MLTRRRDPSPCTDSGEGGPRSGTVALAALPRPVAVVVGAGGVRGA
FT                   VHAGVGHALEQRGFRPDMTTGTSVGALNGAIAAARPDRAAPWLEHVWTQLCRRDVYQPG
FT                   FPATRAGISTDRGLRRQIERDLAEVSGRLPTVALPAGTDVWPAPWDFRHSKRLIEAASA
FT                   TASRFLDELSVDEPVLCRAGHDAVASVTTWWSPRPPFAGAGL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624397.1"
FT   misc_feature    31679..>31954
FT                   /note="Patatins and Phospholipases; Region:
FT                   Patatin_and_cPLA2; cl11396"
FT                   /db_xref="CDD:176430"
FT                   /locus_tag="SCO0039"
FT                   /gene_synonym="SCJ4.20"
FT   misc_feature    31715..31729
FT                   /note="nucleophile elbow; other site"
FT                   /db_xref="CDD:132836"
FT                   /locus_tag="SCO0039"
FT                   /gene_synonym="SCJ4.20"
FT   gene            32134..33357
FT                   /db_xref="GeneID:1095473"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   CDS_pept        32134..33357
FT                   /locus_tag="SCO0040"
FT                   /gene_family="HOG000260753" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase"
FT                   /gene_synonym="SCJ4.21"
FT                   /note="SCJ4.21, possible glycosyl transferase, len: 407 aa;
FT                   similar to many e.g. TR:O86304 (EMBL:AJ223970) macrolide
FT                   glycosyl transferase from Streptomyces ambofaciens (417 aa)
FT                   fasta scores; opt: 615, z-score: 696.4, E(): 2e-31, (34.3%
FT                   identity in 405 aa overlap). Contains Pfam match to entry
FT                   PF00201 UDPGT, UDP-glucoronosyl and UDP-glucosyl
FT                   transferases."
FT                   /db_xref="GI:21218619"
FT                   /db_xref="GeneID:1095473"
FT                   /translation="MSTLAFLNIGMHGHINPTLPVAAELVRRGHTVTYHTFPAFREEIA
FT                   ATGANVRLYPGGDQPLPDPPAPITLMEALARTSLDLLPAVLADLRDDRPDLIVHDSACP
FT                   WGALAARVLGLPAVSSFTTFAYNRHVPSPTRASRELLAGAAARPRNLAGYVGARLALRR
FT                   RFAATGVPLVDLADIRQPLNLVYTSRAFQPAVEEFDRSYRFVGPSIGARPDDPSFPVNR
FT                   LRDPVLYASLGTVFNADPLLLRTFATALSPLAGTVVVSTGQTDPAALGELPGNVLARRS
FT                   VPQLEVLDRAALFITHGGMNSVNEALFAGVPLLLVPQGADQPMVARRVVELGAGLSIRT
FT                   ENITEDSVRAVARRLLEDSRYRAATSGLRATQHEAGGYRRAADELEGYLRPTGAVPVHP
FT                   APVDPQGG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624398.1"
FT   misc_feature    32143..33297
FT                   /note="This family includes the Gtfs, a group of homologous
FT                   glycosyltransferases involved in the final stages of the
FT                   biosynthesis of antibiotics vancomycin and related
FT                   chloroeremomycin. Gtfs transfer sugar moieties from an
FT                   activated NDP-sugar donor to the...; Region: GT1_Gtf_like;
FT                   cd03784"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   misc_feature    32152..33306
FT                   /note="glycosyltransferase, MGT family; Region: MGT;
FT                   TIGR01426"
FT                   /db_xref="CDD:162353"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   misc_feature    order(32170..32175,32179..32181,32569..32571,32578..32583,
FT                   32593..32595,32668..32670,32833..32835,33022..33024,
FT                   33028..33030,33034..33039,33046..33048)
FT                   /note="active site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   misc_feature    order(32170..32172,32833..32835,33022..33024,33028..33030,
FT                   33034..33039)
FT                   /note="TDP-binding site; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   misc_feature    32173..32175
FT                   /note="acceptor substrate-binding pocket; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   misc_feature    order(32215..32217,32416..32418,33277..33282,33289..33291)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99960"
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   misc_feature    33013..33216
FT                   /note="Pfam match to entry PF00201 UDPGT, UDP-glucoronosyl
FT                   and UDP-glucosyl transferases, score 37.10, E-value
FT                   1.3e-09."
FT                   /locus_tag="SCO0040"
FT                   /gene_synonym="SCJ4.21"
FT   gene            33360..33845
FT                   /db_xref="GeneID:1095474"
FT                   /locus_tag="SCO0041"
FT                   /gene_synonym="SCJ4.22"
FT   CDS_pept        33360..33845
FT                   /locus_tag="SCO0041"
FT                   /gene_family="HOG000143515" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein"
FT                   /gene_synonym="SCJ4.22"
FT                   /note="SCJ4.22, possible integral membrane protein, len:
FT                   161 aa; contains possible membrane spanning hydrophobic
FT                   regions."
FT                   /db_xref="GI:21218620"
FT                   /db_xref="GeneID:1095474"
FT                   /translation="MTPAVAALLMLAGLSEALGRVTPVAVRRRGVPRSRIVRLVLAGAV
FT                   VEGAVFALWPLTAWTLAELLPASPSPGDGLDWTPGLVTPLVLSAVLAFPLLGPLLHLLL
FT                   FVGVGAGLTGPLSAATGLGWWTAAGCVAVAGVALGVTVEGVRRLVVRISVTDTAETS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624399.1"
FT   gene            33842..34777
FT                   /db_xref="GeneID:1095475"
FT                   /locus_tag="SCO0042"
FT                   /gene_synonym="SCJ4.23"
FT   CDS_pept        33842..34777
FT                   /locus_tag="SCO0042"
FT                   /gene_family="HOG000143514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.23"
FT                   /note="SCJ4.23, unknown, len: 311 aa"
FT                   /db_xref="GI:21218621"
FT                   /db_xref="GeneID:1095475"
FT                   /translation="MNDFLLWAVALGPALLAEGLLARYEVLAYGAGWRAPVTELPEGVP
FT                   YARGADPDRPPGAYLVYLDGIGKRRVRDSRDGGQLVRAVLAGAPELRVLGQVQPYSPLA
FT                   DPLADRPVWSWLRRRVGLVLFLHNVMQIFVAADRRYRPLYNRAVGSQIATQLRLAGYRP
FT                   GSGVPVVLLSYSGGAQVATGAVDELRERLDCPLLLIMFGGFHNGANDLTRAEHVHRLTS
FT                   SADRIERVGTWMFPQRWPLFRGSGWNRAVRAGNVTVHRFDPATHVGPRSYISRSTLLPD
FT                   GRTHLARTANTVVELIRAHCRSQAAERPLP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624400.1"
FT   gene            complement(35179..35907)
FT                   /db_xref="GeneID:1095476"
FT                   /locus_tag="SCO0043"
FT                   /gene_synonym="SCJ4.24c"
FT   CDS_pept        complement(35179..35907)
FT                   /locus_tag="SCO0043"
FT                   /gene_family="HOG000035270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.24c"
FT                   /note="SCJ4.24c, unknown, len: 242 aa; weakly similar to
FT                   several hypothetical proteins eg. TR:O86850 (EMBL:AJ007731)
FT                   from Streptomyces coelicolor (284 aa) fasta scores; opt:
FT                   167, z-score: 198.4, E(): 0.0011, (31.7% identity in 224 aa
FT                   overlap)."
FT                   /db_xref="GI:21218622"
FT                   /db_xref="GeneID:1095476"
FT                   /translation="MKIAVIGGTGLIGSQVVENLNAAGHEAVPHSLSTGVDVVSGQGVD
FT                   RAVEGADVVVNLRNSPTFDDASLAFFEASMGNLLAAAGDGGVGHFVILSIVGVDKVPGL
FT                   DYYRAKVLQEELLRGGAVPYSIVRATQFMEFMDVVLTWTADKDSVRLPATPIQPIAAKD
FT                   VAAAVAEVAVGAPLNGIRNIGGPEVFALDDLGRLILSRKGDSRTVVTDPTAGMFAAVKG
FT                   DVLTDTDARLAQTRYTDWLS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624401.1"
FT   misc_feature    complement(35239..35907)
FT                   /note="Predicted nucleoside-diphosphate-sugar epimerases
FT                   [Cell envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: COG0702"
FT                   /db_xref="CDD:31046"
FT                   /locus_tag="SCO0043"
FT                   /gene_synonym="SCJ4.24c"
FT   misc_feature    complement(<35644..35907)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCO0043"
FT                   /gene_synonym="SCJ4.24c"
FT   gene            complement(36006..36674)
FT                   /db_xref="GeneID:1095477"
FT                   /locus_tag="SCO0044"
FT                   /gene_synonym="SCJ4.25c"
FT   CDS_pept        complement(36006..36674)
FT                   /locus_tag="SCO0044"
FT                   /gene_family="HOG000146736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase"
FT                   /gene_synonym="SCJ4.25c"
FT                   /note="SCJ4.25c, probable oxidoreductase, len: 222 aa;
FT                   similar to many e.g. SW:NOX_THETH NADH dehydrogenase from
FT                   Thermus thermophilus (205 aa) fasta scores; opt: 169,
FT                   z-score: 215.5, E(): 0.00012, (27.7% identity in 220 aa
FT                   overlap). Contains Pfam match to entry PF00881
FT                   Nitroreductase, Nitroreductase family"
FT                   /db_xref="GI:21218623"
FT                   /db_xref="GeneID:1095477"
FT                   /translation="MDVYEAVKSRRSVRRFSGRPVPREVLKRVLSAAAWAPSGSNLQPW
FT                   HAFVLSDGPLAALKKRAGARLAAGDPFDEPEYEQYPQHLKSPYRERRAAFGEQRYGALG
FT                   IAREDTEARQRAASGNWECFGAPAALFCYIDRDLGHPQWSDVGMFLQNVMLLLREEGLH
FT                   SCTQMAWAKFHSTVAETVAPPPDLMLFCGMSIGYEEPAANSARTGRAALGETVTFVDGP
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="NP_624402.1"
FT   misc_feature    complement(36027..36668)
FT                   /note="Nitroreductase family. Members of this family
FT                   utilize FMN as a cofactor and catalyze reduction of a
FT                   variety of nitroaromatic compounds, including nitrofurans,
FT                   nitrobenzens, nitrophenol, nitrobenzoate and quinones by
FT                   using either NADH or NADPH as a...; Region: Nitroreductase;
FT                   cd02136"
FT                   /db_xref="CDD:73304"
FT                   /locus_tag="SCO0044"
FT                   /gene_synonym="SCJ4.25c"
FT   misc_feature    complement(order(36168..36173,36555..36557,36633..36635,
FT                   36639..36641,36645..36647))
FT                   /note="putative FMN binding site; other site"
FT                   /db_xref="CDD:73304"
FT                   /locus_tag="SCO0044"
FT                   /gene_synonym="SCJ4.25c"
FT   misc_feature    complement(36123..36671)
FT                   /note="Pfam match to entry PF00881 Nitroreductase,
FT                   Nitroreductase family, score 37.00, E-value 4.2e-07"
FT                   /locus_tag="SCO0044"
FT                   /gene_synonym="SCJ4.25c"
FT   gene            complement(36689..36817)
FT                   /db_xref="GeneID:1095478"
FT                   /locus_tag="SCO0045"
FT                   /gene_synonym="SCJ4.26c"
FT   CDS_pept        complement(36689..36817)
FT                   /locus_tag="SCO0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.26c"
FT                   /note="SCJ4.26c, unknown, len: 42 aa"
FT                   /db_xref="GI:21218624"
FT                   /db_xref="GeneID:1095478"
FT                   /translation="MGFSRQRYGARKRPGAGQAQHLVIHEMVANDTVTIATMILSD"
FT                   /transl_table="11"
FT                   /protein_id="NP_624403.1"
FT   gene            36816..37478
FT                   /db_xref="GeneID:1095479"
FT                   /locus_tag="SCO0046"
FT                   /gene_synonym="SCJ4.27"
FT   CDS_pept        36816..37478
FT                   /product="hydrolase"
FT                   /gene_family="HOG000247892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="SCO0046"
FT                   /gene_synonym="SCJ4.27"
FT                   /db_xref="GI:21218625"
FT                   /db_xref="GeneID:1095479"
FT                   /translation="MATLLHIDSSVFPAEASASRSVTAAFRRTWEEQHPEGTVIYRDLA
FT                   AVPVPHITADAWSAGYADPSERSTRQSAAFAARLELIEELERADVILIGAPMYNYTVPS
FT                   TLKAWLDSVLLLGRTAGEAPSAQGTPTVVVASRGGSYAPGTPREDFEFVQNYLEAVLRS
FT                   TLGLDLEFIVPELTMAPRNPAMSELLPLFESSRERAHSEAVTKAKELTERLTADNGR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624404.1"
FT   misc_feature    36816..37448
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:185997"
FT                   /locus_tag="SCO0046"
FT                   /gene_synonym="SCJ4.27"
FT   gene            complement(37614..38768)
FT                   /db_xref="GeneID:1095480"
FT                   /locus_tag="SCO0047"
FT                   /gene_synonym="SCJ4.28c"
FT   CDS_pept        complement(37614..38768)
FT                   /locus_tag="SCO0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /gene_synonym="SCJ4.28c"
FT                   /note="SCJ4.28c, possible transcriptional regulator, len:
FT                   384 aa; C-terminal similar to many transcriptional
FT                   regulator eg. SW:SLYA_ECOLI transcriptional regulator from
FT                   Escherichia coli (146 aa) fasta scores; opt: 156, z-score:
FT                   184.9, E(): 0.0061, (24.6% identity in 122 aa overlap).
FT                   Contains Pfam match to entry PF01047 MarR, MarR family"
FT                   /db_xref="GI:21218626"
FT                   /db_xref="GeneID:1095480"
FT                   /translation="MTDDPHAPVPTALNPVPLGGGPTNVDLHLKPEKFGNVFLSDRLDP
FT                   SRTQVPAAAQRPATAASGNEPTQSVAWKTIPSWFLVATDDRTMGTDNLRFMAKRAKATT
FT                   VEVDAPHAVKETNPDDVTKLILRAAGDSRPSLAKTGTSGRTAFLGGAAVLSIAAGRHRD
FT                   PRPPHLTDRSATVAQSLHGSIPTDSAVLVPGGGGRAARSGHRWLFQVKRYRVTWRRYDA
FT                   VMAVHASSRDAASRASDRPGDVSPFALGLLLRRAHWRAAGVMSEALRPLGIELRHFAVL
FT                   IVLVDRGPTVQRDLAAETGTDKAGIMRVVDDLERRNLAVRKPVPGDRRARAVEITPAGL
FT                   ELFDAAHVAAEPLAEGLVADLGPDDTERLTRLLTRLAHPGGSDA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624405.1"
FT   misc_feature    complement(37674..37973)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="SCO0047"
FT                   /gene_synonym="SCJ4.28c"
FT   misc_feature    complement(37641..37952)
FT                   /note="Pfam match to entry PF01047 MarR, MarR family, score
FT                   48.90, E-value 1.1e-10"
FT                   /locus_tag="SCO0047"
FT                   /gene_synonym="SCJ4.28c"
FT   gene            complement(39107..39490)
FT                   /db_xref="GeneID:1095481"
FT                   /locus_tag="SCO0048"
FT                   /gene_synonym="SCJ4.29c"
FT   CDS_pept        complement(39107..39490)
FT                   /locus_tag="SCO0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.29c"
FT                   /note="SCJ4.29c, unknown, len: 127 aa"
FT                   /db_xref="GI:21218627"
FT                   /db_xref="GeneID:1095481"
FT                   /translation="MSSPAGAEDDPDRAGKDMRVTACTVGTYRLPCPFHLATTPIPSLA
FT                   ILGRQEHPGGVSRAPVVVHRPSISGSSRVSAHRYGRDEILGTVCSDHDPVVFLEGVGID
FT                   EAVPDDRRWVKWRGGPAHEFRAA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624406.1"
FT   gene            39489..39812
FT                   /db_xref="GeneID:1095482"
FT                   /locus_tag="SCO0049"
FT                   /gene_synonym="SCJ4.30"
FT   CDS_pept        39489..39812
FT                   /locus_tag="SCO0049"
FT                   /gene_family="HOG000146513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.30"
FT                   /note="SCJ4.30, unknown, len: 107 aa"
FT                   /db_xref="GI:21218628"
FT                   /db_xref="GeneID:1095482"
FT                   /translation="MSAELERLRAENRQLHEAVTSHAVVDQAIGVLVALGRISPTDGFA
FT                   VLRQVSQHTNIKLSALAECILQHGRGADLPGPVQTELLTALKERFVPTGLFDKSGDAAA
FT                   WIR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624407.1"
FT   misc_feature    39519..39686
FT                   /note="ANTAR domain; Region: ANTAR; pfam03861"
FT                   /db_xref="CDD:146474"
FT                   /locus_tag="SCO0049"
FT                   /gene_synonym="SCJ4.30"
FT   gene            39877..40212
FT                   /db_xref="GeneID:1095483"
FT                   /locus_tag="SCO0050"
FT                   /gene_synonym="SCJ4.31"
FT   CDS_pept        39877..40212
FT                   /locus_tag="SCO0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.31"
FT                   /note="SCJ4.31, hypothetical protein, len: 111 aa; region
FT                   of similarity to many respiratory electron transport chain
FT                   proteins eg. TR:O49078 (EMBL:AF037456) cytochrome B6-F
FT                   complex iron-sulphur subunit from Fritillaria agrestis (230
FT                   aa) fasta scores; opt: 104, z-score: 143.7, E(): 1.2,
FT                   (32.8% identity in 67 aa overlap)."
FT                   /db_xref="GI:21218629"
FT                   /db_xref="GeneID:1095483"
FT                   /translation="MRQGGAPRMATGGTARLLISNGGDATLELTVEPWADTYQIFPKQT
FT                   WVVVTHSPAADGSWAGTLRGDEPFQVDHQPESVAVWVNGNCFHLSDVEGNAIDSADWHC
FT                   PVQGSSF"
FT                   /transl_table="11"
FT                   /protein_id="NP_624408.1"
FT   gene            complement(40223..40918)
FT                   /db_xref="GeneID:1095484"
FT                   /locus_tag="SCO0051"
FT                   /pseudo
FT                   /gene_synonym="SCJ4.32c; SCJ4.33c"
FT   misc_feature    complement(40223..40918)
FT                   /note="SCJ4.32c, partial CDS, possible transposase, len:
FT                   59aa; similar to N-terminal region of many eg. TR:CAB38475
FT                   (EMBL:AL035636) putative transposase (229 aa) fasta scores;
FT                   opt: 249, z-score: 392.1, E(): 1.8e-14, (59.6% identity in
FT                   57 aa overlap).; SCJ4.33c, partial CDS, possible
FT                   transposase, len: 146aa; similar to N-terminal region of
FT                   many eg. TR:CAB38475 (EMBL:AL035636) transposase (229 aa)
FT                   fasta scores; opt: 532, z-score: 652.6, E(): 5.5e-29,
FT                   (55.6% identity in 144 aa overlap).;putative transposase"
FT                   /locus_tag="SCO0051"
FT                   /pseudo
FT                   /gene_synonym="SCJ4.32c; SCJ4.33c"
FT   gene            41354..42174
FT                   /db_xref="GeneID:1095485"
FT                   /locus_tag="SCO0053"
FT                   /pseudo
FT                   /gene_synonym="SCJ4.34; SCJ4.35"
FT   misc_feature    41354..42174
FT                   /note="SCJ4.34, partial CDS, possible transposase, len: 146
FT                   aa; similar to SW:YI22_BURCE insertion element hypothetical
FT                   protein from Pseudomonas cepacia (147 aa) fasta scores;
FT                   opt: 439, z-score: 578.9, E(): 7e-25, (57.6% identity in
FT                   118 aa overlap).; SCJ4.35, partial CDS, possible
FT                   transposase, len: 124 aa; similar to SW:YI21_BURCE
FT                   insertion element hypothetical protein from Pseudomonas
FT                   cepacia (147 aa) fasta scores; opt: 527, z-score: 683.1,
FT                   E(): 1.1e-30, (65.3% identity in 118 aa
FT                   overlap).;transposase"
FT                   /locus_tag="SCO0053"
FT                   /pseudo
FT                   /gene_synonym="SCJ4.34; SCJ4.35"
FT   gene            complement(42171..43682)
FT                   /db_xref="GeneID:1095486"
FT                   /locus_tag="SCO0055"
FT                   /gene_synonym="SCJ4.36c"
FT   CDS_pept        complement(42171..43682)
FT                   /locus_tag="SCO0055"
FT                   /gene_family="HOG000053947" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-associated oxidoreductase"
FT                   /gene_synonym="SCJ4.36c"
FT                   /note="SCJ4.36c, possible membrane-associated
FT                   oxidoreductase, len: 503aa; N-terminal region similar to
FT                   TR:Q53931 (EMBL:X64420) HisD L-histidinol:NAD
FT                   oxidoreductase from Streptomyces coelicolor (203 aa) fasta
FT                   scores; opt: 345, z-score: 401.6, E(): 5.2e-15, (35.6%
FT                   identity in 177 aa overlap). Also similar to TR:O88013
FT                   (EMBL:AL031107) hypothetical protein from Streptomyces
FT                   coelicolor (527 aa) fasta scores; opt: 684, z-score: 783.6,
FT                   E(): 0, (37.0% identity in 525 aa overlap)"
FT                   /db_xref="GI:21218630"
FT                   /db_xref="GeneID:1095486"
FT                   /translation="MLSYDELTSPERELWDAFPEGRRVDLRTGVPDTDAPPAGDRWGPD
FT                   RTVRAAVVATLLLGANDDRSGTVAALRLTGARITGRLNLSGTEICHTFSLQGCRLDEAV
FT                   QLHGATTRTIEITNSWVPGINAELARIEGDLDLRRSTFEGGFLILVNARMAGNLLISDA
FT                   RILDPEEWAVRAGGLVLNGGVFGQRLTTQGGLRLPGAQLLSGLFLQGARLGNTAGVALA
FT                   AGGMAASTVDCSQGFAAQGGVLLRRARIEGLLTFEGAQLNGDGVALDCVSMHVGDFDYR
FT                   TATPLSGLVDLRSAQATWCQDSEQSWPREVLLEGFTYGSIRFWDAPSAAGDDGPPTRDG
FT                   VARRLAWLRRNPGYVPQPYEQLAGWYRQIGHDDDARRVLLAKQRHRRLTLSPSARAWGH
FT                   LLDVTVGYGYRPWLAGVWLLALTLLGTLAFSTHSPSPVKRDEGSPFQPLVYTLDLLIPL
FT                   GGLGQRTGWYWPNSSLQWLSYLLIAFGWMLTTAIIAGITRTLQKN"
FT                   /transl_table="11"
FT                   /protein_id="NP_624409.1"
FT   gene            43768..43857
FT                   /db_xref="GeneID:1095487"
FT                   /locus_tag="SCO0056"
FT                   /gene_synonym="SCJ4.37"
FT   CDS_pept        43768..43857
FT                   /locus_tag="SCO0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.37"
FT                   /note="SCJ4.37, unknown, len: 29 aa"
FT                   /db_xref="GI:21218631"
FT                   /db_xref="GeneID:1095487"
FT                   /translation="MCRELLAKARLHPIESETDDTVLPTELTA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624410.1"
FT   gene            43950..44090
FT                   /db_xref="GeneID:1095488"
FT                   /locus_tag="SCO0057"
FT                   /gene_synonym="SCJ4.38"
FT   CDS_pept        43950..44090
FT                   /locus_tag="SCO0057"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.38"
FT                   /note="SCJ4.38, unknown, len: 46 aa"
FT                   /db_xref="GI:21218632"
FT                   /db_xref="GeneID:1095488"
FT                   /translation="MLWPLPWYLTGPAALAWACLRAREKAAHGQAPEGDADSQSEWGEV
FT                   A"
FT                   /transl_table="11"
FT                   /protein_id="NP_624411.1"
FT   gene            44253..44975
FT                   /db_xref="GeneID:1095489"
FT                   /locus_tag="SCO0058"
FT                   /gene_synonym="SCJ4.39"
FT   CDS_pept        44253..44975
FT                   /locus_tag="SCO0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.39"
FT                   /note="SCJ4.39, unknown, len: 240 aa"
FT                   /db_xref="GI:21218633"
FT                   /db_xref="GeneID:1095489"
FT                   /translation="MLGKQVLPAAGVEEAVAVFRCACRTASHWSFPWAICPRTRVERPP
FT                   RRRTPDRSRPRRRARAGHRSSSIDATARWGHASVARAQDILARRYRLECADAAFELLKT
FT                   SSQQSNVKLHTLADAVVRTPAPDLDARSWRRRPPPAGRSQCGTWAPRPYSTRHPVRPSC
FT                   RRAAGPPTASPLITVKGHVLGMVSSHHGHPLHGFSRLQLAALQQTGTDVGRWLSWHWDT
FT                   VVLDALERLHVQAVGACR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624412.1"
FT   misc_feature    44475..44615
FT                   /note="ANTAR domain; Region: ANTAR; pfam03861"
FT                   /db_xref="CDD:146474"
FT                   /locus_tag="SCO0058"
FT                   /gene_synonym="SCJ4.39"
FT   gene            45267..46073
FT                   /db_xref="GeneID:1095490"
FT                   /locus_tag="SCO0059"
FT                   /gene_synonym="SCJ4.40"
FT   CDS_pept        45267..46073
FT                   /locus_tag="SCO0059"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc-binding oxidoreductase"
FT                   /gene_synonym="SCJ4.40"
FT                   /note="SCJ4.40, possible zinc-binding oxidoreductase, len:
FT                   268 aa; similar to many both prokaryote and eukaryote egs.
FT                   TR:O85702 (EMBL:AF072709) oxidoreductase from Streptomyces
FT                   lividans 66 (313 aa) fasta scores; opt: 494, z-score:
FT                   509.6, E(): 5e-21, (41.3% identity in 240 aa overlap) and
FT                   SW:QOR_CAVPO quinone oxidoreductase from Cavia porcellus
FT                   (guinea pig) (329 aa) fasta scores; opt: 397, z-score:
FT                   411.5, E(): 1.5e-15, (32.8% identity in 244 aa overlap).
FT                   Contains Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases"
FT                   /db_xref="GI:21218634"
FT                   /db_xref="GeneID:1095490"
FT                   /translation="MKAVRFHEYGAPDVLRYEDVEQPLPGAGEVRVRVAATSFNSVDGN
FT                   IRGGFMRGPIPVVLPHTPGIDVAGTVDALGEGVDGVAVGDDAIGFLTMDGDGAAAEYVL
FT                   APAEALAPAPRSVPLADVAAVPVVGLTAYQTLFNRGRLTAGQRVLINGAGGTVGGYAVQ
FT                   LAKDAGAHVIATSSPRSREAVASAGDDEIIDHTTTDVTAAVTEPVDIALSLAPVAPAEL
FT                   AALVTLVRPGGVVVNTTVWMPAPATRSAAYGASTCSSAATSTSWWR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624413.1"
FT   misc_feature    45267..>45839
FT                   /note="alcohol dehydrogenase and quinone reductase-like
FT                   medium chain degydrogenases/reductases; Region: MDR_like_2;
FT                   cd05289"
FT                   /db_xref="CDD:176191"
FT                   /locus_tag="SCO0059"
FT                   /gene_synonym="SCJ4.40"
FT   misc_feature    order(45384..45392,45399..45401,45645..45647,45657..45659,
FT                   45723..45740,45795..45800,45804..45806)
FT                   /note="putative NAD(P) binding site; other site"
FT                   /db_xref="CDD:176191"
FT                   /locus_tag="SCO0059"
FT                   /gene_synonym="SCJ4.40"
FT   misc_feature    45285..46058
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenases, score -75.50, E-value 1e-05"
FT                   /locus_tag="SCO0059"
FT                   /gene_synonym="SCJ4.40"
FT   gene            46064..46201
FT                   /db_xref="GeneID:1095491"
FT                   /locus_tag="SCO0060"
FT                   /gene_synonym="SCJ4.41"
FT   CDS_pept        46064..46201
FT                   /locus_tag="SCO0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.41"
FT                   /note="SCJ4.41, unknown, len: 45 aa; predicted by GC
FT                   Frameplot and amino acid usage."
FT                   /db_xref="GI:21218635"
FT                   /db_xref="GeneID:1095491"
FT                   /translation="MALIVGGELRVAVTERAALTELPALHSRAAEGAVHGKVVVVPSAA
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="NP_624414.1"
FT   gene            complement(46430..47734)
FT                   /db_xref="GeneID:1095492"
FT                   /locus_tag="SCO0061"
FT                   /gene_synonym="SCJ4.42c"
FT   CDS_pept        complement(46430..47734)
FT                   /locus_tag="SCO0061"
FT                   /gene_family="HOG000260707" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.42c"
FT                   /note="SCJ4.42c, unknown, len: 434 aa; similar to
FT                   SW:YDEG_SCHPO hypothetical protein from Schizosaccharomyces
FT                   pombe (fission yeast) (509 aa) fasta scores; opt: 665,
FT                   z-score: 791.0, E(): 0, (37.6% identity in 423 aa overlap)
FT                   and to TR:Q9KEQ9 (EMBL:AP001509) Bacillus halodurans BH0790
FT                   protein, 454 aa; fasta scores: opt: 1262 Z-score: 1468.0
FT                   bits: 280.8 E(): 3.9e-74; 45.433% identity in 416 aa
FT                   overlap"
FT                   /db_xref="GI:21218636"
FT                   /db_xref="GeneID:1095492"
FT                   /translation="MSFPTSITDHPIVQEAVHRLDDLGDPRAGQTLTRCLNDTLARTIR
FT                   PMPDGTAFVVTGDIPAMWLRDSSTQMMPYLALLKDDTALQHLLLAVLRRQFQQIAHDPY
FT                   ANAFNAEPSGRAHDPEDLCGDPWVWEQKYEVDSLAFPLLLAHRFWAATGRTDHVPGMLR
FT                   TARTVISVWRTEQDHERLSTYRFRRENGPSSDTLPNAGRGTPVTRTGMTWSGFRPSDDA
FT                   CAFGYNVPANLCAAAALDGAAELAHHTHDTELAEDAARLAAELRAATARHGTVRHPDFG
FT                   SIYAYEVDGNGNAVLMDDANMPGLLSLPLVANIPTTDPVYLATRGFVLSPRNPTWYRGT
FT                   AAEGIGSPHTPDEHIWPIAIAVQGLTSNDTTERRWALTTLLATDAGTGQMHESFHKDDP
FT                   HRFTRPWFSWANAMYAELALDTVGLGTRPLWQAGT"
FT                   /transl_table="11"
FT                   /protein_id="NP_624415.1"
FT   misc_feature    complement(46448..47662)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG3538"
FT                   /db_xref="CDD:33340"
FT                   /locus_tag="SCO0061"
FT                   /gene_synonym="SCJ4.42c"
FT   misc_feature    complement(46478..47662)
FT                   /note="Protein of unknown function (DUF1237); Region:
FT                   DUF1237; pfam06824"
FT                   /db_xref="CDD:148436"
FT                   /locus_tag="SCO0061"
FT                   /gene_synonym="SCJ4.42c"
FT   gene            complement(47789..48892)
FT                   /db_xref="GeneID:1095493"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   CDS_pept        complement(47789..48892)
FT                   /locus_tag="SCO0062"
FT                   /gene_family="HOG000220179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="LacI family transcriptional regulator"
FT                   /gene_synonym="SCJ4.43c"
FT                   /note="SCJ4.43c, probable LacI family transcriptional
FT                   regulator, len: 367 aa; similar to many transcriptional
FT                   regulators e.g. SW:GALR_ECOLI galactose operon repressor
FT                   (343 aa) fasta scores; opt: 549, z-score: 636.2, E():
FT                   4.5e-28, (32.5% identity in 332 aa overlap). Contains Pfam
FT                   matches to entry PF00532 Peripla_BP_like, Periplasmic
FT                   binding proteins and LacI family and entry PF00356 lacI,
FT                   Bacterial regulatory proteins, lacI family. Contains
FT                   possible helix-turn-helix motif (+3.86 SD) 26-47."
FT                   /db_xref="GI:21218637"
FT                   /db_xref="GeneID:1095493"
FT                   /translation="MRTGGPVQEGRGRDRSMTARRGSGPTMHDVGKLAQVSAMTVSRVL
FT                   KDDPGVSEATRERVFAAVDRLGYRRNQTARSLRLGGSGMIGLVVTNLANPFYSRLALGV
FT                   QEVATEYGLRVVLSNSGEQADREPGLIDGLVDHQVEGLIVVPAGSRQQHLARAMRHVPV
FT                   VLAARPPAGLDTDCVLVEDFHGAREATGCLLADGHTRIAFLGNPPALYTGAERLRGFWA
FT                   AHEEVGVEPDNALICQGLVDSATAERATLDLLGRAERPTALFCTNNRISQGAIRALYKS
FT                   GTTLPVAGFDDFDLSDVLGLPLTLVSYDADEIGRQAARLLIDRLEQDDEAAPRASRRVT
FT                   VPTRVVRHGAPSADGPGQRPPAPDTSV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624416.1"
FT   misc_feature    complement(47891..48820)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PurR; COG1609"
FT                   /db_xref="CDD:31797"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(48659..48811)
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(order(48659..48664,48668..48673,48680..48682,
FT                   48689..48691,48728..48730,48737..48742,48755..48757,
FT                   48764..48769,48773..48787,48809..48811))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(48662..48691)
FT                   /note="domain linker motif; other site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(47891..48643)
FT                   /note="Ligand binding domain of the LacI tanscriptional
FT                   regulator family belonging to the type I
FT                   periplasmic-binding fold protein superfamily; Region:
FT                   PBP1_LacI_sugar_binding_like; cd06267"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(order(48053..48058,48065..48067,48077..48079,
FT                   48161..48163,48479..48487,48494..48496,48503..48505,
FT                   48536..48538,48542..48556,48575..48580,48584..48589,
FT                   48596..48604,48641..48643))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(order(47969..47971,48020..48022,48170..48172,
FT                   48245..48247,48353..48355,48392..48394,48458..48460,
FT                   48593..48595,48602..48607))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(47942..48652)
FT                   /note="Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and LacI family., score 89.10,
FT                   E-value 9.2e-23"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   misc_feature    complement(48743..48826)
FT                   /note="Pfam match to entry PF00356 lacI, Bacterial
FT                   regulatory proteins, lacI family, score 30.90, E-value
FT                   3.3e-07"
FT                   /locus_tag="SCO0062"
FT                   /gene_synonym="SCJ4.43c"
FT   gene            complement(48889..49824)
FT                   /db_xref="GeneID:1095494"
FT                   /locus_tag="SCO0063"
FT                   /gene_synonym="SCJ4.44c"
FT   CDS_pept        complement(48889..49824)
FT                   /locus_tag="SCO0063"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucokinase"
FT                   /gene_synonym="SCJ4.44c"
FT                   /note="SCJ4.44c, possible glucokinase, len: 311 aa; similar
FT                   to many eg. SW:GLK_STRCO glucokinase from Streptomyces
FT                   coelicolor (317 aa) fasta scores; opt: 175, z-score: 195.7,
FT                   E(): 0.0015, (28.2% identity in 326 aa overlap). Contains
FT                   Pfam match to entry PF00480 ROK, ROK family"
FT                   /db_xref="GI:21218638"
FT                   /db_xref="GeneID:1095494"
FT                   /translation="MITATTRHASRPVPVLDIGGTHVTAALVDPTASRPVPSPVIRRPL
FT                   RAHADADAVLDAIARAALALPAGHSPRWGVAMPGPFDYATGVGRFADVGKFESLNGVDV
FT                   GAGLRERLADRCERLRFLNDADAFAVGEYGSGAAAGHDHVVCLTLGTGVGSSFLSGGRP
FT                   VHSGPLVPPGGHAYRLTVHGRPLEDTVSRRGIRAHYARLTSATGDQHLPDVRDIAARAR
FT                   KGDAAAQEAFRYAFDALGQALAPWIDRFEATAVVIGGSMARSWDLIHPALTTGRAPADG
FT                   PDVPVLPARQPEEAPLLGAAHWAQGTPDAP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624417.1"
FT   misc_feature    complement(48910..49779)
FT                   /note="Transcriptional regulator/sugar kinase
FT                   [Transcription / Carbohydrate transport and metabolism];
FT                   Region: NagC; COG1940"
FT                   /db_xref="CDD:32123"
FT                   /locus_tag="SCO0063"
FT                   /gene_synonym="SCJ4.44c"
FT   misc_feature    complement(49321..>49470)
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:186831"
FT                   /locus_tag="SCO0063"
FT                   /gene_synonym="SCJ4.44c"
FT   misc_feature    complement(49336..49467)
FT                   /note="Pfam match to entry PF00480 ROK, ROK family, score
FT                   30.40, E-value 5.8e-08"
FT                   /locus_tag="SCO0063"
FT                   /gene_synonym="SCJ4.44c"
FT   gene            complement(49821..51539)
FT                   /db_xref="GeneID:1095495"
FT                   /locus_tag="SCO0064"
FT                   /gene_synonym="SCJ4.45c"
FT   CDS_pept        complement(49821..51539)
FT                   /locus_tag="SCO0064"
FT                   /gene_family="HOG000146771" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.45c"
FT                   /note="SCJ4.45c, unknown, len: 572 aa"
FT                   /db_xref="GI:21218639"
FT                   /db_xref="GeneID:1095495"
FT                   /translation="MPASRSYDPLPSYQPVDGRVTVGWPALAADLPPGPLVLAVDGPAA
FT                   LDWTALADGLAGAVRAAGRDVEPIDVRGHYAAAADERITALPVPADDPFFTPLSQARVA
FT                   DLFDSPPRPERPVRDGVALVYGPGASLCGPDLLWYADLPKRYAEAAVSKGELPVGVNLG
FT                   RPAVPGDLVRLFYTDWPVLDRHRDAIAGRIDRWIDVQNADVPTALDGAALRSTLAHLAR
FT                   GPVRTRPYFNSTPWGGQWAASELGFTPQSGNTALGYELIAPEAGVMIGDKDAAQVEVPF
FT                   QLLCVAHPEDMLGVDVHRAFGTSFPIRFDYLDTMGGGNLSLHLHPRERYMREVFGWPYT
FT                   QHETYYVTASEDGARVLLGLTGQADLDVMRRQVEDSIDNGTPMPVEQHIQSHPATVGQL
FT                   FMIPAGTPHASGAGNLVLEVSATPYLYSLRLYDWLRKDAAGASRPLPYEHGFANLDTAR
FT                   RGEDVTKDLIQQPRPLRSGEGWREEVLGALPDMFYAVHRLVVAQGCDILDDTAGRFHIL
FT                   NVAAGEGAVIETRDGRSHTLAFAETITIPAAVGPYRVRALGGDEVRIVKALVVEP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624418.1"
FT   misc_feature    complement(49866..50873)
FT                   /note="Phosphomannose isomerase [Carbohydrate transport and
FT                   metabolism]; Region: ManA; COG1482"
FT                   /db_xref="CDD:31671"
FT                   /locus_tag="SCO0064"
FT                   /gene_synonym="SCJ4.45c"
FT   misc_feature    complement(49848..50855)
FT                   /note="mannose-6-phosphate isomerase; Provisional; Region:
FT                   PRK15131; cl14659"
FT                   /db_xref="CDD:187413"
FT                   /locus_tag="SCO0064"
FT                   /gene_synonym="SCJ4.45c"
FT   gene            51831..53144
FT                   /db_xref="GeneID:1095496"
FT                   /locus_tag="SCO0065"
FT                   /gene_synonym="SCJ4.46"
FT   CDS_pept        51831..53144
FT                   /locus_tag="SCO0065"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular binding protein"
FT                   /gene_synonym="SCJ4.46"
FT                   /note="SCJ4.46, possible extracellular binding protein,
FT                   part of a possible binding protein dependent transport
FT                   system, len: 437 aa; similar to many egs. TR:Q9Z492
FT                   (EMBL:AF043654) BxlE, extracellular binding protein from
FT                   Streptomyces lividans (434 aa) fasta scores; opt: 256,
FT                   z-score: 290.5, E(): 8.1e-09, (23.3% identity in 446 aa
FT                   overlap) and SW:YC14_PYRHO hypothetical ABC transporter
FT                   extracellular binding protein from Pyrococcus horikoshii
FT                   OT3 (441 aa) fasta scores; opt: 348, z-score: 393.3, E():
FT                   1.5e-14, (25.4% identity in 343 aa overlap). Contains
FT                   Prosite match to PS00013 Prokaryotic membrane lipoprotein
FT                   lipid attachment site so may be anchored by lipid."
FT                   /db_xref="GI:21218640"
FT                   /db_xref="GeneID:1095496"
FT                   /translation="MSASGRTSSAAVPLARRRFLTGVAAGAAALAAGGCARGASTSAQP
FT                   GTTSISNDNATWDDGYRAAGRELEKITGYTLRPLSNPSVTSYQQVVQMTLQTSKSSDLV
FT                   KWASGYQLKRLARAGGLTDLTPVWKGYAAKGWVRGTSRESVSYRGKVFGIPLYESYYVL
FT                   FYSKPVFGKLGLSAPSSWDELLHCAEVLKRNRITPFLASQVGSWPAIEWFQELVSKVDP
FT                   GFYQRLVAGEASYTDDRARRAMDIWHDFMRKGWMTSPDFDQARGPGALKEGTVGMFLHG
FT                   TWQASGMSAAGMKPGTDYGAFILPTVRPATPKSVIAESGVFVVPSRASSHEAAMANVGA
FT                   WLDPSVQRVWSDFLQDSSANPKVRAGNPVVAGLQRDVARNRRTALVRYWEAGPPSLIQG
FT                   NTNDLGGFMAGQTSPATTLRRMQERALDEWAAWKRDEA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624419.1"
FT   misc_feature    51948..53105
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="SCO0065"
FT                   /gene_synonym="SCJ4.46"
FT   misc_feature    <52170..53105
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:187020"
FT                   /locus_tag="SCO0065"
FT                   /gene_synonym="SCJ4.46"
FT   misc_feature    51903..51935
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /locus_tag="SCO0065"
FT                   /gene_synonym="SCJ4.46"
FT   gene            53141..54100
FT                   /db_xref="GeneID:1095497"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   CDS_pept        53141..54100
FT                   /locus_tag="SCO0066"
FT                   /gene_family="HOG000220406" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane permease"
FT                   /gene_synonym="SCJ4.47"
FT                   /note="SCJ4.47, possible integral membrane permease, part
FT                   of a possible binding protein dependent transport system,
FT                   len: 319 aa; similar to many eg. SW:LACF_AGRRD lactose
FT                   transport system permease from Agrobacterium radiobacter
FT                   (298 aa) fasta scores; opt: 460, z-score: 522.1, E():
FT                   1e-21, (30.5% identity in 272 aa overlap). Contains Pfam
FT                   match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component and Prosite match to PS00402
FT                   Binding-protein-dependent transport systems inner membrane
FT                   comp sign."
FT                   /db_xref="GI:21218641"
FT                   /db_xref="GeneID:1095497"
FT                   /translation="MSTSVTDRRPPTPAGGPGPTRRPTRRPPLTQKWATARERVTAGGF
FT                   MAPAVLLVALFLLAPFVWTIYRSFFSDTRTSPFSWFDNYSLFASDPALSRSIQNTLMWV
FT                   VGTVALPFVLGLAIACMTNAGRFSRLARLCVVLPYALSGSAVAVVWNFMLTTDGAVNQV
FT                   LTALGLDSLAQGWLLTWPGNTVVMILANAWQATGVAVILFLVGLQSIPPETLEAGALDG
FT                   ASGWQQFRHIVLPQLRPVSIIVIGMSLVNGLKSFDLIWVLTQGGPGRATETLAVSMYNE
FT                   TFLELRPGAGAAIAVVLTVIVLAASWLYLRRQLDVKGV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624420.1"
FT   misc_feature    53429..53944
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   misc_feature    order(53477..53482,53489..53494,53531..53542,53546..53575,
FT                   53582..53587,53591..53593,53714..53719,53723..53725,
FT                   53732..53734,53741..53746,53750..53752,53762..53767,
FT                   53774..53776,53825..53827,53867..53872,53879..53881,
FT                   53900..53911,53918..53923)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   misc_feature    order(53549..53593,53900..53917)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   misc_feature    order(53591..53593,53699..53701,53918..53920)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   misc_feature    order(53777..53815,53831..53836,53846..53848)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   misc_feature    53756..53989
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 64.50, E-value 2.3e-15"
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   misc_feature    53759..53845
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp sign."
FT                   /locus_tag="SCO0066"
FT                   /gene_synonym="SCJ4.47"
FT   gene            54097..54918
FT                   /db_xref="GeneID:1095498"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   CDS_pept        54097..54918
FT                   /locus_tag="SCO0067"
FT                   /gene_family="HOG000014703" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane permease"
FT                   /gene_synonym="SCJ4.48"
FT                   /note="SCJ4.48, probable integral membrane permease, len:
FT                   273 aa; similar to many e.g. TR:Q9Z3R7 (EMBL:AF045609)
FT                   inner membrane permease from the alpha-glucosides binding
FT                   protein dependent transport system of Rhizobium
FT                   (Sinorhizobium) meliloti (305 aa) fasta scores; opt: 393,
FT                   z-score: 457.6, E(): 4e-18, (32.3% identity in 229 aa
FT                   overlap). Contains Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component. Contains possible membrane spanning hydrophobic
FT                   regions."
FT                   /db_xref="GI:21218642"
FT                   /db_xref="GeneID:1095498"
FT                   /translation="MTMSLGRVLRNTVIAVLALLWLVPTWLLVVNALVPAGSYSGSPHW
FT                   LPRDFGLFGNMSQAWDKANLGPALGNSLLYSVVSAAAAAVIAGFAAFATIIMPVKRQAL
FT                   WFWVIYSGTLLPLQVFIRPLFLSYAHTSLYDTQTGLVLIYTAIAVPFAFFVMRNYALTL
FT                   PREVVEAARMDGASWWRVFWQIHVPLTRSAMIAVFVFQFVAVWNDLMFGITMVTSRNIR
FT                   PVMAALADLQGNYSNVGPPIVLAGALLVSLPTVVLFFSAQRFFVSSLKIHR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624421.1"
FT   misc_feature    54403..54846
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   misc_feature    order(54409..54420,54424..54453,54460..54465,54469..54471,
FT                   54532..54537,54541..54543,54547..54549,54556..54561,
FT                   54565..54567,54577..54582,54589..54591,54640..54642,
FT                   54682..54687,54694..54696,54715..54726,54733..54738,
FT                   54775..54780,54808..54813,54820..54825,54829..54834,
FT                   54841..54846)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   misc_feature    order(54427..54471,54715..54732)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   misc_feature    order(54469..54471,54517..54519,54733..54735,54769..54771,
FT                   54778..54780,54808..54810)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   misc_feature    order(54592..54630,54646..54651,54661..54663)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   misc_feature    54571..54807
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component, score 61.00, E-value 2.5e-14"
FT                   /locus_tag="SCO0067"
FT                   /gene_synonym="SCJ4.48"
FT   gene            54968..56173
FT                   /db_xref="GeneID:1095499"
FT                   /locus_tag="SCO0068"
FT                   /gene_synonym="SCJ4.49"
FT   CDS_pept        54968..56173
FT                   /locus_tag="SCO0068"
FT                   /gene_family="HOG000014925" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrolase"
FT                   /gene_synonym="SCJ4.49"
FT                   /note="SCJ4.49, possible hydrolase (secreted protein), len:
FT                   401aa; N-terminal region similar to that of TR:Q9Z4P9
FT                   (EMBL:AB024331) alpha-1,6-D-mannanase from Bacillus
FT                   circulans (589 aa) fasta scores; opt: 218, z-score: 251.2,
FT                   E(): 1.2e-06, (26.2% identity in 229 aa overlap)"
FT                   /db_xref="GI:21218643"
FT                   /db_xref="GeneID:1095499"
FT                   /translation="MLRSLLIRATAPAVCAGLLWTAAPAHAQSPAPTRPVSSDTWADRA
FT                   TGTYRALQKHLYEGPGDHGLYLEHTPRQATDQEHSYLWPFREAAQAAVDMQRLPRTGPA
FT                   YRQDAAERFDTAELYHTGGERPGYRSYLPAPLGTGGDVYYDDNAVVALSQLDQYEETGD
FT                   ARYLRRAEQVVPVVSRAWDGDAAKACPGGMDWYDAPGNTIRATNVTALSAQLAARLYEH
FT                   TRNRAYLDKAEQWYGWVYACMRKAPGLYVNDRGDDGSTNETLWTYNSGAMIGTATALYR
FT                   GTGDARYLEKAVADARGSLAYWTGGTRLHDQPAVFNAFYFKDLLDLDAVRPDSAYLSAM
FT                   SAYADNTYRSNRDASSGLFRFQPSNGGDYDPAAPAATLNQSAMVQIFATLADATRRDHR
FT                   TS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624422.1"
FT   misc_feature    55208..56038
FT                   /note="Glycosyl hydrolase family 76; Region:
FT                   Glyco_hydro_76; cl01996"
FT                   /db_xref="CDD:154700"
FT                   /locus_tag="SCO0068"
FT                   /gene_synonym="SCJ4.49"
FT   gene            56225..59383
FT                   /db_xref="GeneID:1095500"
FT                   /locus_tag="SCO0069"
FT                   /gene_synonym="SCJ4.50"
FT   CDS_pept        56225..59383
FT                   /locus_tag="SCO0069"
FT                   /gene_family="HOG000153429" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.50"
FT                   /note="SCJ4.50, unknown, len: 1052 aa"
FT                   /db_xref="GI:21218644"
FT                   /db_xref="GeneID:1095500"
FT                   /translation="MPKPPLTRPSWWDSDIARDLLKERVATTAGLGGRQVRLSGEPLLR
FT                   HDGTGGLLQSIRVGVLHPGGAHPRPRITRARVSTAGGTPVRCETVPGPGDDARLLVPEV
FT                   DAPTPLLIELPELEEGTQVAFEARPQRHWTLHLVQHSHLDIGYTDPQGRVMAESRAYLD
FT                   SLLELCRDTDDWPEPARFRWAVEGFHSFQDWRANRPRRQVESFLDRVREGRVELTAMPF
FT                   NLHTETCSTDELHELLRPMTELRDRHGIDITTAMQTDVPGQVVGLPDVLADNGIRYLSV
FT                   AHNWAGRAVPHLVGGEHLPRLFRWQAPSGKSVLVWRTDTPHGLAYMEGSILGFDESYDH
FT                   VDDLLPAYLGALASFPYPHQGRGIPGFPALDLPGTADPYPWDVLHLRVLGKFADNGPPR
FT                   RVISDTVRRWNEQWAYPRLRASRNQDFFEDAEKRVGDRLETYRGDWTDWWVDGVGAGAV
FT                   PLAATRRGQAALAEAQTVAGYAHLMGVPGSTAVTSAAPEVYRSASLFNEHTWGAGDPWT
FT                   HGDHGHGSGEKQWHWKYSQAMRAHDDAETLLDAASALLGEAFAPSGDAAASFYVVNTCS
FT                   WLRTETARLFLPESTVALSDAVRVLDGRTGEPLPFAEEAQSNDRHRAAGRFLHVPVADV
FT                   PACGAVRLDVVTGADSPAPADGANPPADATVLENDHLRVTVDLREACIASVVDKSTGRE
FT                   MVRQDATVGFNGYVYDEYATAGAFNHQSSKTVADDSMHLLASRSTAPPAALVDRTTDAT
FT                   GQTLVYECAPAGTRRLRVRVHLPHHAARVDIENRIDKDATLTKESAFFAFPFALDGPVV
FT                   HTESTGGVLGTDRETVPGSAAHMRAVRRWISLSDGTRLVALATADAPLVQLSGIAIPYV
FT                   PYPQSLPQEEPATVFSWVHNNIWDTNFPAQQAFDHVFRYSVGFATTAENDTVGADGLAV
FT                   RVAAVTGHPLVPVRARADAGAASPAQARFLALDNPRVRLVGVTVPDSGKLLVRLQSLAD
FT                   VPVTCRLTTPFPVVRAALTTYLGLPLRDISPEPDGAIPVDVPVLATAAVVLDLSSVPTG
FT                   GSAG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624423.1"
FT   misc_feature    56624..57550
FT                   /note="Glycosyl hydrolases family 38 N-terminal domain;
FT                   Region: Glyco_hydro_38; pfam01074"
FT                   /db_xref="CDD:144606"
FT                   /locus_tag="SCO0069"
FT                   /gene_synonym="SCJ4.50"
FT   misc_feature    58217..>58798
FT                   /note="Glycosyl hydrolases family 38 C-terminal domain;
FT                   Region: Glyco_hydro_38C; pfam07748"
FT                   /db_xref="CDD:149037"
FT                   /locus_tag="SCO0069"
FT                   /gene_synonym="SCJ4.50"
FT   gene            59558..60241
FT                   /db_xref="GeneID:1095501"
FT                   /locus_tag="SCO0070"
FT                   /gene_synonym="SCJ4.51"
FT   CDS_pept        59558..60241
FT                   /locus_tag="SCO0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.51"
FT                   /note="SCJ4.51, unknown, possibly involved in sugar
FT                   metabolism, len: 22 aa; similar over region to many
FT                   hypothetical sugar metabolism proteins e.g. SW:VIPB_SALTI
FT                   polysaccharide biosynthesis protein from Salmonella
FT                   enterica (348 aa) fasta scores; opt: 220, z-score: 251.9,
FT                   E(): 1.1e-06, (31.8% identity in 170 aa overlap). Note
FT                   overlap with downstream gene."
FT                   /db_xref="GI:21218645"
FT                   /db_xref="GeneID:1095501"
FT                   /translation="MSGTQTVLSAAASSRRLKRLVFVSSASVYGYGNPDDWAGPEDEHR
FT                   SVRELLSSVYGRMPPQFGEERRLRPLSVYANTKAFGEVQTDLILRPAGISYSVVRYFSV
FT                   YGQPQVIKPGSHSWVVAWFADRAAAGLPLHLNGGGHQVRDFVRVDDIAEGTLRALTEPA
FT                   ADRKTVNITGAGPRSRWRRPAPGPARSGRRRTAGRGCPAAGFRQPASAARARSGRAPWP
FT                   TRPVP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624424.1"
FT   misc_feature    <59564..60022
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCO0070"
FT                   /gene_synonym="SCJ4.51"
FT   gene            complement(60069..60275)
FT                   /db_xref="GeneID:1095502"
FT                   /locus_tag="SCO0071"
FT                   /gene_synonym="SCJ4.52c"
FT   CDS_pept        complement(60069..60275)
FT                   /locus_tag="SCO0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ4.52c"
FT                   /note="SCJ4.52c, unknown, len: 68 aa; predicted by GC
FT                   Frameplot and amino acid usage. Note overlap with
FT                   downstream gene."
FT                   /db_xref="GI:21218646"
FT                   /db_xref="GeneID:1095502"
FT                   /translation="MQISLEAGSRRIKEQDAWAKELFPTVHERLKQAAETLPPDSPAQP
FT                   FVDALTELVQAQADATGFVVLHR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624425.1"
FT   gene            complement(60740..64093)
FT                   /db_xref="GeneID:1095503"
FT                   /locus_tag="SCO0072"
FT                   /gene_synonym="SCJ11.01c; SCJ4.53c"
FT   CDS_pept        complement(60740..64093)
FT                   /locus_tag="SCO0072"
FT                   /gene_family="HOG000146815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /gene_synonym="SCJ11.01c; SCJ4.53c"
FT                   /note="SCJ4.53c, partial CDS, unknown, len: >356 aa;
FT                   similar to many of undefined function e.g. SW:WAPA_BACSU
FT                   wall associated protein from Bacillus subtilis (2334 aa)
FT                   fasta scores; opt: 322, z-score: 315.0, E(): 3.5e-10,
FT                   (27.5% identity in 320 aa overlap).; SCJ11.01c, partial
FT                   CDS, possible secreted protein, len: >793 aa"
FT                   /db_xref="GI:32141098"
FT                   /db_xref="GeneID:1095503"
FT                   /translation="MHSRAARTPMWRARRTHRTALVSAITTAAVVIAAAPGLAATPKPK
FT                   LPEPESPWTKPTKVEAPATPAGSIKAPESEAEAKPSTEVAAWRTAQKARATGEEPAKSP
FT                   TSRSVAAAATDDYLPEDQGEVPWHQILDTRLDDALVARVNVSNGNLMLAATDFDIAGVG
FT                   QKLQLPRTYNSLEAPWGKVSQRWWQAYERYLQINNGEVDVFDATGNLLRFTAASDGTYT
FT                   TPAGYSKDLKKNADGSYTLTDRKSGAKDTYNEHGTLTKVTDKNKGTITVDQHDDGSEHK
FT                   GFRLTETRSGRWIDLVKTYPSQWQAKDHTGRTAVLNLDGSGNLAKVTDTAGKATTYEYD
FT                   SSRRVTKVTTPEGTVTLFTYDSHNRVTSMQRTTGTSGSGHTGPTWRYDYTAATPSDAGT
FT                   TTVTDPHGDETIYTHNADGEVTKVTDPLGHSRHSTYKNHLTQTAIDAMGTGTDGTGGNT
FT                   TTYGWDARNNAVSQKLPLGATASVSAYQTVAGTDLPNDFTTADGRKDSYKYDANGNTMS
FT                   VTTTGTAGATREYTYNEATPECGGFEGQRCTAKDGNGKVTSFTYDDEGNLIKVKPPAPL
FT                   GETTYTYDALGRVETVEDGRGITTVYGYDSRDRVREVSSTNFTVTYTYDGDGNVTTRSD
FT                   ASGFTKWKYDELNRESVRTLQNGAQTALAYTPGGDVDFYTDPTGTTDYTWDKAGRLDYL
FT                   VAPDGAKTDFDYNNNDKRTKTVYPGGTTQAVTIDDNGRPERIKTTSGTQTFVDLTYSYA
FT                   SVGKDTTKIRTRTDHLTNLKTSYTYDSQDRLSYALEADSAGARKASWLYCWDKAGNLTS
FT                   QNGSKSACPGGTTYTYNDASELTGKNGSTTGWSYDKLGNETDAASGTARTDESWTDYSQ
FT                   LAGITTGGTNYDLVHAGTTNAERTKLASTWFHHTALGLASTTTNGVDTGFIREPSGTLN
FT                   SMTTGGKSYYYLTDATGNVLGLVDDTGKRTHTYAYGPTGTPRGTTTEAAPQPYRYAGAY
FT                   ADPTGLYKMGHRYYDPTLGRFTQPDPSGQETNPYLYAAGDPVNRTDPTGLFSFSDILDT
FT                   GSKIFGGVSGCVSGIGAAASTGTIQYAAAVGGVVGAGVGSAVGAGAAVVGSCALGGVAG
FT                   YYGADVITYG"
FT                   /transl_table="11"
FT                   /protein_id="NP_733489.1"
FT   misc_feature    complement(63029..63139)
FT                   /note="RHS Repeat; Region: RHS_repeat; cl11982"
FT                   /db_xref="CDD:159659"
FT                   /locus_tag="SCO0072"
FT                   /gene_synonym="SCJ11.01c; SCJ4.53c"
FT   misc_feature    complement(<61043..63130)
FT                   /note="Rhs family protein [Cell envelope biogenesis, outer
FT                   membrane]; Region: RhsA; COG3209"
FT                   /db_xref="CDD:33022"
FT                   /locus_tag="SCO0072"
FT                   /gene_synonym="SCJ11.01c; SCJ4.53c"
FT   misc_feature    complement(60977..61153)
FT                   /note="RHS repeat-associated core domain; Region:
FT                   Rhs_assc_core; TIGR03696"
FT                   /db_xref="CDD:163408"
FT                   /locus_tag="SCO0072"
FT                   /gene_synonym="SCJ11.01c; SCJ4.53c"
FT   gene            64605..64925
FT                   /db_xref="GeneID:1095504"
FT                   /locus_tag="SCO0073"
FT                   /gene_synonym="SCJ11.02"
FT   CDS_pept        64605..64925
FT                   /locus_tag="SCO0073"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.02"
FT                   /note="SCJ11.02, unknown, len: 106 aa"
FT                   /db_xref="GI:21218647"
FT                   /db_xref="GeneID:1095504"
FT                   /translation="MSTPGRRTPCSHPTRHHRVPAQRLTRSVQQAGRLLSWNLAAGMTT
FT                   AATDLLLAPQADWWHMLWPLPWYITSASIPLWTTLRAREKAAHQQSPGEDDDIHDKWDQ
FT                   AA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624426.1"
FT   gene            64994..65092
FT                   /db_xref="GeneID:1095505"
FT                   /locus_tag="SCO0074"
FT                   /gene_synonym="SCJ11.03"
FT   CDS_pept        64994..65092
FT                   /locus_tag="SCO0074"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.03"
FT                   /note="SCJ11.03, unknown, len: 32 aa"
FT                   /db_xref="GI:21218648"
FT                   /db_xref="GeneID:1095505"
FT                   /translation="MGGTAAPLHPLRLVQDGFRGGDADVLAWFWSG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624427.1"
FT   gene            65092..65679
FT                   /db_xref="GeneID:1095506"
FT                   /locus_tag="SCO0075"
FT                   /gene_synonym="SCJ11.04"
FT   CDS_pept        65092..65679
FT                   /locus_tag="SCO0075"
FT                   /gene_family="HOG000146817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.04"
FT                   /note="SCJ11.04, unknown, len: 195 aa; weakly similar to
FT                   SW:KILB_STRLI KilB protein from Streptomyces lividans
FT                   plasmid pIJ101 thought to be involved in plasmid transfer
FT                   (147 aa) fasta scores; opt: 126, z-score: 152.9, E(): 0.37,
FT                   (27.5% identity in 142 aa overlap). Contains probable
FT                   coiled-coil region approx. 25-45aa. Contains TTA encode
FT                   leucine, possible site for bldA regulation."
FT                   /db_xref="GI:21218649"
FT                   /db_xref="GeneID:1095506"
FT                   /translation="MEASGILFPIVRRGCAMASMLGLLEAREASARERVEVLREEAARA
FT                   VAALEAGEIELDRRVIAREELVEALAVSAAETTGVTEAEGEGETALVPAPASAAEPGAI
FT                   VPHWQEGLSVSVLSPNNQRILNVLQDRPGLEPVRAKDIAAALGIEAAAAKVEGVRPKGK
FT                   RLAERGWLLQEASGAFSAGRRLVASPGGDPSA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624428.1"
FT   misc_feature    65158..65160
FT                   /note="Leucine encoding tta codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCO0075"
FT                   /gene_synonym="SCJ11.04"
FT   gene            complement(65627..66535)
FT                   /db_xref="GeneID:1095507"
FT                   /locus_tag="SCO0076"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.05c; SCJ11.06c; SCJ11.07c"
FT   misc_feature    complement(65627..66535)
FT                   /note="SCJ11.05c, partial CDS, possible transposase, len:
FT                   104 aa; appears to form the C-terminal region of a
FT                   transposase with the remainder encoded by the two upstream
FT                   CDSs, SCJ11.06c and SCJ11.07c. Similar to many egs.
FT                   TR:P73414 (EMBL:D90906) proposed transposase from
FT                   Synechocystis sp. strain PCC6803 (261 aa) fasta scores;
FT                   opt: 246, z-score: 334.1, E(): 3e-11, (44.7% identity in 85
FT                   aa overlap) and TR:CAB38475 (EMBL:AL035636) proposed
FT                   transposase from Streptomyces coelicolor (229 aa) fasta
FT                   scores; opt: 234, z-score: 319.2, E(): 2e-10, (51.5%
FT                   identity in 66 aa overlap).; SCJ11.06c, partial CDS,
FT                   possible transposase, len: 104 aa; appears to form the
FT                   middle region of a transposase with the remainder encoded
FT                   by the downstream and upstream CDSs, SCJ11.05c and
FT                   SCJ11.07c. Similar to many egs. TR:O67989 (EMBL:AF003948)
FT                   proposed transposase from Rhodococcus opacus (242 aa) fasta
FT                   scores; opt: 286, z-score: 379.4, E(): 9e-14, (49.4%
FT                   identity in 89 aa overlap) and TR:CAB38475 (EMBL:AL035636)
FT                   proposed transposase from Streptomyces coelicolor (229 aa)
FT                   fasta scores; opt: 227, z-score: 303.9, E(): 1.4e-09,
FT                   (41.6% identity in 89 aa overlap).; SCJ11.07c, partial CDS,
FT                   possible transposase, len: 143 aa; appears to form the
FT                   N-terminal region of a transposase with the remainder
FT                   encoded by the two downstream CDSs, SCJ11.06c and
FT                   SCJ11.05c. Similar to many eg. TR:Q44579 (EMBL:M98777)
FT                   transposase from IS elements of Acetobacter xylinum (278
FT                   aa) fasta scores; opt: 258, z-score: 326.7, E(): 7.8e-11,
FT                   (38.5% identity in 109 aa overlap). Also similar to
FT                   TR:Q54404 (EMBL:Z11519) from Tn4811, in Streptomyces
FT                   lividans 66 (320 aa) fasta scores; opt: 362, z-score:
FT                   453.5, E(): 6.7e-18, (50.5% identity in 103 aa
FT                   overlap).;transposase"
FT                   /locus_tag="SCO0076"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.05c; SCJ11.06c; SCJ11.07c"
FT   repeat_region   66404..66680
FT                   /note="Degenerate direct repeat unit; repeated at
FT                   6294-6566bp."
FT   gene            complement(66688..67911)
FT                   /db_xref="GeneID:1095508"
FT                   /locus_tag="SCO0079"
FT                   /gene_synonym="SCJ11.08c"
FT   CDS_pept        complement(66688..67911)
FT                   /locus_tag="SCO0079"
FT                   /gene_family="HOG000136928" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane transport protein"
FT                   /gene_synonym="SCJ11.08c"
FT                   /note="SCJ11.08c, possible integral membrane transport
FT                   protein, len: 407 aa; similar to many e.g. TR:P72472
FT                   (EMBL:U63848) sensor protein homolog from Streptomyces
FT                   lividans (410 aa) fasta scores; opt: 2533, z-score: 2742.9,
FT                   E(): 0, (98.5% identity in 407 aa overlap) and TR:Q56147
FT                   (EMBL:U09991) chloramphenicol resistance protein from
FT                   Streptomyces venezuelae (436 aa) fasta scores; opt: 559,
FT                   z-score: 610.6, E(): 1.2e-26, (28.2% identity in 411 aa
FT                   overlap). Contains Pfam match to entry PF00083 sugar_tr,
FT                   Sugar (and other) transporter."
FT                   /db_xref="GI:21218650"
FT                   /db_xref="GeneID:1095508"
FT                   /translation="MPTATTTSIDSPSLPARSPLVSWLAVISVMLGIFSIITTEILPIG
FT                   LLTSIGSSFTISDGMAGLMMTMPGFLAAVSAPVVTVATGRIDRRLMLGTFILLLALANF
FT                   LAAVAPSYWLVLVSRVLVGVTIGGFWSIGAGLASRLVPAESVGRATAVIFSAVPLGSVL
FT                   GVPLGTLIGDVAGWRTAFLVMGILTLCVFAMLLLVVPPLPTDEPTRLSALTGMLRSVNT
FT                   RFALVMTFLVVLAHFGAYTYVTPFLEQVTHVSAGLITVYLLVYGVAGIAGNFLGGSAVA
FT                   RYPIGTFAAAALMIAGATVLLPVLGKEDLGAVALLVLWGVAYGAVPVCSQTWFAKASPD
FT                   SPEASSVLFTASFQATISIGALVGGVVVDHSSPSMVMTLAGTAAALVVLVAWSHGARKN
FT                   PLPDPAKP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624429.1"
FT   misc_feature    complement(66790..67878)
FT                   /note="Arabinose efflux permease [Carbohydrate transport
FT                   and metabolism]; Region: AraJ; COG2814"
FT                   /db_xref="CDD:32643"
FT                   /locus_tag="SCO0079"
FT                   /gene_synonym="SCJ11.08c"
FT   misc_feature    complement(66790..67836)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SCO0079"
FT                   /gene_synonym="SCJ11.08c"
FT   misc_feature    complement(order(66841..66843,66850..66855,66862..66867,
FT                   66874..66879,66910..66912,66919..66924,66934..66936,
FT                   66943..66948,66955..66957,67093..67095,67105..67107,
FT                   67114..67116,67126..67128,67138..67140,67180..67182,
FT                   67189..67194,67201..67206,67213..67215,67429..67431,
FT                   67447..67452,67459..67464,67498..67500,67507..67512,
FT                   67519..67524,67531..67536,67672..67677,67681..67686,
FT                   67696..67698,67705..67710,67717..67719,67768..67773,
FT                   67777..67785,67792..67794))
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SCO0079"
FT                   /gene_synonym="SCJ11.08c"
FT   misc_feature    complement(66694..67842)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -103.00, E-value 0.0034."
FT                   /locus_tag="SCO0079"
FT                   /gene_synonym="SCJ11.08c"
FT   repeat_region   68006..68278
FT                   /note="Degenerate direct repeat unit; repeated at
FT                   4692-4968bp."
FT   misc_feature    68283..69767
FT                   /note="Possible disrupted transposon. Bounded by an
FT                   inverted repeat (Score 51: 21/24 ( 87%) matches, 0 gaps).
FT                   Contains 2 partial CDSs (SCJ11.10c and SCJ11.11c) which are
FT                   similar to many transposases and linked by a possible
FT                   ribosomal frameshifting site but the upstream CDS lacks a
FT                   start codon so is probably not translated. Also contains a
FT                   hypothetical CDS (SCJ11.09)."
FT   repeat_region   68283..68306
FT                   /note="Part of inverted repeat bounding possible disrupted
FT                   insertion element."
FT   gene            68372..68887
FT                   /db_xref="GeneID:1095509"
FT                   /locus_tag="SCO0080"
FT                   /gene_synonym="SCJ11.09"
FT   CDS_pept        68372..68887
FT                   /locus_tag="SCO0080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.09"
FT                   /note="SCJ11.09, unknown, len: 171 aa"
FT                   /db_xref="GI:21218651"
FT                   /db_xref="GeneID:1095509"
FT                   /translation="MGIHCEYVRLSLAKLQRSLSDPSWAQDHIDELGDAWAEEDSLPPE
FT                   KAPYFSIEKSWHKLHHLIAAHGGMPVDVIHGGAELPLEDDMDYGPARYLTPEDVARASG
FT                   CLATTPFDELARHYDLAAMRSAEIYLLPESETGVPSDLDTLRHRYEELARFFSTVATAG
FT                   DGVVLVLA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624430.1"
FT   misc_feature    68372..68881
FT                   /note="Domain of unknown function (DUF1877); Region:
FT                   DUF1877; pfam08974"
FT                   /db_xref="CDD:149898"
FT                   /locus_tag="SCO0080"
FT                   /gene_synonym="SCJ11.09"
FT   gene            complement(68914..69647)
FT                   /db_xref="GeneID:1095510"
FT                   /locus_tag="SCO0081"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.10c; SCJ11.11c"
FT   repeat_region   68914..69647
FT                   /note="Inverted and repeated degenerately at
FT                   20998-21806bp."
FT   misc_feature    complement(68914..69647)
FT                   /note="SCJ11.10c, partial CDS, possible transposon
FT                   transposase, len: 165aa; similar to many egs. TR:O69847
FT                   (EMBL:AL023702) insertion element IS1647 transposase from
FT                   Streptomyces coelicolor (150 aa) fasta scores; opt: 868,
FT                   z-score: 1024.9, E(): 0, (81.8% identity in 148 aa overlap)
FT                   and SW:YI21_BURCE insertion element IS402 hypothetical
FT                   protein from Pseudomonas cepacia (211 aa) fasta scores;
FT                   opt: 472, z-score: 561.6, E(): 6.4e-24, (46.7% identity in
FT                   167 aa overlap).; SCJ11.11c, partial CDS, possible
FT                   transposon transposase, len: 94aa; similar to many egs.
FT                   TR:O69846 (EMBL:AL023702) insertion element IS1647
FT                   transposase from Streptomyces coelicolor (119 aa) fasta
FT                   scores; opt: 460, z-score: 639.1, E(): 3.1e-28, (77.3%
FT                   identity in 88 aa overlap) and SW:YI22_BURCE insertion
FT                   element IS402 hypothetical protein from Pseudomonas cepacia
FT                   (147 aa) fasta scores; opt: 202, z-score: 287.7, E():
FT                   1.1e-08, (39.8% identity in 88 aa overlap);insertion
FT                   element transposase"
FT                   /locus_tag="SCO0081"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.10c; SCJ11.11c"
FT   misc_feature    complement(69370..69376)
FT                   /note="possible ribosomal frameshifting site"
FT                   /locus_tag="SCO0081"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.10c; SCJ11.11c"
FT   repeat_region   69744..69767
FT                   /note="Part of inverted repeat bounding possible disrupted
FT                   insertion element."
FT   gene            69799..70647
FT                   /db_xref="GeneID:1095511"
FT                   /locus_tag="SCO0083"
FT                   /gene_synonym="SCJ11.12"
FT   CDS_pept        69799..70647
FT                   /locus_tag="SCO0083"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /gene_synonym="SCJ11.12"
FT                   /note="SCJ11.12, possible transposase, len: 282aa;
FT                   N-terminal similar to SW:YI22_BURCE (147 aa) fasta scores;
FT                   opt: 431, z-score: 529.9, E(): 3.7e-22, (54.6% identity in
FT                   119 aa overlap), C-terminal similar to SW:YI21_BURCE (211
FT                   aa) fasta scores; opt: 700, z-score: 852.1, E(): 0, (61.4%
FT                   identity in 166 aa overlap). SW:YI22_BURCE and
FT                   SW:YI21_BURCE encode insertion element IS402 hypothetical
FT                   protein from Pseudomonas cepacia. C-terminal also similar
FT                   to TR:O69847 (EMBL:AL023702) insertion element IS1647
FT                   transposase from Streptomyces coelicolor (150 aa) fasta
FT                   scores; opt: 440, z-score: 540.6, E(): 9.4e-23, (44.2%
FT                   identity in 147 aa overlap)."
FT                   /db_xref="GI:21218652"
FT                   /db_xref="GeneID:1095511"
FT                   /translation="MPCPARELSVRFGVGTSPWIVSDELWDRVEPLLPQRERRFRHPGR
FT                   KPLPDRDVLCGILYVLHTGIPWEYLPRGLGFGSGMPCWRRLRDWNEAGVRQRLHEILLA
FT                   ELNAAARLDRSRCVVDSPRQGAKGGQHTGPSPVDRGRAGSKHHLITDGHGTPLAVLLTG
FT                   GNRNDVTQLLPLLDAIPPVRGPVGRPRRKPDSLFADRGYDHDIYRDQARTRGIVPAIAR
FT                   RGTLHGAALGTYRWVVERSLAWLHGFRRLRIRWERRADIHEALLRLACCLITHRQLRAL
FT                   R"
FT                   /transl_table="11"
FT                   /protein_id="NP_624431.1"
FT   misc_feature    69859..>70110
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="SCO0083"
FT                   /gene_synonym="SCJ11.12"
FT   misc_feature    70150..70608
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="SCO0083"
FT                   /gene_synonym="SCJ11.12"
FT   repeat_region   69799..70647
FT                   /note="Inverted and repeated degenerately at
FT                   31881-32405bp."
FT   gene            70777..71235
FT                   /db_xref="GeneID:1095512"
FT                   /locus_tag="SCO0084"
FT                   /gene_synonym="SCJ11.13"
FT   CDS_pept        70777..71235
FT                   /locus_tag="SCO0084"
FT                   /gene_family="HOG000153365" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.13"
FT                   /note="SCJ11.13, hypothetical protein, len: 152 aa; similar
FT                   to TR:Q9S1Q3 (EMBL:AL109972) Streptomyces coelicolor
FT                   hypothetical protein SCJ9A.17, 175 aa; fasta scores: opt:
FT                   683 Z-score: 803.5 E(): 4e-37; 68.421% identity in 152 aa
FT                   overlap"
FT                   /db_xref="GI:21218653"
FT                   /db_xref="GeneID:1095512"
FT                   /translation="MTGEFEHRHGLTPGTNQVRPADHDDQAAARTLAQVTPTPADLATF
FT                   YESIGDVTWEDVGNGYFLNPAGDLLLRLQEYGVVDFGTDEKSRGLVIGSNGGGLIYVAG
FT                   PDGAVYRTRTASLDEAELDKVADGLRQFLELLERSLTRFNADGDPGYL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624432.1"
FT   gene            complement(71648..72139)
FT                   /db_xref="GeneID:1095513"
FT                   /locus_tag="SCO0085"
FT                   /gene_synonym="SCJ11.14c"
FT   CDS_pept        complement(71648..72139)
FT                   /locus_tag="SCO0085"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.14c"
FT                   /note="SCJ11.14c, unknown, len: 163 aa; weak similarity to
FT                   a region from many proposed DNA ligases eg. TR:CAB45581
FT                   (EMBL:AL079355) DNA ligase from Streptomyces coelicolor
FT                   (355 aa) fasta scores; opt: 182, z-score: 228.5, E():
FT                   2.3e-05, (32.6% identity in 132 aa overlap)."
FT                   /db_xref="GI:21218654"
FT                   /db_xref="GeneID:1095513"
FT                   /translation="MNGELVVWESGRLAFERLQQRLARRRGAGALAAARACPAHLVVFG
FT                   LMRQGSTDLPPWPCSRRRTALEELFAETRMTAPLTLCPSTADPDTARQWLTWTSTGQEG
FT                   LVFKPLRAPYRAGARARGKYKICITEDRRRRSRHRPRHRGGGAGQSGVRLVYRSRSAVS
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="NP_624433.1"
FT   misc_feature    complement(71810..>72133)
FT                   /note="Adenylation domain of proteins similar to
FT                   ATP-dependent polynucleotide ligases; Region:
FT                   Adenylation_DNA_ligase_like; cl12015"
FT                   /db_xref="CDD:187161"
FT                   /locus_tag="SCO0085"
FT                   /gene_synonym="SCJ11.14c"
FT   gene            complement(72159..73097)
FT                   /db_xref="GeneID:1095514"
FT                   /locus_tag="SCO0086"
FT                   /gene_synonym="SCJ11.15c"
FT   CDS_pept        complement(72159..73097)
FT                   /locus_tag="SCO0086"
FT                   /gene_family="HOG000005595" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosylglycohydrolase"
FT                   /gene_synonym="SCJ11.15c"
FT                   /note="SCJ11.15c, possible ribosylglycohydrolase (putative
FT                   secreted protein), len: 312 aa; similar to SW:DRAG_RHORU
FT                   (EMBL:X16187) ADP-ribosylglycohydrolase DraG from
FT                   Rhodospirillum rubrum (294 aa) fasta scores; opt: 267,
FT                   z-score: 299.5, E(): 2.5e-09, (31.1% identity in 283 aa
FT                   overlap)"
FT                   /db_xref="GI:21218655"
FT                   /db_xref="GeneID:1095514"
FT                   /translation="MKWIQRAAGAVVGSAVGDALGAPFEFGPQGAFSARFPAPGSGGEM
FT                   CGGGGWDPGEATDDTQMAVLVAESLLERGGLDLPDIFARFQRWAASEPKDIGLQTEDVL
FT                   TNGMPWDLAAAIHFQVNQRAAGNGSLMRASTSAVHFAAAGQEATMEAARRIAALTHGDR
FT                   AAWEGTAIFHELIRVAFEDIDPLAALPDVLALVHPDHRGRYATVLAPDWHPEQATEFNG
FT                   AVWPCLGSAVWALRTTTGFEHAVRAAIDLGGDTDTVAAVTGGLAGAYYGLDAIPARWTQ
FT                   PLHVPLPGFDGRVLHLTDLLHLAHRLAEEPR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624434.1"
FT   misc_feature    complement(72261..72929)
FT                   /note="ADP-ribosylglycohydrolase; Region: ADP_ribosyl_GH;
FT                   cl00614"
FT                   /db_xref="CDD:153890"
FT                   /locus_tag="SCO0086"
FT                   /gene_synonym="SCJ11.15c"
FT   gene            complement(73784..74833)
FT                   /db_xref="GeneID:1095515"
FT                   /locus_tag="SCO0087"
FT                   /gene_synonym="SCJ11.16c"
FT   CDS_pept        complement(73784..74833)
FT                   /locus_tag="SCO0087"
FT                   /gene_family="HOG000104534" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /gene_synonym="SCJ11.16c"
FT                   /note="SCJ11.16c, secreted protein, len: 349 aa; similar to
FT                   TR:P97061 (EMBL:Z81324) hypothetical protein downstream of
FT                   a beta-lactam regulatory protein in Streptomyces
FT                   clavuligerus (338 aa) fasta scores; opt: 548, z-score:
FT                   613.6, E(): 8.1e-27, (40.6% identity in 330 aa overlap)"
FT                   /db_xref="GI:21218656"
FT                   /db_xref="GeneID:1095515"
FT                   /translation="MSDDTDAPRPKRRIQDLGRRTVLRGAAFGAAAPLLASPAHAIASD
FT                   TATTRRASLAGSPSFRWLGTSGWRIDVKERTVLFDPYITRFKTGLFDGNFKPGTKLRSD
FT                   PELVRERIGRPEIVLVSHSHWDHIADVPYIAKTTGARIVGTETTFHLLVAFGVDPGQIS
FT                   VVKGGEVLDFDGITVEVVSSLHSRNKRHTYFAPGTLNAPPPTAPRIISDLPEGDTLAYQ
FT                   VTTGSAGPSAFLMGASDFSERAVQGLSPDLAMIAVPSSASTSRYVPRLLRALGQPGVVV
FT                   PVHWDNFEEPLSETPRRDPAMDLDAFVALVHQETPMSRIVVPDYHTTYGADMRPKPRPV
FT                   PKNGDHRLP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624435.1"
FT   misc_feature    complement(73940..74671)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:186000"
FT                   /locus_tag="SCO0087"
FT                   /gene_synonym="SCJ11.16c"
FT   gene            complement(74917..75876)
FT                   /db_xref="GeneID:1095516"
FT                   /locus_tag="SCO0088"
FT                   /gene_synonym="SCJ11.17c"
FT   CDS_pept        complement(74917..75876)
FT                   /locus_tag="SCO0088"
FT                   /gene_family="HOG000253270" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted beta-lactamase"
FT                   /gene_synonym="SCJ11.17c"
FT                   /note="SCJ11.17c, possible secreted beta-lactamase, len:
FT                   319 aa; some similarity to many e.g. SW:BLAB_STRCI
FT                   partially defined beta-lactamase regulatory protein from
FT                   Streptomyces cacaoi (312 aa) fasta scores; opt: 196,
FT                   z-score: 231.8, E(): 1.5e-05, (28.4% identity in 278 aa
FT                   overlap) and SW:BLAC_BACLI beta-lactamase from Bacillus
FT                   licheniformis (307 aa) fasta scores; opt: 123, z-score:
FT                   148.2, E(): 0.68, (24.3% identity in 267 aa overlap).
FT                   Contains possible N-terminal signal sequence."
FT                   /db_xref="GI:21218657"
FT                   /db_xref="GeneID:1095516"
FT                   /translation="MVEDRIHEAFAGAGAEGLLHAVPIGGKPGCDEVTVGRCSAGDTAA
FT                   VGERAAVDEVAVGADEPVVIASIFKVLLVLEFARQVAAGQLDPRARVRVTAGDRLGGWG
FT                   TAGCADDVELSLRDLALFAISVSDNSAADLLLAQVGLDTVRLLVEELRLERTRIVGGPR
FT                   DVLQSMLSEVGARDESEFALRYPALPEARKRRMSVLDPSRTNASTPREITRLLRLIWCD
FT                   EAGPPQACAWVRELMSRQVFRHRLVSGFPDEVTVAAKTGTLPGLHMEAGVVRYPDGSRY
FT                   AVSVFARTRELASSRTAVDAAIGTAARIAVDFLHRRGS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624436.1"
FT   misc_feature    complement(74953..>75681)
FT                   /note="Beta-lactamase; Region: Beta-lactamase; cl01009"
FT                   /db_xref="CDD:186300"
FT                   /locus_tag="SCO0088"
FT                   /gene_synonym="SCJ11.17c"
FT   gene            75856..76893
FT                   /db_xref="GeneID:1095517"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   CDS_pept        75856..76893
FT                   /locus_tag="SCO0089"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /gene_synonym="SCJ11.18"
FT                   /note="SCJ11.18, probable LysR-family transcriptional
FT                   regulator, len: 345 aa; similar to many e.g. SW:ALSR_BACSU
FT                   ALS operon regulator from Bacillus subtilis (302 aa) fasta
FT                   scores; opt: 507, z-score: 564.5, E(): 4.4e-24, (31.0%
FT                   identity in 290 aa overlap). Note possible alternative
FT                   start codons downstream. Contains Pfam match to entry
FT                   PF00126 HTH_1, Bacterial regulatory helix-turn-helix
FT                   protein, lysR family and Prosite match to PS00044 Bacterial
FT                   regulatory proteins, lysR family signature."
FT                   /db_xref="GI:21218658"
FT                   /db_xref="GeneID:1095517"
FT                   /translation="MYPVLDHRFAPHVSSLAVDLLRHLRIFVAVAEELHFSRAADQLGM
FT                   AQPPLSQAVRRLETELGAELFDRSRRQVKLTPAGAVLLDEARSLLTGEKRLRTLARRAG
FT                   DGELGTLRAGIPPGTMVATLSLLLGACAEHYPGMSVDLQEITTGEQLRLIASGGLDVGL
FT                   VHQPVDITELRIGPEASVELGVVLPRISPLAQLPEVPLAHLAGQDLVLLPREQAPGWYD
FT                   RILDTCRAGGFVPTGLRHASRPELLLALVSAGHGIAFGQGAVAGKEPRVVWRPLSGRPL
FT                   IQRTSAVWSAVRSSHPAAPHFAELAADVLARDRTATLHGDDGAPAETGSPRPWAVVYDE
FT                   ATWRW"
FT                   /transl_table="11"
FT                   /protein_id="NP_624437.1"
FT   misc_feature    75916..76755
FT                   /note="DNA-binding transcriptional activator XapR;
FT                   Provisional; Region: PRK09986"
FT                   /db_xref="CDD:182183"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   misc_feature    75916..76092
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:185792"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   misc_feature    76183..76773
FT                   /note="The C-terminal substrate binding domain of LysR-type
FT                   transcriptional regulators involved in the catabolism of
FT                   aromatic compounds and that of other related regulators,
FT                   contains type 2 periplasmic binding fold; Region:
FT                   PBP2_LTTR_aromatics_like; cd08414"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   misc_feature    order(76198..76200,76219..76221,76228..76233,76237..76242,
FT                   76249..76251,76273..76275,76279..76281,76285..76287,
FT                   76417..76419,76519..76524,76579..76584,76600..76605,
FT                   76609..76614,76663..76665)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   misc_feature    order(76201..76203,76348..76350,76489..76494,76513..76515)
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:176106"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   misc_feature    75916..76344
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   165.40, E-value 9.3e-46"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   misc_feature    75958..76050
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature"
FT                   /locus_tag="SCO0089"
FT                   /gene_synonym="SCJ11.18"
FT   gene            complement(76895..77314)
FT                   /db_xref="GeneID:1095518"
FT                   /locus_tag="SCO0090"
FT                   /gene_synonym="SCJ11.19c"
FT   CDS_pept        complement(<76895..>77314)
FT                   /locus_tag="SCO0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /gene_synonym="SCJ11.19c"
FT                   /note="SCJ11.19c, partial CDS, possible transposase, len:
FT                   140 aa; similar to SW:IS12_STRAL IS112 28,4 kD protein from
FT                   Streptomyces albus (256 aa) fasta scores; opt: 349,
FT                   z-score: 447.9, E(): 1.4e-17, (53.9% identity in 128 aa
FT                   overlap)."
FT                   /db_xref="GI:21218659"
FT                   /db_xref="GeneID:1095518"
FT                   /translation="EGLLNSVEMSQSTPNLEALTHFKNPARVSPTSRDNTPSDYAIAEH
FT                   SKNYRYFTNHQVLVDADTRLVVVTGRPMPGNRNDCKAWEEAGANAAVGRTLTIADDWKK
FT                   AHNKSHPFRAKCSQGDRLDRSKSPGKHPRSSTESRT"
FT                   /transl_table="11"
FT                   /protein_id="NP_624438.1"
FT   misc_feature    77202..78271
FT                   /note="Insertion element IS1652."
FT   repeat_region   77202..77244
FT                   /note="Part of inverted repeat bounding insertion element
FT                   IS1652."
FT   gene            77315..78271
FT                   /db_xref="GeneID:1095519"
FT                   /locus_tag="SCO0091"
FT                   /gene_synonym="SCJ11.20"
FT   CDS_pept        77315..78271
FT                   /locus_tag="SCO0091"
FT                   /gene_family="HOG000104361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="IS1652 transposase"
FT                   /gene_synonym="SCJ11.20"
FT                   /note="SCJ11.20, probable insertion element IS1652
FT                   transposase, len: 318 aa; similar to many e.g. TR:O86758
FT                   (EMBL:AL031035) transposase from Streptomyces coelicolor
FT                   (318 aa) fasta scores; opt: 2217, z-score: 2566.4, E(): 0,
FT                   (99.7% identity in 318 aa overlap)."
FT                   /db_xref="GI:21218660"
FT                   /db_xref="GeneID:1095519"
FT                   /translation="MVHRNAPLTETGRLRLARCVVEDGWPVRRAAERFQVSHTTASRWA
FT                   RRYRQLGVTGMSDRSSRPHHQPRRTAAAVEEHVLRLRREHRIGPLRLAVRCGIAASTAH
FT                   RILVRHGLPPLAALDRATGEPVRRYERARPGELVHIDVKKLGRIPDGGGHKTLGRAEGH
FT                   RSRTNGAGWAYLHTALDDHSRIAYTEDLPDETAPTCAAFLVRATAYFASLGIRIERVLT
FT                   DNAWAYSKNTWRNTCRDLDISPRWTRPWRPQTNGKVERFHRTLLDEWAYQKPYTSDHER
FT                   REAFTHWLHWYNYHRPHTGIGGHTPASRGTNLSEQHS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624439.1"
FT   misc_feature    77711..78121
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="SCO0091"
FT                   /gene_synonym="SCJ11.20"
FT   repeat_region   78229..78271
FT                   /note="Part of inverted repeat bounding insertion element
FT                   IS1652."
FT   gene            complement(78489..78815)
FT                   /db_xref="GeneID:1095520"
FT                   /locus_tag="SCO0092"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.21c; SCJ11.22c; SCJ11.23c"
FT   misc_feature    complement(78489..78815)
FT                   /note="SCJ11.21c, partial CDS, possible transposase,
FT                   associated with the two upstream CDSs, len: 42aa; similar
FT                   to a region of SW:IS12_STRAL insertion element IS112 28.4kD
FT                   protein from Streptomyces albus (256 aa) fasta scores; opt:
FT                   239, z-score: 404.1, E(): 3.8e-15, (88.1% identity in 42 aa
FT                   overlap).; SCJ11.22c, partial CDS, possible transposase,
FT                   associated with upstream and downstream CDSs, len: 42aa;
FT                   similar to a region of SW:IS12_STRAL insertion element
FT                   IS112 28.4kD protein from Streptomyces albus (256 aa) fasta
FT                   scores; opt: 191, z-score: 306.6, E(): 1e-09, (77.5%
FT                   identity in 40 aa overlap).; SCJ11.23c, partial CDS,
FT                   possible transposase, associated with the two downstream
FT                   CDSs, lacks start codon, len: 35aa; similar to a region of
FT                   SW:IS12_STRAL insertion element IS112 28.4kD protein from
FT                   Streptomyces albus (256 aa) fasta scores; opt: 163,
FT                   z-score: 274.2, E(): 6.5e-08, (69.4% identity in 36 aa
FT                   overlap).;transposase"
FT                   /locus_tag="SCO0092"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.21c; SCJ11.22c; SCJ11.23c"
FT   misc_feature    complement(78709..78714)
FT                   /note="Possible site for ribosomal frameshifting."
FT                   /locus_tag="SCO0092"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.21c; SCJ11.22c; SCJ11.23c"
FT   misc_feature    78830..80793
FT                   /note="Noncomposite transposon (awaiting designation)."
FT   repeat_region   78830..78875
FT                   /note="Inverted repeat bounding noncomposite transposon."
FT   gene            complement(78983..79702)
FT                   /db_xref="GeneID:1095521"
FT                   /locus_tag="SCO0095"
FT                   /gene_synonym="SCJ11.24c"
FT   CDS_pept        complement(78983..79702)
FT                   /locus_tag="SCO0095"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.24c"
FT                   /note="SCJ11.24c, hypothetical protein, part of
FT                   noncomposite transposon, len: 239 aa; weakly similar to
FT                   SW:YAFD_ECOLI hypothetical protein from Escherichia coli
FT                   (259 aa) fasta scores; opt: 112, z-score: 130.4, E(): 6.7,
FT                   (25.0% identity in 208 aa overlap)."
FT                   /db_xref="GI:21218661"
FT                   /db_xref="GeneID:1095521"
FT                   /translation="MSIEVVEPPALPPQGTAVEFKVRVPPSGEITLVTGRQRVGIHQAL
FT                   AGRTLTVWANHRSVHFLLDGHPVTTVPSRLRPEDLAYLTMRYGARPAGPEPAPAALPRA
FT                   RSGTAILAAGEPVEVDRKVHRDGLVRLASGRYQVGFALASRTITLRLDGHLMHAIADDA
FT                   LTGTWPCPVPADRLGQIEGPRTATSPLPPPPLPAGAFRAQRKVHASGRFMINGQSIELG
FT                   PRHAGKLVTVVIEDTHY"
FT                   /transl_table="11"
FT                   /protein_id="NP_624440.1"
FT   gene            complement(79839..80690)
FT                   /db_xref="GeneID:1095522"
FT                   /locus_tag="SCO0096"
FT                   /gene_synonym="SCJ11.25c"
FT   CDS_pept        complement(79839..80690)
FT                   /locus_tag="SCO0096"
FT                   /gene_family="HOG000224437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="noncomposite transposon transposase"
FT                   /gene_synonym="SCJ11.25c"
FT                   /note="SCJ11.25c, possible noncomposite transposon
FT                   transposase, len: 283 aa; similar to many e.g. TR:O86758
FT                   (EMBL:AL031035) proposed transposase from Streptomyces
FT                   coelicolor (318 aa) fasta scores; opt: 275, z-score: 330.3,
FT                   E(): 4.9e-11, (32.7% identity in 278 aa overlap)."
FT                   /db_xref="GI:21218662"
FT                   /db_xref="GeneID:1095522"
FT                   /translation="MLRSEVVDVQQLAEYRYRTVREVLGGSPIGEVAARYGTSRQTLHT
FT                   WRRRFVLEGMPGLLDRSRRPRNSPAGLSAEMEAEICELRRRHLRWGARRIAHELSVRGL
FT                   ESAPSRATVHRVLSRNGLVRAQEQQHPRKYRRWQREAPMHLWQMDLVGGVPLADGRECK
FT                   MVTGIDDHSRFVVIASVVAVPSARAVCSAFAAAMRRYGVPFEVLTDNGKQFTGRHQRPQ
FT                   PVEVLFERICRENGITQRLTKPRSPTTTGKIERSHRTLREEFLDHVVPFESLAAAQQAI
FT                   DG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624441.1"
FT   misc_feature    complement(79899..80279)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="SCO0096"
FT                   /gene_synonym="SCJ11.25c"
FT   repeat_region   80748..80793
FT                   /note="Inverted repeat bounding noncomposite transposon."
FT   gene            complement(80845..81165)
FT                   /db_xref="GeneID:1095523"
FT                   /locus_tag="SCO0097"
FT                   /gene_synonym="SCJ11.26c"
FT   CDS_pept        complement(80845..81165)
FT                   /locus_tag="SCO0097"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein"
FT                   /gene_synonym="SCJ11.26c"
FT                   /note="SCJ11.26c, possible integral membrane protein, len:
FT                   106 aa; contains possible membrane spanning hydrophobic
FT                   regions."
FT                   /db_xref="GI:21218663"
FT                   /db_xref="GeneID:1095523"
FT                   /translation="MPARADRIITALSWWWASAPLLLFIPAIAYAVGLPDVRREVGWAF
FT                   GLLALLTAAFAPTAGLVAAQIGDRREARGRFLIMAAVSSVPILFFLLFGVLFPECPDGH
FT                   HC"
FT                   /transl_table="11"
FT                   /protein_id="NP_624442.1"
FT   misc_feature    complement(81565..82665)
FT                   /note="Insertion element IS1653. Previously sequenced as
FT                   EMBL:AB024596 Streptomyces coelicolor insertion sequence
FT                   DNA."
FT   repeat_region   81565..81576
FT                   /note="Parted of the inverted repeat which bounds insertion
FT                   element IS1653."
FT   gene            complement(81602..82441)
FT                   /db_xref="GeneID:1095524"
FT                   /locus_tag="SCO0098"
FT                   /gene_synonym="SCJ11.27c"
FT   CDS_pept        complement(81602..82441)
FT                   /locus_tag="SCO0098"
FT                   /gene_family="HOG000254171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /gene_synonym="SCJ11.27c"
FT                   /note="SCJ11.27c, possible transposase, len: 279 aa;
FT                   previously sequenced therefore identical to TR:Q9Z9H3
FT                   (EMBL:AB024596) putative transposase from Streptomyces
FT                   coelicolor (279 aa) fasta scores; opt: 1839, z-score:
FT                   2190.6, E(): 0, (99.6% identity in 279 aa overlap). Also
FT                   similar to many others eg. TR:Q48339 (EMBL:M80805) from
FT                   IS1031 of Acetobacter xylinum (278 aa) fasta scores; opt:
FT                   611, z-score: 732.8, E(): 0, (38.9% identity in 262 aa
FT                   overlap)."
FT                   /db_xref="GI:21218664"
FT                   /db_xref="GeneID:1095524"
FT                   /translation="MSERKPYPSDLSDARWALIEPTLTAWRNARLERRPTGKPAQVDLR
FT                   DVFNAILYLNRTGIPWKYLPHDFPGHGTVYFYYAAWRDEGIFTQLNYDLTALARVKEGR
FT                   KPEPTASVIDTQSVKTSTNVPLTSQGTDAAKKIVGRKRGILTDTIGLILAVTVTGAGLS
FT                   ENAVGIRLLDQAKRTYPTIVKSWVDTGFKNAVIEHGATLGIDVEVVNRNPEKRGFHVVK
FT                   RRWVVERSIGWIMMHRRLARDYETLTTSSEAMIHIASIDNLAKRITDETTPTWRGTY"
FT                   /transl_table="11"
FT                   /protein_id="NP_624443.1"
FT   misc_feature    complement(82115..82423)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="SCO0098"
FT                   /gene_synonym="SCJ11.27c"
FT   misc_feature    complement(81662..82039)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="SCO0098"
FT                   /gene_synonym="SCJ11.27c"
FT   repeat_region   complement(82656..82665)
FT                   /note="Part of the inverted repeat which bounds the
FT                   insertion element IS1653."
FT   gene            82710..83518
FT                   /db_xref="GeneID:1095525"
FT                   /locus_tag="SCO0099"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.28; SCJ11.29"
FT   misc_feature    82710..83518
FT                   /note="SCJ11.28, partial CDS, possible transposase, len:
FT                   116aa; similar to many egs. TR:O69846 (EMBL:AL023702)
FT                   insertion element IS1647 transposase from Streptomyces
FT                   coelicolor (119 aa) fasta scores; opt: 623, z-score: 791.1,
FT                   E(): 0, (77.4% identity in 115 aa overlap) and
FT                   SW:YI22_BURCE insertion element IS402 hypothetical protein
FT                   (147 aa) fasta scores; opt: 272, z-score: 352.9, E():
FT                   2.7e-12, (39.7% identity in 116 aa overlap).; SCJ11.29,
FT                   partial CDS, possible transposase, len: 153aa; similar to
FT                   many egs. TR:O69847 (EMBL:AL023702) insertion element
FT                   IS1647 transposase (150 aa) fasta scores; opt: 810,
FT                   z-score: 999.4, E(): 0, (76.9% identity in 147 aa overlap)
FT                   and SW:YI21_BURCE insertion element IS402 hypothetical
FT                   protein from Pseudomonas cepacia (211 aa) fasta scores;
FT                   opt: 434, z-score: 539.8, E(): 1e-22, (45.1% identity in
FT                   153 aa overlap). Contains tta leucine codon, possible
FT                   target for bldA regulation.;transposase"
FT                   /locus_tag="SCO0099"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.28; SCJ11.29"
FT   repeat_region   complement(82710..83518)
FT                   /note="Inverted and repeated degenerately at 7202-7935bp."
FT   misc_feature    83047..83053
FT                   /note="Possible site for ribosomal frameshifting."
FT                   /locus_tag="SCO0099"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.28; SCJ11.29"
FT   misc_feature    83189..83191
FT                   /note="tta leucine codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCO0099"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.28; SCJ11.29"
FT   gene            complement(83516..83992)
FT                   /db_xref="GeneID:1095526"
FT                   /locus_tag="SCO0101"
FT                   /gene_synonym="SCJ11.30c"
FT   CDS_pept        complement(83516..83992)
FT                   /locus_tag="SCO0101"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.30c"
FT                   /note="SCJ11.30c, unknown, len: 247 aa; similar to
FT                   SW:YBFG_HAEIN hypothetical protein from Haemophilus
FT                   influenzae (228 aa) fasta scores; opt: 374, z-score: 437.3,
FT                   E(): 5.3e-17, (32.8% identity in 195 aa overlap). Contains
FT                   TTA leucine codon, possible target for bldA regulation."
FT                   /db_xref="GI:161353684"
FT                   /db_xref="GeneID:1095526"
FT                   /translation="MPSLAQVNQFPGAFDSAWQPDAGLVVAHDVLGGVFALNGGAPARA
FT                   GRPGAPGEIVYFAPDSLRWEALGAGHSAWLAWLVSGALAELYTDLRWTGWQDEVRALNS
FT                   DQGLSLFPPLWSAEARQDISATSRRAVPMAELLGVARDSCREFDGADPGLLGAV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624444.2"
FT   misc_feature    complement(83540..83992)
FT                   /note="Protein of unknown function DUF2625; Region:
FT                   DUF2625; cl08177"
FT                   /db_xref="CDD:186792"
FT                   /locus_tag="SCO0101"
FT                   /gene_synonym="SCJ11.30c"
FT   misc_feature    complement(83735..83737)
FT                   /note="tta leucine codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCO0101"
FT                   /gene_synonym="SCJ11.30c"
FT   gene            84893..85339
FT                   /db_xref="GeneID:1095527"
FT                   /locus_tag="SCO0102"
FT                   /gene_synonym="SCJ11.31"
FT   CDS_pept        84893..85339
FT                   /locus_tag="SCO0102"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.31"
FT                   /note="SCJ11.31, unknown, len: 148 aa"
FT                   /db_xref="GI:21218666"
FT                   /db_xref="GeneID:1095527"
FT                   /translation="MSDNVAPLVPRSADVERRRYVSSLHSAPQRTGVSHVGSISHGCDV
FT                   DPVGPDVKPAGKRSAVLRFVLAATPAPTGTSPTRTRVRTSSGRLRLAPGSARRARRDSH
FT                   APRLLVGVRERAADDGGEGVRALPEASGLRVCALSAIEQGWSGR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624445.1"
FT   gene            85336..86643
FT                   /db_xref="GeneID:1095528"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   CDS_pept        85336..86643
FT                   /locus_tag="SCO0103"
FT                   /gene_family="HOG000041711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavohemoprotein"
FT                   /gene_synonym="SCJ11.32"
FT                   /note="SCJ11.32, probable flavohemoprotein, len: 435aa;
FT                   C-terminal region similar to many with reductase and
FT                   dioxygenase activities, typical of flavohemoproteins e.g.
FT                   TR:Q9ZI75 (EMBL:AF039533) naphthalene dioxygenase reductase
FT                   from Pseudomonas stutzeri (328 aa) fasta scores; opt: 369,
FT                   z-score: 419.0, E(): 5.6e-16, (28.6% identity in 241 aa
FT                   overlap). Also typical of flavohemoprotein, C-terminal
FT                   region contains Pfam match to entry PF00175 oxidored_fad,
FT                   Oxidoreductase FAD/NAD-binding domain and N-terminal region
FT                   contains Pfam match to entry PF00042 globin, Globin."
FT                   /db_xref="GI:21218667"
FT                   /db_xref="GeneID:1095528"
FT                   /translation="MTGRFEFMHQSSHPDRPTTPADDWSGANAAHLAAPARIAAAPASV
FT                   TDEDVALVRASLTVVTPHVSELAAHFYSILFSRYPQVRDLFPAELDVQRERLVRALLRI
FT                   VELVDDPDNLVAFCSRLGRGHRKFGTQSGHYPAVGECLLQALSHFAGPAWHPALATAWQ
FT                   RAYTAAADVMVRAAEEDARSRPAVWDAHIVGHVHRGHGIAEITVRPHQPYPFVAGQYVS
FT                   IETPWAPRQWRQYSPANAPRPNSELTFHVRAVREGKVSNALVHHARPGDPVRLGPPEGD
FT                   MVLRPTRQRDLLFVAGGTGLAPIRALIEEVAQGSISDAREVSLFIGARTANELYGLDDM
FT                   LRMSQRYHWLRVRAAVSDERIPGLEGTLPEVLAEFGPWYRHEAYLCGPPQMLSGAVHAL
FT                   RRHGVPPRHIHYDPWDTPVLTAPLGPPPPDEEDDQL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624446.1"
FT   misc_feature    85471..86568
FT                   /note="bifunctional nitric oxide
FT                   dioxygenase/dihydropteridine reductase 2; Provisional;
FT                   Region: PRK13289"
FT                   /db_xref="CDD:183952"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    85471..85803
FT                   /note="Globins are heme proteins, which bind and transport
FT                   oxygen. This family summarizes a diverse set of homologous
FT                   protein domains, including: (1) tetrameric vertebrate
FT                   hemoglobins, which are the major protein component of
FT                   erythrocytes and transport oxygen...; Region: globin;
FT                   cd01040"
FT                   /db_xref="CDD:29979"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    order(85549..85551,85579..85581,85588..85593,85612..85614,
FT                   85621..85623,85705..85710,85738..85740,85747..85749)
FT                   /note="heme-binding site; other site"
FT                   /db_xref="CDD:29979"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    85942..86577
FT                   /note="The oxygenase reductase FAD/NADH binding domain acts
FT                   as part of the multi-component bacterial oxygenases which
FT                   oxidize hydrocarbons using oxygen as the oxidant. Electron
FT                   transfer is from NADH via FAD (in the oxygenase reductase)
FT                   and an [2FE-2S]...; Region: O2ase_reductase_like; cd06187"
FT                   /db_xref="CDD:99784"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    order(85993..85995,86032..86043,86083..86091,86095..86097,
FT                   86107..86115,86230..86232,86239..86241,86569..86571,
FT                   86575..86577)
FT                   /note="FAD binding pocket; other site"
FT                   /db_xref="CDD:99784"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    order(86032..86034,86038..86043)
FT                   /note="FAD binding motif; other site"
FT                   /db_xref="CDD:99784"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    order(86104..86106,86113..86115,86122..86124,86143..86145,
FT                   86167..86169,86173..86175)
FT                   /note="phosphate binding motif; other site"
FT                   /db_xref="CDD:99784"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    order(86215..86217,86227..86238,86242..86244)
FT                   /note="beta-alpha-beta structure motif; other site"
FT                   /db_xref="CDD:99784"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    order(86230..86235,86314..86322,86494..86499)
FT                   /note="NAD binding pocket; other site"
FT                   /db_xref="CDD:99784"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    85462..85869
FT                   /note="Pfam match to entry PF00042 globin, Globin, score
FT                   42.10, E-value 1.3e-08"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   misc_feature    86200..86529
FT                   /note="Pfam match to entry PF00175 oxidored_fad,
FT                   Oxidoreductase FAD/NAD-binding domain, score 59.40, E-value
FT                   7.7e-14"
FT                   /locus_tag="SCO0103"
FT                   /gene_synonym="SCJ11.32"
FT   gene            86640..87311
FT                   /db_xref="GeneID:1095529"
FT                   /locus_tag="SCO0104"
FT                   /gene_synonym="SCJ11.33"
FT   CDS_pept        86640..87311
FT                   /locus_tag="SCO0104"
FT                   /gene_family="HOG000253877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrolase"
FT                   /gene_synonym="SCJ11.33"
FT                   /note="SCJ11.33, possible hydrolase, len: 223aa; similar to
FT                   TR:O54126 (EMBL:AL021529) NTP pyrophosphohydrolase from
FT                   Streptomyces coelicolor (359 aa) fasta scores; opt: 223,
FT                   z-score: 267.6, E(): 1.5e-07, (29.4% identity in 194 aa
FT                   overlap)."
FT                   /db_xref="GI:21218668"
FT                   /db_xref="GeneID:1095529"
FT                   /translation="MNGPETPGSSGEHLLQQQLGTTDRAAVFYDRQVHPYLTPAMREFI
FT                   ARQNMVFLSTADSRGACDASFRAGPPGFCVSLDDRSLTYPEYRGNGVLASAGNMTENPQ
FT                   LGMLFMDFTHDHIGLHVNGTVRLYTDHEIRAWYPLLPTETAPGRQPHLWVHLTVEEAYV
FT                   HCSKHIPHLEPAPRPRSATQRSRPKDSAYFPEPLPVHQASEPAGAEAGRPSWRDRLRIR
FT                   P"
FT                   /transl_table="11"
FT                   /protein_id="NP_624447.1"
FT   misc_feature    86751..87035
FT                   /note="Pyridoxine 5'-phosphate (PNP) oxidase-like proteins;
FT                   Region: PNPOx_like; cl00381"
FT                   /db_xref="CDD:185954"
FT                   /locus_tag="SCO0104"
FT                   /gene_synonym="SCJ11.33"
FT   gene            complement(87907..88632)
FT                   /db_xref="GeneID:1095530"
FT                   /locus_tag="SCO0105"
FT                   /gene_synonym="SCJ11.34c; xlnC"
FT   CDS_pept        complement(87907..88632)
FT                   /locus_tag="SCO0105"
FT                   /gene_family="HOG000179135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endo-1,4-beta-xylanase"
FT                   /gene_synonym="SCJ11.34c; xlnC"
FT                   /note="SCJ11.34c, xlnC, endo-1,4-beta-xylanase (putative
FT                   secreted protein), len: 241 aa; highly similar to many
FT                   endo-1,4-beta-xylanases e.g. SW:XYNC_STRLI from
FT                   Streptomyces lividans (240 aa) fasta scores; opt: 1605,
FT                   z-score: 1785.1, E(): 0, (97.9% identity in 241 aa overlap)
FT                   and SW:XYNA_BACSU from Bacillus subtilis (213 aa) fasta
FT                   scores; opt: 813, z-score: 910.7, E(): 0, (58.8% identity
FT                   in 221 aa overlap). Contains Pfam match to entry PF00457
FT                   Glyco_hydro_11, Glycosyl hydrolases family 11 and Prosite
FT                   matches to PS00777 Glycosyl hydrolases family 11 active
FT                   site signature 2 and PS00776 Glycosyl hydrolases family 11
FT                   active site signature 1"
FT                   /db_xref="GI:21218669"
FT                   /db_xref="GeneID:1095530"
FT                   /translation="MQQDGTQQDRIKQSPAPLNGMSRRGFLGGAGTLALATASGLLLPG
FT                   TAHAATTITTNQTGTDGMYYSFWTDGGGSVSMTLNGGGSYSTQWTNCGNFVAGKGWSTG
FT                   GRRTVRYNGYFNPSGNGYGCLYGWTSNPLVEYYIVDNWGSYRPTGTYKGTVSSDGGTYD
FT                   IYQTTRYNAPSVEGTKTFQQYWSVRQSKVTSGSGTITTGNHFDAWARAGMNMGQFRYYM
FT                   IMATEGYQSSGSSNITVSG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624448.1"
FT   misc_feature    complement(87916..88446)
FT                   /note="Glycosyl hydrolases family 11; Region:
FT                   Glyco_hydro_11; pfam00457"
FT                   /db_xref="CDD:144158"
FT                   /locus_tag="SCO0105"
FT                   /gene_synonym="SCJ11.34c; xlnC"
FT   misc_feature    complement(87916..88458)
FT                   /note="Pfam match to entry PF00457 Glyco_hydro_11, Glycosyl
FT                   hydrolases family 11, score 418.50, E-value 6.2e-122"
FT                   /locus_tag="SCO0105"
FT                   /gene_synonym="SCJ11.34c; xlnC"
FT   misc_feature    complement(87928..87963)
FT                   /note="PS00777 Glycosyl hydrolases family 11 active site
FT                   signature 2."
FT                   /locus_tag="SCO0105"
FT                   /gene_synonym="SCJ11.34c; xlnC"
FT   misc_feature    complement(88207..88239)
FT                   /note="PS00776 Glycosyl hydrolases family 11 active site
FT                   signature 1."
FT                   /locus_tag="SCO0105"
FT                   /gene_synonym="SCJ11.34c; xlnC"
FT   misc_feature    89033..90239
FT                   /note="Possible noncomposite drug resistance transposon."
FT   repeat_region   89033..89161
FT                   /note="Part of inverted repeat bounding possible
FT                   noncomposite drug resistance transposon."
FT   gene            89073..89465
FT                   /db_xref="GeneID:1095531"
FT                   /locus_tag="SCO0106"
FT                   /gene_synonym="SCJ11.35"
FT   CDS_pept        89073..89465
FT                   /locus_tag="SCO0106"
FT                   /gene_family="HOG000254172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="insertion element transposase"
FT                   /gene_synonym="SCJ11.35"
FT                   /note="SCJ11.35, possible noncomposite drug resistance
FT                   transposon transposase, len: 185 aa; similar to many e.g.
FT                   TR:O69927 (EMBL:AL023861) IS1648 transposase from
FT                   Streptomyces coelicolor (141 aa) fasta scores; opt: 432,
FT                   z-score: 565.7 E(): 3.8e-24, (47.8% identity in 136 aa
FT                   overlap)."
FT                   /db_xref="GI:21218670"
FT                   /db_xref="GeneID:1095531"
FT                   /translation="MSLTDAQWARIEPLLPDRTPRRAGQWRDHRQVIDAIVFKYRTGTP
FT                   WMELPERFGSWKGAHNRLRMWAVDGTWEKVFTALLAQADAEGDLDWVIPVDSAVVRAHQ
FT                   HAAGARQKGLRPASRTTMPSDGPAAD"
FT                   /transl_table="11"
FT                   /protein_id="NP_624449.1"
FT   misc_feature    89076..89432
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="SCO0106"
FT                   /gene_synonym="SCJ11.35"
FT   gene            complement(89486..90043)
FT                   /db_xref="GeneID:1095532"
FT                   /locus_tag="SCO0107"
FT                   /gene_synonym="SCJ11.36c"
FT   CDS_pept        complement(89486..90043)
FT                   /locus_tag="SCO0107"
FT                   /gene_family="HOG000266464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminoglycoside nucleotidyltransferase"
FT                   /gene_synonym="SCJ11.36c"
FT                   /note="SCJ11.36c, possible noncomposite drug resistance
FT                   transposon aminoglycoside nucleotidyltransferase, len: 185
FT                   aa; some similarity to many involved in antibiotic
FT                   resistance e.g. TR:Q53702 (EMBL:J03947) lincosaminide
FT                   nucleotidyltransferase from Staphylococcus aureus (161 aa)
FT                   fasta scores; opt: 176, z-score: 229.0, E(): 2.1e-05,
FT                   (28.4% identity in 148 aa overlap)"
FT                   /db_xref="GI:21218671"
FT                   /db_xref="GeneID:1095532"
FT                   /translation="MRCRSDLYLRTVSHYAMSAEDALALLERLHAHGVDACVGGGWSVD
FT                   ALLGKQTRDHSDLDLWVPAVHLDPLFVAFGEAGVDRIFPWPGDRPWNFVLHDGVGLRVD
FT                   LHLYEALADGSLHYGSVVDGAAFPAEALAGHGFIAGTAVRCESAEWAVRSHTGYPARDV
FT                   DRHDVPLLCRKFEIPLPESFEP"
FT                   /transl_table="11"
FT                   /protein_id="NP_624450.1"
FT   misc_feature    complement(<89852..89932)
FT                   /note="Aminoglycoside-2''-adenylyltransferase; Region:
FT                   Aminoglyc_resit; pfam10706"
FT                   /db_xref="CDD:151199"
FT                   /locus_tag="SCO0107"
FT                   /gene_synonym="SCJ11.36c"
FT   repeat_region   90111..90239
FT                   /note="Part of inverted repeat bounding possible
FT                   noncomposite drug resistance transposon."
FT   gene            90242..90391
FT                   /db_xref="GeneID:1095533"
FT                   /locus_tag="SCO0108"
FT                   /gene_synonym="SCJ11.37"
FT   CDS_pept        90242..90391
FT                   /locus_tag="SCO0108"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.37"
FT                   /note="SCJ11.37, unknown, len: 49 aa"
FT                   /db_xref="GI:21218672"
FT                   /db_xref="GeneID:1095533"
FT                   /translation="MLRKTIKVQWLGDEEFGMVGRPRAITHDPESCEKTVSLKALRDPC
FT                   GLAG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624451.1"
FT   gene            complement(90395..90865)
FT                   /db_xref="GeneID:1095534"
FT                   /locus_tag="SCO0109"
FT                   /gene_synonym="SCJ11.38c"
FT   CDS_pept        complement(90395..90865)
FT                   /locus_tag="SCO0109"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.38c"
FT                   /note="SCJ11.38c, unknown, len: 156aa; shows similarity to
FT                   human proteins involved in the expression of GAGE genes eg.
FT                   TR:AAC33676 (EMBL:AF055473) GAGE-7 from Homo sapiens
FT                   (Human) (116 aa) fasta scores; opt: 114, z-score: 144.7,
FT                   E(): 1.1, (31.9% identity in 119 aa overlap)."
FT                   /db_xref="GI:21218673"
FT                   /db_xref="GeneID:1095534"
FT                   /translation="MVRDRLRQRPDPQREVNADVSAADHHTPWQYCRAVPSPPARQTFS
FT                   QATAQPGEQAAIDHGGTVRRGQGYSLRASTIQVIHRQMLARCQPLDGGHGTPTVPAQRK
FT                   ARREYENASARSSRPAPRLGINPSRPATTSCTSRPACTAEDCFALPPIVNVF"
FT                   /transl_table="11"
FT                   /protein_id="NP_624452.1"
FT   gene            complement(90951..91790)
FT                   /db_xref="GeneID:1095535"
FT                   /locus_tag="SCO0110"
FT                   /gene_synonym="SCJ11.39c"
FT   CDS_pept        complement(90951..91790)
FT                   /locus_tag="SCO0110"
FT                   /gene_family="HOG000128097" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding protein"
FT                   /gene_synonym="SCJ11.39c"
FT                   /note="SCJ11.39c, possible DNA-binding protein, len: 279
FT                   aa; similar to TR:O86721 (EMBL:AL031515) hypothetical
FT                   protein from Streptomyces coelicolor (272 aa) fasta scores;
FT                   opt: 123, z-score: 148.4, E(): 0.66, (26.6% identity in 278
FT                   aa overlap). Contains possible helix-turn-helix motif 40-61
FT                   aa (+3.21 SD)"
FT                   /db_xref="GI:21218674"
FT                   /db_xref="GeneID:1095535"
FT                   /translation="MPTNTNRAELRDFLRSRRARVSPEDVGIPATVRRRTPGLRREEVA
FT                   QLAGVGITWYTWLEQGRPINVSSQVLDAVARTLILDAAERDHLYRLAEVPQPPVISDPP
FT                   TELPGHLDTVLEALDPLPAMLVDARTDVLRWNRAYAALHPALVSAPPGKRNTLWQLFAA
FT                   PEGQPRIVNRDEQAPEAVAGFRYRYSQNAGDPRWQDFVARLRTASPLFSRLWTTHDVAP
FT                   PHLCDKRYDITGIGEVSLRATSMELTDHPGVRLVVQTPADRRSRENIDRLLRQATHL"
FT                   /transl_table="11"
FT                   /protein_id="NP_624453.1"
FT   misc_feature    complement(91557..91694)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:186822"
FT                   /locus_tag="SCO0110"
FT                   /gene_synonym="SCJ11.39c"
FT   gene            91977..92729
FT                   /db_xref="GeneID:1095536"
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   CDS_pept        91977..92729
FT                   /locus_tag="SCO0111"
FT                   /codon_start="1"
FT                   /product="oxidoreductase"
FT                   /gene_synonym="SCJ11.40"
FT                   /note="SCJ11.40, probable oxidoreductase, len: 753 aa;
FT                   similar to many egs. TR:O32457 (EMBL:D87924) ORF7 from the
FT                   polyketide synthase cluster of Actinomadura hibisca (246
FT                   aa) fasta scores; opt: 480, z-score: 498.5, E(): 2.1e-20,
FT                   (38.3% identity in 248 aa overlap) and TR:Q54810
FT                   (EMBL:L35560) reductase from the doxorubicin polyketide
FT                   synthase cluster of Streptomyces peucetius (251 aa) fasta
FT                   scores; opt: 408, z-score: 425.7, E(): 2.4e-16, (33.7%
FT                   identity in 243 aa overlap). Contains Pfam matches to entry
FT                   PF00106 adh_short, short chain dehydrogenase and to entry
FT                   PF00678 adh_short_C2, Short chain dehydrogenase/reductase
FT                   C-terminus and Prosite match to PS00061 Short-chain
FT                   dehydrogenases/reductases family signature"
FT                   /db_xref="GI:21218675"
FT                   /db_xref="GeneID:1095536"
FT                   /translation="MSNAFHNKVAVVTGGSAGIGHATARKIAEGGGTVYITGRDQDAAT
FT                   AAAADIPGDVIGVRADSRSTDDLGRLFAQVKRRSGRLDVLVVNAAAIATAPLGTITEDV
FT                   IRTVFDVNITGTIMAVQKALPLLADGGVIVLTGSMAAHKASRGRSLYAASKAGVRALAR
FT                   TWALELTPRGIRVNVVSPGPTDTPGIAQLAATAEEREALIATMGTGTPMTRAGTAEEVA
FT                   AVISFVASDAASHVNGADYQVDGGYGQV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624454.1"
FT   misc_feature    91989..92726
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   misc_feature    91989..92714
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:180183"
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   misc_feature    91998..92537
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 199.10, E-value 6.7e-56"
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   misc_feature    92388..92474
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   misc_feature    92613..92705
FT                   /note="Pfam match to entry PF00678 adh_short_C2, Short
FT                   chain dehydrogenase/reductase C-terminus, score 32.90,
FT                   E-value 7.4e-06"
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   misc_feature    92696..92698
FT                   /note="TTA leucine codon. Possible target for bldA
FT                   regulation"
FT                   /locus_tag="SCO0111"
FT                   /gene_synonym="SCJ11.40"
FT   gene            complement(92773..92928)
FT                   /db_xref="GeneID:1095537"
FT                   /locus_tag="SCO0112"
FT                   /gene_synonym="SCJ11.41c"
FT   CDS_pept        complement(92773..92928)
FT                   /locus_tag="SCO0112"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ11.41c"
FT                   /note="SCJ11.41c, improbable CDS, function unknown, len:
FT                   51aa; predicted by GC Frameplot."
FT                   /db_xref="GI:21218676"
FT                   /db_xref="GeneID:1095537"
FT                   /translation="MTAETITALVARAAFSCSSKIHAPMLARGRVWGSSPSPGSHQLSQ
FT                   EVVPAR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624455.1"
FT   gene            92961..93257
FT                   /db_xref="GeneID:1095538"
FT                   /locus_tag="SCO0113"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.42"
FT   misc_feature    92961..93257
FT                   /note="SCJ11.42, possible pseudogene, len: 98 aa; predicted
FT                   from codon and amino acid usage but lacking a start codon"
FT                   /locus_tag="SCO0113"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.42"
FT   gene            complement(93292..94117)
FT                   /db_xref="GeneID:1095539"
FT                   /locus_tag="SCO0114"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.43c; SCJ11.44c"
FT   misc_feature    complement(93292..94117)
FT                   /note="SCJ11.43c, possible transposase, len: 86 aa; similar
FT                   to many eg. TR:O69847 (EMBL:AL023702) insertion element
FT                   IS1647 transposase (150 aa) from Streptomyces coelicolor
FT                   (150 aa) fasta scores; opt: 197, z-score: 294.5, E():
FT                   4.8e-09, (42.1% identity in 76 aa overlap). Lacks a stop
FT                   codon and start codon is probably fortuitous.; SCJ11.44c,
FT                   possible transposase, len: 174 aa; similar to but longer
FT                   than many eg. TR:O69846 (EMBL:AL023702) insertion element
FT                   IS1647 transposase from Streptomyces coelicolor (119 aa)
FT                   fasta scores; opt: 276, z-score: 344.8, E(): 7.6e-12,
FT                   (40.4% identity in 114 aa overlap).;transposase"
FT                   /locus_tag="SCO0114"
FT                   /pseudo
FT                   /gene_synonym="SCJ11.43c; SCJ11.44c"
FT   repeat_region   complement(93593..94117)
FT                   /note="Inverted and repeated degenerately at 8087-8935bp."
FT   gene            complement(94306..94872)
FT                   /db_xref="GeneID:1095540"
FT                   /locus_tag="SCO0116"
FT                   /gene_synonym="SCJ11.45c"
FT   CDS_pept        complement(94306..94872)
FT                   /locus_tag="SCO0116"
FT                   /gene_family="HOG000219710" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /gene_synonym="SCJ11.45c"
FT                   /note="SCJ11.45c, possible tetR-family transcriptional
FT                   regulator, len: 188 aa; N-terminal region similar to that
FT                   of others e.g. SW:ACRR_ECOLI potential AcrAB operon
FT                   repressor (215 aa) fasta scores; opt: 148, z-score: 188.9,
FT                   E(): 0.0037, (39.3% identity in 61 aa overlap). Contains
FT                   Pfam match to entry PF00440 tetR, Bacterial regulatory
FT                   proteins, tetR family. Also contains possible
FT                   helix-turn-helix motif 32-53aa (+3.34 SD)."
FT                   /db_xref="GI:21218677"
FT                   /db_xref="GeneID:1095540"
FT                   /translation="MSRVSQAQAEENRRRVVDTASRLFREHGTHVSVTDLMKAAGLTHG
FT                   AFYKQFASKEALVDEATAHAFAELAQRYSTGLERHDGQRVAAQRALIDAYLSVEHRDAP
FT                   ADGCPVAALATDIAREGGGEGREARRVYAEGVADFAQFLARDDHDGLVRLCTLFGALVL
FT                   SRATKGLPISGEILAAAHTAVTEEG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624456.1"
FT   misc_feature    complement(<94525..94872)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="SCO0116"
FT                   /gene_synonym="SCJ11.45c"
FT   misc_feature    complement(94690..94827)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="SCO0116"
FT                   /gene_synonym="SCJ11.45c"
FT   misc_feature    complement(94690..94827)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 24.20, E-value
FT                   5.4e-05"
FT                   /locus_tag="SCO0116"
FT                   /gene_synonym="SCJ11.45c"
FT   gene            94989..95681
FT                   /db_xref="GeneID:1095541"
FT                   /locus_tag="SCO0117"
FT                   /gene_synonym="SCJ11.46"
FT   CDS_pept        94989..95681
FT                   /locus_tag="SCO0117"
FT                   /codon_start="1"
FT                   /product="short chain dehydrogenase"
FT                   /gene_synonym="SCJ11.46"
FT                   /note="SCJ11.46, possible oxidoreductase, len: 230 aa;
FT                   similar to many proposed oxidoreductases eg. TR:O53324
FT                   (EMBL:AL021646) oxidoreductase from Mycobacterium
FT                   tuberculosis (235 aa) fasta scores; opt: 626, z-score:
FT                   717.5, E(): 1.3e-32, (50.9% identity in 224 aa overlap).
FT                   Contains Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase and Prosite match to PS00061 Short-chain
FT                   dehydrogenases/reductases family signature"
FT                   /db_xref="GI:21218678"
FT                   /db_xref="GeneID:1095541"
FT                   /translation="MELKNAVAVVTGANRGFGRHLAAQLVERGAKVYGAARRPETVDVP
FT                   GVIPLLLDVTDEASIREATRVASDTTLLINNAGISTGATLLGGDMTEVRRDMETNYFGP
FT                   LATTRSFAPVIEANGGGAVLNVLSALSWFHPAGLGSYAASKAAAWALTGATRDELAPRG
FT                   IAVSALHVGYMDTDMAADVPADQKVDAGEVAAQALYGIETGLPEVLADETSRHVKQSLA
FT                   AAPQPNAD"
FT                   /transl_table="11"
FT                   /protein_id="NP_624457.1"
FT   misc_feature    94989..95666
FT                   /note="Short-chain dehydrogenases of various substrate
FT                   specificities [General function prediction only]; Region:
FT                   DltE; COG0300"
FT                   /db_xref="CDD:30648"
FT                   /locus_tag="SCO0117"
FT                   /gene_synonym="SCJ11.46"
FT   misc_feature    94989..95666
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCO0117"
FT                   /gene_synonym="SCJ11.46"
FT   misc_feature    95004..95519
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 121.40, E-value 1.7e-32"
FT                   /locus_tag="SCO0117"
FT                   /gene_synonym="SCJ11.46"
FT   misc_feature    95370..95456
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT                   /locus_tag="SCO0117"
FT                   /gene_synonym="SCJ11.46"
FT   gene            95989..97518
FT                   /db_xref="GeneID:1095542"
FT                   /locus_tag="SCO0118"
FT                   /gene_synonym="SCJ11.47"
FT   CDS_pept        95989..97518
FT                   /locus_tag="SCO0118"
FT                   /gene_family="HOG000112982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="xylosidase/arabinosidase"
FT                   /gene_synonym="SCJ11.47"
FT                   /note="SCJ11.47, possible xylosidase/arabinosidase, len:
FT                   509aa; similar to many xylosidase/arabinosidases especially
FT                   in the N-terminal xylosidase region e.g. SW:XYLB_BUTFI
FT                   xylosidase/arabinosidase from Butyrivibrio fibrisolvens
FT                   (517 aa) fasta scores; opt: 582, z-score: 640.5, E():
FT                   2.6e-28, (35.2% identity in 526 aa overlap)"
FT                   /db_xref="GI:21218679"
FT                   /db_xref="GeneID:1095542"
FT                   /translation="MRMYDNPVISGFHPDPSVCRVGDDYYLVCSSFEYFPGLPLFHSKD
FT                   LVHWEQIGNVLDRPGQLPLPVPGAKASGGLYAPTIRHHDGRYWVINTNIDGGGNFVVSA
FT                   RRPEGPWRDPVWIDLPGIDPDLAWEEDGTCWCAFSGPEGGINMARIDPVEGTVLEQPFV
FT                   TWSGSGLKYPEAPHLYRIGDWWYLLIAEGGTERGHSVSVARSRSPRGPWQGAPSNPLLS
FT                   HSGTPRPIQNTGHADLVEAPDGSWWMVLLGVRPRGFTPDVHVLGRETFLTPVEWDADGW
FT                   PLLAPVPVSHAAPGGAWHPVPAPPTRDDFDKHSLAPHWISPFTRHEGSWSLTERPGWLL
FT                   LGATGPTLDRPGYTFVGRRQQHHDCRVTALIDPGTGRGGLCVRLDEAHHYEVEAGDGEV
FT                   RVVARIGPLRQTVARRPVPAGPQHLTVTIRTSDLVPASPELTDGGTTGPDTIAFGLGDP
FT                   DTPDARPLAELDGRYLSTEVACGFTGRVIGMYATEGTVAFDWFEYVPTPSV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624458.1"
FT   misc_feature    96004..96840
FT                   /note="Glycosyl hydrolase family 43, beta-D-xylosidase;
FT                   Region: GH43_XYL_1; cd09000"
FT                   /db_xref="CDD:185741"
FT                   /locus_tag="SCO0118"
FT                   /gene_synonym="SCJ11.47"
FT   misc_feature    order(96031..96033,96082..96084,96214..96219,96352..96357,
FT                   96508..96510,96565..96570,96691..96693,96787..96789)
FT                   /note="inhibitor binding site; inhibition site"
FT                   /db_xref="CDD:185741"
FT                   /locus_tag="SCO0118"
FT                   /gene_synonym="SCJ11.47"
FT   misc_feature    order(96031..96033,96355..96357,96508..96510)
FT                   /note="active site"
FT                   /db_xref="CDD:185741"
FT                   /locus_tag="SCO0118"
FT                   /gene_synonym="SCJ11.47"
FT   gene            complement(97760..98281)
FT                   /db_xref="GeneID:1095543"
FT                   /locus_tag="SCO0119"
FT                   /gene_synonym="SCJ11.48c"
FT   CDS_pept        complement(97760..98281)
FT                   /locus_tag="SCO0119"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small secreted protein"
FT                   /gene_synonym="SCJ11.48c"
FT                   /note="SCJ11.48c, possible small secreted protein, len:
FT                   173aa; contains possible N-terminal signal sequence."
FT                   /db_xref="GI:21218680"
FT                   /db_xref="GeneID:1095543"
FT                   /translation="MSVSRTARRAVLTAAVVCVSTLAVPSTAQAAPLPPACQEALLETL
FT                   DKFPVVDFTVPDKVKNTMTAQVLGMSEADQAVFTEVACAAWNTWATQNGQAVATDLDSR
FT                   YRNAAGPVCNKFARSALATIKKHSPNVPAETREMERVAKTVWRDSMEKLAADATNADCR
FT                   TAYNAVKAGW"
FT                   /transl_table="11"
FT                   /protein_id="NP_624459.1"
FT   gene            complement(98463..99338)
FT                   /db_xref="GeneID:1095544"
FT                   /locus_tag="SCO0120"
FT                   /gene_synonym="SCJ11.49c; SCJ21.01c"
FT   CDS_pept        complement(98463..99338)
FT                   /locus_tag="SCO0120"
FT                   /gene_family="HOG000105567" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integral membrane protein"
FT                   /gene_synonym="SCJ11.49c; SCJ21.01c"
FT                   /note="SCJ21.01c, probable integral membrane protein,
FT                   partial CDS, len: >114 aa; SCJ11.49c, probable integral
FT                   membrane protein, len: >222aa; contains probable membrane
FT                   spanning hydrophobic regions."
FT                   /db_xref="GI:32141099"
FT                   /db_xref="GeneID:1095544"
FT                   /translation="MRRHLSLFVTASRYALIGHARNRFAMLLVVVYIPVWIALAYVTIP
FT                   DQPAPFRLRATGEVLSPPGNHLTQITGALNAVTLIAGFMMFAATFTGGAFDRRLAMAGY
FT                   PRFHLVLAKLSALTLVCVAISVYATAVAGFAWTPRQPLLLTAALFGAALTYGALGVVFG
FT                   SVLRREVEGMFAILMISVLDVALQNPLSSSGSDSAVVRFLPTYGAVQASMSAAFSDASG
FT                   GRALLTQCLWLTGASAAAFLVFRRRTRNALVRHRKPPFPAPRGAGGTEGPGVHRPPAES
FT                   GPAPERVGPA"
FT                   /transl_table="11"
FT                   /protein_id="NP_733490.1"
FT   gene            complement(99335..99949)
FT                   /db_xref="GeneID:1095545"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   CDS_pept        complement(99335..99949)
FT                   /locus_tag="SCO0121"
FT                   /codon_start="1"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /gene_synonym="SCJ21.02c"
FT                   /note="SCJ21.02c, probable ABC transport system ATP-binding
FT                   protein, len: 204 aa; similar to many e.g. NUC_ECOLI
FT                   high-affinity zinc uptake system ATP-binding protein (251
FT                   aa), fasta scores; opt: 327 z-score: 404.3 E(): 3.6e-15,
FT                   35.2% identity in 179 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop) and Pfam match to
FT                   entry PF00005 ABC_tran, ABC transporter"
FT                   /db_xref="GI:21218681"
FT                   /db_xref="GeneID:1095545"
FT                   /translation="MDVHDVHHSYRQHAVLRGVGLRLKPGTLAGIVGENGAGKTTLLKI
FT                   LSGELRPDRGTVHHSGRFGYCPQTVVLDDSFTVRQHLDFFRSAFGLTGLERAEEVMETL
FT                   AFTEYLDQRAGRLSGGSRQKLNLTLALMHDPDVLLLDEPYQGFDWETYLRFWELATRLR
FT                   DAGRSVLVVSHLAYDIDRLDQLWRLEGGRLHIQERPMEAAA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624460.1"
FT   misc_feature    complement(99371..99949)
FT                   /note="This family of ATP-binding proteins belongs to a
FT                   multisubunit transporter involved in drug resistance (BcrA
FT                   and DrrA), nodulation, lipid transport, and lantibiotic
FT                   immunity.  In bacteria and archaea, these transporters
FT                   usually include an ATP-binding...; Region:
FT                   ABC_DR_subfamily_A; cd03230"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99347..99937)
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99830..99853)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(order(99428..99430,99524..99529,99746..99748,
FT                   99827..99835,99839..99844))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99746..99757)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99572..99601)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99524..99541)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99506..99517)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99422..99442)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   RBS             complement(99346..99350)
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99377..99874)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 147.80, E-value 1.9e-40"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   misc_feature    complement(99830..99853)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /locus_tag="SCO0121"
FT                   /gene_synonym="SCJ21.02c"
FT   RBS             complement(99957..99960)
FT   RBS             100176..100179
FT   gene            100190..101566
FT                   /db_xref="GeneID:1095546"
FT                   /locus_tag="SCO0122"
FT                   /gene_synonym="SCJ21.03"
FT   CDS_pept        100190..101566
FT                   /locus_tag="SCO0122"
FT                   /gene_family="HOG000076536" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-containing monooxygenase (putative
FT                   secreted protein)"
FT                   /gene_synonym="SCJ21.03"
FT                   /note="SCJ21.03, probable flavin-containing monooxygenase
FT                   (secreted protein), len: 458 aa; similar to many eukaryotic
FT                   monooxygenases, e.g. FMO5_RABIT dimethylaniline
FT                   monooxygenase [N-oxide forming] (532 aa), fasta scores;
FT                   opt: 938 z-score: 1016.9 E(): 0, 38.7% identity in 432 aa
FT                   overlap. Also similar to S. coelicolor putative
FT                   oxidoreductase SCH35.27 E(): 3.4e-07, 34.8% identity in 282
FT                   aa overlap. Contains Pfam match to entry PF00743 FMO-like,
FT                   Flavin-binding monooxygenase-like"
FT                   /db_xref="GI:21218682"
FT                   /db_xref="GeneID:1095546"
FT                   /translation="MRRTCVIGAGPSGLAASRVLASRGIPFDCYEAGSGIGGLWRYGND
FT                   NGMSGVYASLHANISKESMSFSSLPMPDSYPVFPHHTQVLAYLESYAETFGLHGHIGLR
FT                   TEVTSVRPVEGGGWEVTRRSRGGAEAETDRYTEVVVANGHHWDPRLPDPAVPGAGVFEG
FT                   SAVHAHAYRSPEPYAGQRVLVVGMGNSGCEIAAEISRSAARTFLSARAVAHVFPKMLLG
FT                   RPADHWAVSRAAVLPRFLKDPGMALLLRLARGAPALYGLPEPVRRPLAAHPSTSDELLV
FT                   QLARGAVTAKPGIRSFGRDSVSFTDGSRETVDAVVYATGYSLSFPFLAPAVFAAPDGRT
FT                   ELYLRTVPPRLPGLFFMGLAQPAGAAFPLLEPQAEWIADLIEGEVLLPTPAEMTRSIAR
FT                   ARERHDKVYAPSYRHGIEIDICAYRRALRRELRAGRRRARRADARRPDAPRPAPVSDTV
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="NP_624461.1"
FT   misc_feature    100205..>100822
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="SCO0122"
FT                   /gene_synonym="SCJ21.03"
FT   misc_feature    <101090..101458
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="SCO0122"
FT                   /gene_synonym="SCJ21.03"
FT   misc_feature    100190..101563
FT                   /note="Pfam match to entry PF00743 FMO-like, Flavin-binding
FT                   monooxygenase-like, score 47.90, E-value 7.5e-25"
FT                   /locus_tag="SCO0122"
FT                   /gene_synonym="SCJ21.03"
FT   gene            complement(101656..103002)
FT                   /db_xref="GeneID:1095547"
FT                   /locus_tag="SCO0123"
FT                   /gene_synonym="SCJ21.04c"
FT   CDS_pept        complement(101656..103002)
FT                   /locus_tag="SCO0123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.04c"
FT                   /note="SCJ21.04c, unknown, len: 448 aa; some similarity to
FT                   M. tuberculosis hypothetical protein TR:P71694
FT                   (EMBL:Z95844) Rv1425 (459 aa), fasta scores; opt: 150
FT                   z-score: 166.6 E(): 0.063, 23.9% identity in 464 aa
FT                   overlap"
FT                   /db_xref="GI:21218683"
FT                   /db_xref="GeneID:1095547"
FT                   /translation="MSAPPTAPADPSTGSDRPKRSVPPPRHPTHAVDRAFLDLERRRPE
FT                   VRWDAGGVAYLSGPPPSLADLRAYVAFRLGELPLLTSRVTGGRRPGWQPSEDFPVDRHV
FT                   YEVVADGPADWDTALHSALNAPFAPGAYWGVWLIHGHEPDAYALCYRFLHACQDGSAAA
FT                   MTFRAMLGDGEPSARPLPGGSGVFGVPRRFGAAVALATRFLARTFTVRRHRPDPAFAPA
FT                   GERRLWRGRVPVDTLRLIGAGRGGSAHDAHLAALAGALSVWAARSGVPLPRVTAVLPVD
FT                   ARRADEEQTWGNRCFALPVDLPVGPAPGRPDGSPDEEAPLRRLDQIMAVTRKLRGDTWR
FT                   QAVQDLVRYMPDRPTAWYLRRMLSPRVTNVMATSMPLAEKGSLGETRVTGTALLPLLVP
FT                   GHLCGVGLSFFGDWAEVSFVADRALPLGELLPELWEQAVRELAESVQRG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624462.1"
FT   misc_feature    complement(101734..102915)
FT                   /note="acyltransferase, WS/DGAT/MGAT; Region: acyl_WS_DGAT;
FT                   TIGR02946"
FT                   /db_xref="CDD:163081"
FT                   /locus_tag="SCO0123"
FT                   /gene_synonym="SCJ21.04c"
FT   gene            103628..104989
FT                   /db_xref="GeneID:1095548"
FT                   /locus_tag="SCO0124"
FT                   /gene_synonym="SCJ21.05"
FT   CDS_pept        103628..104989
FT                   /locus_tag="SCO0124"
FT                   /gene_family="HOG000253458" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.05"
FT                   /note="SCJ21.05, unknown, len: 453 aa; similar in part to
FT                   several polyketide synthases, e.g. HETM_ANASP polyketide
FT                   synthase HETM (506 aa), fasta scores; opt: 252 z-score:
FT                   267.0 E(): 1.6e-07, 33.7% identity in 199 aa overlap, and
FT                   TR:Q50858 (EMBL:U24657) saframycin MX1 synthetase A (2605
FT                   aa), fasta scores; opt: 244 z-score: 248.0 E(): 1.9e-06,
FT                   28.5% identity in 372 aa overlap. Contains TTA Leu codon;
FT                   possible target for regulation by bldA"
FT                   /db_xref="GI:21218684"
FT                   /db_xref="GeneID:1095548"
FT                   /translation="MRGAIADDDPRGTVDAVPLVSASGPPHRRCSASARPARRGTAPLT
FT                   ALGATLVHVALTGATGFLGLRLLRRLLDTHAWVTVLAHAGSGDALHRITRSLELMGAPS
FT                   AFLARLPERLRVVETDLALPRLGLSARAFRELADSLGAIWHSAGSIHLEGDLPELRRTN
FT                   VEGTRHVLELAAAGRAEPVVRHVSTAFVAGARRTGVAYEDELDDGAGFENAYEQSKYEA
FT                   ELLVHAWSREHGRPALVLRPSILVTDVPSHPELPSHPLQVVERILRDARRATVAAPPTA
FT                   TSSPNGAPDGSSRGAHGLPGPRARPRVRTVGHPHGRLNLLPVEHAADVMVRLSELPSSH
FT                   GVDTYHVVHDRDVPVPTVVALLERLVPLSIDLVDAKPEDPSALETMIDFYPGITAYLTH
FT                   RRRFDDTRVRTLLGPAAVCAPVGLDGLWSGLAPRSGALPRPPDSPPAPAPTPCA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624463.1"
FT   misc_feature    103856..104617
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCO0124"
FT                   /gene_synonym="SCJ21.05"
FT   misc_feature    103829..103831
FT                   /note="TTA Leu codon; possible target for regulation by
FT                   bldA"
FT                   /locus_tag="SCO0124"
FT                   /gene_synonym="SCJ21.05"
FT   RBS             105048..105051
FT   gene            105057..106640
FT                   /db_xref="GeneID:1095549"
FT                   /locus_tag="SCO0125"
FT                   /gene_synonym="SCJ21.06"
FT   CDS_pept        105057..106640
FT                   /locus_tag="SCO0125"
FT                   /gene_family="HOG000294495" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase"
FT                   /gene_synonym="SCJ21.06"
FT                   /note="SCJ21.06, possible oxidoreductase, len: 527 aa;
FT                   similar to hypothetical proteins associated with fatty acid
FT                   or polyketide biosynthesis e.g. TR:O33907 (EMBL:U73935)
FT                   hypothetical protein in eicosapentaenoic acid synthesis
FT                   gene cluster from Shewanella sp. (543 aa), fasta scores;
FT                   opt: 1474 z-score: 1595.4 E(): 0, 48.1% identity in 472 aa
FT                   overlap; and TR:Q44210 (EMBL:U04436) ORF in region required
FT                   for nitrogen fixation in Anabaena 7120 (442 aa), fasta
FT                   scores; opt: 1395 z-score: 1511.4 E(): 0, 47.7% identity in
FT                   440 aa overlap. Also shows some similarity to predicted
FT                   oxidoreductase from M. tuberculosis TR:O33323
FT                   oxidoreductase RV2781c (344 aa), fasta scores; opt: 161
FT                   z-score: 179.6 E(): 0.012, 26.7% identity in 277 aa
FT                   overlap"
FT                   /db_xref="GI:21218685"
FT                   /db_xref="GeneID:1095549"
FT                   /translation="MSVLAAPRALAARPPVFSPEGIAEIVRLIREPVHVVSGPGGRELG
FT                   LATGAPPAGPVLGTLPPLYPEWLGGRTFCEAHGVRFPYVAGEMANGIATTGMVAAMARA
FT                   EMIGFFGAGGLPLPEVERAVHSLAQELESRTNWGVNLIHSPAEPELEWRVAELLLRCGV
FT                   PRISVSAFMELTPAVVLCSAQGLRRGADGGVVRRTRLLAKLSRPEVAERFLSPAPPALL
FT                   DLLVARGSLTREEAALAALVPVAEDITVEADSGGHTDNRPLSVLLPRIAALRDTVCRRF
FT                   GYRRPVRLGAAGGLGTPDAVAAAFALGASYVVTGSVNQTAVEAGLSDEAKAMLCDADVA
FT                   DVAMAPSADMFELGVKLQVLSRGTMFARRAGRLYSAYRDHGSLEEIPPALRAAIERDVL
FT                   GAPFEEVWQRTRAFWEERDPAEAVRAEADPRHRMALVFRWYLGSSSRWAITGESTRRAD
FT                   YQIWCGPAMGAFNRWAAGTFLAEPPHRSVTQIALNLLEGAATLTRAHQLRTYGVPLPSE
FT                   AFTYTPRELA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624464.1"
FT   misc_feature    105258..106511
FT                   /note="2-Nitropropane dioxygenase (NPD)-like domain,
FT                   associated with the (acyl-carrier-protein)
FT                   S-malonyltransferase  FabD. NPD is part of the
FT                   nitroalkaneoxidizing enzyme family, that catalyzes
FT                   oxidative denitrification of nitroalkanes to their
FT                   corresponding...; Region: NPD_FabD; cd04742"
FT                   /db_xref="CDD:73404"
FT                   /locus_tag="SCO0125"
FT                   /gene_synonym="SCJ21.06"
FT   misc_feature    order(105315..105320,105480..105482,105561..105563,
FT                   105663..105665,105807..105809,105816..105821,
FT                   105930..105938,105993..106004)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73404"
FT                   /locus_tag="SCO0125"
FT                   /gene_synonym="SCJ21.06"
FT   misc_feature    order(105822..105827,106440..106442)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73404"
FT                   /locus_tag="SCO0125"
FT                   /gene_synonym="SCJ21.06"
FT   misc_feature    105825..105827
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73404"
FT                   /locus_tag="SCO0125"
FT                   /gene_synonym="SCJ21.06"
FT   gene            106637..112885
FT                   /db_xref="GeneID:1095550"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   CDS_pept        106637..112885
FT                   /locus_tag="SCO0126"
FT                   /gene_family="HOG000294462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta keto-acyl synthase"
FT                   /gene_synonym="SCJ21.07"
FT                   /note="SCJ21.07, probable multi-domain beta keto-acyl
FT                   synthase, len: 2082 aa; similar to proteins involved in
FT                   fatty acid or polyketide biosynthesis e.g. TR:O30776
FT                   (EMBL:) heterocyst glycolipid synthase HglE (1053 aa),
FT                   fasta scores; opt: 2382 z-score: 1897.1 E(): 0, 41.6%
FT                   identity in 1013 aa overlap, and TR:O54142 (EMBL:AL021530)
FT                   S. coelicolor polyketide synthase RedX (982 aa), fasta
FT                   scores; opt: 910 z-score: 728.5 E(): 0, 37.4% identity in
FT                   494 aa overlap. Contains 2x Pfam matches to entry PF00109
FT                   ketoacyl-synt, Beta-ketoacyl synthase, and Pfam match to
FT                   entry PF00550 pp-binding, Phosphopantetheine attachment
FT                   site"
FT                   /db_xref="GI:21218686"
FT                   /db_xref="GeneID:1095550"
FT                   /translation="MSGPAAAAPSAAARPRGETMSGSTPRQVPVAVVGVGALVPGATDA
FT                   AGYWRVVTGGRDLITEVPASRWRVEDHYDPDPAAPDKTYARRGAFLPEVDFDPMAYGVP
FT                   PANLPATDTSQLLALMVADQVLRDAGGTSGIDRDRTGVVLGAAALELLPHMYGRSQRPA
FT                   WLAGLRESGLDEAKAQAVCDRIAARFEPWRESTFPGLLGNVVAGRIANRFDLHGVNHTT
FT                   DAACASSLAALSTAVGELSLHRADLVISGGVDTGNDIGMFLCFSKTPALSPSGDCRPFA
FT                   EAADGTMLGEAVVMYALKRLSDAERDGDRIHAVIRGIGTSSDGRSTAIYAPLPEGQERA
FT                   LRRAYEEAGYPPETVELVEAHGTGTKAGDTAELAALNAVFGASGRPDGQWCAIGSVKSQ
FT                   IGHTKCAAGAAGLLKAVMALHHKVLPPTVKVERPNPAAAAPHGPFYVNTQARPWVRPAG
FT                   HPRRAAVSSFGFGGSNFHVTLEEYAPPTVPTPSSGTHAGTPARPAPKNTGRPALRHRTA
FT                   SSELVLFAAASPSALEERLPEDGRPLAALARESHAAFSPTARVRLAVVAADTDDLRGKY
FT                   AQALAHIRRRPEASFSAPSGIRYAYGEPAPGRIGFLFPGQGSQYVGMGAELAMLAPTAQ
FT                   AVWDRLGSIRFDGRPLHRAVFPPPAFTEEERAARAALLNATEWAQPALAVHALALLAVV
FT                   RELGLRPDCVAGHSFGELVALHCAGALDAESLVGLARRRGELMREAAATPGAMLAVAAD
FT                   RVRVAEVLAGGGFEDIWPANHNSPRQTVLSGSAAAVERARSAFSAAGIASRGLSASTAF
FT                   HSPLVAPAVEPLAAHLRTVTFSEPRIEVYGNTDAAPYPSCPDAVRRRVAGHLASPVLFQ
FT                   DQIEAMYAAGVRTFVEVGAGATLTGLVGQILGGREHAAVPLDRPAGAGADTFHAALGEL
FT                   AVRGVPLDLNPLWTPYASPVTPAKEREPRMTVKISGANYGQLPPSGTPHVEPTPAPDHG
FT                   PRPDAVPAVAAPVPAVALPSQAPGDVPLPPVYEPAAASSPQEFGPSHPAEAPADARPVI
FT                   GDDRQLAVESIHRQTAETHLACQRLLTDSHMAFLRMTETTLAALLGAPVPGAVPGMTAP
FT                   AALPLPRSVGPLDVPAAVAPPVAAPAPAAVVGAATPYPVPEASAPPASAAMRPSVSEPA
FT                   PPAQAPARDASAPDRSAPEPTPSELSSSELEELLLSVVADLTGYPTAMLHVDMDLEADL
FT                   GVDSIKRVEILSAVRRRVGDVAVGDAGRLGKLRTLREITAALASGARTAGPAPEPDVPV
FT                   VPAPRADAFEPSPAKARAAAPFSTTVDVPAVRGDGSEPSADEAGVDGWTPLTRLVPRMV
FT                   ESPVCGLATAGLLDGPVVVSGEDVAGCPVVGLVARKLAERGVDATAVAEVPEGARGVVH
FT                   LGGLSASGTPDEAREVHRSALRAARALAPRAAGGGGLFVTVQDTGGDFGLGGHAPGRAW
FT                   LGGTAGLARTAAKEWPDVRVRVLDCERGGRDDEEVADAIVSELLEGGADTEVGLRADGT
FT                   RALLRMVPGPLTPGGAPRIGENSVIVATGGARGVTAAALLDLARTHRPRIVLLGRTEAA
FT                   AEPAGLASATDERALTRLLAQRAGDAEESSPARIAEEARRILAAREVRATLAGLEAAGS
FT                   PARYVRVDVRDADALTAALREVRATWGPVTGIVHGAGVLADKRIADKTDEQAEPVMATK
FT                   VDGLRALLSATADDPLDTILLFSSVAAVFGNAGQSDYAMANEVLQQVASAEQARRPDCL
FT                   VRCVAWGPWQGGMVTPALAAHFGRAGVPLIPPAQGAAACTAELNGAAGQARVVLTAGDG
FT                   PTAADERLRAQVLVSSDTLPQLADHAPAGVPVLPVALVLNWFAGAAAAWLPAEGQLVLR
FT                   DLRVYRKYDLPELEGVGHRLTVLGNRGAPGSPAGVEAELRGEEGPAHFRAVVDTGDGAP
FT                   DPSRWDTPADLKPLDVSAPYDGGVLFHGPRFHALREVRGVSEHGAEATVAGLRSLGWPG
FT                   GRGPLDPAAVDGALQLALLWGEKVLGAATLPMAVAECRVYRRGPVDDAVRCVVRERKVH
FT                   DTGARCDAALIGPGGSVLLELTGVELVSRPS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624465.1"
FT   misc_feature    106763..108082
FT                   /note="Beta-ketoacyl synthase; Region: PKS_KS; smart00825"
FT                   /db_xref="CDD:129058"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    106766..108073
FT                   /note="polyketide synthases (PKSs) polymerize simple fatty
FT                   acids into a large variety of different products, called
FT                   polyketides, by successive decarboxylating Claisen
FT                   condensations. PKSs can be divided into 2 groups, modular
FT                   type I PKSs consisting of one or...; Region: PKS; cd00833"
FT                   /db_xref="CDD:29420"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    order(107312..107314,107717..107719,107840..107842)
FT                   /note="active site"
FT                   /db_xref="CDD:29420"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    108458..109339
FT                   /note="malonyl CoA-acyl carrier protein transacylase;
FT                   Region: fabD; TIGR00128"
FT                   /db_xref="CDD:161724"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    108473..109366
FT                   /note="Acyl transferase domain; Region: Acyl_transf_1;
FT                   cl08282"
FT                   /db_xref="CDD:186816"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    <110243..112735
FT                   /note="polyketide-type polyunsaturated fatty acid synthase
FT                   PfaA; Region: omega_3_PfaA; TIGR02813"
FT                   /db_xref="CDD:163029"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    <111521..111937
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    106724..108088
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, score 370.70, E-value 1.6e-107"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    108461..109447
FT                   /note="Pfam match to entry PF00698 Acyl_transf, Acyl
FT                   transferase domain, score 210.50, E-value 2.5e-59"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   misc_feature    110228..110437
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 20.50, E-value
FT                   0.00048"
FT                   /locus_tag="SCO0126"
FT                   /gene_synonym="SCJ21.07"
FT   gene            112932..119654
FT                   /db_xref="GeneID:1095551"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   CDS_pept        112932..119654
FT                   /locus_tag="SCO0127"
FT                   /gene_family="HOG000118926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta keto-acyl synthase"
FT                   /gene_synonym="SCJ21.08"
FT                   /note="SCJ21.08, probable multi-domain beta keto-acyl
FT                   synthase, len: 2240 aa; similar to proteins involved in
FT                   fatty acid or polyketide biosynthesis e.g. TR:Q44221
FT                   Anabaena sp. type 4 polyketide synthases HglD (fragment)
FT                   (448 aa), fasta scores; opt: 760 z-score: 639.3 E():
FT                   2.9e-28, 38.0% identity in 392 aa overlap; MCAS_MYCBO
FT                   mycocerosic acid synthase (2110 aa), fasta scores opt: 707
FT                   z-score: 586.8 E(): 2.5e-25, 35.4% identity in 560 aa
FT                   overlap; and TR:O54142 (EMBL:AL021530) S. coelicolor
FT                   polyketide synthase RedX (982 aa), opt: 658 z-score: 550.3
FT                   E(): 2.7e-23, 36.4% identity in 470 aa overlap. Contains
FT                   Pfam match to entry PF00109 ketoacyl-synt, Beta-ketoacyl
FT                   synthase, Pfam match to entry PF00698 Acyl_transf, Acyl
FT                   transferase domain, and 2x Pfam matches to entry PF01377
FT                   Thioester_dehyd, Thioester dehydrase"
FT                   /db_xref="GI:21218687"
FT                   /db_xref="GeneID:1095551"
FT                   /translation="MRFEPIAIVGRGCVLPGALDPDGFWENVAAGRTSLTAAPEGRWRL
FT                   PRHRVMGTVDDHLDRTWTDIGGYVEGFESVFDPEGFLLPPERIATLDPLFHWVLYGVRQ
FT                   ALTEAGRTTPLRRGGLILGNLSYPTPTGAAFAEHVWLSAQRPQLREALLTGGRHPRPDA
FT                   RNRFSSGLPALLAARALGLGAGAWSLDAACASSLYAIKLACDRLHDGTADLMVAGAASR
FT                   PDPLYLHVGFCGLSATSRTGRSRPFDRDADGLVHGEGAGFVALTRLSDARAAGLPVFGV
FT                   IRGVGLSNDGRGSGLISPSEEGQVRAMRLAYEVAGVAPESVSLVECHATGTPVGDAVEA
FT                   RGMARVFGASDDVPIGSAKSNIGHLLASAGVAGLLKVLGAMRAGVRPATLGARRPLDAL
FT                   SGTPLRVLDTAEQWAGPRRAAVSAFGFGGTNAHLLLDDPDDAPPPSVPRPAYGPRPTAR
FT                   RAAPADRAPQDPVPGPDAPDTPAAAADSGAPGDRTPGACAVPVAIVAIGARVGEGTSVE
FT                   DLRQAVLGGERRGPVAEIAVQLTGLCFPPLALERTVRHQLLVLEAAREAARTVNLPRER
FT                   TMVVIGTGVDPEVARAGARWRIPHWLEESGVPVTAASADLARDAFTPPMTAEGVVGSMP
FT                   NLAANRISTQLDLAGPSFTVSAEEASGLVALEAAARALRSGEVDAALVGATDLSCEAVH
FT                   RAAVRESAPGVEPGDAAVVLVLKLLDAARRDGDTVVAVLDEEAGGEPDMVIGDGPDAGF
FT                   DPASAFGRAHAASGLVSVAVAALSLQHRVVPRPDASADTTAVTHTARAVAVPVEGPAMS
FT                   VRLRAGDPRPWLPGPAPRLRVFSGADRAQVLAALEAGTESSAGPARLALVADGGTAWAE
FT                   RREAARRWLAEGGARPADVLYRDAPVGGETAFVYTNGSAAYPGMGHALTLACPSLGESV
FT                   RAGHRAIGTRLRSGRGPGVLDQIWSVAELAVFHTVFSREVLGLRPDAAIGYSSGESTAL
FT                   VALGAWPDASGLYEATRESGLFTTELTGELRAVRRYWRQRGIGGDRWSSYLVAAPLEAV
FT                   RAELAGERAVHLMAVNAPGVCVVGGESKACAAVVARLGVDRAIELDYDMAAHAPELAEV
FT                   REVWREAHRRPTVEVPGVRFYSGATGRAYRPTTERAAEALTAQGLGTIDFAATIERAWA
FT                   DGVRVFVEHGPRKLCTGWIKRVLGDREFVAVALDAPDDTGLRNLCLAVGELVVAGVPVR
FT                   ADALTARLEEAATGLPAPGPAVTVAVPLTPCLPPLEPAVTVLPRAPELAPVPAERPAPG
FT                   ERPGAPVAAGPAAAVGPVARLSDPASPAPGSPGVAGTVARQSRRAALVHEEIMAAHAEA
FT                   HRRFLHVSALAVTALTAGGRADAGRAAVSLPPGGVASVPASAALPVRPPCAPPVPVRPR
FT                   GPVPAPRPGTAPAAVPVPGAKPVFDRAQLEHLASGEISTLFGPRFAEQDRYAVQTRMPG
FT                   PPMLFADRVTAIDAVPAALVLPGPVRTDGRIWTETDVLTDSWYLDATGRMPAGVLIEAG
FT                   QADLLLLSWLGADLLNRGERAYRLLGCEVTFHGGPPRPGDTLCFEIHVDGHAEAGGVRL
FT                   AFFHYDCYVDGELRLSVREGQAGFFTPAELATSGGVRWDPAEHAPGDDLPFDPPAVRCE
FT                   RSHFGTDRVRALAQGSPAECFGQGWEATAAHVRTPLLDGERLRLLDEVTVFDPVGGPWG
FT                   RGYLRAETAVSPDDWFFTGHFKNDPCMPGTLMLQGGLQAMAFYLTASGHTVDRDGWRFE
FT                   PVDTQPSRTKCRGQATPESRRIVYELFVRGVSAGPVPTLHADVLGSVDGRKAFLGRGMA
FT                   LRLVPDWPLSQWRDSGPPAVQEDGAPVPPPRLGGLSGHREAKAVAVAADGFRFDYASLL
FT                   ACAWGRPSEAFGTMYEPFDGTRRVARLPGPPYHFMSRIVSVDGVQGGMREGSVVVAEYD
FT                   VPERAWYFEQNPSRCMPLAVLMEVALQPCGWLASYAGSATTSEQDLLFRNLDGVKTVTG
FT                   EVTAGTRTIRTRAELTRVSRSGDMIIESFRVVCTADDAPLAELTTVFGYFPRSAFDDQQ
FT                   GLPVPAEERARLDEPCNRVVDLTARPARYCAGEPRLPGRMLLMLDRVTGSWPEGGTAGL
FT                   GRLRSEKDVHPDAWFFRAHFFQDPVQPGSLGVEAMCQLLQYHLIEGGAADGIAHPRFEP
FT                   VLPGRETVWTYRGQITPANRLIRVDMDIVETGTDARGPYAVADATLWGDDTCIYRVRGL
FT                   GMRVVSGPPPVR"
FT                   /transl_table="11"
FT                   /protein_id="NP_624466.1"
FT   misc_feature    112941..114236
FT                   /note="polyketide synthases (PKSs) polymerize simple fatty
FT                   acids into a large variety of different products, called
FT                   polyketides, by successive decarboxylating Claisen
FT                   condensations. PKSs can be divided into 2 groups, modular
FT                   type I PKSs consisting of one or...; Region: PKS; cd00833"
FT                   /db_xref="CDD:29420"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    112947..114236
FT                   /note="Beta-ketoacyl synthase; Region: PKS_KS; smart00825"
FT                   /db_xref="CDD:129058"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(113508..113510,113913..113915,114021..114023)
FT                   /note="active site"
FT                   /db_xref="CDD:29420"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    114429..115001
FT                   /note="Beta-ketoacyl synthase, N-terminal domain; Region:
FT                   ketoacyl-synt; cl09934"
FT                   /db_xref="CDD:186875"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    <115590..116603
FT                   /note="Acyl transferase domain; Region: Acyl_transf_1;
FT                   cl08282"
FT                   /db_xref="CDD:186816"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    117987..118394
FT                   /note="FabA, beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase: Bacterial protein of the type II, fatty
FT                   acid synthase system that binds ACP and catalyzes both
FT                   dehydration and isomerization reactions, apparently in the
FT                   same active site. The FabA...; Region: FabA; cd01287"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(118101..118109,118230..118241)
FT                   /note="active site 2"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(118110..118112,118122..118124,118200..118226,
FT                   118230..118232,118236..118241)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(118122..118124,118131..118136,118143..118148,
FT                   118200..118211)
FT                   /note="active site 1"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    118533..>118757
FT                   /note="The hotdog fold was initially identified in the E.
FT                   coli FabA (beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase) structure and subsequently in 4HBT
FT                   (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
FT                   number of other seemingly unrelated...; Region: hot_dog;
FT                   cl00509"
FT                   /db_xref="CDD:186045"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    118626..119039
FT                   /note="The hotdog fold was initially identified in the E.
FT                   coli FabA (beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase) structure and subsequently in 4HBT
FT                   (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
FT                   number of other seemingly unrelated...; Region: hot_dog;
FT                   cl00509"
FT                   /db_xref="CDD:186045"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(118779..118784,118902..118910)
FT                   /note="active site 2"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(118797..118799,118806..118811,118818..118820,
FT                   118878..118886)
FT                   /note="active site 1"
FT                   /db_xref="CDD:48035"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    119184..119636
FT                   /note="FabA, beta-hydroxydecanoyl-acyl carrier protein
FT                   (ACP)-dehydratase: Bacterial protein of the type II, fatty
FT                   acid synthase system that binds ACP and catalyzes both
FT                   dehydration and isomerization reactions, apparently in the
FT                   same active site. The FabA...; Region: FabA; cd01287"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(119184..119192,119358..119360,119367..119372,
FT                   119379..119384,119436..119441,119445..119450)
FT                   /note="active site 1"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(119187..119189,119193..119195,119346..119348,
FT                   119358..119360,119436..119441,119445..119465,
FT                   119469..119471,119475..119480)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    order(119337..119345,119469..119480)
FT                   /note="active site 2"
FT                   /db_xref="CDD:48032"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    112947..114248
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, score 255.20, E-value 9.1e-73"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    115632..116603
FT                   /note="Pfam match to entry PF00698 Acyl_transf, Acyl
FT                   transferase domain, score -20.20, E-value 9.5e-09"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    117936..118361
FT                   /note="Pfam match to entry PF01377 Thioester_dehyd,
FT                   Thioester dehydrase, score 50.00, E-value 5.2e-11"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   misc_feature    119151..119531
FT                   /note="Pfam match to entry PF01377 Thioester_dehyd,
FT                   Thioester dehydrase, score 30.60, E-value 1.8e-07"
FT                   /locus_tag="SCO0127"
FT                   /gene_synonym="SCJ21.08"
FT   gene            119651..119833
FT                   /db_xref="GeneID:1095552"
FT                   /locus_tag="SCO0128"
FT                   /gene_synonym="SCJ21.09"
FT   CDS_pept        119651..119833
FT                   /locus_tag="SCO0128"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.09"
FT                   /note="SCJ21.09, unknown, len: 60 aa"
FT                   /db_xref="GI:21218688"
FT                   /db_xref="GeneID:1095552"
FT                   /translation="MICSALQREVGRQARTTAVLAAAVPVRAGQVAFPCPGGDAFWVRL
FT                   VDRRLAAMQAAGAEG"
FT                   /transl_table="11"
FT                   /protein_id="NP_624467.1"
FT   misc_feature    <119675..>119827
FT                   /note="This domain family includes the Enolpyruvate
FT                   transferase (EPT) family and the RNA 3' phosphate cyclase
FT                   family (RTPC). These 2 families differ in that EPT is
FT                   formed by 3 repeats of an alpha-beta structural domain
FT                   while  RTPC has 3 similar repeats with a...; Region:
FT                   EPT_RTPC-like; cl00288"
FT                   /db_xref="CDD:185884"
FT                   /locus_tag="SCO0128"
FT                   /gene_synonym="SCJ21.09"
FT   gene            119841..120215
FT                   /db_xref="GeneID:1095553"
FT                   /locus_tag="SCO0129"
FT                   /gene_synonym="SCJ21.10"
FT   CDS_pept        119841..120215
FT                   /locus_tag="SCO0129"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.10"
FT                   /note="SCJ21.10, unknown, len: 124 aa"
FT                   /db_xref="GI:21218689"
FT                   /db_xref="GeneID:1095553"
FT                   /translation="MAVQLSASDGGGRQECAGAPGCSVGCVEAAADGDRLGGGGEVDVG
FT                   FRQTYPRQSTGGCLPTVHMPGWERSRRPCSRWDGVSCHSWPQSGFRHRMSLGEPVWVDL
FT                   VPRSVSRDVLLYAEAVLPTV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624468.1"
FT   RBS             120446..120449
FT   gene            120457..121371
FT                   /db_xref="GeneID:1095554"
FT                   /locus_tag="SCO0130"
FT                   /gene_synonym="SCJ21.11"
FT   CDS_pept        120457..121371
FT                   /locus_tag="SCO0130"
FT                   /gene_family="HOG000267036" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-lactamase"
FT                   /gene_synonym="SCJ21.11"
FT                   /note="SCJ21.11, possible beta-lactamase, len; 304 aa; some
FT                   similarity to S. coelicolor TR:CAB39710 (EMBL:AL049485)
FT                   putative beta-lactamase SC6A5.26C (310 aa), fasta scores;
FT                   opt: 197 z-score: 236.5 E(): 8e-06, 28.1% identity in 295
FT                   aa overlap, and TR:O34760 (EMBL:AF008220) Bacillus subtilis
FT                   YtnP (256 aa), fasta scores; opt: 189 z-score: 228.5 E():
FT                   2.2e-05, 25.1% identity in 191 aa overlap and similar to
FT                   TR:Q9ALW1 (EMBL:AF338729) Plesiomonas sp. M6 methyl
FT                   parathion hydrolase Mpd, 331 aa; fasta scores: opt: 511
FT                   Z-score: 578.8 bits: 115.3 E(): 1.3e-24; 31.61% identity in
FT                   310 aa overlap"
FT                   /db_xref="GI:21218690"
FT                   /db_xref="GeneID:1095554"
FT                   /translation="MNQINAARPDAPARDEAVPSRYALKVGDIDVTVISDGVLAINPAT
FT                   LATNADKAELSAWLRDNFLPPEVIDYPLNVSVVRSGDRTILIDSGLGTEFPGFPRAGQL
FT                   AMRLDAAGIDPASVTDVVLTHLHMDHIGGLLVEGLRGRLRKDLRVHLAAAEAEFWQAPD
FT                   FSRTAMPAPVPETLVTTAARFLDVYRGQLRPFETEFEVAPGVRIERTGGHTPGHSIVRL
FT                   ESGGERLTFAGDAVFQCGFDQPGWYNGFEHDPEESARVRMALLKEMAASGEHLMASHLP
FT                   FPSVCHVATAGNAFRFVPTVWDY"
FT                   /transl_table="11"
FT                   /protein_id="NP_624469.1"
FT   misc_feature    120658..121272
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:186000"
FT                   /locus_tag="SCO0130"
FT                   /gene_synonym="SCJ21.11"
FT   gene            complement(121617..122456)
FT                   /db_xref="GeneID:1095555"
FT                   /locus_tag="SCO0131"
FT                   /gene_synonym="SCJ21.12c"
FT   CDS_pept        complement(121617..122456)
FT                   /locus_tag="SCO0131"
FT                   /gene_family="HOG000261041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /gene_synonym="SCJ21.12c"
FT                   /note="SCJ21.12c, probable secreted protein, len: 279 aa;
FT                   similar to hypothetical proteins e.g. YBHP_ECOLI (253 aa),
FT                   fasta scores; opt: 244 z-score: 290.0 E(): 8.4e-09, 29.5%
FT                   identity in 251 aa overlap. Also similar to S. coelicolor
FT                   TR:Q9ZBN3 (EMBL:AL034492) SC6C5.12C (276 aa), fasta scores;
FT                   opt: 474 z-score: 555.0 E(): 1.5e-23, 41.0% identity in 278
FT                   aa overlap"
FT                   /db_xref="GI:21218691"
FT                   /db_xref="GeneID:1095555"
FT                   /translation="MFRRTLPVLAAAVGLAAAAAGPATADDVPADRLPGHRVLDVMTFN
FT                   IHHAQGTDDVLDLRRVANVIRKSGADVVGLQEVDKHYSARSDWADQPAELAELLGYHVV
FT                   FGANIDNSPPAPGGHRVQYGTAILSRYPITASDNTWLYKSPGQEQRGLLHATLDVHGKK
FT                   VEFYNTHLAAGSQADRLQQTAQVVDLIGTRKPGILVGDFNALPAAPESRPLQNAYTDAW
FT                   AKSLHARGDGATYPAQSPTERIDLIYATRRVTPLVAQVLKDDPAASDHRPLLGKVLV"
FT                   /transl_table="11"
FT                   /protein_id="NP_624470.1"
FT   misc_feature    complement(121635..122342)
FT                   /note="Endonuclease/Exonuclease/phosphatase family; Region:
FT                   Exo_endo_phos; cl00490"
FT                   /db_xref="CDD:186031"
FT                   /locus_tag="SCO0131"
FT                   /gene_synonym="SCJ21.12c"
FT   RBS             complement(122463..122468)
FT   gene            122743..125502
FT                   /db_xref="GeneID:1095556"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   CDS_pept        122743..125502
FT                   /locus_tag="SCO0132"
FT                   /gene_family="HOG000074072" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /gene_synonym="SCJ21.13"
FT                   /note="SCJ21.13, probable transcriptional regulator, len:
FT                   919 aa; similar to many e.g. TR:AAD28307 (EMBL:U95170)
FT                   Rhodococcus erythropolis ThcG (927 aa), fasta scores; opt:
FT                   1176 z-score: 1258.4 E(): 0, 34.2% identity in 933 aa
FT                   overlap, and TR:AAA53487 (EMBL:U03114) Streptomyces albus
FT                   LipR (890 aa), fasta scores; opt: 740 z-score: 791.4 E():
FT                   0, 31.1% identity in 952 aa overlap. Contains PS00017
FT                   ATP/GTP-binding site motif A (P-loop), Pfam match to entry
FT                   PF00196 GerE, Bacterial regulatory proteins, luxR family,
FT                   and probable helix-turn-helix motif at aa 871-892 (Score
FT                   1389, +3.92 SD)"
FT                   /db_xref="GI:21218692"
FT                   /db_xref="GeneID:1095556"
FT                   /translation="MVRKLRLRGRLGECDALDRLTGTVMSERSAVLVVRGEPGIGKSAL
FT                   LDHYAERISRHRVVRVAGVESEMELPFAGLHQLCAPFLGHLDRLPDPQSEALATAFGLS
FT                   SGPPPDRFLVGLAVLSLLSDAANEDPLFCLVDDAQWFDEVSAQTLGFVARRLLAEPVAL
FT                   VLATREPPGQAPLAGLPELVLKGLEDAEARALLDGALRGELDDRIRDRILDEARGNPLA
FT                   LLELPRGLTATETAESFGPPAPAPTADRIEQSFLRQVSSLPVATRRLLLVAAAEPIGDA
FT                   VLLRRAARQLGIEPGATAPAEEAGMIDIGALVRFRHPLLRSAVYRSAGLLERQETHRAL
FT                   ADVTDRALDPDRRAWHLAWATLAPDEAVAAELQTSAVRAQSRGGVAAAATLLAYAATLT
FT                   PEPRVRAARAVAAASAKLRAGAPDAARKLLTMAEGGPLSEFDQARAHLLRAQIAFASSR
FT                   VSQTAPLLSAARGLVPLDAALARETFLDAISAAMFAGRLSADADVGAVARAAREALPET
FT                   EGPRTADLLLRTLAVRFGTGYRDALPLAKRAVGRLLVEPDAGEVLRWSWLTSAVAADMW
FT                   DDEGWAALAARHVRTARATGALSELPLALNSQVLVDLFAGALDAASLLTAEIPTVLEAA
FT                   GGDLAPYGALTLAALKGDGPHAEQLIRSSLEDSAARGEGIGVGIAQWARAVLCNGAGKY
FT                   ERARQAADQAAAHTKDLAAVNWGLCELVEAAVRSGDRDTAVDALDRLDEATGGAGTDWA
FT                   LGVQARARALLGTGTAAETLYREAIERLARTRVRTELARAHLVYGEWLRRENRREDARA
FT                   QLRTAHAMFTGFGAGAFAQRSGRELHALGERTVGRPAAAPTALTAQETQIAHLARDGLT
FT                   NAEIGAELFISPHTVEWHLRKVFAKLGITSRRQLRSSLGDRPLAPAPA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624471.1"
FT   misc_feature    122761..>123210
FT                   /note="Predicted ATPase [General function prediction only];
FT                   Region: COG3899"
FT                   /db_xref="CDD:33687"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    122791..>122940
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    order(122848..122853,122863..122871)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    order(122851..122853,122863..122871,122920..122922,
FT                   122926..122931)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    <125143..125469
FT                   /note="RNA polymerase sigma-70 factor, Bacteroides
FT                   expansion family 1; Region: Sig70_bacteroi1; TIGR02985"
FT                   /db_xref="CDD:132030"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    125305..125457
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    order(125308..125316,125353..125361,125383..125388,
FT                   125392..125397,125401..125415,125446..125448)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    order(125341..125343,125347..125349,125353..125355,
FT                   125446..125454)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    122848..122871
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   misc_feature    125296..125493
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 59.20, E-value
FT                   8.8e-14"
FT                   /locus_tag="SCO0132"
FT                   /gene_synonym="SCJ21.13"
FT   gene            complement(125625..126005)
FT                   /db_xref="GeneID:1095557"
FT                   /locus_tag="SCO0133"
FT                   /gene_synonym="SCJ21.14c"
FT   CDS_pept        complement(125625..126005)
FT                   /locus_tag="SCO0133"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.14c"
FT                   /note="SCJ21.14c, unknown, len: 126 aa"
FT                   /db_xref="GI:21218693"
FT                   /db_xref="GeneID:1095557"
FT                   /translation="MLLEMDPPGLETIPGAELADRTRPMDDGARQTVNGPSTGSRADGA
FT                   QSVTWLIGVPFRAQGSRLVWMYYVVDGAGDDLHAVQTAMERAYTAEERRARGDAGAATE
FT                   PLKIQRILRDAIGRVTLNACQS"
FT                   /transl_table="11"
FT                   /protein_id="NP_624472.1"
FT   RBS             complement(126014..126017)
FT   gene            complement(126989..127294)
FT                   /db_xref="GeneID:1095558"
FT                   /locus_tag="SCO0134"
FT                   /gene_synonym="SCJ21.15c"
FT   CDS_pept        complement(126989..127294)
FT                   /locus_tag="SCO0134"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.15c"
FT                   /note="SCJ21.15c, unknown, len: 101 aa"
FT                   /db_xref="GI:21218694"
FT                   /db_xref="GeneID:1095558"
FT                   /translation="MALRATVRGRAPRPEARGGSITPGPGWQHVGGPFLSRAHCLTALA
FT                   AYRAHDPGREYRYGTDGAGSWNVYLEALPTYGPDGTGTSSAGRGRPALRIVRPDEH"
FT                   /transl_table="11"
FT                   /protein_id="NP_624473.1"
FT   gene            127571..128290
FT                   /db_xref="GeneID:1095559"
FT                   /locus_tag="SCO0135"
FT                   /gene_synonym="SCJ21.16"
FT   CDS_pept        127571..128290
FT                   /locus_tag="SCO0135"
FT                   /gene_family="HOG000133451" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /gene_synonym="SCJ21.16"
FT                   /note="SCJ21.16, unknown, len: 239 aa; similar to two
FT                   hypothetical proteins from S. coelicolor TR:O86620
FT                   (EMBL:AL031155) SC3A7.19 (232 aa), fasta scores; opt: 188
FT                   z-score: 222.0 E(): 5.1e-05, 33.6% identity in 238 aa
FT                   overlap, and TR:Q9ZBN4 (EMBL:AL034492) SC6C5.11 (327 aa),
FT                   fasta scores; opt: 149 z-score: 176.2 E(): 0.018, 30.0%
FT                   identity in 203 aa overlapand to TR:Q988L9 (EMBL:AP003009)
FT                   Rhizobium loti MLR6684 protein, 259 aa; fasta scores: opt:
FT                   764 Z-score: 831.4 E(): 1.1e-38; 51.883% identity in 239 aa
FT                   overlap"
FT                   /db_xref="GI:21218695"
FT                   /db_xref="GeneID:1095559"
FT                   /translation="MTSGKPTVVLVHGAFADSSSWNGVVERLQSHDYRVVSASNPLRGL
FT                   TSDAAHVRELVAAIDGPVVLAGHSYGGSVMSVAAKGLGNVRALVFAAAFLPEVGESAIA
FT                   LSGKFPGSTLADVLRPVPVTLLDGSQAADLYIEQSAFHQQFAADVPAETTAVMAAIQRP
FT                   VTDAALGEGASAAAWKDIPSWVLVATEDRNIPAQTQLFMAERADATVMSLTSSHAVSVS
FT                   RPGDVARLVNEAAQATA"
FT                   /transl_table="11"
FT                   /protein_id="NP_624474.1"
FT   misc_feature    127577..128281
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="SCO0135"
FT                   /gene_synonym="SCJ21.16"
FT   misc_feature    127703..128269
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:187168"
FT                   /locus_tag="SCO0135"
FT                   /gene_synonym="SCJ21.16"
FT   gene            complement(128634..130184)
FT                   /db_xref="GeneID:1095560"
FT                   /locus_tag="SCO0136"