(data stored in ACNUC7421 zone)

HOGENOMDNA: STRTD_1

ID   STRTD_1; SV 1; empty ; DNA; empty ; PRO; 4449 BP.
XX
AC   NC_008500;
XX
PR   Project: 58327;
XX
DE   Streptococcus thermophilus LMD-9 plasmid 1, complete sequence.
XX
OS   Streptococcus thermophilus LMD-9
OC   Bacteria; Firmicutes; Lactobacillales; Streptococcaceae; Streptococcus.
XX
RN   [1]
RP   1-4449
RX   PUBMED; 17030793.
RA   Makarova,K., Slesarev,A., Wolf,Y., Sorokin,A., Mirkin,B., Koonin,E.,
RA   Pavlov,A., Pavlova,N., Karamychev,V., Polouchine,N., Shakhova,V.,
RA   Grigoriev,I., Lou,Y., Rohksar,D., Lucas,S., Huang,K., Goodstein,D.M.,
RA   Hawkins,T., Plengvidhya,V., Welker,D., Hughes,J., Goh,Y., Benson,A.,
RA   Baldwin,K., Lee,J.H., Diaz-Muniz,I., Dosti,B., Smeianov,V., Wechter,W.,
RA   Barabote,R., Lorca,G., Altermann,E., Barrangou,R., Ganesan,B., Xie,Y.,
RA   Rawsthorne,H., Tamir,D., Parker,C., Breidt,F., Broadbent,J., Hutkins,R.,
RA   O'Sullivan,D., Steele,J., Unlu,G., Saier,M., Klaenhammer,T.,
RA   Richardson,P., Kozyavkin,S., Weimer,B. and Mills,D.;
RT   "Comparative genomics of the lactic acid bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 103 (42), 15611-15616 (2006)
XX
RN   [2]
RP   1-4449
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-OCT-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4449
RG   US DOE Joint Genome Institute (JGI), The Lactic Acid Bacteria
RA   Lucas,S., Copeland,A., Detter,J.C., Glavina del Rio,T., Pitluck,S.,
RA   Grigoriev,I., Rokhsar,D., Slesarev,A., Pavlov,A., Pavlova,N.,
RA   Karamychev,V., Polouchine,N., Shakhova,V., Kozyavkin,S., Makarova,K.,
RA   Koonin,E., Mills,D.A. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (22-JUN-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000420.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662188
CC   Source DNA and bacteria available from Robert Hutkins
CC   (rhutkins1@unl.edu)
CC   Contacts: Robert Hutkins (rhutkins1@unl.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by Kira Makarova and Eugene Koonin
CC   Finishing done by Fidelity Systems Inc. (Gaithersburg)URL --
CC   http://www.fidelitysystems.com
CC   Project Information available at:
CC   http://genome.jgi-psf.org/mic_home.html
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4449
FT                   /strain="LMD-9"
FT                   /mol_type="genomic DNA"
FT                   /organism="Streptococcus thermophilus LMD-9"
FT                   /plasmid="1"
FT                   /db_xref="taxon:322159"
FT   gene            complement(65..385)
FT                   /db_xref="GeneID:4405942"
FT                   /locus_tag="STER_A1"
FT   CDS_pept        complement(65..385)
FT                   /locus_tag="STER_A1"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116326680"
FT                   /db_xref="GeneID:4405942"
FT                   /translation="MVNWTQLFNRNERQDSSKDEWAEYTEKSLQDFMKSEFMQSFAEDC
FT                   SQMLKDEGNEFYESYDTIKAKMNSVLTDFGYMSLEVYEDAFSEEKQLEDLLKFKAEYLA
FT                   SK"
FT                   /protein_id="YP_796427.1"
FT   gene            complement(1030..1611)
FT                   /db_xref="GeneID:4405943"
FT                   /locus_tag="STER_A2"
FT   CDS_pept        complement(1030..1611)
FT                   /locus_tag="STER_A2"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE or related
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116326681"
FT                   /db_xref="GeneID:4405943"
FT                   /translation="MSEFYPANRIAVEIDDVLRMLSYVCDKISSRQKIVADGVKTHQKM
FT                   GLRAYDLGLSPIVVMADEIGSLVASMDSKQKKEFLALVTQIVQKGRSVSCFAIFGTQSP
FT                   KTDTTLSSDIRSQFATKILLGLASGENQRMAFDGEVARKGNIERFKGFYVSDGKTEQPM
FT                   LFHVPDLHSHGLNDLKIIKKAYELGFSGNQ"
FT                   /protein_id="YP_796428.1"
FT   misc_feature    complement(1300..>1584)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="STER_A2"
FT   gene            complement(2378..3484)
FT                   /db_xref="GeneID:4405944"
FT                   /locus_tag="STER_A3"
FT   CDS_pept        complement(2378..3484)
FT                   /locus_tag="STER_A3"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:116326682"
FT                   /db_xref="GeneID:4405944"
FT                   /translation="MGRNPYASMVYKVDWFAFTVSDEIDTNGAEKGFVLLENLGYDLDE
FT                   FEPIPGRYFYNSGLTLGGYVNLYYNDYEKNLARNTSNSRNYVFTGQGCTDLAQKINNDW
FT                   VGLFSILKKLGVKITRFDIALDDFNGVLSFPRMENKLVKGHYRSSKKTYNVVKQADVNG
FT                   DIKGYTLYIGSQAKSSTGTYFLRCYDKFAQYKEKAQIPPKEAIDTGIWQRYEISYTKKK
FT                   ARKIVDLMTDEGRTIGSVFMDTMRDIVEFLEPTKTQAKAIHKNKNRWKVSKWWQDFLDS
FT                   AEKVQLGEAERDLDLGGLLRWLRVSVVPALKLLEELGDAKGFDIHQIIKDITPSDYSKK
FT                   QKRLFNNAMKQSSREIMTYLERFKEGEY"
FT                   /protein_id="YP_796429.1"
FT   misc_feature    complement(2492..3145)
FT                   /note="Replication initiation factor; Region: Rep_trans;
FT                   pfam02486"
FT                   /db_xref="CDD:145562"
FT                   /locus_tag="STER_A3"
FT   gene            complement(3609..4016)
FT                   /db_xref="GeneID:4405945"
FT                   /locus_tag="STER_A4"
FT   CDS_pept        complement(3609..4016)
FT                   /locus_tag="STER_A4"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116326683"
FT                   /db_xref="GeneID:4405945"
FT                   /translation="MSEEQTNGLSQLRKLQALQAQKKAQAKTSSMVKLENIVGVYLGTE
FT                   PTEHFPKILDSNGNKVQEEKNGRKVDKRSETSDGWTYTFAEFATCKTIKIVLPQRVNVQ
FT                   LMGAYKLGGLGYDIKSGNMYFIEKDTTITNY"
FT                   /protein_id="YP_796430.1"
SQ   Sequence 4449 BP; 1350 A; 967 C; 679 G; 1453 T; 0 other;
     TCCTCCCTTT CCGTATTGTT GACCTTGTGC TTTTTCGATT GTGCCGACGA AAAGAATAAA        60
     CCAACTACTT AGAAGCTAGA TATTCAGCCT TAAATTTCAA CAAGTCTTCA AGTTGCTTTT       120
     CTTCAGAAAA AGCATCTTCA TACACTTCAA GTGACATATA CCCAAAATCT GTAAGAACAG       180
     AATTCATTTT AGCTTTGATT GTATCATAAC TTTCATAAAA CTCATTACCT TCGTCTTTTA       240
     GCATTTGACT ACAATCTTCA GCAAAACTTT GCATAAACTC AGATTTCATA AAGTCTTGAA       300
     GACTTTTTTC AGTATATTCA GCCCATTCAT CTTTTGAAGA ATCTTGACGT TCATTGCGAT       360
     TAAATAATTG TGTCCAATTT ACCATAATGT AAATCCTCCT TTCTTTCTTT GTACTTTTAT       420
     TATACCACGC TTTTATATAA TATTAAGGGA GGGTTTCATA TCTAGAAAAC CCATTAATAC       480
     CAACGATTAA CAGACTTTTC TTGCACTTTT AATTTGACTA AATTTGCCGA TTTTGCTAAA       540
     ATAAATGCAC CTATTTGGTC AATTTTATAA CTAATTAAGC AGAAAAGAGA CATATATGTC       600
     AAAATATAAA AGAAAATTAA ACATAAAATG GTTTGCAACT ACAAAGCTAG GAATCGAAGA       660
     GCTTGCCAAA AATACAGACT TCTCATTAAC ATCATCAGAT TTCAGACTTC TGTTTTATTT       720
     ACTTTCAAAA ATTGATGAGG ACAATCTAGC AACCTTACCA AAACAAAAAG ATATATCTAC       780
     TGAAATAAAT ATTTCAGTAA GAAAAATCTC AGAAGGATTA CGACGATTAC ATGAAGCTAA       840
     AATCATAGTC AAATCTGGTA AGCCAAAAAC TTATTTCATC AATCCAGCCT TTTTTTACAC       900
     TGGAGGAGCT CAAGTTTTAG AACTTAAACA AGAAGATTTT GACAGTAACT TTGCCCCCAA       960
     AGTAGACACA TATACTCCAA TCGCTGATGC TGCTGAACTA GAACGTCAAT TACAAACCAA      1020
     TCCATATCTT TATTGATTAC CCGAAAAGCC TAATTCATAG GCTTTTTTTA TGATTTTTAA      1080
     GTCATTTAAA CCATGTGAGT GTAGGTCAGG AACATGAAAC AACATCGGCT GTTCTGTTTT      1140
     ACCATCAGAC ACGTAGAAGC CTTTAAAACG CTCTATATTA CCTTTTCTTG CCACTTCCCC      1200
     ATCAAAAGCC ATACGTTGAT TTTCGCCACT AGCCAACCCT AATAATATCT TAGTAGCGAA      1260
     CTGGCTTCTA ATATCGCTTG ATAACGTAGT ATCAGTTTTA GGCGACTGTG TTCCGAATAT      1320
     TGCAAAGCAA GAAACGCTAC GTCCTTTTTG AACAATCTGA GTGACAAGGG CTAAAAATTC      1380
     TTTTTTCTGC TTACTATCCA TTGAAGCCAC TAACGACCCA ATTTCATCAG CCATTACAAC      1440
     GATAGGTGAC AAACCTAAAT CATAGGCACG TAAGCCCATT TTTTGATGTG TTTTGACACC      1500
     GTCAGCAACT ATCTTTTGGC GTGAGCTAAT TTTATCGCAA ACATACGACA ACATTCTCAA      1560
     AACGTCATCA ATTTCAACTG CAATACGGTT AGCTGGATAA AATTCAGACA TAGCACTAAA      1620
     TTCATTTTTA GGGTCAACTA TATAGATTTC AGATTTCGAC CACATCAATG ATTGAACAAG      1680
     CAAAGATATT AAGGTAGTTG ATTTGCCAGC TCCTGATTTC CCCCAACAAA TGATATGTGG      1740
     GAAATCAGCT AGATTTATCT TCAATCCTTC TTGTAAGGTC AACACGTGAC TAGGTTGTTT      1800
     CATCTGTTTT AAGGTCGCTG GTCGCCAAGT TTTATCAGTT GCCACGTCTT CTAGTACAAA      1860
     TTTATAAGTC AGTCCGTCCG TCGTTATCAT TCCAGACGTT ACTGCATAAC AGCCTAATTT      1920
     CCCTTTAAAG CTAGAATTTA TATCTTCTGT CAGTCTCTCG ATGTCGTACA TACCAGCTAA      1980
     TTTCTCGACT TCTACGCTGA TGCGTGAGGG TCTGCTATCA CACACCCTCA CGCTCGGAAC      2040
     CGAAATAAAG GGGGTATCTT GCAGACGATT AACTGACATT GTAGCCAGCA AGCTCTTAGT      2100
     AACCGCCTTT TCTGCTCCTC GTTGTGTGAT ATATTTGCCG ATTGTCCCCG CTTTGATCAC      2160
     TGACTTTGTC AGTGAATACG CTCGCCAAAT CGTCAAAATA GCGACCAGCG ACCAAAGCCC      2220
     AATTATGCCA AATTGGCATA ATTTAGACGG AACAAAATAA CCAATTACCA AAAACAATAC      2280
     CGCAAGCCCA AAGACTAGCC CCCACCATGC CAAAAATTGA GCGTATAAAG GCACTTTATA      2340
     GACGTTTTGA GCGTTCTTTT TATACGTCTT TGCCATATTA GTATTCACCT TCTTTAAAGC      2400
     GCTCGAGATA AGTCATAATC TCACGACTTG ACTGCTTCAT TGCATTGTTA AACAGACGTT      2460
     TCTGTTTTTT CGAATAATCA CTTGGCGTAA TATCTTTAAT AATTTGATGA ATATCAAAAC      2520
     CTTTTGCATC CCCAAGTTCT TCCAGCAACT TTAAGGCTGG CACAACTGAT ACACGCAACC      2580
     AGCGAAGCAA ACCGCCTAAA TCTAAGTCCC GTTCTGCTTC TCCAAGTTGA ACTTTTTCAG      2640
     CACTATCAAG GAAATCTTGC CACCATTTCG AAACTTTCCA ACGATTCTTA TTCTTATGGA      2700
     TTGCCTTTGC TTGCGTTTTC GTCGGCTCTA AAAATTCAAC AATGTCTCTC ATCGTATCCA      2760
     TGAAAACAGA ACCGATAGTT CGTCCCTCAT CCGTCATTAA ATCAACGATT TTACGGGCTT      2820
     TCTTCTTTGT ATATGAAATC TCATAACGTT GCCAAATTCC CGTGTCTATC GCTTCTTTTG      2880
     GCGGAATTTG TGCCTTTTCT TTGTATTGAG CAAATTTATC GTAACACCGT AGAAAATACG      2940
     TCCCAGTGCT CGACTTCGCT TGTGAGCCAA TATATAGAGT ATATCCTTTA ATGTCGCCGT      3000
     TTACGTCGGC TTGCTTAACA ACGTTATAAG TCTTTTTAGA CGACCTATAA TGTCCCTTAA      3060
     CTAGTTTATT TTCCATCCTC GGAAAACTAA GAACTCCATT GAAATCATCT AACGCAATAT      3120
     CAAAACGCGT AATTTTTACA CCTAATTTTT TTAAGATTGA AAATAGTCCA ACCCAATCAT      3180
     TATTGATTTT TTGCGCCAAA TCCGTGCAAC CTTGACCCGT AAAAACATAA TTACGACTAT      3240
     TCGACGTGTT ACGTGCCAAA TTTTTCTCGT AATCGTTATA GTAAAGATTT ACATATCCGC      3300
     CCAATGTTAA ACCAGAATTA TAGAAATAAC GTCCTGGAAT TGGTTCAAAT TCGTCTAAAT      3360
     CATAACCTAA ATTTTCAAGC AAAACGAAGC CTTTTTCAGC TCCATTTGTG TCTATTTCAT      3420
     CAGACACAGT AAAAGCGAAC CAGTCAACCT TGTAAACCAT TGATGCGTAA GGGTTTCTAC      3480
     CCATTCTAAC ACCCCTATTC TCGTATCTGT AGACCCCCTG ATTAGTGTTC GGGGTCTATC      3540
     TGCTGGAACC TAGTTCCAGC AGTCCCGAAA TTTCTATTTT AGCAATGACA TAAATGTCAT      3600
     GTTCAAATCT AGTAATTTGT GATAGTCGTA TCTTTTTCAA TAAAGTACAT GTTACCCGAT      3660
     TTAATGTCAT AACCTAAACC GCCTAACTTA TAAGCCCCCA TTAGTTGCAC GTTTACACGT      3720
     TGTGGAAGTA CAATCTTAAT CGTCTTACAA GTCGCAAATT CAGCAAACGT ATAAGTCCAC      3780
     CCATCCGATG TTTCTGACCG TTTATCTACT TTTCGACCGT TCTTTTCTTC CTGTACTTTG      3840
     TTTCCGTTAC TATCTAGAAT TTTCGGAAAG TGTTCAGTCG GCTCAGTTCC CAGGTAAACA      3900
     CCAACAATAT TTTCTAATTT GACCATGCTC GATGTCTTGG CTTGTGCCTT TTTTTGAGCT      3960
     TGTAGAGCTT GCAATTTTCG CAATTGTGAT AATCCGTTTG TTTGTTCTTC TGACATATAA      4020
     AAAATGTCCT TTCTTTAGTG AATTTTTAAC GCTTGTACAC CGCCAAAATT TACTAAAGAA      4080
     AAGACACTAA GATATTTTTT TTCAAAATTT CATAACTTGA CCGTAAGAGA TAAAGTTTGA      4140
     TATAATGAAG TTGCGAATAT TTAGGGTCTT GTAAAGTAAA CTTTGATCGG TTAGTACAAG      4200
     ACTTTTTTTT ATGCTTAAAA ACAGAATTGC GACGTTCTTT TTTAAGCTAT GTAGACATTA      4260
     TAACACAGAA AATCAATCAA TAAAAGACGG TCCCCCGTGT TCTGTTCCCG TGGGTTTCCA      4320
     CCCACACCCG ACAAGCGTAG GACGCTTGAC CCCACCTCTG AAAAGAATTA CTGCTCAGTT      4380
     GATTTATTCT TTTCGTCGGC TTTCACAATC TAGCACTTGA TCAACAATAC GGAAAGGGTC      4440
     GCTCTCGCT                                                              4449
//

If you have problems or comments...

PBIL Back to PBIL home page