(data stored in ACNUC7421 zone)

HOGENOMDNA: SULAA_1

ID   SULAA_1; SV 1; empty ; DNA; empty ; PRO; 1640877 BP.
XX
AC   NC_012438;
XX
PR   Project: 58121;
XX
DE   Sulfurihydrogenibium azorense Az-Fu1 chromosome, complete genome.
XX
OS   Sulfurihydrogenibium azorense Az-Fu1
OC   Bacteria; Aquificae; Aquificales; Hydrogenothermaceae;
OC   Sulfurihydrogenibium.
XX
RN   [1]
RP   1-1640877
RX   PUBMED; 19136599.
RA   Reysenbach,A.L., Hamamura,N., Podar,M., Griffiths,E., Ferreira,S.,
RA   Hochstein,R., Heidelberg,J., Johnson,J., Mead,D., Pohorille,A.,
RA   Sarmiento,M., Schweighofer,K., Seshadri,R. and Voytek,M.A.;
RT   "Complete and draft genome sequences of six members of the Aquificales";
RL   J. Bacteriol. 191 (6), 1992-1993 (2009)
XX
RN   [2]
RP   1-1640877
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (25-MAR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1640877
RA   Reysenbach,A.-L., Heidelberg,J.F. and Nelson,W.C.;
RT   "Direct Submission";
RL   Submitted (13-NOV-2008) The Institute for Genomic Research, 9712 Medical
RL   Center Dr, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001229.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1640877
FT                   /strain="Az-Fu1"
FT                   /mol_type="genomic DNA"
FT                   /organism="Sulfurihydrogenibium azorense Az-Fu1"
FT                   /db_xref="taxon:204536"
FT   gene            complement(683..758)
FT                   /db_xref="GeneID:7673768"
FT                   /locus_tag="SULAZ_0002"
FT   tRNA            complement(683..758)
FT                   /db_xref="GeneID:7673768"
FT                   /locus_tag="SULAZ_0002"
FT                   /product="tRNA-Thr"
FT   gene            complement(825..900)
FT                   /db_xref="GeneID:7673215"
FT                   /locus_tag="SULAZ_0003"
FT   tRNA            complement(825..900)
FT                   /db_xref="GeneID:7673215"
FT                   /locus_tag="SULAZ_0003"
FT                   /product="tRNA-Gly"
FT   gene            complement(905..992)
FT                   /db_xref="GeneID:7673744"
FT                   /locus_tag="SULAZ_0004"
FT   tRNA            complement(905..992)
FT                   /db_xref="GeneID:7673744"
FT                   /locus_tag="SULAZ_0004"
FT                   /product="tRNA-Tyr"
FT   gene            complement(1001..1078)
FT                   /db_xref="GeneID:7673747"
FT                   /locus_tag="SULAZ_0005"
FT   tRNA            complement(1001..1078)
FT                   /db_xref="GeneID:7673747"
FT                   /locus_tag="SULAZ_0005"
FT                   /product="tRNA-Thr"
FT   gene            complement(1663..3036)
FT                   /db_xref="GeneID:7673763"
FT                   /locus_tag="SULAZ_0007"
FT   CDS_pept        complement(1663..3036)
FT                   /locus_tag="SULAZ_0007"
FT                   /gene_family="HOG000101642" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF01637;
FT                   match to protein family HMM PF03008"
FT                   /db_xref="GI:225847841"
FT                   /db_xref="GeneID:7673763"
FT                   /translation="MRFINREEELQILEQEYKKDTSSFVVIYGRRRTGKTTLIEKFIEN
FT                   KEAVYFLATLQNEKLQIESFKNVVSEVLNDDLLKSLTVENWETIFKYIATKVQKKLIIV
FT                   IDEFQYLAQVNSSIPSIFQSIWDNLLKNKNLMLILCGSLIGLMYKTTLGYTSPLYGRRT
FT                   AQIKLKPMNFKNFKKFFKSLDNLKLLEFYSVIGGIPRYIEIFDETLDVFENIRRNVLHK
FT                   NSYLYEEPKFILKEEIKDPITYFSILQVISQGEHKIGKIASKLGMQTQNLTSFIEKLIE
FT                   LDILERKVPITEENPEKSKKGLYFIKDNFFNFWFKYVFPYQNYLETGKYDYVLDKIKSD
FT                   FHVFESFTFEEIVLEYIYDLDIPFHIYKAGKWWDKDTEIDVVAVGEDSILFGECKYWDS
FT                   LVGVNVLHQLKEKAKKVDWKKDKRKEYYAVFSKIGFTKELIDLAKKDKSILLFNFQEF"
FT                   /protein_id="YP_002728004.1"
FT   misc_feature    complement(2422..3030)
FT                   /note="Archaeal ATPase; Region: Arch_ATPase; pfam01637"
FT                   /db_xref="CDD:145008"
FT                   /locus_tag="SULAZ_0007"
FT   misc_feature    complement(1849..2097)
FT                   /note="Archaea bacterial proteins of unknown function;
FT                   Region: DUF234; pfam03008"
FT                   /db_xref="CDD:145908"
FT                   /locus_tag="SULAZ_0007"
FT   gene            complement(3084..4226)
FT                   /db_xref="GeneID:7674063"
FT                   /locus_tag="SULAZ_0008"
FT   CDS_pept        complement(3084..4226)
FT                   /locus_tag="SULAZ_0008"
FT                   /gene_family="HOG000062784" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair exonuclease"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00619"
FT                   /db_xref="GI:225847842"
FT                   /db_xref="GeneID:7674063"
FT                   /translation="MRFLHLSDTHLGYHQYGLVERSKDYFDAFMSVVDVAIENKVDFII
FT                   HTGDFFHTHRPSNQTLLEGIEIVRRLNDHNIPIFTVAGNHDRGSGVRDTTALEILKHIG
FT                   LKVLDAGVDDSLGVNIFGLKYISPIFIKRNLKLEEILEKLYDKTQSKNNFNILMLHLEF
FT                   EPFFNSGLKLEHYLPEGMYNYVGIGHYHQRQEPINLNGSTVVYSGSTEYTQFNEKTYTE
FT                   KGCYVVEVENGSSRAEFVPIKNRMFLSYSFDDETLMDVIKSIKELELPTDKKPILFLKG
FT                   KTKKFLTNKEVLEILQKEALMDRFLHVSCDVVNQSKKILDFQVIQEEDKSTTIKEKLKE
FT                   LLEEDELLIKVEKVLEEIKAFENLKDFEDYIESHQEFLEL"
FT                   /protein_id="YP_002728005.1"
FT   misc_feature    complement(3579..4223)
FT                   /note="Mre11 nuclease, N-terminal metallophosphatase
FT                   domain; Region: MPP_Mre11_N; cd00840"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="SULAZ_0008"
FT   misc_feature    complement(order(3654..3662,3747..3749,3972..3977,
FT                   4080..4082,4197..4199,4203..4205))
FT                   /note="active site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="SULAZ_0008"
FT   misc_feature    complement(order(3654..3656,3660..3662,3747..3749,
FT                   3975..3977,4080..4082,4197..4199,4203..4205))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="SULAZ_0008"
FT   misc_feature    complement(order(3846..3851,3957..3962,3966..3968,
FT                   4071..4073,4173..4193))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="SULAZ_0008"
FT   gene            complement(4223..4423)
FT                   /db_xref="GeneID:7672625"
FT                   /locus_tag="SULAZ_0009"
FT   CDS_pept        complement(4223..4423)
FT                   /locus_tag="SULAZ_0009"
FT                   /gene_family="HOG000062785" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:225847843"
FT                   /db_xref="GeneID:7672625"
FT                   /translation="MTPMRIQRIMMGIILITGLLLDLNGVEWGKYLIWFVALMALFAGI
FT                   TGFCPSDTVLKKITGKETMCG"
FT                   /protein_id="YP_002728006.1"
FT   gene            complement(4447..5133)
FT                   /db_xref="GeneID:7672586"
FT                   /locus_tag="SULAZ_0010"
FT   CDS_pept        complement(4447..5133)
FT                   /locus_tag="SULAZ_0010"
FT                   /gene_family="HOG000062631" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:225847844"
FT                   /db_xref="GeneID:7672586"
FT                   /translation="MMEEDERLSRPYRPVIPIVFYHGEKPWNIPTKIPQLKNIKENLRD
FT                   YIHSLSYILFDTSKVEDTFLVDKLYANACLMSAIYTMKNIFKDLQSLKPILEKLILADV
FT                   KDCLYIIIDYTVIIKKDLETIEKVLEEIGGEEKMMTLTEKWKMEGLKKGMEEGLKKGIE
FT                   QGLQQGLQQGLVEGLRQSIFDAVELKFGYVEDALKEKISRISDVDLLKEIHRKIILAKS
FT                   LNDIII"
FT                   /protein_id="YP_002728007.1"
FT   misc_feature    complement(4708..>5094)
FT                   /note="Putative transposase, YhgA-like; Region:
FT                   Transposase_31; pfam04754"
FT                   /db_xref="CDD:147088"
FT                   /locus_tag="SULAZ_0010"
FT   gene            complement(5241..5441)
FT                   /db_xref="GeneID:7673349"
FT                   /locus_tag="SULAZ_0011"
FT   CDS_pept        complement(5241..5441)
FT                   /locus_tag="SULAZ_0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:225847845"
FT                   /db_xref="GeneID:7673349"
FT                   /translation="MSIEKSPHDWLFKMIFSQEQNVKSFLEIFLPQVYQIILPNSLKLS
FT                   DTEKLSKKYKKFFLILPLTVK"
FT                   /protein_id="YP_002728008.1"
FT   misc_feature    complement(<5268..5426)
FT                   /note="Putative transposase, YhgA-like; Region:
FT                   Transposase_31; pfam04754"
FT                   /db_xref="CDD:147088"
FT                   /locus_tag="SULAZ_0011"
FT   gene            complement(5453..8020)
FT                   /db_xref="GeneID:7672815"
FT                   /locus_tag="SULAZ_0012"