(data stored in SCRATCH zone)

HOGENOMDNA: STCOE1_2

ID   STCOE1_2; SV 1; empty ; DNA; empty ; PRO; 356023 BP.
XX
AC   NC_003903;
XX
PR   Project: 57801;
XX
DE   Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence.
XX
OS   Streptomyces coelicolor A3(2)
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Streptomycineae; Streptomycetaceae; Streptomyces.
XX
RN   [1]
RP   1-356023
RX   PUBMED; 19054329.
RA   O'Rourke,S., Wietzorrek,A., Fowler,K., Corre,C., Challis,G.L. and
RA   Chater,K.F.;
RT   "Extracellular signalling, translational control, two repressors and an
RT   activator all contribute to the regulation of methylenomycin production in
RT   Streptomyces coelicolor";
RL   Mol. Microbiol. 71 (3), 763-778 (2009)
XX
RN   [2]
RP   1-356023
RX   PUBMED; 18988741.
RA   Corre,C., Song,L., O'Rourke,S., Chater,K.F. and Challis,G.L.;
RT   "2-Alkyl-4-hydroxymethylfuran-3-carboxylic acids, antibiotic production
RT   inducers discovered by Streptomyces coelicolor genome mining";
RL   Proc. Natl. Acad. Sci. U.S.A. 105 (45), 17510-17515 (2008)
XX
RN   [3]
RP   1-356023
RX   PUBMED; 12000953.
RA   Bentley,S.D., Chater,K.F., Cerdeno-Tarraga,A.M., Challis,G.L.,
RA   Thomson,N.R., James,K.D., Harris,D.E., Quail,M.A., Kieser,H., Harper,D.,
RA   Bateman,A., Brown,S., Chandra,G., Chen,C.W., Collins,M., Cronin,A.,
RA   Fraser,A., Goble,A., Hidalgo,J., Hornsby,T., Howarth,S., Huang,C.H.,
RA   Kieser,T., Larke,L., Murphy,L., Oliver,K., O'Neil,S., Rabbinowitsch,E.,
RA   Rajandream,M.A., Rutherford,K., Rutter,S., Seeger,K., Saunders,D.,
RA   Sharp,S., Squares,R., Squares,S., Taylor,K., Warren,T., Wietzorrek,A.,
RA   Woodward,J., Barrell,B.G., Parkhill,J. and Hopwood,D.A.;
RT   "Complete genome sequence of the model actinomycete Streptomyces
RT   coelicolor A3(2)";
RL   Nature 417 (6885), 141-147 (2002)
XX
RN   [4]
RP   1-356023
RX   PUBMED; 9573173.
RA   Redenbach,M., Ikeda,K., Yamasaki,M. and Kinashi,H.;
RT   "Cloning and physical mapping of the EcoRI fragments of the giant linear
RT   plasmid SCP1";
RL   J. Bacteriol. 180 (10), 2796-2799 (1998)
XX
RN   [5]
RP   1-356023
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-SEP-2004) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [6]
RP   1-356023
RA   Bentley,S.D., Parkhill,J., Barrell,B.G. and Rajandream,M.A.;
RT   "Direct Submission";
RL   Submitted (20-FEB-2001) Streptomyces coelicolor sequencing project, Sanger
RL   Centre, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA E-mail:
RL   barrell@sanger.ac.uk Plasmid supplied by Prof. David A. Hopwood, [3] John
RL   Innes Centre, Norwich Research Park, Colney, Norwich, Norfolk NR4 7UH, UK
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AL589148.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..356023
FT                   /strain="A3(2)"
FT                   /mol_type="genomic DNA"
FT                   /organism="Streptomyces coelicolor A3(2)"
FT                   /plasmid="SCP1"
FT                   /db_xref="taxon:100226"
FT   misc_feature    1..75122
FT                   /note="Terminal inverted repeat.; label: TIR-L"
FT   misc_feature    1..342
FT                   /note="Previously sequenced as EMBL:S70700 [Left end of
FT                   SCP1]; label: S70700"
FT   gene            complement(899..1522)
FT                   /db_xref="GeneID:1095080"
FT                   /locus_tag="SCP1.01c"
FT   CDS_pept        complement(899..1522)
FT                   /locus_tag="SCP1.01c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 207aa"
FT                   /db_xref="GI:21234000"
FT                   /db_xref="GeneID:1095080"
FT                   /translation="MTDRLEWAHVSSPAELLYPGRDIDGAVVEPGEIAVAMWTGSNGIA
FT                   VHGPREEVRNRFLQLAAAVDSAPPVRTEGGCIAEHSDPPHGQLAQANPEPGTEYVFVLS
FT                   DYAHAAARALGRGWCGESGFLGAWGLVFCLEEPDTSPLEGRSVRLFVDAEGDLCVGLHD
FT                   DVVPSSEWHYIPTEDLPDFAPRSPEELTAWGEVIASAIRRHYLT"
FT                   /protein_id="NP_639577.1"
FT   RBS             complement(1528..1533)
FT   gene            complement(1607..2812)
FT                   /db_xref="GeneID:1095081"
FT                   /locus_tag="SCP1.02c"
FT   CDS_pept        complement(1607..2812)
FT                   /locus_tag="SCP1.02c"
FT                   /gene_family="HOG000109681" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 401aa"
FT                   /db_xref="GI:21234001"
FT                   /db_xref="GeneID:1095081"
FT                   /translation="MTTTDVNTAFADEKARQIDAARNRERMFQDRIDRGEIRLLGGDRY
FT                   EVLTGWDRGETFTVSRNAQGQIDAILANHGLDQRADGTIALYASSPAWHGLGQIIPGGV
FT                   TDIDTVLREGGLDFTVTTVPALYQWDGALREHPDQFHTVREDTGAALGAVGRRYQPIQN
FT                   RQGFEFLQELVGRFDVVWESAGVIRGGRRVFISIRLPQTVTVDAEGINDTVVPYVAVMN
FT                   DHSGQGQFQCVVTPWRPVCANTERLAVRDAVTRWAVRHTAGATNQIKEARRTLGLSVQY
FT                   FDQFASEETALARTDISLHDFHKTIADLWPLDEDASKRTRTNHAARVSALDEVFATETE
FT                   RVGRTAYAAERAITGYLDHVAPRRPGQSMTQEIVRATAALEGSDDDMKSKAHRRLMLLT
FT                   RA"
FT                   /protein_id="NP_639578.1"
FT   misc_feature    complement(1622..2569)
FT                   /note="Domain of unknown function (DUF932); Region: DUF932;
FT                   cl12129"
FT                   /db_xref="CDD:164334"
FT                   /locus_tag="SCP1.02c"
FT   RBS             complement(2818..2824)
FT   gene            complement(2903..3121)
FT                   /db_xref="GeneID:1095082"
FT                   /locus_tag="SCP1.03c"
FT   CDS_pept        complement(2903..3121)
FT                   /locus_tag="SCP1.03c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 72aa"
FT                   /db_xref="GI:21234002"
FT                   /db_xref="GeneID:1095082"
FT                   /translation="MFLVTTDTKLGAVVVAPECADDLDDETQAVIEAAAFTWRSDIEAF
FT                   TQPGQNRQAASRIALRLVQLGHDVLAV"
FT                   /protein_id="NP_639579.1"
FT   gene            complement(3109..3345)
FT                   /db_xref="GeneID:1095083"
FT                   /locus_tag="SCP1.04c"
FT   CDS_pept        complement(3109..3345)
FT                   /locus_tag="SCP1.04c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 78aa"
FT                   /db_xref="GI:21234003"
FT                   /db_xref="GeneID:1095083"
FT                   /translation="MRNGAVQTFTVIGLRSDVDMRDLFIAGVIPGPLSDEVVILDTSEE
FT                   EFTRWAMEFDATDADSAAEQAYAHCQEEDPCSW"
FT                   /protein_id="NP_639580.1"
FT   RBS             complement(3126..3131)
FT                   /locus_tag="SCP1.04c"
FT   RBS             complement(3354..3358)
FT   gene            complement(3424..3819)
FT                   /db_xref="GeneID:1095084"
FT                   /locus_tag="SCP1.05c"
FT   CDS_pept        complement(3424..3819)
FT                   /locus_tag="SCP1.05c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 131aa"
FT                   /db_xref="GI:21234004"
FT                   /db_xref="GeneID:1095084"
FT                   /translation="MPPITIASSDDHRFALIIQPTGAFRLLAWLPVSTPHHALCCDTAR
FT                   PVDLTTTLTLWIDQDAAAYGEKPNRAAHGLIQLYRPAPLPYVGNVVLTGTPDSDGTAAG
FT                   LSRPQALALIDLYLDTATVGLMPRPRS"
FT                   /protein_id="NP_639581.1"
FT   RBS             complement(3827..3831)
FT   stem_loop       3974..4234
FT                   /note="Inverted repeat spanning a region of non-coding DNA.
FT                   Score 52: 24/29 ( 82%) matches, 0 gaps."
FT   gene            complement(4408..4632)
FT                   /db_xref="GeneID:1095085"
FT                   /locus_tag="SCP1.06c"
FT   CDS_pept        complement(4408..4632)
FT                   /locus_tag="SCP1.06c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 74aa"
FT                   /db_xref="GI:21234005"
FT                   /db_xref="GeneID:1095085"
FT                   /translation="MNSYLVRWDIDLDASDPVDAARKALAIQRDPWSWATVFTVHGQHQ
FT                   GAPQVATVDLDPEGLDPSGSGAPRVELAG"
FT                   /protein_id="NP_639582.1"
FT   gene            complement(4629..4922)
FT                   /db_xref="GeneID:1095086"
FT                   /locus_tag="SCP1.07c"
FT   CDS_pept        complement(4629..4922)
FT                   /locus_tag="SCP1.07c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 97aa"
FT                   /db_xref="GI:21234006"
FT                   /db_xref="GeneID:1095086"
FT                   /translation="MSACQSAAPRPAPPDDPVQRLAAYDQLAVSARDFLDRFHSKINGY
FT                   RLPAEEGENPEDTDIDPAQYEAYDECRADYGEMAMHLMEAVAGHAPKERTGT"
FT                   /protein_id="NP_639583.1"
FT   RBS             complement(4641..4644)
FT                   /locus_tag="SCP1.07c"
FT   gene            complement(4919..5440)
FT                   /db_xref="GeneID:1095087"
FT                   /locus_tag="SCP1.08c"
FT   CDS_pept        complement(4919..5440)
FT                   /locus_tag="SCP1.08c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 173aa"
FT                   /db_xref="GI:21234007"
FT                   /db_xref="GeneID:1095087"
FT                   /translation="MSALCNHTRADYHHDGEICMYARDLSPGDKLSVLRGSAQAVVREA
FT                   DPAEEDGWMSVLLDVSGDGPTLISSHTVLSVRRPEPDPQPDITGDQDDGPLTTVTVDLT
FT                   VTETVTYDFQSEIELPADVVDDENELHSYLDEREELWLDDLDPTGKNGALCITERTLDE
FT                   ARVAGDGGKS"
FT                   /protein_id="NP_639584.1"
FT   RBS             complement(4929..4935)
FT                   /locus_tag="SCP1.08c"
FT   gene            complement(5516..6181)
FT                   /db_xref="GeneID:1095088"
FT                   /locus_tag="SCP1.09c"
FT   CDS_pept        complement(5516..6181)
FT                   /locus_tag="SCP1.09c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 221aa"
FT                   /db_xref="GI:21234008"
FT                   /db_xref="GeneID:1095088"
FT                   /translation="MAFDNPYEISVFTTLHPDGEVAHSVGEPTRTTLLSELPTLAGAAP
FT                   YTTLLLADGIELHRQPASTDADNPIATTLAARYGYEGFTLRGTVYITGDSGESDTATGM
FT                   ELDPFDALYRALHEAADTAGVRLYRKIGPEDTVTVAYDDYVPGDVFWFLGTSHRVLRFE
FT                   DMDPQSVTAQENPGARVMVCDDEFKITALPGSIFPERADRAPAGFWQRTGHQLLPASR"
FT                   /protein_id="NP_639585.1"
FT   RBS             complement(6187..6192)
FT   stem_loop       6318..6590
FT                   /note="Inverted repeat spanning a region of non-coding DNA.
FT                   Score 96: 36/39 ( 92%) matches, 0 gaps."
FT   RBS             6765..6772
FT   gene            6777..7271
FT                   /db_xref="GeneID:1095089"
FT                   /locus_tag="SCP1.10"
FT   CDS_pept        6777..7271
FT                   /locus_tag="SCP1.10"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, contains TTA encoded leucine at residue 33,
FT                   possible target for bldA regulation. len: 164aa"
FT                   /db_xref="GI:21234009"
FT                   /db_xref="GeneID:1095089"
FT                   /translation="MADVEERDAARALAAQARNVAWAADGTPWQRFLRAISGGRWGRQP
FT                   TGWTVIRLDAPWQDTPSSERPGWRERAANLAGDVAFAVDYTVCTACRLGWVEWPYTMEK
FT                   YQRCGLATAGLEALRLEHPGLSWHTLGGHFQDSRPFWAAAGAGVPGSYQQRETCPHLPE
FT                   G"
FT                   /protein_id="NP_639586.1"
FT   misc_feature    6873..6875
FT                   /note="tta leucine codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCP1.10"
FT   gene            complement(7395..8138)
FT                   /db_xref="GeneID:1095090"
FT                   /locus_tag="SCP1.11c"
FT   CDS_pept        complement(7395..8138)
FT                   /locus_tag="SCP1.11c"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 247aa"
FT                   /db_xref="GI:21234010"
FT                   /db_xref="GeneID:1095090"
FT                   /translation="MIPSGFSLKGGVSPIRQHDRRERHAALEVAMRKPHDPHEQTLPAH
FT                   LVAIVDAAIRRRAGKEPCAPDDLGIRDQRYARRPLDGSAGYHLWSPTHGLGFCNRHARR
FT                   RGFLPYWRDEELGPPMAAVHVPPEQRCGGWVAPRYLPRPWIGPLPERWPEERIPIWYAW
FT                   WRLHDIQDGTCATCSAPAYAIDHDHHTGLVRGLLCVSCNKREGTCRRRAQEGTHPGRPC
FT                   FQPYWDDPPAAPLRWMHGKSSLSAA"
FT                   /protein_id="NP_639587.1"
FT   misc_feature    complement(7512..7679)
FT                   /note="Recombination endonuclease VII; Region:
FT                   Endonuclease_7; pfam02945"
FT                   /db_xref="CDD:111794"
FT                   /locus_tag="SCP1.11c"
FT   gene            complement(8135..8590)
FT                   /db_xref="GeneID:1095091"
FT                   /locus_tag="SCP1.12c"
FT   CDS_pept        complement(8135..8590)
FT                   /locus_tag="SCP1.12c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="doubtful CDS, unknown, len: 151aa"
FT                   /db_xref="GI:21234011"
FT                   /db_xref="GeneID:1095091"
FT                   /translation="MMRPMRDDTVRDQIRFLRDCLDGEEALALVAGDGWPEPTGEVVSA
FT                   LRAGGFTDEQIRTIFTWGPGRAAVYADLLQRILDQLATLSSVRRPAHKEAVRRGIHSLL
FT                   YLYRNAPGWEPKWGPDFPYARLSRVTRERAVELLADREQRAAGGAVG"
FT                   /protein_id="NP_639588.1"
FT   RBS             complement(8148..8153)
FT                   /locus_tag="SCP1.12c"
FT   gene            complement(8633..10249)
FT                   /db_xref="GeneID:1095092"
FT                   /locus_tag="SCP1.13c"
FT   CDS_pept        complement(8633..10249)
FT                   /locus_tag="SCP1.13c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="conserved hypothetical protein, len: 538aa;
FT                   C-terminal similar to TR:Q9KXL1 (EMBL:AL357524)
FT                   hypothetical protein from Streptomyces coelicolor (282 aa)
FT                   fasta scores; opt:  682, z-score: 810.6, E(): 0, 51.1%
FT                   identity in 235 aa overlap. Contains TTA encoded leucine at
FT                   residue 154, possible target for bldA regulation."
FT                   /db_xref="GI:21234012"
FT                   /db_xref="GeneID:1095092"
FT                   /translation="MPKRGSWSWIGSSQAVRRDNRDVTKHRFLVARQIGAEPFSYTRTC
FT                   LDTSLVERLRNTSLDDMTDLDAAYELTRLAMVDLEAFGTGGGETLDDQEIAVLLRTLPA
FT                   VLKRLGVALKLPFRDFKSFKSYWKDQGMSDSYAARRSYVNSVFGPALDQLDEYHPHLRQ
FT                   SRDQTRRITDVTRRRLRDGLAGAWWGGTLDEVQFLSRLYDLDNLPSHDSRFANAARDIW
FT                   QHCINNPADWEDDWIWHDERFGLADGDEALLRFLAEMLHPAARTDTAEVERLHAFFNET
FT                   LAHDGYELIEVDSISGAPVFAARTIGAGVPGVMKNLIFAADGPKPEFVLGDAINNDVLI
FT                   VKNEQFCLVYSQPLSASGLTWGEMISWWRARESLPADMPDNEVGRALYKRLWTSLHSDP
FT                   ERPKWLSPEQRVFRTYCELYPISETGASHPALLPQVYLHMDPKTRKERGNKDTALGRER
FT                   MDFLLLLPHGVRVVVEVDGKHHYAEGDEASPRLYAKMVAEDRALRLKGYEVYRFGGYEL
FT                   GLNSAPAMLRRFFAELLGSQP"
FT                   /protein_id="NP_639589.1"
FT   misc_feature    complement(9788..9790)
FT                   /note="tta leucine codon, possible target for bldA
FT                   regulation."
FT                   /locus_tag="SCP1.13c"
FT   gene            complement(10282..11430)
FT                   /db_xref="GeneID:1095093"
FT                   /locus_tag="SCP1.14c"
FT   CDS_pept        complement(10282..11430)
FT                   /locus_tag="SCP1.14c"
FT                   /gene_family="HOG000053259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 382aa"
FT                   /db_xref="GI:21234013"
FT                   /db_xref="GeneID:1095093"
FT                   /translation="MADQQLIDHAARHDLAITAKQLAGWRRAGLLPGNIPGGGLGQGRG
FT                   SASTPPPESFDLVVALGRMSGRGKRPTDLALLLFAEGLPVPEATVRAAFRAAVDTATLP
FT                   DEGDGEDDGLDLDERLDRLSHQLPDSGQTVTLVPARARRIDERIARILGKLPAELVELD
FT                   HNAEPPRLTPQDATLTAVTATLGGSVPLQDIGALLRAMSPGLPANPFASLVETTQEDVP
FT                   EAAARIIADDGSLTFIPDGDARDLLRALADTASLEDLAAGWHTAAQVREWALDLCQRVE
FT                   RELDAGQLGEAVEEWLHGRLLPSGVSVTETLRDRRWAPSKGAFSALMLLFQCQMFVLLD
FT                   GLEPGCQWHVLQIPRVLPPPVRDLILSKAVGPETAAAGEGTS"
FT                   /protein_id="NP_639590.1"
FT   RBS             11674..11678
FT   gene            11690..11914
FT                   /db_xref="GeneID:1095094"
FT                   /locus_tag="SCP1.15"
FT   CDS_pept        11690..11914
FT                   /locus_tag="SCP1.15"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="possible membrane protein, len: 74aa; contains
FT                   possible membrane-spanning hydrophobic regions."
FT                   /db_xref="GI:21234014"
FT                   /db_xref="GeneID:1095094"
FT                   /translation="MTTDTDDSRPQDRDHQDLRLVVLLLALVVGLLITGAAVYLTREHP
FT                   SLAQPLGVGAAVISALAAIAGIVARVIRR"
FT                   /protein_id="NP_639591.1"
FT   gene            complement(12362..12946)
FT                   /db_xref="GeneID:1095095"
FT                   /locus_tag="SCP1.16c"
FT   CDS_pept        complement(12362..12946)
FT                   /locus_tag="SCP1.16c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 194aa"
FT                   /db_xref="GI:21234015"
FT                   /db_xref="GeneID:1095095"
FT                   /translation="MQRSTATLKRDVANKLLRQIAAELGLDEQAVILNCMGIRAAESPA
FT                   RSKKQRLAIDMRTSANSRMVLTWHPIFEVTDREVWQEIATHGLEYHPVYDALIPRLSCV
FT                   FCVLAPFDVLVRAARLCWALGLPLPARYRDLEAKIGHRFKQSHSLAQVYAEAERLEREE
FT                   GPLVWNRGDAVRQHLGAGAADDYLARVALAA"
FT                   /protein_id="NP_639592.1"
FT   misc_feature    complement(12662..>12871)
FT                   /note="Adenine nucleotide alpha hydrolases superfamily
FT                   including N type ATP PPases, ATP sulphurylases Universal
FT                   Stress Response protein and electron transfer flavoprotein
FT                   (ETF). The domain forms a apha/beta/apha fold which  binds
FT                   to Adenosine nucleotide; Region: AANH_like; cl00292"
FT                   /db_xref="CDD:185887"
FT                   /locus_tag="SCP1.16c"
FT   RBS             13078..13085
FT   gene            13089..13907
FT                   /db_xref="GeneID:1095096"
FT                   /locus_tag="SCP1.17"
FT   CDS_pept        13089..13907
FT                   /locus_tag="SCP1.17"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 272aa"
FT                   /db_xref="GI:21234016"
FT                   /db_xref="GeneID:1095096"
FT                   /translation="MRTSGRGGEGQKYALTSDEDDSDFWGFAQEVEGLFTPLPDEDGAR
FT                   RVHLAGCLPQGGLLRCVDHVGTRRAVAGNAWFELLDGDGATMGSYFVNEVTVIDVKPSA
FT                   SGAGLVDLTVTLWCENALPGAERPWELVRTGRLNHTGMWHELAPEDRHAWLSVALWSRE
FT                   YQRQAKPDAPAGQVFTLDGRHIVDRDTFYCAIGEAINGPGGYFGWNLDALDDCLRGGWG
FT                   ATTPFTLHWDFSAEARTRLAEHVPAGDRELVLFDLLLEIFEERGVSVILR"
FT                   /protein_id="NP_639593.1"
FT   misc_feature    13620..13880
FT                   /note="Barstar_SaI14_like contains sequences that are
FT                   similar to SaI14, an RNAase inhibitor, which are members of
FT                   the Barstar family. Barstar is an intracellular inhibitor
FT                   of barnase, an extracellular ribonuclease of Bacillus
FT                   amyloliquefaciens. Barstar binds...; Region:
FT                   Barstar_SaI14_like; cd05143"
FT                   /db_xref="CDD:88272"
FT                   /locus_tag="SCP1.17"
FT   misc_feature    order(13701..13703,13707..13709,13713..13721,13731..13733,
FT                   13845..13847)
FT                   /note="putative RNAase interaction site; other site"
FT                   /db_xref="CDD:88272"
FT                   /locus_tag="SCP1.17"
FT   gene            complement(13943..16294)
FT                   /db_xref="GeneID:1095097"
FT                   /locus_tag="SCP1.18c"
FT   CDS_pept        complement(13943..16294)
FT                   /locus_tag="SCP1.18c"
FT                   /gene_family="HOG000102804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA integrase/recombinase"
FT                   /transl_table="11"
FT                   /note="possible DNA integrase/recombinase, len: 783aa;
FT                   C-terminal region weakly similar to many members of the
FT                   'phage' integrase family eg. SW:P06697 (TNPB_STAAU)
FT                   transposase B (transposon Tn554) from Staphylococcus aureus
FT                   (630 aa) fasta scores; opt:  205, z-score: 242.4, E():
FT                   4.9e-06, 22.1% identity in 280 aa overlap. Contains Pfam
FT                   match to entry PF00589 Phage_integrase, Phage integrase
FT                   family."
FT                   /db_xref="GI:21234017"
FT                   /db_xref="GeneID:1095097"
FT                   /translation="MTAEPATAAVPPRPFGDLSSSSSRSIAKLVVDTWDGGTSTRQQRG
FT                   QAAGLLLDYLAGYPGLTWQERWDASPVGQGLADVNDLECRRSPSVKLTTGLRALICLRV
FT                   IQPSLVAFRRHHMTGFAAHFISAQSDPLLDEFAKQVEVHQHTYAHRTETLFDLCVLLAV
FT                   QGVALSDVTAPALLHFAQENRRAWSVVDPGNKAGNRLRGQGVWHVLHAVGHLPPTVPAT
FT                   MRAALMRGQKSVEELVGLYPIRNQAVRGLLIDYFTRRRADTDYATLKNLVLHLAHHFWE
FT                   KIERLNPDQADLRISPEIYAAWRQMIAVKDNGAPRAGADSLVISVRSFYYDLHTWAAQE
FT                   PERWATWVAPCPVPPSDLHGLGARRRRINERSADRTRQRQPLLPVLVEHVESRYDHFRQ
FT                   LLQLAEEAVEGESFTFAGTSYTRVLSEADRKLSRHTAPIPPRLRNNDSGEMVHIATEEE
FT                   TTFWDWAAVETLRHSGVRVEELCELTHLSIRQYQRPGGEVIALLVIAPSKTDRERVIPM
FT                   SAELFHVIASIIRRHARTGRPIPLVTRYDPHDKVWSPPMPFLFQRQNGTVPAVFNPGTI
FT                   QKMIERRCLALAEMHPGFKGLKFTPHDFRRIFITELVNSGLPIHIGAALLGHLNVQTTR
FT                   GYVAVFDEDVIRHYQEHLEHRRQIRPTDEYRDTSSDEWTEFEEHFDRRKVELGSCGRPY
FT                   GTPCQHEHACIRCPMLHVNPKMLARLSELEADLLQRRTQAEGEGWIGEIEGIDLTLTFL
FT                   RAKRDDTQRRAQRPAVHLGIPARRRPQESE"
FT                   /protein_id="NP_639594.1"
FT   misc_feature    complement(14381..14935)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.18c"
FT   misc_feature    complement(order(14384..14386,14489..14494,14771..14773,
FT                   14864..14869))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.18c"
FT   misc_feature    complement(order(14384..14386,14411..14413,14480..14482,
FT                   14489..14491,14771..14773,14867..14869))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.18c"
FT   misc_feature    complement(order(14384..14386,14411..14413,14480..14482,
FT                   14489..14491,14867..14869))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.18c"
FT   misc_feature    complement(order(14384..14386,14480..14482,14867..14869))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.18c"
FT   misc_feature    complement(14354..14989)
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family, score 61.30, E-value 2.1e-14"
FT                   /locus_tag="SCP1.18c"
FT   RBS             complement(16299..16303)
FT   gene            complement(16386..17612)
FT                   /db_xref="GeneID:1095098"
FT                   /locus_tag="SCP1.19c"
FT   CDS_pept        complement(16386..17612)
FT                   /locus_tag="SCP1.19c"
FT                   /gene_family="HOG000102693" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative DNA integrase/recombinase"
FT                   /transl_table="11"
FT                   /note="possible DNA integrase/recombinase, len: 408aa;
FT                   C-terminal region weakly similar to many members of the
FT                   'phage' integrase family eg. SW:P21891 (XERD_ECOLI)
FT                   integrase/recombinase XerD from Escherichia coli (298 aa)
FT                   fasta scores; opt:  195, z-score: 217.2, E(): 0.00012,
FT                   28.1% identity in 217 aa overlap. Contains Pfam match to
FT                   entry PF00589 Phage_integrase, Phage integrase family.
FT                   Possible upstream and downstream alternative translational
FT                   strat sites."
FT                   /db_xref="GI:21234018"
FT                   /db_xref="GeneID:1095098"
FT                   /translation="MSVIAVKESEVDLRHELMEGRAQLPRAGAVVETGEAHPPFMVVNG
FT                   LGREVEPVTAYLRDLALSDSSPLTARSYGFGMLRWFRLLWLLDVAWERATEAETAVLTG
FT                   WLRTAPNPQRHRRNPQSPPPGTVNPRTGKPYLGPGYAPTTINHALSVVSGFYAFHAHYG
FT                   RGPVANPVPVSPQRRRALSHLSPLEPKPVLGRARLRQKVTGRPPRSIPDPLWDELFAAM
FT                   GCERDRALLDCYVSSGARAEELLGVETGDIHWAKPGLYVITKGTRERELVPISPEACVR
FT                   LARYLDSTGTPEAGEPVWRTRHGEDRPLTYWAMRRVVQRAQQNLRTNWTLHDLRHTAAH
FT                   RMANGGKLTLPEVQAVLRHANIQTTSRYLAVRVEEIFDALLEHYNQPRPQVSYPTGYAT
FT                   DDIAAVFGA"
FT                   /protein_id="NP_639595.1"
FT   misc_feature    complement(16506..16940)
FT                   /note="C-terminal catalytic domain. The tyrosine
FT                   recombinase/integrase family share the same catalytic
FT                   domain containing six conserved active site residues. The
FT                   best-studied members of this diverse family include the
FT                   bacteriophage lambda integrase, the...; Region: INT_REC_C;
FT                   cd01182"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.19c"
FT   misc_feature    complement(order(16509..16511,16617..16622,16818..16820,
FT                   16890..16895))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.19c"
FT   misc_feature    complement(order(16509..16511,16536..16538,16608..16610,
FT                   16617..16619,16818..16820,16893..16895))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.19c"
FT   misc_feature    complement(order(16509..16511,16536..16538,16608..16610,
FT                   16617..16619,16893..16895))
FT                   /note="active site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.19c"
FT   misc_feature    complement(order(16509..16511,16608..16610,16893..16895))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29503"
FT                   /locus_tag="SCP1.19c"
FT   misc_feature    complement(16479..17027)
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family, score 63.70, E-value 4e-15"
FT                   /locus_tag="SCP1.19c"
FT   gene            complement(17618..18400)
FT                   /db_xref="GeneID:1095099"
FT                   /locus_tag="SCP1.20c"
FT   CDS_pept        complement(17618..18400)
FT                   /locus_tag="SCP1.20c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 260aa"
FT                   /db_xref="GI:21234019"
FT                   /db_xref="GeneID:1095099"
FT                   /translation="MAAARPQGPNRRHHTAEEPMDITTRLYLLDLVRQAQQSTAAHAAA
FT                   VRAAARAAKAATQARDRVDEHARQRPTAQDPEQPDEATGELDQALEEYTDCRGRLQAAN
FT                   RKVTRTFLAARAANRTLGATYAQHARGRARVASRDEVAAGLLDELADVPLALMDAAHAI
FT                   LVQSSAGKDSLVQLHRIATWAKKAGCLHKVVVIHIDLGEESEWPGVRELAQRQAERYGL
FT                   RFHVLRAEGGLLGLVEKRGMWPDAARRLCTVICTSSHR"
FT                   /protein_id="NP_639596.1"
FT   misc_feature    complement(<17621..17914)
FT                   /note="Adenine nucleotide alpha hydrolases superfamily
FT                   including N type ATP PPases, ATP sulphurylases Universal
FT                   Stress Response protein and electron transfer flavoprotein
FT                   (ETF). The domain forms a apha/beta/apha fold which  binds
FT                   to Adenosine nucleotide; Region: AANH_like; cl00292"
FT                   /db_xref="CDD:185887"
FT                   /locus_tag="SCP1.20c"
FT   misc_feature    complement(order(17804..17806,17810..17812,17882..17893,
FT                   17900..17905))
FT                   /note="Ligand Binding Site; other site"
FT                   /db_xref="CDD:73291"
FT                   /locus_tag="SCP1.20c"
FT   RBS             complement(18403..18407)
FT   gene            complement(18421..19278)
FT                   /db_xref="GeneID:1095100"
FT                   /locus_tag="SCP1.21c"
FT   CDS_pept        complement(18421..19278)
FT                   /locus_tag="SCP1.21c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 285aa"
FT                   /db_xref="GI:21234020"
FT                   /db_xref="GeneID:1095100"
FT                   /translation="MTTNPTATEGDLLIAELARRGRRAYLGGDRGVTFLITTADPDAPD
FT                   DEGSAYTTAHLLMYAGEHADRPAAEHTESWSAHLHDAEGTYVDTLFAGAGTPLDAETDT
FT                   ALFAIQVCDWLDDRRRATARLDSTPAPDRSARRRLGDLTLAELLASAADNHAGLVEHLA
FT                   REDRDEMYDTITNAYVTQIGVALTVALSTAKAAFPAAQPPRKPYQARRPLREMTLADFL
FT                   HAADRERAALSEHLDHGDRTDAFTFAVIAECHVEVLGRYLRLARHDHDTGRTPIWPTPG
FT                   SDAR"
FT                   /protein_id="NP_639597.1"
FT   gene            complement(19353..19586)
FT                   /db_xref="GeneID:1095101"
FT                   /locus_tag="SCP1.22c"
FT   CDS_pept        complement(19353..19586)
FT                   /locus_tag="SCP1.22c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 77aa"
FT                   /db_xref="GI:21234021"
FT                   /db_xref="GeneID:1095101"
FT                   /translation="MADVTYRGYGVIGTGHWGNPLDRIVDLANLALKFGEATLRIRTEH
FT                   DNGVTITFQTLKFSPAGVEAVEASSVLEPLPF"
FT                   /protein_id="NP_639598.1"
FT   gene            complement(19574..19708)
FT                   /db_xref="GeneID:1095102"
FT                   /locus_tag="SCP1.23c"
FT   CDS_pept        complement(19574..19708)
FT                   /locus_tag="SCP1.23c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, doubtful CDS, len: 44aa"
FT                   /db_xref="GI:21234022"
FT                   /db_xref="GeneID:1095102"
FT                   /translation="MTLRRFTPALLPIVAAVTDGGIGTVNLDISFECRGAATRGRWPT"
FT                   /protein_id="NP_639599.1"
FT   RBS             complement(19590..19595)
FT                   /locus_tag="SCP1.23c"
FT   RBS             complement(19712..19718)
FT   gene            19920..20165
FT                   /db_xref="GeneID:1095103"
FT                   /locus_tag="SCP1.24"
FT   CDS_pept        19920..20165
FT                   /locus_tag="SCP1.24"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, doubtful CDS, len: 81aa"
FT                   /db_xref="GI:21234023"
FT                   /db_xref="GeneID:1095103"
FT                   /translation="MWLQPTAIRRAWLSARGQCDWFVHTEHDRLLRRERTRRAAMKWAR
FT                   GYEEPCAVSPQDLVPELAGRVALYPGEGPDTYVPRR"
FT                   /protein_id="NP_639600.1"
FT   gene            complement(20274..21338)
FT                   /db_xref="GeneID:1095104"
FT                   /locus_tag="SCP1.25c"
FT   CDS_pept        complement(20274..21338)
FT                   /locus_tag="SCP1.25c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 354aa"
FT                   /db_xref="GI:21234024"
FT                   /db_xref="GeneID:1095104"
FT                   /translation="MIRAGRRKYAQTSDELAKAMGISIGTFRNKQPYTAEAFPPLISSE
FT                   GARVKLWDSQQTAAYLAGRPVPAAPDEGDDQDLLDRNEAAAELGVAPKTWDDYKRHPQI
FT                   APHLTKVKGVEHCPRGILKTFRTAKSTSTDTSPKGRPKGSGDMVPRDEVAARVGALLDE
FT                   VPAVTLATVQERLGLSYAAAARALPRLRGERLADLLQAEPDLTPEDAATRLGYPAAVHR
FT                   TTLTSAATELRARQVQPYLQRVADVLVGAGLAEQQDIVVQRLEGDVLAAAVSLSGSGAP
FT                   ALVWDERYGWRTAVSRRHPIGKETGTPPEGDGIRYLSEEQQPEPAELLAALTDGRRGSQ
FT                   QPKRIHPAGAALHD"
FT                   /protein_id="NP_639601.1"
FT   RBS             complement(21345..21349)
FT   gene            complement(22062..22904)
FT                   /db_xref="GeneID:1095105"
FT                   /locus_tag="SCP1.26c"
FT   CDS_pept        complement(22062..22904)
FT                   /locus_tag="SCP1.26c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 280aa"
FT                   /db_xref="GI:21234025"
FT                   /db_xref="GeneID:1095105"
FT                   /translation="MYRMRIKWQDIIDRARDIVDGYDGGVTVRQVMYRLVAAGLLPNTA
FT                   PMYRRLSSRLAQARRDGHFPDLIDTIREVHVPSAWPDADAFLADIPQQFRLDRTRGQEW
FT                   ALYVAAEKDTLRQLLTGWLAEYGIPVLVVRGFGSQSYADVVRDRARSDPRPATLLYIGD
FT                   FDASGSDIERDWVKRTDCWERVERVLLTDGQVREYQLPPAEGKRDDPRWPGFARRYGFD
FT                   LDRPVQWEVEALEPAELKRLVMEAVDAYIDREVLAEVRAEEEHQRAQLTALLGRHHEG"
FT                   /protein_id="NP_639602.1"
FT   RBS             complement(22918..22922)
FT   stem_loop       23049..23095
FT                   /note="Score 69: 23/23 (100%) matches, 0 gaps, possible 23
FT                   base loop."
FT   gene            complement(23099..26470)
FT                   /db_xref="GeneID:1095106"
FT                   /locus_tag="SCP1.27c"
FT   CDS_pept        complement(23099..26470)
FT                   /locus_tag="SCP1.27c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 1123aa"
FT                   /db_xref="GI:21234026"
FT                   /db_xref="GeneID:1095106"
FT                   /translation="MAPPPHRRHTDSGGQHMSRIMITTPALNAMSGHGLTDAALIVDGR
FT                   RTAVAYSVFCPATERYSLVTLDGRWIIPGKEGYKTRGPATTYARRHVSDLRPEALRVYE
FT                   PIKHTGRPQVGRYGARRSGRCMGQVQAATVGYECGSCHAHVSWDHVWVEGFTIVLDGRG
FT                   THTVSYALRSEHRREFGTVPAETPAVKAPTPVDTPAVSAPVAEAAPVPAPVAVATPVAP
FT                   AESAAPFCAPYSVAEYSITLDVSAVGRIAYGGHKPVKRWKVVDANGRVASDAHLSRLAA
FT                   DVRADILNGESGHAQTPDTCPEGTPDNVRPLVSAGTHGRAYITGGGARLNIESADGRAR
FT                   FTLHTVPDDAHQEARDGFHKRARELSGQIVKRADGRPVFKPAKLQMWSGKPAPRKAFEP
FT                   KDYAPGSMLAWMVGGVRFTGQVWATRVQGGAWNGDQGEATAVVVATVDGRRARRDEAVT
FT                   VPLYTGSRRKRAFAHVSMPYGVADNGAVQRYLADVTVIAPECAADGLFDVVTPRVDDMD
FT                   AWEGEGGAFVREYDNAPAQTPAEADTENVAPVADAPAEAERVVGEYCHRCQEKGLVIAG
FT                   TCRRCGRVDIVAAMAASGPRTCPAEERAQATGRLYCRRCFRTGVALYASKYWTVDGEGH
FT                   RFHICADCYTAHGGRLPEAGPAPVMAPAGAVIRAARAARKEAEESGASVGEIHRAGEAA
FT                   RVAVAVAYGQRPADVISDPSGTDGWEGEGGACVGVDRPSAPDAGSPAVPVGPDPSPEMG
FT                   TCTALAVDTPRAASDAMSGRGPVAARDSEGGTAPGITAPRAHPRAARPGADPYAVLPAV
FT                   AKWEATPGTDLRTATLTCAGESYRVAHAPDGVLPYTVRRTGGGTGADLGGWVDMDDVRA
FT                   IIRGDRRRTAALEADRRRVEQEQRRAAYRLQGERRQAPARLTEQERRAAARRTEEKHRP
FT                   VAAELYVSPITGNAVLTFVCGACATTHDDVLGRPQTIGGRYRTPLSVDRDTLTALVEKR
FT                   GWKVTGPWTAHGRRGDTMRAPVAATPAYLAWVDATYGPGPVTPEVRAGERITPVQRGWW
FT                   DVVSKDGHRYELTWRPVLTGEVWSVRYRSADGFETVARTGMAATVLAGMRADSAERSHQ
FT                   VGATAEPESVHVPVSS"
FT                   /protein_id="NP_639603.1"
FT   RBS             complement(26475..26479)
FT   gene            complement(26523..26876)
FT                   /db_xref="GeneID:1095107"
FT                   /locus_tag="SCP1.28c"
FT   CDS_pept        complement(26523..26876)
FT                   /locus_tag="SCP1.28c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 117aa"
FT                   /db_xref="GI:21234027"
FT                   /db_xref="GeneID:1095107"
FT                   /translation="MGHTPGALLITPEADIVPIDLPANSHERLTVMRSVIRCARVDVVA
FT                   LTSQMDMWLDDEGIYNHPVNKLASLLAVRFGFTHQPYHGPVLLTGGADNDGETVPLTKD
FT                   KIVALLTSITDLL"
FT                   /protein_id="NP_639604.1"
FT   gene            27692..28150
FT                   /db_xref="GeneID:1095108"
FT                   /locus_tag="SCP1.29"
FT   CDS_pept        27692..28150
FT                   /locus_tag="SCP1.29"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 152aa"
FT                   /db_xref="GI:21234028"
FT                   /db_xref="GeneID:1095108"
FT                   /translation="MGLLFAAMDDELTNDDHLRALAALEAVVQNDDGALQALVGGTRER
FT                   PLAALLAAYGQHTLHRVLLAAFGIEATMTYDETGQRVAELNGDPMARIVFLLADSLHHQ
FT                   AILAGDDLVTAKRIGGSVLLAIHAFTDADNQDALALLRALRNEALQGY"
FT                   /protein_id="NP_639605.1"
FT   gene            complement(28328..28891)
FT                   /db_xref="GeneID:1095109"
FT                   /locus_tag="SCP1.30"
FT   CDS_pept        complement(28328..28891)
FT                   /locus_tag="SCP1.30"
FT                   /gene_family="HOG000146868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 187aa"
FT                   /db_xref="GI:21234029"
FT                   /db_xref="GeneID:1095109"
FT                   /translation="MVRNTKAFREAVAETLAELARRGVTLAPATVEDTIERNVRAVADQ
FT                   LGIQARSAWRYFDAAALADTIAHSVKELEDSSAYDGAGQAPMPPKDNPELALILAGVPD
FT                   ALAQTGGDLYAVILNVAVNAWTAGHIHGEDDCEGCEGGRGPTGHDWQARMRTLTEMQPD
FT                   ITKWFDRDVWTRAMSSTGFTVNRA"
FT                   /protein_id="NP_639606.1"
FT   repeat_region   29043..29778
FT                   /note="Directly, imperfectly repeated at 264720..265446.
FT                   Inverted and perfectly repeated at
FT                   complement(326246..326981)."
FT   gene            29125..29784
FT                   /db_xref="GeneID:1095110"
FT                   /locus_tag="SCP1.31"
FT   CDS_pept        29125..29784
FT                   /locus_tag="SCP1.31"
FT                   /gene_family="HOG000240322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative secreted protein"
FT                   /transl_table="11"
FT                   /note="possible secreted protein, len: 219aa; similar to
FT                   TR:Q9KY42 (EMBL:AL356892) hypothetical protein from
FT                   Streptomyces coelicolor (214 aa) fasta scores; opt: 499,
FT                   z-score: 600.0, E(): 5.9e-26, 41.9% identity in 210 aa
FT                   overlap. Also strongly similar over full length to CDS
FT                   SCP1.267 (fasta scores; opt: 1190, z-score: 1349.2, E(): 0,
FT                   77.5% identity in 218 aa overlap) and C-terminus strongly
FT                   similar to its neighbouring CDS SCP1.268 (111 aa) (fasta
FT                   scores; opt: 401, z-score: 463.8, E(): 2.6e-21, 57.4%
FT                   identity in 108 aa overlap). Contains a possible cleavable
FT                   N-terminal signal sequence."
FT                   /db_xref="GI:21234030"
FT                   /db_xref="GeneID:1095110"
FT                   /translation="MVTSVLRGLVAALLAVLSITASTPAQAAQTLTVAEAVTRLPVDAE
FT                   SRVGYDRDAFRHWNRGDDPSDGCSTRNEVLIAEAVEPPTVGPRCRLTGGRWWSYYDQVW
FT                   VASASGLDIDHMVPLAESWDSGAFAWTAKRREAYANDQGAQTSLVAVTARSNRSKADQD
FT                   PAQWMPPAAAAHCRYIAEWVGTKLRWSLTADETEVAALRDAASDCPGQRVTFELAA"
FT                   /protein_id="NP_639607.1"
FT   misc_feature    29230..29721
FT                   /note="Domain of unknown function (DUF1994); Region:
FT                   DUF1994; pfam09352"
FT                   /db_xref="CDD:150128"
FT                   /locus_tag="SCP1.31"
FT   repeat_region   29490..29757
FT                   /note="Directly and imperfectly repeated at 265494..265758.
FT                   Inverted and perfectly repeated at
FT                   complement(326267..325534)."
FT   gene            complement(29839..30219)
FT                   /db_xref="GeneID:1095111"
FT                   /locus_tag="SCP1.32c"
FT   CDS_pept        complement(29839..30219)
FT                   /locus_tag="SCP1.32c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 126aa"
FT                   /db_xref="GI:21234031"
FT                   /db_xref="GeneID:1095111"
FT                   /translation="MDDGSPVEPTELLAQHGVPPAQLEPAPAPPALSEVIARILAAPPH
FT                   PCSACGADSATARVVPFPGVGLRWVDLCWEHGMSVRRRSRVPTTLEGIAADLRAAAGEA
FT                   GLPQAARLAFIRSGNDYRTDHG"
FT                   /protein_id="NP_639608.1"
FT   gene            complement(30246..31271)
FT                   /db_xref="GeneID:1095112"
FT                   /locus_tag="SCP1.33c"
FT   CDS_pept        complement(30246..31271)
FT                   /locus_tag="SCP1.33c"
FT                   /gene_family="HOG000053338" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 341aa; similar to TR:Q9S292
FT                   (EMBL:AL096849) hypothetical protein from Streptomyces
FT                   coelicolor (322 aa) fasta scores; opt:  620, z-score:
FT                   708.4, E(): 5.5e-32, 37.3% identity in 322 aa overlap."
FT                   /db_xref="GI:21234032"
FT                   /db_xref="GeneID:1095112"
FT                   /translation="MEVVVVGDAQAMAGRVPTVMHVRCPDRLREGVYRQVLELLTDLSP
FT                   VVQALPPTAALVELKGALRYHGSEVHRLGEVLRVRTLSRLGVDVRVGIGPSITIAATAS
FT                   AQVPLPGGVLTVAPDDVTDWLAPLPGEALHGLGPRQAGALHEYGIHTVGLLAAVSPETV
FT                   QRLLGGKAGRLAADRARGRDPRPVVPRALPAAATVRMRFDRHVLDGADVRAALLDLVVQ
FT                   LGRLLRRRGQAARAVSLTLQFAGGGSWEKSRRLPEPSAHDEDLRTMAYRLIDAAGLQRG
FT                   RLTGLFLKADDLVDADRVAQQISLDQAREARLVAEATVDRVRDKFGPGVIGPAATARRA
FT                   S"
FT                   /protein_id="NP_639609.1"
FT   misc_feature    complement(<30780..31205)
FT                   /note="Y-family of DNA polymerases; Region: PolY; cl12025"
FT                   /db_xref="CDD:176619"
FT                   /locus_tag="SCP1.33c"
FT   misc_feature    complement(30267..>31172)
FT                   /note="DNA polymerase IV; Validated; Region: PRK03858"
FT                   /db_xref="CDD:179663"
FT                   /locus_tag="SCP1.33c"
FT   RBS             complement(31275..31281)
FT   gene            31461..32399
FT                   /db_xref="GeneID:1095113"
FT                   /locus_tag="SCP1.34"
FT   CDS_pept        31461..32399
FT                   /locus_tag="SCP1.34"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative integral membrane protein"
FT                   /transl_table="11"
FT                   /note="possible conserved integral membrane protein, len:
FT                   312aa; similar to many from Streptomyces coelicolor eg.
FT                   TR:O69922 (EMBL:AL023861) putative integral membrane
FT                   protein (367 aa) fasta scores; opt:  613, z-score: 713.6,
FT                   E(): 2.8e-32, 44.6% identity in 222 aa overlap. Contains
FT                   multiple possible membrane-spanning hydrophobic regions."
FT                   /db_xref="GI:21234033"
FT                   /db_xref="GeneID:1095113"
FT                   /translation="MSLGLGEPDQPSRVSRAMVAIPIAWIIVVSVTEILTPSHIHLGPL
FT                   LVAAPAVTPSFAGPRTVGLVATLAVIAQTVIGVLRDPDELLSANREAQILALIVVGICL
FT                   VLFCVERERRAKEMEQVRYVSEAAQQVVLPPLPKRLGPLRTAVMYLAAEAEARIGGDLY
FT                   AAARTTSGTRVIVGDVRGKGMTAVSDAALLLGAFRVAAHRHAPLEELVAYLDRSVRWDV
FT                   VEPEGDESLSAGGVLARHAAAGARTAVVTATWAPDTLRAAELAEALRILGAGKPRLLGY
FT                   ADARVPQSAPGCPRFCDAPLDEAVQRLVAHP"
FT                   /protein_id="NP_639610.1"
FT   misc_feature    31971..>32114
FT                   /note="Serine/threonine phosphatases, family 2C, catalytic
FT                   domain; The protein architecture and deduced catalytic
FT                   mechanism of PP2C phosphatases are similar to the PP1,
FT                   PP2A, PP2B family of protein Ser/Thr phosphatases, with
FT                   which PP2C shares no sequence...; Region: PP2Cc; cl00120"
FT                   /db_xref="CDD:185796"
FT                   /locus_tag="SCP1.34"
FT   gene            32556..32855
FT                   /db_xref="GeneID:1095114"
FT                   /locus_tag="SCP1.35"
FT   CDS_pept        32556..32855
FT                   /locus_tag="SCP1.35"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 99aa"
FT                   /db_xref="GI:21234034"
FT                   /db_xref="GeneID:1095114"
FT                   /translation="MYLATHPHSAVPALRDVIGTRKAVYSVPDEQVTATVDVGPWMEQK
FT                   TAAVLAHRSEVTRGALPGVIAGLPPDARHRLFATEWYIRHATITAGSAQTELTA"
FT                   /protein_id="NP_639611.1"
FT   misc_feature    33050..37172
FT                   /note="Appears to be the remnant of an integrated
FT                   transposon Tn4811. Region previously sequenced as
FT                   EMBL:AF204735 Streptomyces coelicolor A3(2) plasmid SCP1
FT                   transposon Tn4811 putative NADP-dependent oxidoreductase
FT                   and putative regulator genes, complete cds; and unknown
FT                   genes; label: AF204735"
FT   gene            complement(33166..34080)
FT                   /db_xref="GeneID:1095115"
FT                   /locus_tag="SCP1.36c"
FT   CDS_pept        complement(33166..34080)
FT                   /locus_tag="SCP1.36c"
FT                   /gene_family="HOG000136816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="possible AraC-family transcriptional regulator, len:
FT                   304aa; previously sequenced as TR:Q9L8G9 (EMBL:AF204735).
FT                   Similar to many eg. from streptomycetes eg. SW:Q03320
FT                   (ARAL_STRAT) putative AraC-like transcription regulator
FT                   from Tn4811-homologous locus in Streptomyces antibioticus
FT                   (303 aa) fasta scores; opt: 1769, z-score: 2065.7, E(): 0,
FT                   88.5% identity in 304 aa overlap. Contains Pfam match to
FT                   entry PF00165 HTH_AraC, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, Prosite match to
FT                   PS00041 Bacterial regulatory proteins, araC family
FT                   signature and helix-turn-helix motif (Score 1345 (+3.77
FT                   SD)) at residue 216-237."
FT                   /db_xref="GI:21234035"
FT                   /db_xref="GeneID:1095115"
FT                   /translation="MDPLEDVLTLLKTRSHLSASLVAGGRWAVRFDAPRVVKFNAVRRG
FT                   TCQLEVDGIDEPIDLAEGDCYLLTRPRSFTLRSDPETAPVDGGAVFARAEDGIARAGQG
FT                   DDVFLIGGGFSFGTRAQELLLDRLPPIVHVPADTPHAETVQWALTAIDQELTHRPMAST
FT                   LIAEHLAVIMLVHVLRLHLERAPHAVSGWLAGLADPVVATALTCLHRDPARSWTVADLA
FT                   DTAAVSRSTLAARFKATVGQGPLEYLTRWRIELAARQLREGNATLASIAHSVGYGSESA
FT                   LSVAFKRVLGMPPGDYRKHPTMP"
FT                   /protein_id="NP_639612.1"
FT   misc_feature    complement(33334..33459)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="SCP1.36c"
FT   misc_feature    complement(33187..33435)
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="SCP1.36c"
FT   misc_feature    complement(33184..33291)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="SCP1.36c"
FT   misc_feature    complement(33178..33438)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   125.10, E-value 1.3e-33"
FT                   /locus_tag="SCP1.36c"
FT   misc_feature    complement(33199..33327)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature"
FT                   /locus_tag="SCP1.36c"
FT   RBS             complement(34087..34091)
FT   gene            34167..35162
FT                   /db_xref="GeneID:1095116"
FT                   /locus_tag="SCP1.37"
FT   CDS_pept        34167..35162
FT                   /locus_tag="SCP1.37"
FT                   /codon_start="1"
FT                   /product="putative short-chain oxidoreductase"
FT                   /transl_table="11"
FT                   /note="probable short-chain oxidoreductase, len: 331aa;
FT                   previously sequenced as TR:Q9L8H0 (EMBL:AF204735). Also
FT                   similar to many others eg. TR:Q9RR99 (EMBL:AE002088)
FT                   oxidoreductase, short-chain dehydrogenase/reductase family
FT                   from Deinococcus radiodurans (336 aa) fasta scores; opt:
FT                   795, z-score: 899.7, E(): 0, 44.7% identity in 320 aa
FT                   overlap. Contains Pfam match to entry PF00106 adh_short,
FT                   short chain dehydrogenase and Prosite match to PS00061
FT                   Short-chain dehydrogenases/reductases family signature."
FT                   /db_xref="GI:21234036"
FT                   /db_xref="GeneID:1095116"
FT                   /translation="MTTNPDGGRHARNDSALLTTPFDSHARAQEVIDGVDLTGRRAVVT
FT                   GGASGLGAKTVRALAAAGAEVTIATRHPQSAEPLVQEAAAAGAGRVHAEALDLSDVASV
FT                   DSFARAWRGPLDILVANAGIMALPTRTLTPYGWEMQLATNYLGHFALATGLHAALRDAG
FT                   SARIVVVSSGAHLGTPFEFEDPHFARRPYDPWAAYGQSKTADVLFTVGARRWAADGITA
FT                   NALNPGYILTRLQRHVDDETMRAFGVMDDQGNVKPLPYYKTPEQGAATSVLLAASPLLN
FT                   GVTGRYFEDNQEARTVEDGDDQPGGVAAHALDPEAADRLWEYGADTLSAG"
FT                   /protein_id="NP_639613.1"
FT   misc_feature    34218..35159
FT                   /note="oxidoreductase; Provisional; Region: PRK06196"
FT                   /db_xref="CDD:180460"
FT                   /locus_tag="SCP1.37"
FT   misc_feature    34272..>34871
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCP1.37"
FT   misc_feature    34284..34865
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 107.20, E-value 3.2e-28"
FT                   /locus_tag="SCP1.37"
FT   misc_feature    34719..34805
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT                   /locus_tag="SCP1.37"
FT   gene            complement(35455..36417)
FT                   /db_xref="GeneID:1095117"
FT                   /locus_tag="SCP1.38c"
FT   CDS_pept        complement(35455..36417)
FT                   /locus_tag="SCP1.38c"
FT                   /gene_family="HOG000254171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /note="probable transposase, len: 320aa; previously
FT                   sequenced as TR:Q9L8H1 (EMBL:AF204735). Also similar to
FT                   many others eg. TR:Q9R9Q9 (EMBL:AF144039) putative
FT                   transposase from Rhizobium meliloti (Sinorhizobium
FT                   meliloti) (277 aa) fasta scores; opt: 734, z-score: 824.2,
FT                   E(): 0, 44.3% identity in 262 aa overlap. Also similar to
FT                   SCP1.82 fasta scores; opt: 1219, z-score: 1504.5, E(): 0,
FT                   64.0% identity in 275 aa overlap. Contains Pfam match to
FT                   entry PF01511 Transposase_6, Transposase and Pfam match to
FT                   entry PF01675 Transposase_13, Transposase."
FT                   /db_xref="GI:21234037"
FT                   /db_xref="GeneID:1095117"
FT                   /translation="MRHRLYPSDMTDAEWALVEPLLPPPACDTARGGRPEKHPRREIVD
FT                   AIRYVVDTGCKWRALPADFPPWRTVWGFMARWAAVGVIGQLRDALAQRIRRDMGRGPRA
FT                   VATIIDSQSVKAASTVGKDSRGYDAGKRINGRKRHMVVDTKGLPLMVMVTPADLHDSAV
FT                   AKEVLFRLRLTHPEITLVWADSAYAGKLVTWAKKHLNLTIKTVSRPKDTSGWVLLPRRW
FT                   VVERSLAWMMNARRHARDYERLIQHSETLITWAAITVMTKRLTRTGPTGWSKKPKATAD
FT                   SSPQVSPAATAGRPAGSATEEPARAAPLSARQPQPAGRF"
FT                   /protein_id="NP_639614.1"
FT   misc_feature    complement(36019..36402)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="SCP1.38c"
FT   misc_feature    complement(35635..36117)
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="SCP1.38c"
FT   misc_feature    complement(35629..36012)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3293"
FT                   /db_xref="CDD:33102"
FT                   /locus_tag="SCP1.38c"
FT   repeat_region   complement(35620..37143)
FT                   /note="Inverted and (degenerately) repeated at
FT                   79749..81248. Inverted and (perfectly) repeated at
FT                   318881..320404"
FT   misc_feature    complement(35653..35904)
FT                   /note="Pfam match to entry PF01675 Transposase_13,
FT                   Transposase, score 177.60, E-value 2e-49"
FT                   /locus_tag="SCP1.38c"
FT   misc_feature    complement(36034..36288)
FT                   /note="Pfam match to entry PF01511 Transposase_6,
FT                   Transposase, score 183.10, E-value 4.4e-51"
FT                   /locus_tag="SCP1.38c"
FT   RBS             complement(36422..36426)
FT   gene            complement(36486..36905)
FT                   /db_xref="GeneID:1095118"
FT                   /locus_tag="SCP1.39c"
FT   CDS_pept        complement(36486..36905)
FT                   /locus_tag="SCP1.39c"
FT                   /gene_family="HOG000053437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 139aa; previously sequenced as
FT                   TR:Q9L8H2 (EMBL:AF204735). Strongly similar to TR:Q54403
FT                   (EMBL:Z11519) hypothetical protein from transposon Tn4811
FT                   of Streptomyces lividans (138 aa) fasta scores; opt:  858,
FT                   z-score: 1093.1, E(): 0, 95.7% identity in 139 aa overlap."
FT                   /db_xref="GI:21234038"
FT                   /db_xref="GeneID:1095118"
FT                   /translation="MPRASRRKGDAARRHADTIRFVLFEARPAGLAMHQLITASGLSDS
FT                   QVRSGLAALRDEAAAKGWPPLIWTRTDGYQLDAERAALEAYERAVVREKLTQFRRFITG
FT                   TVTPHAAAHPNDKWVKHIVAQLNSIESTLDLIASA"
FT                   /protein_id="NP_639615.1"
FT   gene            complement(36908..>37165)
FT                   /db_xref="GeneID:1095119"
FT                   /locus_tag="SCP1.40c"
FT   CDS_pept        complement(36908..>37165)
FT                   /locus_tag="SCP1.40c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, partial CDS, len: 85aa; appears to have
FT                   been truncated by an insertion/excision event. previously
FT                   sequenced as TR:Q9L8H3 (EMBL:AF204735). Also identical to
FT                   the C-terminus of the larger TR:Q54402 (EMBL:Z11519)
FT                   hypothetical protein from transposon Tn4811 of Streptomyces
FT                   lividans (336 aa) fasta scores; opt:  472, z-score: 637.5,
FT                   E(): 4.8e-28, 100.0% identity in 85 aa overlap."
FT                   /db_xref="GI:21234039"
FT                   /db_xref="GeneID:1095119"
FT                   /translation="PVAPAVRHIDRTVEFLDLVTACHSFVAAAGRAVPGLRDRTLGEDE
FT                   RTIVHENVAKVRATLDWIETAVDTGKVDMDGELARMLRGE"
FT                   /protein_id="NP_639616.1"
FT   stem_loop       37171..37860
FT                   /note="Inverted repeat spanning region of non-coding DNA.
FT                   Score 58: 22/24 ( 91%) matches, 0 gaps. May be associated
FT                   with the truncation of CDS SCP1.40c."
FT   gene            complement(37969..39204)
FT                   /db_xref="GeneID:1095120"
FT                   /locus_tag="SCP1.41c"
FT   CDS_pept        complement(37969..39204)
FT                   /locus_tag="SCP1.41c"
FT                   /gene_family="HOG000000063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 411aa; weakly similar to many eg.
FT                   TR:Q9L195 (EMBL:AL158057) hypothetical protein from
FT                   Streptomyces coelicolor (437 aa) fasta scores; opt: 476,
FT                   z-score: 570.6, E(): 2.6e-24, 32.7% identity in 327 aa
FT                   overlap."
FT                   /db_xref="GI:21234040"
FT                   /db_xref="GeneID:1095120"
FT                   /translation="MSSAPSELPRLLTAAETAAPVDAVSVIAEHLRRRFTAREISFLIV
FT                   DLTGKAVARLPTAQAESGREVERISLFGSVYEQVIRTQRLYQEVTGQGQRMIVPVTNRG
FT                   DAIGLLELLLPAAPDEGVLEAVGEAAHVLAYIVIANGRFTDLYTWGKRSRPPTLAAEIQ
FT                   YQLLPPSLSCEAAQFALCGNLEPSEDLSGDTFDYTLDRDTLHLSVTDPMGHDTAAALAA
FT                   TVLVSALRGARRAGAGLTDQAHRADRALADHDHGHATGQLLRINLHTGLAQLVNAGHPW
FT                   PLRMRNGTVEEIPCEVDPPFGLSVIEPHPYRAQNIDLRPGDRLLMLTDGMLERHGENID
FT                   IPGLLQRTRGLHPRETTLMLTSAVRDAAGGRLEDDATVMCLDWHGTHETQRHVSSGADT
FT                   QQASASRPKQEP"
FT                   /protein_id="NP_639617.1"
FT   misc_feature    complement(38053..>38430)
FT                   /note="Serine/threonine phosphatases, family 2C, catalytic
FT                   domain; The protein architecture and deduced catalytic
FT                   mechanism of PP2C phosphatases are similar to the PP1,
FT                   PP2A, PP2B family of protein Ser/Thr phosphatases, with
FT                   which PP2C shares no sequence...; Region: PP2Cc; cl00120"
FT                   /db_xref="CDD:185796"
FT                   /locus_tag="SCP1.41c"
FT   misc_feature    complement(38650..40716)
FT                   /note="Previously sequenced as EMBL:AB042603 [nt
FT                   complement(39385..40716) forms the right junction between
FT                   the integrated SCP1 and the chromosome in Streptomyces
FT                   coelicolor strain A634]; label: AB042603"
FT   RBS             complement(39211..39218)
FT   gene            complement(40107..40754)
FT                   /db_xref="GeneID:1095121"
FT                   /locus_tag="SCP1.42c"
FT   CDS_pept        complement(40107..40754)
FT                   /locus_tag="SCP1.42c"
FT                   /gene_family="HOG000161265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TetR family regulatory protein"
FT                   /transl_table="11"
FT                   /note="possible TetR-family regulator, len: 215aa; similar
FT                   to many eg. TR:Q9L2D0 (EMBL:AL137187) putative TetR-family
FT                   transcriptional regulator from Streptomyces coelicolor (194
FT                   aa) fasta scores; opt: 317, z-score: 374.6, E(): 2.1e-13,
FT                   34.5% identity in 206 aa overlap. Contains Pfam match to
FT                   entry PF00440 tetR, Bacterial regulatory proteins, tetR
FT                   family."
FT                   /db_xref="GI:21234041"
FT                   /db_xref="GeneID:1095121"
FT                   /translation="MGRPYLLCMARPRSFDRDHVLHAAERQFRTTGYNGTSVDDISAAT
FT                   GLGRGSLYAAFDGKHGVLLQAMAGYSIRLGQFVPEALAGPDEGALERLRGFLLRAVEGV
FT                   PLAADVPPAPDRAAAACFAAKMALEIGASDSEVERLANDCFSLVATAVAECVRAAQRNG
FT                   DIDPDADPDDLAYLLLTIVRGVDVVGASGHSPARLTSIAESAFALLPRPRHR"
FT                   /protein_id="NP_639618.1"
FT   misc_feature    complement(<40458..40730)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="SCP1.42c"
FT   misc_feature    complement(40563..40697)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="SCP1.42c"
FT   misc_feature    complement(40557..40697)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 45.40, E-value
FT                   4e-10"
FT                   /locus_tag="SCP1.42c"
FT   RBS             complement(40763..40768)
FT   RBS             40923..40927
FT   gene            40935..41750
FT                   /db_xref="GeneID:1095122"
FT                   /locus_tag="SCP1.43"
FT   CDS_pept        40935..41750
FT                   /locus_tag="SCP1.43"
FT                   /codon_start="1"
FT                   /product="short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /note="possible short-chain oxidoreductase, len: 271aa;
FT                   similar to many proposed oxidoreductase eg. SW:P37959
FT                   (YUSZ_BACSU) hypothetical oxidoreductase from Bacillus
FT                   subtilis (280 aa) fasta scores; opt: 441, z-score: 502.6,
FT                   E(): 1.6e-20, 33.6% identity in 274 aa overlap. Contains
FT                   Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase and Prosite match to PS00687 Aldehyde
FT                   dehydrogenases glutamic acid active site."
FT                   /db_xref="GI:21234042"
FT                   /db_xref="GeneID:1095122"
FT                   /translation="MQTAHPVALVTGASSGIGRAAALALVGAGFAVVGTSRNAANAEPL
FT                   AGVTFLDLDVTSDESVHSLIEEVIERFGRIDVLVNNAGVGAVGAGEESSISQTREVFDV
FT                   NVFGLIRMTNAVLPHMRAQGGGRVVNVSSVLGLIPAPFMAIYAATKHAVEGYSESVDHE
FT                   LREHGVRMLLVEPAYTSTGFEASGMAPDSPVPGYAAQREVSRDVLATAFRNADNPDVVV
FT                   KVIVAAATDSKPKLRYTAGSMAARVSVLRRIVPSRAFDRQIRKINRLAG"
FT                   /protein_id="NP_639619.1"
FT   misc_feature    40935..41747
FT                   /note="Short-chain dehydrogenases of various substrate
FT                   specificities [General function prediction only]; Region:
FT                   DltE; COG0300"
FT                   /db_xref="CDD:30648"
FT                   /locus_tag="SCP1.43"
FT   misc_feature    40938..41747
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:186874"
FT                   /locus_tag="SCP1.43"
FT   misc_feature    40950..41480
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 210.30, E-value 3e-59"
FT                   /locus_tag="SCP1.43"
FT   misc_feature    41481..41504
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site"
FT                   /locus_tag="SCP1.43"
FT   RBS             42345..42350
FT   gene            42353..43369
FT                   /db_xref="GeneID:1095123"
FT                   /locus_tag="SCP1.44"
FT   CDS_pept        42353..43369
FT                   /locus_tag="SCP1.44"
FT                   /gene_family="HOG000072910" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative oxidoreductase"
FT                   /transl_table="11"
FT                   /note="possible oxidoreductase, len: 338aa; similar to many
FT                   eg. TR:Q9RJW9 (EMBL:AL133210) putative reductase (fragment)
FT                   from Streptomyces coelicolor (311 aa) fasta scores; opt:
FT                   795, z-score: 852.7, E(): 0, 44.0% identity in 293 aa
FT                   overlap and SW:O82864 (AHPF_PSEPU) alkyl hydroperoxide
FT                   reductase subunit from Pseudomonas putida (520 aa) fasta
FT                   scores; opt: 301, z-score: 325.3, E(): 1.2e-10, 25.6%
FT                   identity in 301 aa overlap."
FT                   /db_xref="GI:21234043"
FT                   /db_xref="GeneID:1095123"
FT                   /translation="MAVATPAYASDALDEGTVDAVVIGGGAAGLNGALMLARSRRSVVV
FT                   IDSGSPRNAPAEAMHGFIVLDGTPPSEILRRGREQVRQYGGRVVSGEVVSAESAAPSAD
FT                   GDLRFTVTLADGRGITARRILVATGLTDALPEVPGLAEHWGHSVVHCPYCHGWEVRDEP
FT                   IGILATGPASIGPALLFRQLTEDLTYFTHGTDLDEDSRARFNARGIRVIDTPVTEVVND
FT                   EDGVLAGVRLADGQVVARRVLAVTPQMQARIKGLEGLGLPVQDLPTGRTFASGIDGTTE
FT                   VPGVWVAGNATDPVAQVGTSAAAGALAGIEMNKMLAIADTDAALQKLSGGSPKGATG"
FT                   /protein_id="NP_639620.1"
FT   misc_feature    42464..43300
FT                   /note="Thioredoxin reductase [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: TrxB;
FT                   COG0492"
FT                   /db_xref="CDD:30838"
FT                   /locus_tag="SCP1.44"
FT   misc_feature    <42968..>43066
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:187400"
FT                   /locus_tag="SCP1.44"
FT   RBS             43453..43459
FT   gene            43464..45101
FT                   /db_xref="GeneID:1095124"
FT                   /locus_tag="SCP1.45"
FT   CDS_pept        43464..45101
FT                   /locus_tag="SCP1.45"
FT                   /gene_family="HOG000239124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative integral membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="possible integral membrane efflux protein, len:
FT                   545aa; similar to many eg. TR:Q9XE01 (EMBL:AB019519) VarS
FT                   virginiamycin S resistance protein from Streptomyces
FT                   virginiae (518 aa) fasta scores; opt: 1001, z-score:
FT                   1036.6, E(): 0, 36.8% identity in 522 aa overlap and
FT                   TR:O54186 (EMBL:AL021411) putative transport protein from
FT                   Streptomyces coelicolor (533 aa) fasta scores; opt: 2830,
FT                   z-score: 2920.7, E(): 0, 79.5% identity in 533 aa overlap.
FT                   Contains multiple possible membrane-spanning hydrophobic
FT                   regions."
FT                   /db_xref="GI:21234044"
FT                   /db_xref="GeneID:1095124"
FT                   /translation="MPFLANTPVEKIAGPYARRWWALLVLCLSLLITVMANTSLIVAAP
FT                   DMTTDLGLSSSDLQWVVDSYTVPYAALMLVLGAIGDKYSRRGALVLGLLIFAGGSVMGS
FT                   MVDETSLVIVARAIMGVGAAVVMPATLSLVVATFPRSERAKAITAWAATSGVAVAVGPL
FT                   VSGWLLEDHAWGSTFLINVPIAVLAVFGALALVPPSKAEGMGRIDYVGGLLSIVTVGSL
FT                   IYAAIEGPHAGWGAGPVTAAVVAGAGLIAFVAWELRHPHPMLDVRKFALRPFSGSMLAV
FT                   MFFFFGMFAVIYYSTQFLQFVLGYGALETGVRLLPLGGAVFLGSALTGMLAPKLGVRVM
FT                   AVTGLAIGTAGMLLLTQIDKGSTYGDFLAPLMMLGLALGLAISPATDTIMGSFPESELG
FT                   VGGGVNDTALELGGALGIAVLGSLLGTAYRDELTDLVGNRLPAEAMETAKDSVGAGLAV
FT                   AERVAQDPSAGPQQAQAAVDAVHQAFAHGVAQTSLIGGIIMAAGTLIVLAILPGRRGFA
FT                   QKGAEPGAGTTASEAAATDVREHTGATH"
FT                   /protein_id="NP_639621.1"
FT   misc_feature    43566..>44015
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SCP1.45"
FT   misc_feature    order(43572..43574,43581..43589,43593..43598,43647..43649,
FT                   43656..43661,43668..43670,43680..43685,43689..43694,
FT                   43830..43835,43842..43847,43854..43859,43866..43868,
FT                   43902..43907,43914..43919,43935..43937)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="SCP1.45"
FT   misc_feature    43575..44843
FT                   /note="methyl viologen resistance protein SmvA;
FT                   Provisional; Region: PRK14995"
FT                   /db_xref="CDD:184957"
FT                   /locus_tag="SCP1.45"
FT   stem_loop       45248..45324
FT                   /note="Inverted repeat. Score 67: 29/34 ( 85%) matches, 0
FT                   gaps, 9 base loop."
FT   gene            complement(45946..47966)
FT                   /db_xref="GeneID:1095125"
FT                   /locus_tag="SCP1.46c"
FT                   /pseudo
FT   misc_feature    complement(45946..47966)
FT                   /note="pseudogene, unknown, len: 673aa; similar in regions
FT                   to two hypothetical proteins found on plasmids - TR:O85873
FT                   (EMBL:AF079317) from plasmid pNL1 of Sphingomonas
FT                   aromaticivorans (741 aa) fasta scores; opt: 310, z-score:
FT                   360.6, E(): 1.3e-12, 32.1% identity in 234 aa overlap and
FT                   TR:Q9R6H6 (EMBL:AB016260) from plasmid pTi-SAKURA of
FT                   Agrobacterium tumefaciens (716 aa) fasta scores; opt: 293,
FT                   z-score: 341.1, E(): 1.6e-11, 32.9% identity in 222 aa
FT                   overlap."
FT                   /locus_tag="SCP1.46c"
FT                   /pseudo
FT   gene            49731..50141
FT                   /db_xref="GeneID:1095126"
FT                   /locus_tag="SCP1.47"
FT   CDS_pept        49731..50141
FT                   /locus_tag="SCP1.47"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 136aa; similar to TR:Q9KY36
FT                   (EMBL:AL356892) hypothetical protein from Streptomyces
FT                   coelicolor (111 aa) fasta scores; opt:  212, z-score:
FT                   263.6, E(): 3.3e-07, 37.0% identity in 108 aa overlap."
FT                   /db_xref="GI:21234045"
FT                   /db_xref="GeneID:1095126"
FT                   /translation="MSTPAPNSVPFDPHASPADLVAAQRQAAELYAALRAHQTTLPWSR
FT                   EPHDGWPEETERGRENSGQPASPGWTAAEADEFDRLLAELRTATAQVLCHPWWERCAAE
FT                   GIKGEAMVTARQALKYAEGAAPLGQGDVETAA"
FT                   /protein_id="NP_639622.1"
FT   gene            complement(50418..51074)
FT                   /db_xref="GeneID:1095127"
FT                   /locus_tag="SCP1.48c"
FT   CDS_pept        complement(50418..51074)
FT                   /locus_tag="SCP1.48c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 218aa; N-terminal region weakly
FT                   similar to many eg. SW:P71311 (YAIS_ECOLI) hypothetical
FT                   protein from Escherichia coli (185 aa) fasta scores; opt:
FT                   221, z-score: 290.7, E():  1e-08, 28.7% identity in 164 aa
FT                   overlap."
FT                   /db_xref="GI:21234046"
FT                   /db_xref="GeneID:1095127"
FT                   /translation="MTSVLVVVAHPDDAEIAMGMRIHWYALNGATVRVHCLTTGTPAPD
FT                   GTEVRRQECLSAGELLGVDQYTFSSIPDTRFVENRGRINADLFDVFREARPDIIYTHYP
FT                   DDQHLDHSVTAREVTTVARREAPNLRHFRSPYSVGFEPNEFFFGTAELLEAKVRALKCF
FT                   ASQTQLDMDVFRQLTEVAYRQHLHHNVVASLPTEATCAEMFNIARQVHVATTRQL"
FT                   /protein_id="NP_639623.1"
FT   misc_feature    complement(50745..51062)
FT                   /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929"
FT                   /db_xref="CDD:163934"
FT                   /locus_tag="SCP1.48c"
FT   RBS             complement(51080..51086)
FT   gene            complement(51118..52008)
FT                   /db_xref="GeneID:1095128"
FT                   /locus_tag="SCP1.49c"
FT   CDS_pept        complement(51118..52008)
FT                   /locus_tag="SCP1.49c"
FT                   /gene_family="HOG000152083" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="unknown, len: 296aa"
FT                   /db_xref="GI:21234047"
FT                   /db_xref="GeneID:1095128"
FT                   /translation="MNHPAPIPNDLWAWALDHLPDARTATDVSWARGDSRVWRIDTTTA
FT                   SAFVKISPSVRDYTRETDAYVYAARALAPHQAPRLIASDHHLLALLTTPQPGKIVRGLP
FT                   LEEDQELRVHEEAGRLLRRWHDHSAPATADEQTAIRDAITGQTDEAAACLQATRHRLAP
FT                   DEQKLVEEVAHDLPHLADELPLVYRHGDYATRNWLWDPAQHGFGVIDFAMAAPGIAVEE
FT                   YVWLHSALWTPRPSLRDAFFTGYGRTLAAVERQALTLFAARLGVSYLHAGLTKQDPVLT
FT                   ERGHLVLHRMTADQN"
FT                   /protein_id="NP_639624.1"
FT   misc_feature    complement(51238..51909)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:186871"
FT                   /locus_tag="SCP1.49c"
FT   misc_feature    complement(51262..51909)
FT                   /note="Phosphotransferase enzyme family; Region: APH;
FT                   pfam01636"
FT                   /db_xref="CDD:145007"
FT                   /locus_tag="SCP1.49c"
FT   misc_feature    complement(order(51313..51315,51379..51384,51415..51417,
FT                   51421..51426,51436..51438,51724..51735,51775..51777,
FT                   51859..51861,51865..51867,51898..51900))
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SCP1.49c"
FT   misc_feature    complement(order(51379..51384,51415..51417,51421..51426,
FT                   51436..51438,51724..51735,51775..51777,51859..51861,
FT                   51865..51867,51898..51900))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SCP1.49c"
FT   misc_feature    complement(order(51313..51315,51436..51438))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="SCP1.49c"
FT   RBS             complement(52021..52024)
FT   gene            complement(52099..53301)
FT                   /db_xref="GeneID:1095129"
FT                   /locus_tag="SCP1.50c"