(data stored in ACNUC7421 zone)

HOGENOMDNA: STRTD_2

ID   STRTD_2; SV 1; empty ; DNA; empty ; PRO; 3361 BP.
XX
AC   NC_008501;
XX
PR   Project: 58327;
XX
DE   Streptococcus thermophilus LMD-9 plasmid 2, complete sequence.
XX
OS   Streptococcus thermophilus LMD-9
OC   Bacteria; Firmicutes; Lactobacillales; Streptococcaceae; Streptococcus.
XX
RN   [1]
RP   1-3361
RX   PUBMED; 17030793.
RA   Makarova,K., Slesarev,A., Wolf,Y., Sorokin,A., Mirkin,B., Koonin,E.,
RA   Pavlov,A., Pavlova,N., Karamychev,V., Polouchine,N., Shakhova,V.,
RA   Grigoriev,I., Lou,Y., Rohksar,D., Lucas,S., Huang,K., Goodstein,D.M.,
RA   Hawkins,T., Plengvidhya,V., Welker,D., Hughes,J., Goh,Y., Benson,A.,
RA   Baldwin,K., Lee,J.H., Diaz-Muniz,I., Dosti,B., Smeianov,V., Wechter,W.,
RA   Barabote,R., Lorca,G., Altermann,E., Barrangou,R., Ganesan,B., Xie,Y.,
RA   Rawsthorne,H., Tamir,D., Parker,C., Breidt,F., Broadbent,J., Hutkins,R.,
RA   O'Sullivan,D., Steele,J., Unlu,G., Saier,M., Klaenhammer,T.,
RA   Richardson,P., Kozyavkin,S., Weimer,B. and Mills,D.;
RT   "Comparative genomics of the lactic acid bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 103 (42), 15611-15616 (2006)
XX
RN   [2]
RP   1-3361
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-OCT-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3361
RG   US DOE Joint Genome Institute (JGI), The Lactic Acid Bacteria
RA   Lucas,S., Copeland,A., Detter,J.C., Glavina del Rio,T., Pitluck,S.,
RA   Grigoriev,I., Rokhsar,D., Slesarev,A., Pavlov,A., Pavlova,N.,
RA   Karamychev,V., Polouchine,N., Shakhova,V., Kozyavkin,S., Makarova,K.,
RA   Koonin,E., Mills,D.A. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (22-JUN-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000421.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2662188
CC   Source DNA and bacteria available from Robert Hutkins
CC   (rhutkins1@unl.edu)
CC   Contacts: Robert Hutkins (rhutkins1@unl.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Annotation done by Kira Makarova and Eugene Koonin
CC   Finishing done by Fidelity Systems Inc. (Gaithersburg)URL --
CC   http://www.fidelitysystems.com
CC   Project Information available at:
CC   http://genome.jgi-psf.org/mic_home.html
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3361
FT                   /strain="LMD-9"
FT                   /mol_type="genomic DNA"
FT                   /organism="Streptococcus thermophilus LMD-9"
FT                   /plasmid="2"
FT                   /db_xref="taxon:322159"
FT   gene            complement(77..505)
FT                   /db_xref="GeneID:4405946"
FT                   /locus_tag="STER_B1"
FT   CDS_pept        complement(77..505)
FT                   /locus_tag="STER_B1"
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="molecular chaperone (small heat shock protein)"
FT                   /transl_table="11"
FT                   /db_xref="GI:116326685"
FT                   /db_xref="GeneID:4405946"
FT                   /translation="MLNKIQPRNSDTYSMTPFDFFEDFSRNLFNDFKSNLIKTDIHETD
FT                   NEYLVEAELPGIPKENIQVTYEDGVLTISGQQQIDTVDEDKKGKLIRSERSSTSLRRQY
FT                   LLENVKEDEIKASYSDGILKVTLPKDSNKEIKKSIPIE"
FT                   /protein_id="YP_796431.1"
FT   misc_feature    complement(119..397)
FT                   /note="Group of bacterial proteins containing an alpha
FT                   crystallin domain (ACD) similar to Lactobacillus plantarum
FT                   (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55
FT                   and HSP 19.3. sHsps are molecular chaperones that suppress
FT                   protein aggregation and...; Region: ACD_LpsHSP_like;
FT                   cd06471"
FT                   /db_xref="CDD:107228"
FT                   /locus_tag="STER_B1"
FT   misc_feature    complement(order(140..145,200..202,338..343,347..349,
FT                   353..355,374..388))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:107228"
FT                   /locus_tag="STER_B1"
FT   gene            2200..3144
FT                   /db_xref="GeneID:4405947"
FT                   /locus_tag="STER_B2"
FT   CDS_pept        2200..3144
FT                   /locus_tag="STER_B2"
FT                   /gene_family="HOG000008603" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid rolling circle replication initiator
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:116326686"
FT                   /db_xref="GeneID:4405947"
FT                   /translation="MDKIQNQEEILVDKNSRGKDRNWRGRKILSLKLADIFKELQYKDS
FT                   LIERVATCGDTLRFIRREDGSLKLYQAYFCKNKLCPMCNWRRSMKYSYQTSRIVDEAIK
FT                   QEPKARFLFLTLTVKNVEGEALNSTISQLTKSFDRLFRRAKVKKNLLGYLRSVEVTHNE
FT                   NDNTYHPHIHVLMMVKSSYFKGGNYISQIEWSGIWSQSLKVSYTPMVDIRTVKETGKGL
FT                   RGAVLETAKYPTKPIKLDVENMQVVDDLYNGLYRKRQLGYGGLFKTIKKQLQLDDVENG
FT                   DLIHTSDDKENISKGTEIVAIWNVTKQNYYLKK"
FT                   /protein_id="YP_796432.1"
FT   misc_feature    2464..3135
FT                   /note="Replication protein; Region: Rep_1; cl02412"
FT                   /db_xref="CDD:121293"
FT                   /locus_tag="STER_B2"
SQ   Sequence 3361 BP; 1096 A; 539 C; 640 G; 1086 T; 0 other;
     CAAGATTTTA ACACTCTCAA AAAAGAAAAG GCGCCTATAA AATTTTATAG ACGTCTCTTT        60
     TCGTAATTTT TAATTACTAC TCAATTGGAA TAGATTTTTT TATTTCTTTG TTGCTATCTT       120
     TTGGCAAGGT TACTTTAAGA ATTCCATCTG AATAAGAAGC CTTTATTTCG TCTTCTTTAA       180
     CATTTTCTAA TAAATATTGA CGTCGGAGAC TTGTTGAACT ACGTTCGCTA CGAATCAACT       240
     TTCCTTTTTT ATCTTCGTCT ACTGTATCAA TTTGTTGTTG CCCACTAATT GTTAATACTC       300
     CGTCTTCGTA AGTAACTTGA ATGTTTTCTT TAGGAATACC AGGAAGTTCA GCTTCTACAA       360
     GATATTCATT ATCAGTTTCA TGAATATCTG TTTTGATTAA ATTGGACTTA AAATCATTGA       420
     ATAAATTACG ACTAAAGTCT TCAAAAAAAT CAAAAGGCGT CATACTATAT GTGTCTGAGT       480
     TGCGTGGTTG AATCTTATTT AACATAATAA TCACTCCTTT CTATATTCTC ACTTCAATTG       540
     TTATTATAGT CCAAAAAAGT CAGTTTTCAA GTATTATGTC TTTGAAATTG TAAAATCGTG       600
     CTACGGGCGT TTTATAGGGG TTTAACAACG TCACTATTTT AGTTCGTCCA ACTGTTGGAC       660
     AATTAGGACG TTTTATACCG ACATTTTCTA ACAAATTCAA TTGTTCGCAA AACGAACAAA       720
     CAAACCTTGT TCTTTCTAGT ACACTAAATT TAATTGTTCC TAAATTGTGC GACGTGGTAG       780
     AATTTGGAAG CTCTTAAATG TCGTAACGTT TCGACATTTG GAAGCTCCTA AATGTTGTAA       840
     CGTTGCAATA TTTGGAAGTT CTTAAAAGCG ACTACGTGGT CGTATTTGAT ATATGTAGGG       900
     TGTAAAATTT TCCACGACCT AGCAAGAAAG AAAGTCAAAG ACTACGTTAT CAAGTTGGAA       960
     AATGTCCAAC CAAATTGGAA AAATTCCAAC CAGTTTCCAA CCAGTGTCCA ACAGAGATAG      1020
     AGTTAGAATT AGAGTTAAAT CTAGATATAA AGACAGAAGT AGAAGAGAGA AATAGACAGA      1080
     TGTCTTCTGC TACTGCTGAA TTACACTTAT AAGCGTCTAT CACAAACTGT TAGACAATTC      1140
     TAACCAAACG ACAACCATTT GGCAACCCAA TATAAGTAAA GATAATATAA GTAAAGTCAG      1200
     TATAAGTGAA GATAGTATAA GTGAATATAA TTCAGTAAAA GATAATTCAT GTGGTCAACT      1260
     TGGTTGGTTG AGTTGCCTTG AGCTGTTAGT CTTTTTTGAC TAATAGCTAT AAATTTTAGC      1320
     CAGGCGATTT ATGCCGAGAA AACTCTTGTC AGTAAGCTGA GCGATTTAGA CTGAAAGTGT      1380
     CTGAGTCGCA AGACTGAAAG CTTGCGATAA GGACACGAAG TCTAGAAAAT CAGCGAAAGG      1440
     TTACTTGCTG ACAAGAGGAA ATTGGAATAA AAAGCCTTAA TTTTTGAGTG ATGTGATTTC      1500
     TTCCATGTCA TATCTCTTTC ATATGCCCCT AATTCTCAAA TTTCGGGGGT TATTTGCCGT      1560
     TTTACCGTCT CTCTAGTAAA TGTACCGCTA GATTATTTAG GACGGTTACA AGCGATTTTA      1620
     GAGCCATTTC TTGCCCTTTT GGATAAAGTA AGCTCTGACT TGCTTTCCTT TATCGGTACG      1680
     CTGTATCATA GCAATTTATT TTGCTATGTT CAGCTTTATG ATGTGGTCGG TCATATCTTG      1740
     CAGATCTCCA AGGGTGGTAC ATTTTTGGGT CATCCTTAAA TAGTCCTCGT TTTTGGCAAA      1800
     ACCATATAGC TAGATGTTCG AACCTGCTCA AATTTGAGCG TATTGAAATC TTGATTTTGC      1860
     TGTGTAGTTG TAACTACGGA GCCATATTTC TCGTTGTTCT CTCGTGCTTC TTTGGTGAAT      1920
     TTTTCCTGAA AGTAAAAAGA GGGCTGAAAG CCCAAAAAAA GCAGTCGAAA GACTGCTTTC      1980
     TTCTTATCTT GATACTAGTA GGAAATAACT CTCACGCAAA AAACATATCA CCATGACCTT      2040
     GTAAACCCTT GATACTACTG GATTTTTAGG CAAAAAAAAA GCTCCTTTAC GGTATAAAGC      2100
     TTTCGTGTTA TAATTTAAGG TGCTTAATCA AAAATTATGA AAGGATAACG TAAGGAGTTT      2160
     TTTTTATTTC TTTGTTATTA TAACAGGTAA GATTATATCA TGGATAAAAT CCAAAATCAA      2220
     GAGGAAATTC TTGTCGATAA AAACAGCCGA GGAAAAGATA GGAATTGGAG AGGACGAAAA      2280
     ATATTAAGTT TGAAATTAGC TGATATCTTT AAAGAATTGC AGTACAAAGA TAGTCTTATT      2340
     GAGCGAGTGG CAACGTGTGG TGATACTTTG CGATTTATTC GGCGAGAAGA TGGTTCTTTA      2400
     AAATTATATC AGGCTTATTT CTGTAAAAAC AAGCTATGTC CTATGTGCAA TTGGAGACGT      2460
     TCAATGAAAT ACTCTTATCA GACATCAAGG ATTGTAGACG AAGCTATAAA ACAAGAACCT      2520
     AAAGCACGCT TCCTATTTCT GACATTGACT GTTAAGAATG TTGAGGGTGA AGCCTTGAAT      2580
     AGTACGATTA GTCAGCTGAC AAAATCATTT GACCGTTTAT TTAGACGTGC TAAAGTAAAG      2640
     AAAAATCTGT TAGGGTATTT ACGTTCTGTA GAAGTCACTC ATAACGAAAA TGATAATACA      2700
     TATCACCCTC ATATCCATGT TTTGATGATG GTAAAATCTA GTTATTTTAA AGGTGGGAAT      2760
     TACATTTCAC AAATAGAGTG GAGTGGAATA TGGTCGCAGT CACTCAAGGT CTCTTACACG      2820
     CCTATGGTAG ATATTCGAAC AGTCAAAGAG ACTGGCAAAG GACTGAGAGG GGCAGTCTTG      2880
     GAAACCGCAA AATATCCAAC TAAACCGATT AAGCTTGATG TAGAGAATAT GCAAGTGGTA      2940
     GATGACCTAT ATAACGGTCT GTATCGAAAA AGACAACTCG GCTATGGTGG TCTATTTAAG      3000
     ACAATCAAGA AGCAATTACA ACTTGATGAT GTTGAAAATG GCGATTTAAT TCATACGTCT      3060
     GACGATAAAG AAAATATCTC AAAAGGTACA GAAATAGTCG CTATTTGGAA CGTCACAAAG      3120
     CAAAATTATT ATCTGAAAAA ATAAAATCAA GCTTCTCGAA AGAGGGGCTT TTTTTATTGT      3180
     ATGACACCCC TTAAAATTCT AGAAAATTGG TGCGTGACGT GAGAAAATAC CTTGTGGTGG      3240
     CTCTCCTAAG CACGAGAATG GGCGGGGGGC GTTTTAAATA GTATCAAGGG TAAATCTACC      3300
     AGTCAACTAT AAAATCGTGC TACGGGCTTT TTAGAGGGCT TTAGTGATGT CCTAGAAAAA      3360
     T                                                                      3361
//

If you have problems or comments...

PBIL Back to PBIL home page