(data stored in ACNUC8465 zone)

HOGENOMDNA: SULIN_2

ID   SULIN_2; SV 1; empty ; DNA; empty ; PRO; 42245 BP.
XX
AC   NC_012624;
XX
PR   Project: 58825;
XX
DE   Sulfolobus islandicus Y.N.15.51 plasmid pYN01, complete sequence.
XX
OS   Sulfolobus islandicus Y.N.15.51
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Sulfolobus.
XX
RN   [1]
RP   1-42245
RX   PUBMED; 19435847.
RA   Reno,M.L., Held,N.L., Fields,C.J., Burke,P.V. and Whitaker,R.J.;
RT   "Biogeography of the Sulfolobus islandicus pan-genome";
RL   Proc. Natl. Acad. Sci. U.S.A. 106 (21), 8605-8610 (2009)
XX
RN   [2]
RP   1-42245
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (29-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-42245
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Dalin,E.,
RA   Tice,H., Pitluck,S., Sims,D.R., Brettin,T., Bruce,D., Detter,J.C., Han,C.,
RA   Kuske,C.R., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Anderson,I., Whitaker,R.J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (30-JAN-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001405.
CC   URL -- http://www.jgi.doe.gov
CC   http://www.life.uiuc.edu/S.islandicus
CC   JGI Project ID: 4005359
CC   Source DNA and archaea available from Rachel Whitaker
CC   (rwhitaker@life.uiuc.edu)
CC   Contacts: Rachel Whitaker (rwhitaker@life.uiuc.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC   Organism display name:  Sulfolobus islandicus Y.N.15.51
CC   GOLD ID:  Gi01319 http://genomesonline.org/GOLD_CARDS/Gi01319.html
CC   Sequencing Status:  Complete
CC   Phenotypes:  Acidophile
CC   Diseases:  None
CC   Habitat:  Fresh water, Hot spring
CC   Oxygen Requirement:  Facultative
CC   Cell Shape:  Coccus-shaped
CC   Motility:  Nonmotile
CC   Sporulation:  Nonsporulating
CC   Energy Source:  Lithotroph
CC   Temperature Range:  Hyperthermophile
CC   Biotic Relationship:  Free living
CC   Isolation:  Hot spring at Yellowstone National Park.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..42245
FT                   /strain="Y.N.15.51"
FT                   /mol_type="genomic DNA"
FT                   /organism="Sulfolobus islandicus Y.N.15.51"
FT                   /plasmid="pYN01"
FT                   /db_xref="taxon:419942"
FT   gene            23..985
FT                   /db_xref="GeneID:7803133"
FT                   /locus_tag="YN1551_3172"
FT   CDS_pept        23..985
FT                   /locus_tag="YN1551_3172"
FT                   /gene_family="HOG000107926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transport protein, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288720"
FT                   /db_xref="GeneID:7803133"
FT                   /translation="MISKKEFLPILAYSIPTYVLVYPSFFVNTLAREFPYWEAFLLLSL
FT                   PFLGRVVGSLIYQFFKSYIIPLLTLSILTLLQIDLNIIFPVRFLIGIIFGLMTSYAVDN
FT                   AVKTNNLVLGLTTAGWSIGWILSYIAYTTIHNWNQICIISSIIIVSIALLDRRVSLDKI
FT                   KINISLPKTSSIIVYFSALTPAFTLQIIPSIFEKAHTTWLILPSYLLSIAAYTILPIIA
FT                   SKIGLKRCIIITTLGILISGITTFLITPYTLLPYTSLGLGILSLIPKYLTTKNEKANTL
FT                   GIALNIGSIGGLIIPTLYTIIPTSPESILIITSIILLTI"
FT                   /protein_id="YP_002841972.1"
FT   gene            1034..1225
FT                   /db_xref="GeneID:7803081"
FT                   /locus_tag="YN1551_3173"
FT   CDS_pept        1034..1225
FT                   /locus_tag="YN1551_3173"
FT                   /gene_family="HOG000271120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288721"
FT                   /db_xref="GeneID:7803081"
FT                   /translation="MISPDLAIKILLLVPSVIFFFYSAVYLMLFELNVQPKLSKFYRNT
FT                   SLVLAGGGILLLTIYLMI"
FT                   /protein_id="YP_002841973.1"
FT   gene            1255..1452
FT                   /db_xref="GeneID:7803082"
FT                   /locus_tag="YN1551_3174"
FT   CDS_pept        1255..1452
FT                   /locus_tag="YN1551_3174"
FT                   /gene_family="HOG000271121" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288722"
FT                   /db_xref="GeneID:7803082"
FT                   /translation="MANANGTVKEMAEKTGIKEEAVYHLLEFLTIAGIVKKENDRYSID
FT                   KTMRTIAQLLIDFKDGDDVN"
FT                   /protein_id="YP_002841974.1"
FT   gene            1449..1823
FT                   /db_xref="GeneID:7803083"
FT                   /locus_tag="YN1551_3175"
FT   CDS_pept        1449..1823
FT                   /locus_tag="YN1551_3175"
FT                   /gene_family="HOG000271122" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288723"
FT                   /db_xref="GeneID:7803083"
FT                   /translation="MKKIVIKTELPYNYRKLKGFFISPGVLRLFYDVKSVEVAGNLSYI
FT                   INNKYNAIMYFSNVDIVWEIYNGRLKDKISVWLYPIGDNTGLHLKFETNRILPLKKPLE
FT                   NEVKAGVELLKSLLDALRRF"
FT                   /protein_id="YP_002841975.1"
FT   gene            1823..2377
FT                   /db_xref="GeneID:7803084"
FT                   /locus_tag="YN1551_3176"
FT   CDS_pept        1823..2377
FT                   /locus_tag="YN1551_3176"
FT                   /gene_family="HOG000270898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF1286"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288724"
FT                   /db_xref="GeneID:7803084"
FT                   /translation="MKLRTHYIFSTGLLTLLDSVLFHEYFYYALILSGIVSVIGNSLID
FT                   RIGHKEIATRYGYIPVRTPLTHTIPRSVVWGIVSVVPVFILLLIYYYGFSYHEYYFSLS
FT                   NKVVLLILLNGVVVGPSHLFLDVFTERGIYHKVNGKWRRFALAHFSYDNPLVNGLAILL
FT                   GIIMLLAALYLHNYHYYNYYF"
FT                   /protein_id="YP_002841976.1"
FT   misc_feature    1823..>2038
FT                   /note="Protein of unknown function (DUF1286); Region:
FT                   DUF1286; pfam06939"
FT                   /db_xref="CDD:148513"
FT                   /locus_tag="YN1551_3176"
FT   gene            3198..3449
FT                   /db_xref="GeneID:7803085"
FT                   /locus_tag="YN1551_3178"
FT   CDS_pept        3198..3449
FT                   /locus_tag="YN1551_3178"
FT                   /gene_family="HOG000270372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288725"
FT                   /db_xref="GeneID:7803085"
FT                   /translation="MEVKIEKHKSRFTITQLILMAMAKAPGSCCSLEYLHEKTGVDKKE
FT                   LLVYLTRLAKRGIIERKWHKSRAGKERMYCLKYKEDIL"
FT                   /protein_id="YP_002841977.1"
FT   misc_feature    3222..3446
FT                   /note="Sulfolobus plasmid regulatory protein; Region:
FT                   Sulfolobus_pRN; pfam05584"
FT                   /db_xref="CDD:114314"
FT                   /locus_tag="YN1551_3178"
FT   gene            3446..4588
FT                   /db_xref="GeneID:7803086"
FT                   /locus_tag="YN1551_3179"
FT   CDS_pept        3446..4588
FT                   /locus_tag="YN1551_3179"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288726"
FT                   /db_xref="GeneID:7803086"
FT                   /translation="MSPPNDKFLEYAKALLETAESDLDASKFLWDCNYQAQSVFYLQQS
FT                   TEKIFKAFRSMYQYLFVEFPEFITEELIASSNSRVTNLMPYLTLLNLRLKERKLNIKGL
FT                   EDLLKKEYSHGLKKGLKGEIDELKKELEYDKVILKGIFSQLQYTNITNNIDSAIYSLIN
FT                   NLLSPQGNQQNIEKELKDIEGIIESINNVTSFLQKFVGEIKKQPSSIPLQSSSRNSSNL
FT                   VDIILDEVLPSILTVLILPFKLYNIASYLAQFEENSRYPQINNGNIEIPQDIIRNWSNN
FT                   YSSIYGNLYEVIKEILNNFKKTDQFLLDIHYRVIQRNYSMDSILNDILGFIDFINNIFP
FT                   ILLQKNILQKIINIINKDKIDENDIEQLANELIKTLEKVI"
FT                   /protein_id="YP_002841978.1"
FT   misc_feature    3479..>3640
FT                   /note="HEPN domain; Region: HEPN; cl00824"
FT                   /db_xref="CDD:154022"
FT                   /locus_tag="YN1551_3179"
FT   gene            4908..6167
FT                   /db_xref="GeneID:7803087"
FT                   /locus_tag="YN1551_3180"
FT   CDS_pept        4908..6167
FT                   /locus_tag="YN1551_3180"
FT                   /gene_family="HOG000270382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288727"
FT                   /db_xref="GeneID:7803087"
FT                   /translation="MLIDISKLDEQQRKRIIKKLVEKLGLSQAAKMLDVGRSTLYRYVN
FT                   SDQSIPLDIVRKAAEMLASDELSDAIYGLKVVDVDFTTALSVVVKAMKDEKFRNFFVSI
FT                   LYQYLGDYLKNVSSTYIVTEEDVKKFEKLLQGKSKSTIVMRMRYLRIALTKLGYELSPD
FT                   SIRDLIAELSEDSSNVARHTANSLKLFIKTVVKEKNLQLAQLLYNSFKVPKSKYKYKPQ
FT                   PLSLETLRRIFDNIEHLGAKAFFLLLSESGLRVGEVYSLKMDQLDLENRIIKVMKESET
FT                   KRAYISFIHTETRKWLQEVYFPYREEFIRTYEHVVGHIGADVEAWKQKLFPFQLADLRS
FT                   SIKEGMRKVLGKEFRLYDLRSFFASYLIKNGVSPMIVNILQGRAPPAQFQILQNHYFVM
FT                   SEIELKKIFDEKGPKLLSPK"
FT                   /protein_id="YP_002841979.1"
FT   misc_feature    4956..5093
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="YN1551_3180"
FT   misc_feature    5382..>5714
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="YN1551_3180"
FT   misc_feature    5583..6038
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="YN1551_3180"
FT   misc_feature    order(5667..5669,5781..5783,5976..5978,5985..5987)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="YN1551_3180"
FT   misc_feature    order(5667..5669,5976..5978,5985..5987)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="YN1551_3180"
FT   misc_feature    order(5667..5672,5781..5783,5970..5978)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="YN1551_3180"
FT   gene            complement(6145..6432)
FT                   /db_xref="GeneID:7803088"
FT                   /locus_tag="YN1551_3181"
FT   CDS_pept        complement(6145..6432)
FT                   /locus_tag="YN1551_3181"
FT                   /gene_family="HOG000108415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288728"
FT                   /db_xref="GeneID:7803088"
FT                   /translation="MAEVSKLLIPGVTVSKMRSGKKEIYYVYLPLRFDKYLSHGKWSVT
FT                   AITDQREILIGLRSLYKHGNYFILTLPISLKQIWEQYLGKEIDLILEKAA"
FT                   /protein_id="YP_002841980.1"
FT   gene            complement(6438..6734)
FT                   /db_xref="GeneID:7803089"
FT                   /locus_tag="YN1551_3182"
FT   CDS_pept        complement(6438..6734)
FT                   /locus_tag="YN1551_3182"
FT                   /gene_family="HOG000108422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF904"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288729"
FT                   /db_xref="GeneID:7803089"
FT                   /translation="MTINEIIEENEELQIQYSKALNTIAALERKLQKLERENERLQKEN
FT                   ISLKDENMKLRRQNNILMRAIEIALTIRDREKQDLHLKAVLQKIKEETGEFKG"
FT                   /protein_id="YP_002841981.1"
FT   misc_feature    complement(6459..6698)
FT                   /note="Protein of unknown function (DUF904); Region:
FT                   DUF904; cl11531"
FT                   /db_xref="CDD:159520"
FT                   /locus_tag="YN1551_3182"
FT   gene            complement(6954..7148)
FT                   /db_xref="GeneID:7803090"
FT                   /locus_tag="YN1551_3184"
FT   CDS_pept        complement(6954..7148)
FT                   /locus_tag="YN1551_3184"
FT                   /gene_family="HOG000232274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288730"
FT                   /db_xref="GeneID:7803090"
FT                   /translation="MRVVTFKLEEELLQQLDLYCINNAKERSEVIRTAIKFYLSCRKGR
FT                   VYRLNSFEEKNNGVRVREI"
FT                   /protein_id="YP_002841982.1"
FT   gene            complement(7145..7489)
FT                   /db_xref="GeneID:7803091"
FT                   /locus_tag="YN1551_3185"
FT   CDS_pept        complement(7145..7489)
FT                   /locus_tag="YN1551_3185"
FT                   /gene_family="HOG000270842" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288731"
FT                   /db_xref="GeneID:7803091"
FT                   /translation="MRKALRLAHFDKNKKVKVLELGFDDVEINSKDFAEEGSLLLSIHS
FT                   ENQKTFFHLSTAEAALLKERLDYILALLAKQYIEADEKAAKTRQSKNQQKKNQEEGEEV
FT                   DWEEIESEKE"
FT                   /protein_id="YP_002841983.1"
FT   gene            complement(7486..7698)
FT                   /db_xref="GeneID:7803092"
FT                   /locus_tag="YN1551_3186"
FT   CDS_pept        complement(7486..7698)
FT                   /locus_tag="YN1551_3186"
FT                   /gene_family="HOG000108739" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288732"
FT                   /db_xref="GeneID:7803092"
FT                   /translation="MNDFDRFINCWLKFRRVDNIQQLEGDCQQLICKFFNAIANDDPSF
FT                   TEDLEEDVSYCRKFERKVLIPGVIQ"
FT                   /protein_id="YP_002841984.1"
FT   gene            complement(7691..7981)
FT                   /db_xref="GeneID:7803093"
FT                   /locus_tag="YN1551_3187"
FT   CDS_pept        complement(7691..7981)
FT                   /locus_tag="YN1551_3187"
FT                   /gene_family="HOG000108573" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288733"
FT                   /db_xref="GeneID:7803093"
FT                   /translation="MSEKEIIDKIFARFEEFINSNDLMLVNIEELKVVWAVRDGKTLKG
FT                   FLRIGKKHIPFYASFNEKTELTLWIPSIGHIFYPEKAIENFIEEVESEKNE"
FT                   /protein_id="YP_002841985.1"
FT   gene            complement(7974..8465)
FT                   /db_xref="GeneID:7803094"
FT                   /locus_tag="YN1551_3188"
FT   CDS_pept        complement(7974..8465)
FT                   /locus_tag="YN1551_3188"
FT                   /gene_family="HOG000108574" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288734"
FT                   /db_xref="GeneID:7803094"
FT                   /translation="MTEATTLQQHLEKAYMLFGKAQKLTADRAARRILHEINELISAME
FT                   EFQLYGLDYDEAEVGTKLCYYEKQLQLIEEKRDSMLLRSFRQMVSKSDDKLGSLPQNLD
FT                   EEKYFINWMKEKGYEECYYSKVEALRRLDEIGAEAAVEEVEDPLGSGLDIWCLKVRKNE
FT                   "
FT                   /protein_id="YP_002841986.1"
FT   gene            complement(8462..8629)
FT                   /db_xref="GeneID:7803095"
FT                   /locus_tag="YN1551_3189"
FT   CDS_pept        complement(8462..8629)
FT                   /locus_tag="YN1551_3189"
FT                   /gene_family="HOG000108693" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288735"
FT                   /db_xref="GeneID:7803095"
FT                   /translation="MTGKLYLVRLQCLNVVAGGPDELSFAYVYADSEEEAKKEASDGMC
FT                   FAIDAAEVGE"
FT                   /protein_id="YP_002841987.1"
FT   gene            complement(8626..8958)
FT                   /db_xref="GeneID:7803096"
FT                   /locus_tag="YN1551_3190"
FT   CDS_pept        complement(8626..8958)
FT                   /locus_tag="YN1551_3190"
FT                   /gene_family="HOG000108424" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288736"
FT                   /db_xref="GeneID:7803096"
FT                   /translation="MKKMSLVEMAQKNSPVDGEKDLLFLISLLDREDKIEFVKEFREDF
FT                   EQQIEEKKLSKTAYYKFLNGYAPSDERILQIVEADEEARRWLIERVREKAKRALQIIER
FT                   MEAEEE"
FT                   /protein_id="YP_002841988.1"
FT   gene            complement(9034..11273)
FT                   /db_xref="GeneID:7803097"
FT                   /locus_tag="YN1551_3191"
FT                   /pseudo
FT   gene            9271..9855
FT                   /db_xref="GeneID:7803098"
FT                   /locus_tag="YN1551_3192"
FT   CDS_pept        9271..9855
FT                   /locus_tag="YN1551_3192"
FT                   /gene_family="HOG000220335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288737"
FT                   /db_xref="GeneID:7803098"
FT                   /translation="MLKPKEVCQKLGISYRTLQSYVKKGYIKPVILQSGKWRFKEEDVE
FT                   RLMGVVRKRKVVLYARVSSNTQKDDLINQVKYLEENVKDYDQVITDIGSGLNMKRKGFL
FT                   KLLRMILNNEVSKVVIAYPDRLVRFGFEIIEEACKAHNCELVVLNKEDKTPEQELIEDL
FT                   ISILVSFSGKLYGMRSHKYEKVKKCVEELKA"
FT                   /protein_id="YP_002841989.1"
FT   misc_feature    9271..9852
FT                   /note="Predicted site-specific integrase-resolvase [DNA
FT                   replication, recombination, and repair]; Region: COG2452"
FT                   /db_xref="CDD:32568"
FT                   /locus_tag="YN1551_3192"
FT   misc_feature    9274..9420
FT                   /note="Helix-Turn-Helix DNA binding domain of truncated
FT                   MerR-like proteins; Region: HTH_MerR-trunc; cd04762"
FT                   /db_xref="CDD:133390"
FT                   /locus_tag="YN1551_3192"
FT   misc_feature    order(9277..9285,9325..9327,9373..9381)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133390"
FT                   /locus_tag="YN1551_3192"
FT   misc_feature    9436..9825
FT                   /note="Serine Recombinase (SR) family, IS607-like
FT                   transposase subfamily, catalytic domain; members contain a
FT                   DNA binding domain with homology to MerR/SoxR located
FT                   N-terminal to the catalytic domain. Serine recombinases
FT                   catalyze site-specific recombination of...; Region:
FT                   SR_IS607_transposase_like; cd03769"
FT                   /db_xref="CDD:58118"
FT                   /locus_tag="YN1551_3192"
FT   misc_feature    order(9451..9453,9457..9459,9640..9645,9652..9654)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58118"
FT                   /locus_tag="YN1551_3192"
FT   misc_feature    9457..9459
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58118"
FT                   /locus_tag="YN1551_3192"
FT   gene            9833..11134
FT                   /db_xref="GeneID:7803099"
FT                   /locus_tag="YN1551_3193"
FT   CDS_pept        9833..11134
FT                   /locus_tag="YN1551_3193"
FT                   /gene_family="HOG000108671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase, IS605 OrfB family"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288738"
FT                   /db_xref="GeneID:7803099"
FT                   /translation="MSKSLRLKSFQPEEEYVYLTYSLKNNKKVKSKILLENYKHLLQKA
FT                   LDWLWERTKIERKEVKKGKKIFAKVKVTLPKKKEVYKVLRDELEKVNNLASHYVDKAIN
FT                   DAYSILNSWRRRAEKGQASLRKPRLKKVYVRVKSTLRKVEGESVRITVRPYEYVTFSWS
FT                   HKWFSRRVEGLELGEPVIKEDKVHLPFRYKLPWFTPLDFLSIDSNLYTLDAYDGEKFVT
FT                   FSLKELYSLKFGMELKRSKIQSFASKHGRKGKVLLRKYSHRERNRVLDYVHKFVNKLLG
FT                   MYPLTMFAVEKLNKQSMFQDADDKLSKKVSRTVWRTIHRVLKYKAPLYGSFVKEVNPHL
FT                   TSKSCPRCGWVSRKVGRIFKCERCGFTLDRQLNASLNIYLKMCGFPHLFLTPTGSRWIG
FT                   VIPLKGRRGMNGALPRDSGEAQGLRIGYKFMKIQ"
FT                   /protein_id="YP_002841990.1"
FT   misc_feature    10097..10732
FT                   /note="Probable transposase; Region: Transposase_2;
FT                   pfam01385"
FT                   /db_xref="CDD:144832"
FT                   /locus_tag="YN1551_3193"
FT   misc_feature    10775..10975
FT                   /note="Putative transposase DNA-binding domain; Region:
FT                   Transposase_35; pfam07282"
FT                   /db_xref="CDD:115907"
FT                   /locus_tag="YN1551_3193"
FT   gene            11394..11675
FT                   /db_xref="GeneID:7803100"
FT                   /locus_tag="YN1551_3194"
FT   CDS_pept        11394..11675
FT                   /locus_tag="YN1551_3194"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288739"
FT                   /db_xref="GeneID:7803100"
FT                   /translation="MKVYPINAKYKVLIVLLKLGGSGKYSDIDRMMRNSNLRFFIEQLR
FT                   QEGFIEDRYEGNKHIIKLTEDGEKLAKRLMEAEEFVMMKIAQARGQIQ"
FT                   /protein_id="YP_002841991.1"
FT   gene            11785..12426
FT                   /db_xref="GeneID:7803101"
FT                   /locus_tag="YN1551_3195"
FT   CDS_pept        11785..12426
FT                   /locus_tag="YN1551_3195"
FT                   /gene_family="HOG000108417" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288740"
FT                   /db_xref="GeneID:7803101"
FT                   /translation="MIIGMGKSPVTAILQQYSYICAYPCFFDNKVLLTENRSRAYIQYI
FT                   KLLVRHYAKYGRALKIAIWPDYTPLYKVEKIANIYLFNNISFIVPIHDLSELEIVDELV
FT                   ENGFRVFAGYASDKKLRKYELDDFKEVANYDRWYLGVSSKHEVREAVLYNFQGFDITTF
FT                   LFGRHEDRKDSKKLASNILNFVKEISKVKGKQTILYDFCGKLGSLTGERR"
FT                   /protein_id="YP_002841992.1"
FT   gene            12525..12968
FT                   /db_xref="GeneID:7803102"
FT                   /locus_tag="YN1551_3196"
FT   CDS_pept        12525..12968
FT                   /locus_tag="YN1551_3196"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved conjugative plasmid protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288741"
FT                   /db_xref="GeneID:7803102"
FT                   /translation="MNMDSREVYPMLKTWILKGVVTVSKQGRRNVYSISQKFKSLISSV
FT                   VKKYSYKGREFIIAKAKERYKRFLGRDPDPEVLAVIEYFVDKALSGNPYVQGSQNESVA
FT                   ELLARVLNISLYDINEILRELVQANILYVWRNRKARLDSSLTA"
FT                   /protein_id="YP_002841993.1"
FT   gene            complement(13406..13744)
FT                   /db_xref="GeneID:7803103"
FT                   /locus_tag="YN1551_3197"
FT   CDS_pept        complement(13406..13744)
FT                   /locus_tag="YN1551_3197"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288742"
FT                   /db_xref="GeneID:7803103"
FT                   /translation="MIIKEELKVRVKYNVKINSQGEKVKYPYYIVTFPIEYSNILKERK
FT                   ILKNVTIVTNEEKIELSNVKIFSLEYYRKGEENIPYFSISIPKEIGEKLIGKKVLVIAE
FT                   IELNSPVY"
FT                   /protein_id="YP_002841994.1"
FT   gene            13878..14015
FT                   /db_xref="GeneID:7803104"
FT                   /locus_tag="YN1551_3198"
FT   CDS_pept        13878..14015
FT                   /locus_tag="YN1551_3198"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288743"
FT                   /db_xref="GeneID:7803104"
FT                   /translation="MAKRTNKTRKSKKEEDEMIDEVQEKFGEYCSDPENYTDEACEKLF
FT                   "
FT                   /protein_id="YP_002841995.1"
FT   gene            14143..14298
FT                   /db_xref="GeneID:7803105"
FT                   /locus_tag="YN1551_3199"
FT   CDS_pept        14143..14298
FT                   /locus_tag="YN1551_3199"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288744"
FT                   /db_xref="GeneID:7803105"
FT                   /translation="MTENKKNKKEVNMTFISFPSKEIFEQIYNELSEDGKKELDRMMKE
FT                   GRVKIY"
FT                   /protein_id="YP_002841996.1"
FT   gene            complement(14609..16339)
FT                   /db_xref="GeneID:7803106"
FT                   /locus_tag="YN1551_3200"
FT   CDS_pept        complement(14609..16339)
FT                   /locus_tag="YN1551_3200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288745"
FT                   /db_xref="GeneID:7803106"
FT                   /translation="MKMSDYVEIDIGEFPKDWDVRKLKDVIIKAKSGGTPRRNVPEYWN
FT                   GNIPFAKIQDITKSGKYLYNTEEFITEKGLENSNAWIVPKDSLLLTIYGSLGFVAINKI
FT                   PVATNQAIIGIIPNKNIIDTEFLYYWYLYFKPYWSKFIKKGTQPNLTLEIVLNSSVPIL
FT                   PLEEQKKIVELLQKATDIYYTLKDYIIQIRNSTETITKVIRKELLTKGIGHRDYVETDI
FT                   GEFPKDWEVRRLNEIAIIRSGFSERKRDENSKVIHLRPDNIDNETDRIVFHRIVYIPES
FT                   PKIERYLLRHLDIVLVNTNGSIDHIGKLGIIDMPLNQKITFSNHLTAIRIVSKDVEPYY
FT                   IYYLLSWYHLNGSFKKVVKNQAGKWNLNLDTIRNLLIPLPPLEEQKKIVELLQKVDELI
FT                   IRFNDFLQNLEDEANTLYKSILRLALTGKLTEDWRRQIILLRSVVIPYLVYQASKIKGR
FT                   PVYMTELMKYLFLLQKEYNINLAYNFEPYKYGPFTPQLYKDLEELKDRIEVKEVKDNVD
FT                   KSLITSKELPQVNQDIANAVNDLINRFGNKDLKELLSYVYKKYPEYTVKSELNLDEFLK
FT                   "
FT                   /protein_id="YP_002841997.1"
FT   misc_feature    complement(15038..16306)
FT                   /note="EcoKI restriction-modification system protein HsdS;
FT                   Provisional; Region: PRK09737"
FT                   /db_xref="CDD:170075"
FT                   /locus_tag="YN1551_3200"
FT   misc_feature    complement(15809..16297)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="YN1551_3200"
FT   misc_feature    complement(15143..15664)
FT                   /note="Type I restriction modification DNA specificity
FT                   domain; Region: Methylase_S; pfam01420"
FT                   /db_xref="CDD:144860"
FT                   /locus_tag="YN1551_3200"
FT   gene            complement(16326..17891)
FT                   /db_xref="GeneID:7803107"
FT                   /locus_tag="YN1551_3201"
FT   CDS_pept        complement(16326..17891)
FT                   /locus_tag="YN1551_3201"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-6 DNA methylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288746"
FT                   /db_xref="GeneID:7803107"
FT                   /translation="MKQSKEVDWNSFGDELWNIANIFRSDIVKPTEYLEEFSYLFFLRL
FT                   FDEQEIYQENIAKELGEDYKSTIPSEYRFFNWACDPRNYARSKGFKTVTEFLDKMFLDL
FT                   ANLPDTGDPKIDEDRSIIKKIFSNKTRRMQNDNTVIQVIDRLRLLKLPGDEGRKFDALG
FT                   RGYEFLMYKLGQQGNYGQFFTPRNIVSFMVRIIDPNPGEVILDPAAGTGGFLVKAFEYV
FT                   KQKIERQITNEADKEIKIRELKHNLYGIEKAPDVFKLGLMNLRLHGDGSSNFENLDALS
FT                   GSVQGAYKEKADVITTNPPFGPFSGEPTGNFKYKFKRFETYFIQAIMDMVKPGGRVATV
FT                   MLEGLLFNENYEGIRRDLVDKFKIEAVFSLPAGVFLPYSAAKTDILVFRRPNKGEKTTD
FT                   KVLFFNIESDGYELKPTRKPIGDCDKKGDIDGCGDLPLALEIYQKFKRGEEIPQTEQYF
FT                   VVDVEEIRKHDYRLDINVYRKVRLEEENADPKQLIELMETNLSDAMKRLNELKKILGIG
FT                   DENE"
FT                   /protein_id="YP_002841998.1"
FT   misc_feature    complement(<17682..17846)
FT                   /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
FT                   /db_xref="CDD:152596"
FT                   /locus_tag="YN1551_3201"
FT   misc_feature    complement(16437..17414)
FT                   /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
FT                   /db_xref="CDD:111293"
FT                   /locus_tag="YN1551_3201"
FT   misc_feature    complement(<16986..17318)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="YN1551_3201"
FT   gene            complement(17911..20202)
FT                   /db_xref="GeneID:7803108"
FT                   /locus_tag="YN1551_3202"
FT   CDS_pept        complement(17911..20202)
FT                   /locus_tag="YN1551_3202"
FT                   /gene_family="HOG000075151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III restriction protein res subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288747"
FT                   /db_xref="GeneID:7803108"
FT                   /translation="MPNTEADAITLCDEHLRKLGWNLEKFKKNHTLKDLFPNISFTENE
FT                   GKHRPDYTLILGDKVILIEAKKKGVDLRAAIAEARESAKILRKYGVNVPYIYACDGQKW
FT                   YMQNLDANTVETQVERFLKPEEVSVTLNPVSSSINALDLRNYQKIAVQQIITSFLSGKK
FT                   RMLVEMATGTGKTEVVMAAIAKLLDEGKVKNVLYLVDRDSLATQTYQRFNARLGDKYNI
FT                   RKLSGDINDLSADIIISTVQMLYVDEKFKLFNSDHFQLIVLDEAHRSYYGDWHKVVQYF
FT                   NKAAVLGLTATPKIDKDVDNFAYFGYPIFRYTYSRGVKDGYLADTIYYKFLTNVDIYGI
FT                   HDLGYDFDPNDLGKKVDIPMRNELIAEKYFEAINFKETKELKKAIVFAASIKHAENLRL
FT                   AFIRKYNELMGYSPDNAEAEEIFRSIHSAIPNHEELVREFQSPNSRIKVAFTVDLLSTG
FT                   VDAPDVEVIVMARPTKSRVLYLQMKGRGTRIYKEGNKVKDKFYLIDFVDTWRLENEEDK
FT                   PITNEDIVKEEEEEEKEISELMGSTEEPQRTTAKKEVKREQKREEMVILDIPVSIVYAE
FT                   VITPENFKNELKGISEQVVRQVKAYLQAQEEVQIKKTQFETAVRSFDYFYRKNGGKTLN
FT                   ENYLKELEAFLNEQGITEDVLKDTYGEPDATLKDFVEVALGLKTFPTPEERKRNLIKEW
FT                   YNKKGYPKECERLFMALYDFRKRNPNIDKKAFFNAEVVKQAGGFSKVKGCFEDINSFWK
FT                   LYDEAVMETG"
FT                   /protein_id="YP_002841999.1"
FT   misc_feature    complement(<18628..20193)
FT                   /note="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases
FT                   [Defense mechanisms]; Region: HsdR; COG4096"
FT                   /db_xref="CDD:33853"
FT                   /locus_tag="YN1551_3202"
FT   misc_feature    complement(19324..19716)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="YN1551_3202"
FT   misc_feature    complement(19675..19689)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="YN1551_3202"
FT   misc_feature    complement(19402..19413)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="YN1551_3202"
FT   misc_feature    complement(18724..19077)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="YN1551_3202"
FT   misc_feature    complement(order(18841..18849,18922..18927,19027..19038))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="YN1551_3202"
FT   misc_feature    complement(order(18739..18741,18748..18750,18760..18762,
FT                   18823..18825))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="YN1551_3202"
FT   gene            complement(21939..24935)
FT                   /db_xref="GeneID:7803109"
FT                   /locus_tag="YN1551_3204"
FT   CDS_pept        complement(21939..24935)
FT                   /locus_tag="YN1551_3204"
FT                   /gene_family="HOG000107834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288748"
FT                   /db_xref="GeneID:7803109"
FT                   /translation="MWGKKEVIKYYELFPKVEYDKTFNILNSLGHVFEIIYFKDKDLMH
FT                   LYAYTNTQLEVLRKDFGVNENVNIPVPKFVGRILFKNEKDFYWGAEFNDFNSFLTKLRP
FT                   REQLRLWIVLEPRLNEIFLKYSDKLKRNQSIIGKRQREVLASRLEQFAKDNIYYLQPYI
FT                   LSDDKKRIKELTKELQQFILTRSRKLRLEIRKTKGWEDNIPRVPRFHSLKIKRWLWVDE
FT                   EKINKVAVIPNPSIIPVNFVTGGILPELPPNRNGFEIGKTIQSGKSYMLELEDLYRHGY
FT                   VIGGTGAGKTTTIISLITAIKKAYNNTIIMIFDPHGDMAEEVASYFADDEKLIYFHPVE
FT                   SGISINPLALPNIPNKEQALLLGFSNVMEIFEKLFGLKDTAVYVKYIIQVSMQLLYSKT
FT                   PEPTFRDLYRIIYKLRTGEIDLPVDDPTWENKLGMFQNMQEQSFLSAVSRLEMLGTNPL
FT                   LLKIFSRSKIDDKELFKPGNIIVINASKAAVGNDAAFLILAGWIFKTWYYALARAALGM
FT                   ERIPIIAFMDEFQNIASLSVIDDILSEARKYGMHIIMAHQHTGQLDKPLIKSIMSNTGV
FT                   KLLMKEQGDDAKAFAEIFPEFGSELQKILPSLGVGETVAIITPRKEGDKVVPVRVKVNY
FT                   VPVKKNPEKLKKVIDRMQIYITGEIPKSEDIESIVNPIMKYIEKPNVLEQLVLYHVFKN
FT                   GKKMYLVDLLKELGLDRDKVNDVVNRLEKLGYIDVEKEGNKKVLYYGKGLFGNVKAVAP
FT                   SVEGRKLAMKVMLRYMKQGYYVTPAKQDQSLTSRPDIVAIPIDKSTLRPIYDRSIAIEI
FT                   ESCNELSVHPEQVMHNFRKESTKDFAEVHSWAYEECFDKLQQLYNQLSDVEKNKVKIFS
FT                   IKLKKEIEQQSKEEQKQEQLTGEFNGKREEKAESIAQQAAQGAAANNANSKLGSLTLKE
FT                   VTIEVLKEDTDYAIIKIGDKQYRVLKTDLELLKAAAKDPELLEDVKLKENKILIQAAGT
FT                   KKTILLGPT"
FT                   /protein_id="YP_002842000.1"
FT   misc_feature    complement(23193..>23741)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="YN1551_3204"
FT   misc_feature    complement(23355..23369)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29986"
FT                   /locus_tag="YN1551_3204"
FT   misc_feature    complement(22722..>22895)
FT                   /note="Predicted membrane-associated trancriptional
FT                   regulator    [Transcription]; Region: COG2512"
FT                   /db_xref="CDD:32582"
FT                   /locus_tag="YN1551_3204"
FT   gene            complement(25092..25484)
FT                   /db_xref="GeneID:7803110"
FT                   /locus_tag="YN1551_3205"
FT   CDS_pept        complement(25092..25484)
FT                   /locus_tag="YN1551_3205"
FT                   /gene_family="HOG000108695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288749"
FT                   /db_xref="GeneID:7803110"
FT                   /translation="MRTLLALFVIIVLGVTVTATTTNNSIINSTQIQSYAQKIPAPPSN
FT                   FFQGILNLVAQGYNWLVGIIQGILQNTLLKQDPGLASTYANIIAWLIPLTAIYILLVFA
FT                   EVAKKILGYILVAGWLFLIVVLFLAH"
FT                   /protein_id="YP_002842001.1"
FT   sig_peptide     complement(25425..25484)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.923 at
FT                   residue 20"
FT                   /locus_tag="YN1551_3205"
FT   gene            25524..26078
FT                   /db_xref="GeneID:7803111"
FT                   /locus_tag="YN1551_3206"
FT   CDS_pept        25524..26078
FT                   /locus_tag="YN1551_3206"
FT                   /gene_family="HOG000108696" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved conjugative plasmid protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288750"
FT                   /db_xref="GeneID:7803111"
FT                   /translation="MDWFLSLFNIILVLVFYEVFHGILYYKSREVKREGRISVRVLNIN
FT                   EENAVTLNSIFFRNTIVFLSNKIDEKILTHEEGHTKQFNYIYAFLIAVAALLSISTLLA
FT                   IPAILVGKFLLWKMERDADLYAYTKYNIKYESVAERPKSKIDRIKAWVFDTHPPDWVRE
FT                   KEEYYEKKISLIKLFIQDLTS"
FT                   /protein_id="YP_002842002.1"
FT   gene            complement(26052..26333)
FT                   /db_xref="GeneID:7803112"
FT                   /locus_tag="YN1551_3207"
FT   CDS_pept        complement(26052..26333)
FT                   /locus_tag="YN1551_3207"
FT                   /gene_family="HOG000108697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved conjugative plasmid protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288751"
FT                   /db_xref="GeneID:7803112"
FT                   /translation="MKRLQVIKCKAKAVVKMPVTKYRKGNHEAAVGGFIAGLALLGGAI
FT                   ASTFDSSFSSLLGSDASYITDFLALIGFVSLIGGIVEYRRLRSQILNK"
FT                   /protein_id="YP_002842003.1"
FT   sig_peptide     complement(26193..26333)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.874 at
FT                   residue 47"
FT                   /locus_tag="YN1551_3207"
FT   gene            26376..26891
FT                   /db_xref="GeneID:7803113"
FT                   /locus_tag="YN1551_3208"
FT   CDS_pept        26376..26891
FT                   /locus_tag="YN1551_3208"
FT                   /gene_family="HOG000108698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288752"
FT                   /db_xref="GeneID:7803113"
FT                   /translation="MKLRELTVGWLYTTSGIDEKSFPIGIKNVNMKELLVIFPLLILTI
FT                   SFAFKNIMIAMAFIAPVFFFVFYEEKSMDEFQYIYHFLRFYLNDFLAPKEEKNKKESKK
FT                   KVKTFDIKKFKDEIIITASALLALTNVNAFINTFQLKFYYPTSLSQDLLFAVGTGVAIG
FT                   FIISKIRK"
FT                   /protein_id="YP_002842004.1"
FT   gene            complement(26900..27055)
FT                   /db_xref="GeneID:7803114"
FT                   /locus_tag="YN1551_3209"
FT   CDS_pept        complement(26900..27055)
FT                   /locus_tag="YN1551_3209"
FT                   /gene_family="HOG000108699" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved conjugative plasmid protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288753"
FT                   /db_xref="GeneID:7803114"
FT                   /translation="MLAIRSKDPEEIIELAKKYRAFPMELTLYINDPKIVAGLKSKRKV
FT                   DVIKID"
FT                   /protein_id="YP_002842005.1"
FT   gene            27987..28589
FT                   /db_xref="GeneID:7803115"
FT                   /locus_tag="YN1551_3211"
FT   CDS_pept        27987..28589
FT                   /locus_tag="YN1551_3211"
FT                   /gene_family="HOG000271113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288754"
FT                   /db_xref="GeneID:7803115"
FT                   /translation="MRKFNYNEIVILNPLQTRYQMMSSRVFISLHAAANDGIYRMNRRK
FT                   FVTKYGPKTIGIYMLGAFGALILLIGIGMAAYPFTQTTGMTSADGLIAIVIGGLMLYFA
FT                   IKNAKKTVQKINEEKGIEGELVVPWNQVKTITVMNVRQENVANRPSLVLNTIAPTYKEI
FT                   GDWHVLTIDGRDITIPNVDDPYNKLNYVKNRFNLNFS"
FT                   /protein_id="YP_002842006.1"
FT   gene            complement(28594..30099)
FT                   /db_xref="GeneID:7803116"
FT                   /locus_tag="YN1551_3212"
FT   CDS_pept        complement(28594..30099)
FT                   /locus_tag="YN1551_3212"
FT                   /gene_family="HOG000271114" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288755"
FT                   /db_xref="GeneID:7803116"
FT                   /translation="MRKALTILLIILVLPSLLSGAGNIIATAQGGGGGSPGGLGQFIAT
FT                   LQTLIPAALILLAILANRYDQRYALVLFAAAMASAIFLAAATGGKIGGNVQITLVQLQV
FT                   KVSGPTSAYTGNTETYTVSWSPSMSGTVIWTVLYNGSIVYNATGGTSFTYTFNDPGKYI
FT                   VAASVINQQNFAGGSGAVLVTVTNPPSPLGWIEGAITGAISGLINSVANAFTGFLTTLL
FT                   QIFGAPLEWMTYSPTPTMSPASQSIYNQMKDFSVGLAMLFIAFSIAYNAIRGEYADLVD
FT                   LAGDVMYKLSVWGLFFAGGLTIYTYAANFINSIIYSVAGPYLGIATVEYTGGATLFTAL
FT                   FALMNGIPFGFGDALSMFLSLVMFLLAITLAIATIKYAVMLAIVDTIPLWATLWIFEWT
FT                   RKIAMVVIDLLIGLMVAGLIAAVTFAILATLPLGALMFAIDPIAMDGEFLFTLAFFVFG
FT                   LRPGEHMMGAFRKKNGGGSGNTVVVENNSGGSTSSEPPPGRYM"
FT                   /protein_id="YP_002842007.1"
FT   sig_peptide     complement(30034..30099)
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.344 at
FT                   residue 22"
FT                   /locus_tag="YN1551_3212"
FT   gene            complement(30176..30337)
FT                   /db_xref="GeneID:7803117"
FT                   /locus_tag="YN1551_3213"
FT                   /pseudo
FT   gene            30399..31298
FT                   /db_xref="GeneID:7803118"
FT                   /locus_tag="YN1551_3214"
FT   CDS_pept        30399..31298
FT                   /locus_tag="YN1551_3214"
FT                   /gene_family="HOG000108651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288756"
FT                   /db_xref="GeneID:7803118"
FT                   /translation="MGKSKYKRDWSKYDENVITRYELMFPFYVFQHWWELLAEENRNAK
FT                   KTYKAPKEFNDFLAFLHLFLPYRAIEGVLRALERLKIIPTSLDYSTIWERVRNMNIKFP
FT                   EANDQLEVIADATGISTNKGGQYIIAKWGKTKDSKFLKIEIVMDKDQFNVINAEVTSNE
FT                   VQTAVKTVKDLQDKGKKVKKFYGDKAYDANEVYKTGVEVVVPPRENASTRRGHPARRKA
FT                   VREFKRLGYNRWREERGYGVRWRIESLFSAVKRTFGESVRATSFLGQVVEAKLKFWAYA
FT                   WMVHLANSLVGRAPGIRV"
FT                   /protein_id="YP_002842008.1"
FT   misc_feature    30732..31244
FT                   /note="Transposase DDE domain; Region: Transposase_11;
FT                   pfam01609"
FT                   /db_xref="CDD:144990"
FT                   /locus_tag="YN1551_3214"
FT   gene            complement(31383..31703)
FT                   /db_xref="GeneID:7803119"
FT                   /locus_tag="YN1551_3215"
FT   CDS_pept        complement(31383..31703)
FT                   /locus_tag="YN1551_3215"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288757"
FT                   /db_xref="GeneID:7803119"
FT                   /translation="MVANYSNLVYVHDIIQTIIVYNPNFVMTLLQANADDWARKIIGIK
FT                   YSSKEVKLPNDRAIDALYIATDAELKSLCIGFEVKSGNGIDKDQLTEELEGLRELRSCV
FT                   LC"
FT                   /protein_id="YP_002842009.1"
FT   gene            complement(31697..33867)
FT                   /db_xref="GeneID:7803120"
FT                   /locus_tag="YN1551_3216"
FT                   /pseudo
FT   gene            complement(32435..33493)
FT                   /db_xref="GeneID:7803121"
FT                   /locus_tag="YN1551_3217"
FT   CDS_pept        complement(32435..33493)
FT                   /locus_tag="YN1551_3217"
FT                   /gene_family="HOG000107832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase IS4 family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288758"
FT                   /db_xref="GeneID:7803121"
FT                   /translation="MVTPVLPHQNNIQQIGYKLLSMLNFKGKKGEEVARTLISACLWND
FT                   SVESKSRAYGVSPQTVRNYVEEQGMEVIEKLLESARKISLKVLKGVKEIDVSIDWTTKT
FT                   WYGRPVGGLGSSEEGNSWNYATATTKFNGKVLLLAFVTQVKGMTKEEIVKALVEQVVAM
FT                   GFKIRLITLDAGFYTVDVLNFISQFKYIVAVPVGDVKVYEEFDGDYATNSKRHRRDEQV
FT                   KFRLLVYSKEKVRRKKKSVVYFARATNLDLPKGEVLDLYNKVRGPIETSYRNIKAFLPF
FT                   TSSTKFVFRTLIFVLAVAFYSLYTVFKGEVRREQFRILLILLFSDDLFYLKDFLFKSIE
FT                   PLINNIDLFSRR"
FT                   /protein_id="YP_002842010.1"
FT   misc_feature    complement(32438..33220)
FT                   /note="FOG: Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3385"
FT                   /db_xref="CDD:33192"
FT                   /locus_tag="YN1551_3217"
FT   gene            complement(33864..35174)
FT                   /db_xref="GeneID:7803122"
FT                   /locus_tag="YN1551_3218"
FT   CDS_pept        complement(33864..35174)
FT                   /locus_tag="YN1551_3218"
FT                   /gene_family="HOG000270379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ParB domain protein nuclease"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288759"
FT                   /db_xref="GeneID:7803122"
FT                   /translation="MSKLKEYKEISIEEIKEVDEFRTFIPENNMYDKIKEDIAKNGIKV
FT                   PLIVNQNYELINGYTRLKIAKELGIKKVPVAVYETTDRADEYDLLVSTNLTQRQLSKAQ
FT                   ALALIEKAVEEKTKILKKNQNSENNPKETKVERVPVQLSESQNKKIQSLTDLRNAVKEE
FT                   LKKYNVKVDDRALDYYIRIKENAPWLTDYILKGKLGIYPAYSIYTKLQEMGLLEAVAKL
FT                   PPYERNTLLTDGRKIILDERKDLLEEIVNHRMAVSQAINKLKTEEKLQRSKKKSKVKEE
FT                   KEDEGEEVETDEGEEAESDEYSFVEEWAQKEEEAKQQLTPQFNTEVHSPAEEITRINHE
FT                   KWLQTVAKLKEEMLSNCPEIKQLYEEKKLDEEAILTMVEVWRNFQIAFKNLSINWHNVA
FT                   EPLLSSHLNRQQLEELFYKFVKGNMRLYPKEEFGVVK"
FT                   /protein_id="YP_002842011.1"
FT   misc_feature    complement(34929..35096)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="YN1551_3218"
FT   gene            complement(35171..35452)
FT                   /db_xref="GeneID:7803123"
FT                   /locus_tag="YN1551_3219"
FT   CDS_pept        complement(35171..35452)
FT                   /locus_tag="YN1551_3219"
FT                   /gene_family="HOG000108592" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288760"
FT                   /db_xref="GeneID:7803123"
FT                   /translation="MGKISTDKYIFLTPRAYIVIYLLKVGKAKASEIAESTQIPYQTVI
FT                   QNIRWLLAEGYVIKEQEGEEIYYVLTDKGRHLATTELEKIRKLIEVVQ"
FT                   /protein_id="YP_002842012.1"
FT   misc_feature    complement(35219..35398)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="YN1551_3219"
FT   misc_feature    complement(order(35228..35230,35357..35359,35366..35368))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="YN1551_3219"
FT   misc_feature    complement(order(35249..35257,35270..35278,35294..35299,
FT                   35303..35308,35315..35320,35324..35335,35360..35368))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="YN1551_3219"
FT   gene            35558..35839
FT                   /db_xref="GeneID:7803124"
FT                   /locus_tag="YN1551_3220"
FT   CDS_pept        35558..35839
FT                   /locus_tag="YN1551_3220"
FT                   /gene_family="HOG000270381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288761"
FT                   /db_xref="GeneID:7803124"
FT                   /translation="MKENYRVLSETEQYILLYLISIKEGVAVKEIYEEMKLSPNAVTQA
FT                   VNKLLNEGLLTEKREEVFPRRRLIYLSEKGRKIAQLLLQMQEIIKVNQ"
FT                   /protein_id="YP_002842013.1"
FT   misc_feature    35591..35809
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="YN1551_3220"
FT   gene            35898..36047
FT                   /db_xref="GeneID:7803125"
FT                   /locus_tag="YN1551_3221"
FT   CDS_pept        35898..36047
FT                   /locus_tag="YN1551_3221"
FT                   /gene_family="HOG000108593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288762"
FT                   /db_xref="GeneID:7803125"
FT                   /translation="MAKVEEGEIILDTEEEVNNLIEAIRKEKVDEELIKKALLLSKKSL
FT                   VSNL"
FT                   /protein_id="YP_002842014.1"
FT   gene            complement(36015..36632)
FT                   /db_xref="GeneID:7803126"
FT                   /locus_tag="YN1551_3222"
FT   CDS_pept        complement(36015..36632)
FT                   /locus_tag="YN1551_3222"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288763"
FT                   /db_xref="GeneID:7803126"
FT                   /translation="MSTNIQPFDTISTPLGNCYVYTIHSSFINRLGSFDCGEKEQNEFI
FT                   RRLAVGHYLAGINHTFLLICDNDLAGFVSFSSYSYAFAEGFIGKIREVMKEEFNRRGLP
FT                   HEFNISFKKLPVILLGQLGIDKRYQGKGVGSVFVKNFIIPYSLGYCINNSCIGILVYTK
FT                   TAKEFYEKLGFQLIYEDKSGGANYFYSLYKNVLEVRYKAFLA"
FT                   /protein_id="YP_002842015.1"
FT   gene            36776..37099
FT                   /db_xref="GeneID:7803127"
FT                   /locus_tag="YN1551_3223"
FT   CDS_pept        36776..37099
FT                   /locus_tag="YN1551_3223"
FT                   /gene_family="HOG000107846" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc finger SWIM domain protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288764"
FT                   /db_xref="GeneID:7803127"
FT                   /translation="MISTQTPKNPIKRLDVFYVLSEGVVVAGDVESKSRKGLLHYTRIV
FT                   LDPLTMKITKASCDCEGYTFRHNCWHIKTLEQMIKEDRELRERIEKARQEMMQIEEDIA
FT                   SWG"
FT                   /protein_id="YP_002842016.1"
FT   gene            37103..37285
FT                   /db_xref="GeneID:7803128"
FT                   /locus_tag="YN1551_3224"
FT   CDS_pept        37103..37285
FT                   /locus_tag="YN1551_3224"
FT                   /gene_family="HOG000107844" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288765"
FT                   /db_xref="GeneID:7803128"
FT                   /translation="MSEVLQTQRNLEELVKLLRIYFQLDEILSFAMEELGGDEIVVEIS
FT                   AVKDRVRKVIERMIS"
FT                   /protein_id="YP_002842017.1"
FT   gene            37373..39247
FT                   /db_xref="GeneID:7803129"
FT                   /locus_tag="YN1551_3225"
FT   CDS_pept        37373..39247
FT                   /locus_tag="YN1551_3225"
FT                   /gene_family="HOG000271116" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288766"
FT                   /db_xref="GeneID:7803129"
FT                   /translation="MSFLNLFKKPSQQAVKKDKTKYYKLEGIPFFLLAPEDRDMKMKEL
FT                   SALLSQAEKGYIYISRKPDTYEFEGTKFPIITSSFNLITEKELDLETAEPPQRPKIVKE
FT                   YAKYLQTTEGYARVLVSYAYSTKIYEGALGRIDFKSLRPELFELVVQFQKISPLSVRNY
FT                   LNSLEVKKQKMARYASSSVQVEEMLVRGAQLKKDLDEEAADPLKFRFVFIIHSKTVQEL
FT                   ESLTRELTQTAQENGILLDVPCCAQKELYSFEGSVGYRISSNISLSKFYPIIGFSLIEP
FT                   GGIFLGTDDKGAPIAINPYLSVNGRQNPHWAITGTTGAGKTTTGAVLIDRLRKAHDDVY
FT                   VIVIDPMSNYNRFFENEADLNIVFGDNDYLGLDPVSLANEGVVSSGDIADFLIESYGIP
FT                   AELRGILVSQLEQNKSLKELMDNLEDLASKKFATEYRKLENFLLNMTTGSDKYVFQGSP
FT                   PSLKNKKFVILGLKTEDTRKKRLAATMLMLYAYSLINKLPKDVEKLILIDEAHFLFEYQ
FT                   SVAKIIAIIYRTARALRTSMITMTQLIQHYNMNNYSREAWQLANNKLILKQEKEAKDDL
FT                   VNLAHLSEEEIDYILKSSRGRGILRTGAITTHIQIQLTDEEKEHWRTE"
FT                   /protein_id="YP_002842018.1"
FT   misc_feature    <38708..39088
FT                   /note="conjugal transfer ATP-binding protein TraC;
FT                   Provisional; Region: PRK13721"
FT                   /db_xref="CDD:172263"
FT                   /locus_tag="YN1551_3225"
FT   gene            39249..39506
FT                   /db_xref="GeneID:7803130"
FT                   /locus_tag="YN1551_3226"
FT   CDS_pept        39249..39506
FT                   /locus_tag="YN1551_3226"
FT                   /gene_family="HOG000271117" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288767"
FT                   /db_xref="GeneID:7803130"
FT                   /translation="MSLVQLIEKAAKKYNIKINSLPNGVIILVKNDIGYVQIAAVRNVY
FT                   YVRYLTKNEAYIIRNLNEKIIELILEEKLEETEAIKIPDV"
FT                   /protein_id="YP_002842019.1"
FT   gene            complement(39468..40130)
FT                   /db_xref="GeneID:7803131"
FT                   /locus_tag="YN1551_3227"
FT   CDS_pept        complement(39468..40130)
FT                   /locus_tag="YN1551_3227"
FT                   /gene_family="HOG000271118" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288768"
FT                   /db_xref="GeneID:7803131"
FT                   /translation="MQECYKVRNSEGFLVDSCTGEVVDFDNYTYQDYSNLEYYERASSQ
FT                   KRETEKEIKDMKKIVLNYLQSVMTEKEKEMFYKILQKIDEKKLDASFYLAIYEYILERE
FT                   GKVVTRDYIKFLKMKGLGRHAIRQKKKLLRHVVREDPIIHYIYEYSGDKEEALRIYELL
FT                   KKKGIMYGKAETRKKILLKYLSDQKLKEKLFEEERMKEIERTLLLLNIRDFDSFSFF"
FT                   /protein_id="YP_002842020.1"
FT   gene            complement(40222..42222)
FT                   /db_xref="GeneID:7803132"
FT                   /locus_tag="YN1551_3228"
FT   CDS_pept        complement(40222..42222)
FT                   /locus_tag="YN1551_3228"
FT                   /gene_family="HOG000271119" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:228288769"
FT                   /db_xref="GeneID:7803132"
FT                   /translation="MGDNIFGMDIRRFSVLFIAIIIILAFIASFANLKVPQQNSSIQIG
FT                   SGGGSSGSYSVPGPKYIYNKTVTLSPSLQDLQYVRGSYSNLPAPYYNISPEAYILFNFS
FT                   KPDNNMLNLLFDALARNASEIAPGPYGALLSIASSAYVNITNYKNTSLQPFPLNENDTE
FT                   NYSKWDIIVKYGKTLEAPNGFQSGWSYPPSDLISVNPPVYKIINETSVKTSVNVQYNEY
FT                   TYLYNKYTHNQGNVTYVYEYYAMKVWGTAYLYANNQLINSQSFATTFYWYGGEYGPNYI
FT                   YGTITVPPESTQEVYGSYSISAGAGYKHYQRTVNNTTYIYYIYYPTGPYLSTTSYNFNW
FT                   YEYNVTLPIMVIVYNGSDPQTLINNKIYNSRNITAYFTYTTWSSDPIANSTTIVTYDHI
FT                   QIANYTIERIWHAGNIEIIPLLNTQQDWNTINYYLTFNVQDNTVQPPYWISQKMIYSKS
FT                   AAISWFYLEQNATLAHTLYNYIMKTINKTDFQYWKFEYFVLASQFVMYTFNTTSSVFTN
FT                   LLELESFYENWSLVTANILNLSAWPKLQYFNYQIMFFNISRIPQIYNNTIFMNITGNYE
FT                   IYLVDIYNALYYSGFNKVPFGNIYYYFNPLNNETTYFYLNTTGQHIPYLHETLCFTSAN
FT                   YIPNIFYATFQYTAAVKTEIIAIWNGTVWVS"
FT                   /protein_id="YP_002842021.1"
SQ   Sequence 42245 BP; 13231 A; 7839 C; 7415 G; 13760 T; 0 other;
     TTTTTAAAAA CCCTGCATAG TGATGATCTC CAAAAAAGAG TTTTTACCTA TTCTTGCATA        60
     CTCTATTCCA ACATATGTAC TAGTGTATCC ATCATTTTTT GTTAACACTC TAGCAAGGGA       120
     ATTCCCATAC TGGGAGGCAT TCCTACTACT CTCCCTACCC TTTCTAGGGA GAGTAGTAGG       180
     ATCCCTAATT TACCAATTCT TCAAATCCTA CATCATACCG CTCCTAACCC TTAGCATACT       240
     CACGCTCCTA CAAATCGATT TAAACATAAT ATTTCCCGTC AGATTCTTGA TCGGCATAAT       300
     CTTCGGACTA ATGACCAGCT ACGCAGTTGA CAATGCTGTT AAAACGAACA ACTTAGTGTT       360
     AGGTTTAACC ACAGCGGGCT GGAGTATAGG ATGGATACTA TCATATATAG CATATACAAC       420
     AATCCATAAT TGGAATCAAA TATGCATAAT CAGCAGCATA ATAATAGTAT CCATAGCACT       480
     CCTAGACAGA AGAGTAAGCC TAGATAAAAT CAAAATCAAT ATAAGCTTAC CAAAAACGTC       540
     ATCCATAATA GTCTACTTCT CAGCGTTAAC CCCGGCATTC ACACTACAAA TAATTCCGAG       600
     CATATTCGAA AAAGCACACA CAACATGGCT AATACTCCCT TCGTATCTAC TTTCCATAGC       660
     TGCGTATACT ATACTACCAA TAATAGCAAG CAAAATAGGA CTAAAGAGAT GCATCATAAT       720
     AACAACCCTA GGAATACTAA TTAGTGGAAT AACAACATTC CTAATAACAC CCTACACCCT       780
     ATTACCATAT ACCTCACTAG GACTAGGAAT ACTTTCACTA ATACCGAAAT ACTTAACAAC       840
     GAAAAACGAA AAAGCCAACA CTCTGGGAAT AGCCCTAAAT ATAGGATCAA TAGGAGGACT       900
     AATAATACCA ACGCTATACA CAATAATACC GACAAGCCCA GAATCAATAC TCATAATAAC       960
     TTCAATAATA TTGTTAACAA TCTAAAAAAT TGTAATGAGG GTTTTTAAAA ACCCCAAAAG      1020
     TGAAGGTGGT GAAATGATTT CGCCTGACTT AGCAATAAAA ATTCTTCTAT TAGTTCCTTC      1080
     AGTAATATTC TTCTTCTACA GTGCAGTATA TTTAATGTTA TTTGAGCTAA ATGTACAACC      1140
     TAAACTGAGC AAATTCTACA GAAATACTAG TCTAGTTTTA GCTGGAGGTG GTATACTATT      1200
     ATTGACAATT TATTTAATGA TTTAGATAGC ATAGATGATA TAATTTTAAT AATATTGGCA      1260
     AATGCTAACG GAACTGTTAA AGAAATGGCA GAGAAAACGG GAATAAAAGA AGAAGCTGTA      1320
     TATCATCTTT TAGAATTTCT AACAATAGCT GGGATTGTGA AGAAAGAGAA TGATAGATAT      1380
     TCTATAGATA AAACAATGAG AACTATAGCT CAACTTTTGA TAGATTTTAA AGACGGAGAT      1440
     GACGTGAATT GAAGAAAATA GTAATAAAAA CAGAACTTCC TTATAATTAT AGAAAGCTTA      1500
     AGGGATTTTT CATTTCACCT GGGGTGCTCA GATTATTTTA TGACGTAAAG AGTGTAGAAG      1560
     TTGCAGGGAA TTTATCATAT ATTATTAACA ACAAGTACAA TGCAATAATG TATTTCAGTA      1620
     ATGTTGATAT TGTATGGGAG ATTTATAATG GTAGATTAAA GGATAAGATC TCAGTATGGT      1680
     TATATCCAAT TGGTGATAAT ACAGGATTAC ACTTGAAATT CGAAACTAAT AGAATACTCC      1740
     CGCTAAAGAA ACCTCTAGAA AATGAAGTCA AAGCAGGAGT AGAATTGCTA AAAAGTTTGT      1800
     TAGATGCTTT GAGGAGGTTC TGATGAAGTT AAGAACCCAT TACATCTTCT CAACCGGTTT      1860
     ATTGACGCTT CTGGACTCTG TACTCTTTCA TGAATATTTT TACTACGCTT TAATCTTGAG      1920
     CGGAATAGTT TCGGTAATAG GTAATTCCTT GATTGATAGG ATTGGCCATA AGGAGATTGC      1980
     CACTAGGTAT GGGTATATCC CGGTAAGGAC ACCTTTAACC CATACAATTC CTAGAAGTGT      2040
     AGTTTGGGGT ATTGTCTCCG TAGTCCCGGT CTTTATTCTC TTATTGATTT ATTATTATGG      2100
     GTTTAGCTAT CACGAGTACT ATTTCTCCCT TAGCAATAAG GTGGTGTTGT TAATATTGTT      2160
     AAATGGTGTA GTTGTTGGGC CCTCTCATTT GTTCCTGGAC GTATTTACGG AAAGGGGAAT      2220
     ATATCATAAA GTAAATGGTA AGTGGAGGAG ATTCGCATTG GCACACTTCT CCTATGATAA      2280
     CCCCTTAGTA AATGGATTAG CAATCTTACT AGGAATTATA ATGCTGCTAG CAGCACTTTA      2340
     TCTACATAAC TACCATTATT ACAACTATTA TTTCTAACGA GATAATAATA GTATAAAGAT      2400
     AAAAACAAAA AAGTTTTTAA ATCTGTTTTT ACAGAAGTAG AAATGGGGGA TGAGGGGATG      2460
     ATGAGTAGGG TCAGAATTGA CCTATGATAG GACACTCGGC AGCTGACCTG ACCCCCTCAT      2520
     CCCTAATTTA TTCTTACCTT ATCTAACTAT TAAGCTTTTC TTCTCATTGA ATTTTGAAAA      2580
     ATTGAGCAAA GAATGAGGTT GGATCCTAAC GTTAAATTTA CGACGTGAGA AAAATTCAAT      2640
     AAACTCCCCA GTTTGCTAAG AAAAATTCTT TCTTCTAATT TCTTAATCTC ATCTAATTTT      2700
     GTATTATTAG CTAATAATGT ACAATAAATG CAGCTGAGGA GTGATATGAT GCAACATAGA      2760
     TACGCTAAAC ATTCTCTATA ATAAACTGAA ATATGATAAT GTATTCGAAT TGAATTAAGC      2820
     ATCTTTATAA TTAGGCAAAT TTGTATAACA CAAATATAAG TGTGCGTAAT TATTGCAGAA      2880
     ATAGTTATCA AGACACTTGT TAAAATAAAA GAAATGATGA GAAGAGTTTT ATTTCTCATA      2940
     ATATTATAAA TTTTATTTAA AAAGCTCAGT TGAATTAACT CCAGTTTACT CTACAAAAAT      3000
     TCAAAGTAGT TAATCCTGCA CGGATCTCAA ATTTTTTAGT TAAAAGAGCA AGGTAATGCG      3060
     ATAATGACCA TAAATACTAC ACTTTGTTAA CCCTACTATT CCCAGTTTGG GAACTCATTT      3120
     TCAGCCCCCT TCTAAGGAGG TAACACTTTG TTAACCCTAG TTAAGGTTTA TTAAGGGAAA      3180
     TTTCTCAATA CAATTTTATG GAAGTTAAGA TAGAGAAACA TAAGTCAAGG TTTACCATTA      3240
     CACAATTAAT TTTAATGGCT ATGGCTAAAG CTCCTGGGAG CTGCTGTAGT TTGGAATATT      3300
     TACATGAGAA AACTGGTGTT GATAAGAAGG AGCTGCTAGT ATATCTAACA AGGTTAGCCA      3360
     AAAGAGGAAT AATAGAAAGG AAATGGCATA AAAGTAGGGC AGGGAAAGAG AGAATGTATT      3420
     GTCTGAAGTA TAAGGAGGAT ATACTATGAG CCCGCCAAAT GATAAATTTT TAGAATACGC      3480
     TAAAGCGCTT TTAGAAACTG CAGAATCTGA TTTAGATGCA AGTAAATTTC TTTGGGATTG      3540
     TAATTATCAA GCTCAGTCAG TGTTTTATCT TCAGCAATCA ACCGAGAAGA TATTTAAAGC      3600
     GTTTAGGAGC ATGTATCAGT ACCTCTTTGT AGAATTTCCC GAATTTATTA CAGAGGAACT      3660
     GATAGCTTCA AGTAATAGTA GAGTTACTAA CTTGATGCCC TATCTTACAC TGTTAAATTT      3720
     AAGGTTAAAA GAGAGAAAAC TGAATATTAA AGGCCTGGAA GATTTACTGA AAAAGGAATA      3780
     CTCTCATGGC TTAAAGAAAG GATTAAAGGG CGAAATAGAT GAGTTAAAAA AGGAACTTGA      3840
     ATATGATAAA GTTATTTTAA AGGGTATATT TTCTCAACTA CAGTATACTA ATATAACAAA      3900
     TAATATTGAT TCTGCAATAT ACTCGCTTAT AAATAATTTA TTATCACCTC AAGGTAACCA      3960
     ACAGAATATC GAGAAAGAAT TAAAAGATAT AGAGGGAATC ATTGAGAGTA TTAATAATGT      4020
     AACTTCGTTC CTTCAAAAAT TCGTGGGAGA AATTAAAAAA CAACCATCAA GTATACCCTT      4080
     ACAAAGTTCA TCCAGGAATA GTAGTAATTT AGTAGATATT ATTTTAGACG AAGTTTTACC      4140
     TTCTATACTT ACCGTTTTAA TATTACCATT TAAACTATAT AATATAGCGT CTTATCTTGC      4200
     TCAGTTTGAA GAGAATTCAA GATATCCGCA AATAAATAAC GGAAACATTG AAATTCCACA      4260
     AGATATAATT CGCAATTGGT CTAATAATTA TTCTAGTATT TACGGTAATT TATATGAGGT      4320
     AATAAAAGAG ATTCTAAATA ACTTTAAGAA AACTGACCAA TTTCTGCTAG ATATTCATTA      4380
     TAGAGTTATT CAGAGAAACT ATTCTATGGA TAGTATACTT AATGATATTC TTGGTTTCAT      4440
     AGACTTTATA AACAATATTT TTCCAATATT ACTACAAAAA AATATATTAC AGAAAATAAT      4500
     AAATATTATA AATAAAGATA AAATAGATGA AAATGATATT GAACAATTAG CAAATGAATT      4560
     AATCAAAACA CTGGAAAAAG TGATCTAAAA GGAAATTAAG CCTAACATAA ACTGTGGGAT      4620
     TCGATAGTTT GGAACGTTTT ACGTATTCTA CTACTATTTT ATTCTACTTT TCTTTCATAA      4680
     CATAATTCTA CTTCTACTTC AACGTGCAAC AGAAAACGTT TCTTTTCAAC GTTTTACTGA      4740
     AACGTTATCT AGCCTGTCGA GCCCCTGACC CGGGTTCAAA TCCCGGCCGC GGCGTTAATT      4800
     TTCCCTTAAA TTGAAAGAGA GCTACGTTCT CTTTATAAAG GCGTAAATGG AACAGTAATC      4860
     CTTATTTTTG GAACAGCGTC ACTTTCTTAT AAGTAGGGTA GAAATATATG CTAATTGATA      4920
     TTTCTAAACT GGACGAGCAA CAAAGGAAGA GAATTATTAA GAAGTTAGTA GAGAAGTTGG      4980
     GGTTATCTCA AGCTGCAAAA ATGCTGGATG TCGGTAGGAG TACTTTATAT AGATACGTTA      5040
     ACAGTGATCA GAGTATTCCT TTAGACATTG TGAGGAAAGC TGCAGAAATG TTAGCTTCAG      5100
     ACGAACTTTC GGACGCAATA TACGGGCTGA AAGTAGTTGA CGTTGATTTT ACTACTGCAT      5160
     TATCTGTAGT TGTTAAAGCT ATGAAAGATG AGAAGTTCCG GAACTTTTTC GTTTCGATAC      5220
     TTTATCAATA TCTAGGAGAC TATTTGAAGA ACGTATCATC AACATACATT GTTACTGAAG      5280
     AAGACGTGAA GAAGTTTGAA AAATTGCTCC AGGGTAAGAG TAAAAGCACT ATTGTCATGA      5340
     GGATGAGGTA TCTTAGGATA GCGCTTACAA AGTTGGGATA TGAGTTAAGC CCGGACAGTA      5400
     TCAGAGACTT AATAGCGGAG TTATCTGAAG ATAGCAGCAA TGTAGCCAGA CATACCGCGA      5460
     ATTCCTTGAA ACTATTTATC AAAACAGTAG TAAAGGAGAA GAACTTGCAG TTAGCACAGC      5520
     TGTTATATAA TTCGTTCAAA GTTCCTAAGT CTAAGTATAA ATACAAACCC CAACCGCTTA      5580
     GTTTAGAGAC GTTAAGAAGA ATCTTTGATA ATATAGAACA CTTAGGTGCT AAAGCTTTCT      5640
     TCTTATTGCT ATCAGAATCA GGGCTCAGGG TAGGAGAAGT ATACTCGCTT AAGATGGACC      5700
     AACTAGATCT GGAAAACCGC ATAATAAAAG TGATGAAAGA ATCAGAAACC AAGAGGGCCT      5760
     ATATTTCCTT TATCCATACA GAAACTAGGA AGTGGTTACA AGAAGTTTAT TTCCCATATA      5820
     GGGAAGAGTT TATAAGGACG TATGAACACG TTGTAGGTCA TATAGGAGCT GATGTAGAAG      5880
     CGTGGAAGCA GAAACTGTTC CCTTTTCAGT TAGCGGACTT AAGATCTTCA ATAAAAGAAG      5940
     GGATGAGGAA GGTTCTGGGA AAGGAGTTCA GACTTTACGA CTTGAGGAGC TTCTTTGCCA      6000
     GCTATTTAAT CAAAAACGGA GTATCGCCGA TGATAGTTAA CATCTTACAA GGACGTGCTC      6060
     CCCCTGCTCA ATTCCAGATA CTACAAAACC ATTATTTCGT GATGAGCGAG ATAGAGCTGA      6120
     AGAAGATATT TGATGAAAAA GGGCCTAAGC TGCTTTCTCC AAAATAAGGT CTATTTCTTT      6180
     ACCTAAATAC TGCTCCCAGA TCTGTTTCAA TGAAATGGGT AGGGTAAGTA TAAAGTAGTT      6240
     TCCGTGCTTA TATAGGCTCC TTAGGCCTAT TAGTATTTCA CGCTGATCAG TTATAGCTGT      6300
     GACGCTCCAT TTTCCATGGC TTAAATACTT ATCGAAACGC AGAGGTAAAT AAACGTAATA      6360
     AATCTCCTTC TTTCCGCTCC TCATTTTTGA TACCGTAACT CCAGGTATCA ATAACTTACT      6420
     CACTTCGGCC ATTAGATTCA CCCCTTAAAC TCCCCAGTTT CTTCCTTAAT CTTCTGTAAA      6480
     ACTGCCTTCA GATGTAGGTC TTGTTTTTCT CTATCTCGTA TAGTCAGTGC AATCTCTATA      6540
     GCCCTCATTA GAATATTATT TTGTCTTCTC AGTTTCATAT TTTCATCTTT TAATGAAATG      6600
     TTCTCTTTCT GCAATCTTTC ATTCTCTCTT TCTAACTTTT GCAGCTTCCT CTCTAAAGCT      6660
     GCTATAGTAT TCAATGCTTT ACTATACTGA ATTTGCAGCT CTTCGTTTTC TTCAATGATC      6720
     TCATTTATTG TCATGTCTTA TCGCCCAATC GTCCAGGGTA GTTTGTCTCA TCTTTTTCTC      6780
     CTTATTCTTT TTAGTCCATT TTTCTGCATA AGGGCAAGAA AGACGATGGG GTCTCCAATC      6840
     TGGGTCAACT GGAATTTTAT AGCCCTTAAC ATGCCTAACC CAGTAGATTT TCTTATGGCA      6900
     ATATTCGCAC TCTGATTCCT CAAATGCCTC TACCCAGTCG GGTATGTCTG AAGTCATATT      6960
     TCCCTCACCC TAACTCCATT GTTTTTCTCT TCAAAGGAAT TTAGTCTGTA AACTCTGCCT      7020
     TTCCTGCAGC TTAAGTAAAA CTTTATTGCG GTCCTAATTA CCTCGCTTCT CTCCTTAGCG      7080
     TTATTAATGC AGTATAAGTC TAGCTGCTGT AACAATTCCT CCTCTAGTTT AAATGTAACA      7140
     ACCCTCATTC CTTTTCACTC TCGATCTCTT CCCAGTCTAC TTCCTCTCCT TCTTCTTGGT      7200
     TCTTTTTCTG CTGATTCTTA CTTTGCCTGG TTTTTGCAGC TTTTTCATCT GCCTCTATGT      7260
     ATTGTTTAGC TAAGAGTGCT AGAATGTAAT CTAATCTCTC TTTAAGTAGA GCAGCTTCAG      7320
     CTGTTGAGAG ATGGAAGAAG GTCTTTTGAT TCTCAGAGTG TATAGACAAT AATAAACTCC      7380
     CTTCTTCGGC GAAATCTTTA GAATTTATTT CAACATCATC AAATCCTAAT TCGAGAACTT      7440
     TCACTTTCTT ATTTTTATCA AAGTGGGCTA ACCGTAGGGC TTTTCTCATT GAATAACACC      7500
     TGGAATCAAT ACTTTTCTTT CGAATTTCCT ACAATAGCTT ACGTCTTCTT CTAAGTCTTC      7560
     AGTAAAGCTA GGATCATCAT TAGCAATAGC ATTGAAGAAT TTGCAAATAA GCTGCTGACA      7620
     ATCTCCTTCT AATTGCTGAA TGTTGTCTAC TCTTCTGAAC TTTAACCAAC AATTAATGAA      7680
     TCTGTCAAAA TCATTCATTC TTCTCACTCT CGACCTCTTC TATGAAGTTC TCAATGGCCT      7740
     TCTCTGGATA GAATATATGG CCAATACTAG GAATCCATAA TGTAAGCTCA GTTTTCTCGT      7800
     TGAAAGAGGC ATAGAATGGA ATATGTTTTT TGCCTATCCT CAGAAATCCC TTTAACGTCT      7860
     TTCCATCTCT GACCGCCCAC ACTACCTTAA GTTCCTCTAT GTTTACTAAC ATAAGATCGT      7920
     TAGAATTGAT AAATTCTTCA AATCTAGCAA ATATCTTATC TATAATTTCC TTCTCACTCA      7980
     TTCTTCCTCA CCTTTAGACA CCAAATATCC AATCCGCTGC CCAGGGGATC TTCAACTTCT      8040
     TCAACTGCAG CTTCTGCTCC TATCTCATCT AACCTTCTAA GAGCCTCTAC CTTAGAATAG      8100
     TAACATTCTT CATATCCCTT TTCCTTCATC CAATTAATGA AGTATTTCTC TTCATCTAGA      8160
     TTTTGCGGTA AACTCCCCAG TTTATCGTCA GATTTTGATA CCATTTGCCT AAAACTTCTC      8220
     AATAACATAG AATCTCTTTT CTCTTCAATT AATTGTAACT GCTTTTCATA ATAGCATAAT      8280
     TTTGTTCCAA CTTCTGCTTC ATCATAGTCT AAGCCGTATA GCTGAAACTC TTCCATTGCA      8340
     CTTATCAACT CGTTAATTTC ATGTAATATC CTCCTTGCAG CTCTATCTGC AGTTAGTTTC      8400
     TGAGCTTTGC CGAATAACAT GTAAGCTTTC TCTAAGTGCT GCTGCAAAGT AGTAGCTTCA      8460
     GTCATTCTCC CACCTCAGCA GCATCTATAG CAAAGCACAT TCCATCAGAA GCTTCCTTTT      8520
     TTGCCTCCTC CTCGCTGTCC GCGTACACGT ATGCAAAACT TAATTCATCT GGTCCTCCTG      8580
     CGACAACGTT TAAACATTGC AACCTTACTA AGTAGAGCTT TCCAGTCATT CCTCCTCAGC      8640
     CTCCATTCTT TCAATTATTT GTAGAGCTCT CTTTGCCTTC TCCCTGACTC TTTCAATTAG      8700
     CCATCTTCTT GCTTCTTCAT CGGCTTCCAC TATCTGTAAT ATTCTTTCGT CACTGGGCGC      8760
     ATAGCCGTTG AGAAACTTAT AGTATGCAGT TTTGCTCAGC TTCTTTTCTT CTATCTGCTG      8820
     TTCGAAATCT TCTCTGAATT CCTTTACGAA TTCTATCTTA TCTTCTCTGT CCAATAAACT      8880
     AATTAAAAAA AGAAGATCTT TCTCCCCATC AACTGGGGAG TTTTTTTGAG CCATTTCAAC      8940
     TAAACTCATT TTCTTCATTC TACATAGTAT GCAGAGAGAT ATTTAAACTT TTGCATTCAA      9000
     CATAGAGTGC AGAGAATCTC AAATAAAAAA ATGTTATTTA CCAATCTCTT TTAGAGTATC      9060
     GTTTAATTCT AATAATTTTT CAACTACAAC CTTGCCAGTC TCCGTTAACT TCACTACCTT      9120
     CTTAGCAGTT CCTACTGAAG TTTTTTCTTC TCTCACCACT ATTAACCCAT TCTCTTCTAA      9180
     AATCGGTATC CATTTCTGGA TTGTATGCCG TCGTCAACAG TTTCCGATAA ACCGTGAAGT      9240
     TTATATACTT TGTATGTAAG TTTAACTACA ATGCTGAAAC CTAAGGAAGT GTGCCAAAAA      9300
     CTAGGAATAT CATACCGCAC ACTACAGAGC TATGTTAAGA AGGGTTACAT AAAACCCGTG      9360
     ATACTACAGA GTGGAAAATG GAGGTTTAAA GAAGAGGATG TCGAAAGACT CATGGGGGTT      9420
     GTTAGGAAGA GGAAAGTAGT ATTATACGCT AGGGTATCAT CAAACACACA GAAAGACGAC      9480
     TTAATAAACC AAGTTAAGTA CCTGGAGGAG AACGTTAAGG ACTACGACCA AGTAATAACA      9540
     GACATTGGTT CTGGGTTGAA CATGAAGAGA AAAGGATTCC TCAAGCTATT GAGAATGATA      9600
     CTAAACAACG AAGTATCGAA AGTTGTCATA GCCTACCCAG ACAGACTAGT TAGGTTCGGC      9660
     TTTGAAATAA TAGAGGAGGC ATGCAAAGCA CACAACTGCG AGCTCGTGGT ATTAAATAAG      9720
     GAGGACAAAA CACCAGAGCA GGAACTAATC GAAGATTTGA TCTCTATACT GGTATCATTT      9780
     AGCGGAAAGT TGTATGGTAT GAGGAGCCAT AAATATGAGA AGGTGAAGAA GTGTGTCGAA      9840
     GAGCTTAAGG CTTAAATCAT TCCAACCGGA GGAGGAATAC GTTTACCTAA CTTACTCCCT      9900
     GAAGAATAAT AAGAAGGTGA AGAGCAAGAT ATTACTAGAG AACTATAAAC ACCTACTACA      9960
     GAAGGCTTTA GACTGGTTAT GGGAGAGGAC TAAGATAGAG AGGAAGGAGG TCAAGAAGGG     10020
     CAAGAAAATT TTCGCTAAGG TTAAAGTAAC CTTGCCAAAG AAAAAGGAAG TTTACAAGGT     10080
     GTTGAGGGAT GAGTTAGAGA AGGTTAACAA TCTAGCTTCA CATTACGTTG ACAAAGCAAT     10140
     AAATGATGCT TACTCAATCT TGAATAGTTG GAGGAGGAGG GCTGAAAAAG GACAAGCGTC     10200
     ATTAAGGAAA CCTAGATTGA AGAAGGTTTA CGTTAGGGTA AAGTCGACAC TTAGAAAGGT     10260
     TGAGGGTGAG AGTGTAAGGA TTACAGTAAG ACCTTACGAA TACGTCACCT TCTCATGGTC     10320
     TCACAAATGG TTTTCAAGGA GGGTTGAAGG GCTTGAGTTG GGTGAGCCAG TAATAAAGGA     10380
     GGATAAAGTT CACCTACCAT TTCGTTATAA GTTACCTTGG TTTACTCCCC TTGACTTTCT     10440
     ATCTATTGAT AGTAACTTGT ACACATTAGA CGCTTACGAT GGGGAGAAGT TCGTCACATT     10500
     TTCTTTGAAG GAGTTGTATA GTTTGAAGTT CGGTATGGAG TTGAAGAGGA GTAAAATACA     10560
     GTCCTTCGCT TCTAAACACG GTAGGAAGGG GAAGGTATTG TTGAGGAAGT ACTCCCACCG     10620
     TGAAAGGAAC CGCGTGCTTG ATTATGTTCA CAAGTTTGTG AACAAACTGT TGGGAATGTA     10680
     TCCTCTCACT ATGTTTGCTG TCGAGAAGTT GAATAAGCAG TCAATGTTCC AAGACGCTGA     10740
     TGATAAGCTG TCTAAGAAGG TTTCAAGGAC TGTATGGAGG ACTATACACC GCGTGCTTAA     10800
     ATACAAGGCT CCCCTTTATG GTTCTTTCGT TAAGGAGGTG AACCCACACC TCACATCTAA     10860
     GTCCTGCCCC AGATGTGGAT GGGTTTCCCG AAAGGTCGGC AGGATTTTCA AGTGTGAGAG     10920
     GTGTGGGTTC ACTCTAGATA GGCAACTAAA CGCATCTCTC AATATTTACC TCAAGATGTG     10980
     CGGGTTTCCC CACCTCTTTC TTACTCCCAC TGGGAGTAGG TGGATTGGGG TTATCCCGCT     11040
     AAAGGGGCGG AGGGGTATGA ACGGGGCGTT GCCCCGCGAC TCTGGTGAAG CCCAAGGGCT     11100
     GAGGATTGGA TACAAATTCA TGAAAATTCA ATGAAGCCCA AACCCCAACT CATTTGGCTA     11160
     ATTTTTACCA GATCCATTAA GGATCCCTCA CCCATCATGT TAATATATAG TAATATTTGC     11220
     ATAGGAGTTG ACAAAATATC GAGAAGCTTT TTATTTATAA CAAGTTCACT CATTCTACTC     11280
     TCACTACATA ATATAGAGAG TAAAATTTTA ATAGTTTCGC TTACCAGTGC CCTCTGTTCT     11340
     GCAGTCTACA CAGAAAGCAA ACTTTTAATA CTTTCTGCAC ATAGTATAGA GTGATGAAAG     11400
     TCTACCCTAT CAACGCTAAA TACAAGGTAC TTATAGTGTT ATTGAAACTT GGAGGAAGCG     11460
     GAAAGTATAG TGATATAGAC AGAATGATGC GTAATTCTAA CTTACGCTTC TTCATAGAAC     11520
     AATTAAGACA AGAAGGTTTT ATTGAAGACA GATATGAGGG AAATAAACAT ATAATAAAGT     11580
     TAACAGAGGA TGGAGAAAAA CTCGCTAAGA GATTAATGGA AGCTGAAGAG TTCGTAATGA     11640
     TGAAAATAGC TCAAGCGAGA GGCCAGATTC AATGAAATCC TTCTTTTTCA TTTTTATTAT     11700
     AGTTATTCTC TATTTCGTTC TTCTTCAATT AGAATTCTCT ATTGATAGAA GAGAACGGTA     11760
     AACTGAGGAG TTTAAGGTGA GAAAATGATT ATCGGTATGG GAAAAAGTCC AGTAACTGCA     11820
     ATTCTGCAGC AATACAGCTA TATCTGTGCA TATCCTTGCT TCTTTGATAA CAAAGTATTG     11880
     CTGACTGAGA ATAGAAGCAG GGCTTATATC CAGTACATTA AATTATTAGT AAGGCATTAT     11940
     GCAAAATACG GCAGGGCTCT TAAAATCGCA ATATGGCCCG ACTATACTCC ATTATATAAG     12000
     GTAGAGAAAA TAGCAAACAT ATACTTGTTT AATAATATAA GCTTCATAGT TCCTATACAC     12060
     GATTTATCAG AACTAGAGAT TGTAGATGAA CTAGTAGAGA ATGGGTTCAG GGTTTTCGCG     12120
     GGTTATGCTT CCGATAAGAA GCTTAGAAAA TATGAACTTG ATGACTTCAA AGAAGTAGCA     12180
     AATTACGACC GGTGGTATCT AGGAGTATCA TCTAAGCATG AGGTAAGAGA GGCAGTACTA     12240
     TATAATTTCC AGGGTTTTGA CATAACAACA TTTCTCTTTG GAAGACATGA GGATAGAAAG     12300
     GACAGCAAAA AACTTGCATC AAATATACTG AATTTCGTTA AAGAGATCAG TAAGGTCAAA     12360
     GGCAAACAAA CTATTCTTTA CGATTTCTGC GGTAAACTGG GGAGTTTAAC GGGTGAAAGA     12420
     CGGTGATAGG CGTTGAAATA ACTCCTAAAT CCTCCAGGGT TATCAACACC TTGGCCTTTC     12480
     TGCTGGAGAA CGGGAGCTCC TTCGCTCACC AACTATCTCA AATCATGAAC ATGGACTCCA     12540
     GAGAAGTATA CCCCATGCTG AAGACCTGGA TCCTAAAGGG AGTTGTAACG GTATCAAAAC     12600
     AGGGTAGGAG GAACGTCTAT TCGATCTCCC AGAAATTCAA ATCTTTAATC AGCAGTGTCG     12660
     TAAAGAAGTA TTCTTATAAG GGCAGGGAAT TCATAATAGC TAAGGCTAAG GAGAGGTATA     12720
     AGAGGTTCTT AGGGAGGGAT CCGGACCCGG AAGTATTAGC AGTAATAGAG TACTTTGTAG     12780
     ATAAAGCACT CTCTGGAAAC CCCTACGTCC AAGGATCTCA AAACGAAAGC GTTGCAGAGT     12840
     TGTTGGCCAG GGTACTGAAC ATTTCCTTAT ATGATATTAA TGAAATACTG AGGGAACTAG     12900
     TCCAGGCTAA CATCTTATAT GTTTGGAGGA ACAGAAAGGC AAGGTTAGAC TCTTCCCTTA     12960
     CGGCCTAACT GCCTTACCTA AAACTATGAG TAATTTTTCT CAGTCTCGTA ATAAAAGTTC     13020
     TAACTAGCGT AAACTCCCCA GTTTAATTTG TAAAAACTCA AAGTAAAAAC AAACTAATTC     13080
     TTTGAATAAA CTCCCCAGTT TATTGAGAAA AATAGAAACC TCTCTAAAAA GAGACTTGCT     13140
     ATTTATTACT ACTACTCAAA CTTTCACAAA AAATAAAAAC AAAAACAAAC GTTCTTACAC     13200
     TACTTTCAAT TTTACAACTT TTTACTTAGG CTAATTTTAC GCTAAATTAT AGCTAATTGA     13260
     ATTTTTTGTT TTATTTTTAG AAAAATTTTA TGAAAAGAAA GAAGGCCTTA CATACTTCTT     13320
     TTTACTGGGC CTAAGCTTTT TCACTCTTCT GTTTTTCATT CTCAGAACTC TTAGTAGTAG     13380
     TTATTACCAG TAGTCGAATT TTTCTTCAGT AAACTGGGGA GTTTAATTCT ATCTCAGCTA     13440
     TTACTAAAAC TTTCTTACCT ATTAATTTCT CCCCTATCTC TTTAGGAATA GAAATACTAA     13500
     AGTAAGGAAT ATTTTCTTCT CCTTTTCTGT AATATTCCAA AGAAAATATC TTCACATTAC     13560
     TTAACTCTAT TTTCTCTTCA TTGGTAACTA TTGTTACGTT TTTTAATATT TTTCTCTCCT     13620
     TAAGTATGTT AGAATACTCT ATAGGAAAAG TAACTATATA ATAAGGATAC TTAACCTTCT     13680
     CTCCCTGACT GTTAATCTTT ACGTTATACT TTACCCTTAC TTTTAACTCC TCTTTAATTA     13740
     TCATATGTAT GGATATTTTT AATTTTCCCT TATAAATCTT TCTTTATTTT AAGAGAGATT     13800
     CCCTTCTAAA TTATAGAAGA ATCTAAGAGA GAAATATTTA AATACTAGAA AGTAATAACT     13860
     ATACTTGTGA AAGAAAAATG GCAAAAAGAA CAAATAAGAC AAGAAAAAGC AAAAAAGAAG     13920
     AAGATGAAAT GATAGACGAA GTACAAGAAA AATTTGGGGA ATATTGCTCT GACCCAGAGA     13980
     ACTACACTGA TGAGGCTTGT GAAAAGTTAT TTTAATTTTT TTTTTTAAAA AAACTTTCTA     14040
     AGAATATAGC ATATAATTTT CTTATTGTTA TAATTCTCTC TTAGTACAGT AGTTTATTTA     14100
     GGAGAGAAAT ATTTATATAT TAGTTTAAAG AAAGTATAAT TGATGACGGA AAACAAAAAG     14160
     AACAAAAAAG AAGTAAACAT GACATTCATA TCATTTCCTA GCAAAGAAAT TTTTGAACAA     14220
     ATATATAATG AGCTAAGTGA AGACGGTAAA AAAGAATTAG ATAGAATGAT GAAAGAAGGT     14280
     AGAGTAAAGA TATACTAATT TTTCATTTAA TATTTTAAAC TTTTTCCTCA ATTTGCTAGC     14340
     ATTTTCTCAA TTTCTTCTCC TATCTTGTCG TCTAATTTCT GAATCCCTGG CATTGGCTTG     14400
     AAATTAAACT TCTCCTTCAA TACTCAAAAT TGGGAGAAAG AGAAGAGATA GAAAAGAAGA     14460
     ATTTACCACA GAATTGTGAG AAATTAAGGC AAAAAAGTAG TTTAACTCAA GATTGTGAGA     14520
     AAAAAGATAA AATGAATAGG GGGTTTTACC ACAAAAATGG GTAAAATTTC ATTCTCACTA     14580
     AAAATATATT CAAGTTATAA TAAAAAGATT ATTTTAAAAA TTCATCTAAA TTTAATTCGG     14640
     ATTTTACAGT ATATTCTGGA TATTTCTTAT ACACATAGGA TAACAACTCC TTAAGGTCCT     14700
     TATTCCCAAA TCTATTTATT AAATCGTTTA CCGCGTTGGC GATATCTTGA TTTACCTGCG     14760
     GTAACTCCTT AGATGTGATT AAACTCTTAT CTACGTTATC TTTAACTTCC TTAACCTCTA     14820
     TCCTATCCTT AAGCTCCTCA AGATCCTTAT AAAGTTGGGG AGTAAAAGGA CCATATTTGT     14880
     ATGGTTCAAA ATTGTAAGCT AGATTAATGT TATATTCCTT TTGAAGGAGG AATAGATACT     14940
     TCATTAACTC TGTCATATAG ACTGGCCTAC CTTTAATCTT AGACGCTTGA TAGACTAAAT     15000
     ATGGTATTAC TACAGATCTA AGTAGGATAA TTTGCCTCCT CCAATCCTCA GTTAATTTCC     15060
     CTGTTAATGC TAACCTAAGA ATAGACTTAT ATAGAGTATT TGCCTCATCT TCTAAGTTCT     15120
     GTAGGAAATC ATTAAATCGA ATAATAAGTT CATCAACCTT TTGAAGTAGT TCTACGATCT     15180
     TCTTTTGTTC CTCTAGGGGA GGTAAAGGAA TTAGTAAATT TCTTATTGTA TCTAAGTTAA     15240
     GATTCCACTT CCCTGCTTGG TTTTTAACCA CTTTCTTAAA AGATCCGTTT AGATGATACC     15300
     ATGAGAGTAA ATAATATATA TAATATGGTT CCACATCCTT TGATACAATC CGTATTGCCG     15360
     TTAGATGATT ACTAAAGGTT ATCTTTTGAT TTAAAGGCAT ATCAATAATA CCAAGTTTCC     15420
     CTATATGATC AATACTACCA TTAGTATTGA CCAATACGAT ATCCAAATGC CTGAGCAAAT     15480
     ACCTCTCAAT TTTTGGAGAT TCAGGTATAT ATACAATTCT ATGAAAAACA ATCCTATCCG     15540
     TTTCATTATC AATATTATCT GGTCTTAAAT GGATTACTTT ACTATTCTCA TCTCTTTTCC     15600
     TCTCTGAAAA ACCAGAACGT ATAATAGCAA TTTCATTAAG TCTTCTTACT TCCCAATCCT     15660
     TAGGAAATTC GCCAATATCA GTCTCAACAT AATCTCTATG CCCTATACCT TTAGTCAATA     15720
     ATTCCTTTCT TATTACTTTC GTTATAGTTT CTGTAGAATT TCTAATTTGA ATAATATAAT     15780
     CCTTTAAGGT GTAATAAATA TCAGTGGCCT TTTGAAGTAG TTCTACGATC TTCTTTTGTT     15840
     CTTCTAGGGG AAGTATAGGA ACTGAGCTAT TTAAAACTAT TTCAAGTGTA AGATTGGGTT     15900
     GAGTACCCTT TTTAATAAAT TTACTCCAAT AAGGTTTGAA GTATAGATAC CAATAATATA     15960
     AAAATTCTGT ATCTATAATA TTCTTATTAG GTATTATTCC TATAATTGCT TGATTTGTCG     16020
     CTACTGGTAT TTTATTAATT GCAACAAATC CTAAAGAACC ATAAATTGTT AATAGTAAAG     16080
     AATCCTTTGG AACTATCCAA GCATTAGAAT TTTCTAATCC TTTTTCAGTA ATAAATTCCT     16140
     CAGTATTGTA TAGATACTTA CCAGATTTCG TTATATCTTG TATCTTTGCA AATGGAATGT     16200
     TTCCGTTCCA ATATTCAGGA ACATTTCTTC TGGGTGTTCC TCCAGATTTT GCTTTTATTA     16260
     TAACATCTTT TAATTTTCTT ACATCCCAAT CCTTAGGAAA TTCACCAATA TCAATCTCAA     16320
     CATAATCACT CATTTTCATC GCCAATGCCT AAGATCTTCT TTAACTCATT CAACCTTTTC     16380
     ATAGCGTCAC TTAAGTTAGT CTCCATTAAT TCTATAAGTT GTTTGGGATC TGCATTTTCT     16440
     TCCTCTAACC TGACTTTCCT ATATACGTTA ATATCTAATC TATAATCATG TTTCCTTATC     16500
     TCTTCAACAT CTACTACGAA GTACTGTTCA GTTTGAGGTA TTTCCTCTCC TCTCTTAAAT     16560
     TTCTGATAAA TTTCTAGAGC TAAAGGCAAG TCTCCGCATC CATCTATATC CCCCTTCTTA     16620
     TCACAATCCC CTATAGGTTT CCTAGTCGGT TTAAGTTCAT AGCCGTCGCT TTCTATGTTA     16680
     AAGAAAAGTA CCTTATCTGT AGTCTTTTCT CCCTTGTTAG GCCTTCTAAA GACTAATATA     16740
     TCTGTTTTAG CAGCTGAGTA AGGCAAGAAA ACCCCTGCGG GTAATGAAAA CACAGCTTCA     16800
     ATCTTGAATT TATCAACTAA ATCTCTCCTA ATACCTTCAT AGTTCTCGTT AAAGAGGAGG     16860
     CCTTCCAGCA TTACTGTAGC TACCCTCCCT CCAGGTTTGA CCATGTCCAT TATAGCTTGA     16920
     ATGAAATAAG TTTCAAATCT CTTGAACTTA TACTTAAAGT TACCAGTAGG TTCACCACTA     16980
     AATGGACCAA AAGGCGGGTT AGTGGTTATA ACGTCTGCCT TCTCCTTATA TGCACCTTGG     17040
     ACTGAGCCAG AGAGAGCATC TAGGTTCTCA AAGTTCGATG AGCCGTCTCC ATGAAGCCTT     17100
     AAATTCATTA GCCCTAACTT AAAGACATCT GGAGCTTTTT CTATACCGTA AAGGTTATGC     17160
     TTTAATTCCC TTATTTTTAT TTCCTTATCA GCTTCATTGG TAATTTGTCT CTCTATTTTT     17220
     TGTTTAACAT ATTCAAAAGC CTTAACTAAA AATCCTCCAG TTCCAGCAGC TGGATCTAAT     17280
     ATAACTTCAC CTGGGTTGGG ATCGATAATT CTGACCATAA AGGAAACTAT ATTCCTAGGC     17340
     GTAAAGAACT GTCCGTAATT ACCTTGTTGC CCAAGTTTAT ACATCAAAAA TTCGTACCCT     17400
     CTACCTAAAG CATCAAATTT TCTTCCTTCG TCTCCAGGTA ATTTCAGTAG CCTAAGCCTA     17460
     TCTATAACCT GGATTACCGT ATTATCGTTT TGCATTCTCC TGGTTTTGTT GGAGAATATT     17520
     TTCTTGATTA TACTTCTATC TTCATCTATT TTTGGATCTC CGGTATCTGG TAAATTAGCC     17580
     AAATCGAGAA ACATTTTATC CAAAAATTCT GTTACTGTTT TGAACCCCTT ACTTCTAGCA     17640
     TAATTTCTAG GATCACATGC CCAGTTAAAG AATCTGTACT CACTTGGTAT AGTGGACTTA     17700
     TAGTCTTCAC CCAACTCTTT AGCTATGTTT TCCTGGTAAA TTTCCTGCTC ATCAAACAAC     17760
     CTCAGGAAAA ACAGATACGA GAATTCCTCT AAATATTCCG TTGGTTTTAC TATATCGCTT     17820
     CTAAATATAT TAGCAATATT CCATAACTCA TCTCCAAAGG AGTTCCAATC AACTTCTTTA     17880
     CTCTGTTTCA TCGAGTTTTC GTAACACGAA TTAGCCAGTT TCCATCACCG CCTCATCATA     17940
     TAGTTTCCAG AATGAGTTTA TATCTTCAAA GCACCCTTTT ACCTTAGAAA ATCCTCCAGC     18000
     TTGCTTAACC ACCTCAGCGT TGAAAAACGC CTTCTTATCT ATATTTGGGT TTCTCTTTCT     18060
     AAAGTCATAG AGTGCCATGA ATAATCTTTC ACATTCTTTA GGATATCCTT TCTTGTTATA     18120
     CCATTCCTTG ATAAGATTCC TTTTCCTTTC CTCTGGAGTC GGGAAAGTTT TCAATCCCAA     18180
     AGCCACTTCT ACGAAGTCTT TTAGGGTAGC GTCGGGTTCT CCATAAGTAT CCTTTAAAAC     18240
     ATCCTCTGTT ATGCCTTGTT CATTAAGGAA AGCTTCAAGC TCCTTTAAAT AATTCTCGTT     18300
     TAACGTTTTA CCTCCATTTT TCCTATAAAA ATAGTCGAAG GATCTGACTG CGGTTTCAAA     18360
     TTGTGTCTTC TTTATTTGTA CTTCTTCTTG TGCTTGTAAA TAAGCCTTTA CTTGTCTTAC     18420
     TACTTGTTCA CTTATTCCTT TTAATTCATT CTTAAAATTC TCAGGAGTAA TTACTTCAGC     18480
     ATAAACTATA CTTACTGGAA TATCTAAGAT TACCATCTCT TCTCTCTTTT GTTCTCTCTT     18540
     CACTTCCTTC TTGGCAGTAG TCCTTTGCGG TTCTTCTGTG GAACCCATAA GCTCGCTTAT     18600
     TTCCTTCTCT TCTTCCTCTT CTTCTTTCAC GATGTCCTCA TTCGTTATCG GCTTGTCTTC     18660
     TTCATTTTCT AATCTCCATG TGTCCACAAA ATCAATAAGA TAGAATTTGT CCTTTACTTT     18720
     ATTTCCCTCT TTATATATTC TAGTCCCTCT ACCTTTCATT TGTAAATATA ATACTCTGGA     18780
     TTTTGTAGGC CTTGCCATAA CTATTACTTC TACGTCAGGG GCATCAACAC CAGTGGATAG     18840
     TAAATCTACA GTAAAAGCAA CTTTGATCCT AGAGTTAGGA CTTTGGAATT CTCTAACTAA     18900
     TTCCTCATGA TTAGGAATAG CGGAATGAAT AGAGCGGAAA ATTTCTTCAG CCTCAGCATT     18960
     ATCAGGAGAG TATCCCATTA ATTCATTATA TTTCCTAATA AAAGCTAGCC TGAGATTTTC     19020
     TGCATGCTTA ATACTAGCTG CAAAAACAAT AGCTTTCTTC AGCTCTTTAG TTTCTTTAAA     19080
     GTTTATTGCT TCGAAGTATT TTTCAGCTAT TAATTCATTC CTCATTGGTA TATCTACTTT     19140
     TTTACCTAAA TCGTTAGGAT CAAAATCATA ACCTAAATCA TGAATTCCAT AAATATCTAC     19200
     ATTTGTAAGG AACTTATAGT AAATTGTATC TGCTAAATAG CCGTCTTTTA CTCCCCTACT     19260
     ATATGTATAT CTAAAAATAG GATATCCGAA ATACGCAAAA TTATCAACAT CCTTATCAAT     19320
     TTTAGGGGTT GCAGTAAGCC CTAACACTGC TGCTTTATTA AAGTATTGCA CAACTTTATG     19380
     CCAATCTCCA TAATACGATC TATGTGCCTC ATCTAAAACT ATCAATTGGA AATGATCTGA     19440
     ATTAAATAGT TTGAATTTCT CATCTACATA CAGCATTTGT ACTGTTGAAA TGATTATATC     19500
     TGCAGATAAG TCATTAATAT CACCACTTAA TTTTCTTATA TTATACTTGT CTCCTAACCT     19560
     AGCATTAAAT CTCTGATAAG TTTGGGTTGC TAGGGAATCC CTATCAACTA AATACAAGAC     19620
     ATTTTTTACC TTGCCCTCAT CAAGGAGTTT CGCTATTGCT GCCATTACAA CCTCTGTTTT     19680
     CCCTGTTCCA GTAGCCATTT CTACTAACAT TCTCTTTTTA CCGCTGAGAA AAGACGTAAT     19740
     TATTTGCTGT ACTGCAATCT TCTGATAATT TCTTAAATCA AGGGCATTAA TCGAACTGGA     19800
     AACCGGATTT AATGTTACTG AAACTTCTTC AGGCTTTAGA AACCTCTCTA CTTGGGTTTC     19860
     TACTGTATTT GCATCTAGGT TTTGCATGTA CCATTTTTGA CCATCACACG CATAGATATA     19920
     AGGTACGTTA ACTCCATATT TTCTTAGAAT TTTAGCACTC TCTCTAGCCT CTGCTATTGC     19980
     AGCTCTTAAA TCAACACCCT TTTTCTTCGC CTCAATTAGA ATTACCTTAT CTCCTAAAAT     20040
     TAAAGTATAA TCTGGTCTAT GTTTTCCTTC ATTTTCTGTA AACGATATGT TTGGGAAGAG     20100
     ATCCTTTAGG GTGTGGTTTT TCTTAAATTT CTCGAGATTC CATCCCAACT TCCTAAGATG     20160
     TTCATCGCAT AACGTTATCG CATCAGCTTC GGTATTTGGC ATGATAATAA ATATGCAGAA     20220
     AAATTTTTTA ACCTTTCGGG GGTTAAGGGG TGGGAGCCCC TTATACTAAT TTTAGAAGAG     20280
     AACAGCCCCC AGTTTTTTGA AGTTAGAAAA GCAGTTTAGC AGTATCTGAG ACAGGTTAAG     20340
     CAGTCCTGGA ATAAGCAGGG TTTTAGGCCC TAAATTAGCA GCTAAGGCTA TAGGACCTTG     20400
     TAAAGCAGTT TTTCTAAAAA CATAGTTAGT AGAAAACTCC GGAGCTAGTA GGGATTAGCA     20460
     GTTTTAGGTT TTGGGTTATA GGGCGTTAGC CCTTATACTG TGATAAATTC TATTTGAAGA     20520
     GAAGGGAATT AAGGTTTAGA GAATAGGAAA GAATAAGGAT TAGCGCAGTT GTATTTAGAA     20580
     AAGAATAGTT TAGAATTATT TATATAGAGA ATTGCAAGGT AAGGGATTAT AATAATAGAT     20640
     GAAAGCCGTT ATGAATAAGA TAATGGGCTA AAACGAAAAG ACCTGGAGTA GTTAGTGTTG     20700
     GGAAAATGGT TATTGAGCTT AGGATCCTGG AAGGGTATTA AGTAAAATAG TTAGTTAGAA     20760
     TGGGATATAG CAAAGAAGGA ATGAGACCCT AAGATGTTAA ATTAGAGGGT ATTAGGTTAT     20820
     AGGGTTATTT AAGGCTAAGT TATAAGAGTA AGTAGGTTTG TGTTAGTAAG CAGCTTAGAA     20880
     GAATAGTATA AGCAGAAAGA GAGTAGAGGT GCTAAGCAGA GAATAGTTAG TAAAGATAGT     20940
     AAAGTTTAGA GGCAGAGGAG TAAGCAAAAA GTAGAGAAGA GAGGTTGTTG TTTGTTAGAG     21000
     TAAGAAAAGC TGCTAAAGAG TAAGCAGTTT AGAAGCAAGG AAGATAGTAA GTAAAGTTTA     21060
     GCAAATAGAT CAGATTTGAG TTAGACAGAA GTAAAAAGAG AAGAAGCAAA AGTAGAAAAG     21120
     AAGAGACAGT AAAACAAAGC TAGAGTTAGA AAGAGTAAGA ATAGAGTTTG ATAGTTAAAA     21180
     GCAAAAGAGT AAGAAAGTTT GAGAATTAAA GGAAGCGGGC GCAAAGCCCG AAAATTGGGT     21240
     ATAGAATTTT GTTTAGATTA TAAGTAAAAA TTAGAGAATG GGGGTATAGA GATGAAATGC     21300
     GGTGCACGAA GTTGCATAGC CGAAGCACAA AGTAAAATAT CCACAGCATA AAGTCATATA     21360
     ATAACTGCAT TAATTCTAAT GTTGAATAAT TCTTTCTACT GAGGTATAAA ATTTGCATAG     21420
     TTAGGATATG AGGGGTTTTT AAATATTTAC TATTATTAGG ATGAGGAAAG ATGGGAGAAG     21480
     AAGTAAATAA TCAGTCAATT CAAAACCAAC CTCAGTTAAA TCAAAATAAT TTAAACAAGG     21540
     GAGATAATAT CTCTTCTAAT GAAGAGAATG TAAATGAAAA GAAGAAAGAA GAAAAGAAAA     21600
     GTAAGAAGCA GAAAGTAGAG AAGAAGAAAA GTGATGATTA CTTATTATTA GTATATCCAG     21660
     AAAAAGCAAA GTCTTTCAGA GCCAAAGTAC AAAATTGTAT TATCGAAATA TTAAAGAAAA     21720
     ACGAGTTAAT GAACGAGAAA GACTTAGTTT TGCAGTTGAT TTTTGAATGC GAAGCTGCTA     21780
     AAGAGTACTA TAAAGTAACT CACGAGACTC AGTACCTGAG GAGAATTATA TGGAAGATGG     21840
     CGAAGGATAA GACGATTTTG AGGGCGAAAA TAGTTGGAGA TGAGAGGTAT ACATGGTATT     21900
     TATTACCAGA GAACTTAGAA AAAGTAAAGG ATAAGTTATT ACGTAGGGCC TAAAAGGATA     21960
     GTTTTCTTAG TTCCAGCTGC TTGGATTAAG ATCTTATTTT CTTTTAGTTT TACGTCTTCC     22020
     AGTAGCTCCG GATCCTTTGC TGCTGCTTTA AGCAGTTCTA AGTCTGTCTT AAGTACCCTG     22080
     TACTGCTTAT CTCCTATCTT TATTATTGCA TAATCGGTAT CCTCTTTGAG GACCTCTATC     22140
     GTTACTTCTT TCAGCGTTAA ACTCCCCAGT TTACTGTTAG CATTATTGGC AGCAGCTCCC     22200
     TGGGCTGCTT GTTGAGCTAT ACTTTCAGCC TTCTCTTCTC TTTTGCCGTT AAACTCCCCA     22260
     GTTAACTGTT CTTGTTTCTG TTCTTCTTTA CTTTGTTGTT CTATCTCTTT CTTTAACTTT     22320
     ATTGAGAATA TCTTAACTTT GTTTTTCTCT ACATCAGAAA GTTGATTATA TAGCTGCTGC     22380
     AGCTTATCAA AACATTCTTC GTATGCCCAT GAATGTACTT CTGCAAAGTC CTTAGTGCTT     22440
     TCCTTTCTGA AATTATGCAT TACTTGCTCC GGATGTACAC TAAGCTCATT GCAGCTTTCT     22500
     ATTTCAATTG CAATAGATCT ATCATAAATG GGCCTCAATG TTGATTTGTC GATAGGTATA     22560
     GCTACTATAT CAGGTCTAGA CGTCAAGCTC TGGTCTTGTT TGGCTGGAGT TACGTAATAA     22620
     CCTTGCTTCA TGTACCTGAG CATTACCTTC ATGGCCAGTT TTCTACCTTC AACAGAAGGA     22680
     GCTACTGCTT TAACATTTCC AAACAGTCCC TTACCGTAGT AGAGAACCTT TTTGTTTCCT     22740
     TCCTTTTCAA CGTCTATATA ACCTAGTTTC TCCAATCTGT TTACCACATC ATTCACCTTA     22800
     TCCCTGTCCA ATCCTAGCTC CTTTAATAGA TCAACTAAAT ACATCTTCTT CCCATTTTTG     22860
     AACACGTGAT ATAGAACCAG TTGTTCTAAT ACGTTAGGTT TCTCTATATA TTTCATAATT     22920
     GGGTTAACTA TACTCTCTAT GTCTTCGCTC TTAGGTATCT CTCCGGTTAT ATATATCTGC     22980
     ATTCTGTCTA TGACTTTCTT CAGCTTCTCT GGGTTCTTTT TCACAGGGAC GTAGTTTACT     23040
     TTAACCCTCA CTGGGACAAC CTTATCTCCC TCTTTTCTCG GTGTGATTAT GGCTACAGTT     23100
     TCGCCTACTC CTAGGCTGGG TAGGATTTTT TGTAGCTCTG AGCCGAACTC TGGAAATATT     23160
     TCCGCAAACG CTTTAGCGTC ATCTCCTTGT TCCTTCATCA ACAGCTTCAC CCCAGTATTG     23220
     CTCATTATTG ATTTAATGAG GGGTTTGTCT AACTGTCCAG TGTGTTGATG AGCCATGATA     23280
     ATATGCATAC CGTACTTCCT GGCTTCGCTT AGAATATCAT CTATAACGCT CAATGATGCA     23340
     ATATTCTGGA ACTCGTCCAT AAATGCAATA ATAGGAATCC TTTCCATGCC TAATGCAGCC     23400
     CTCGCTAATG CATAGTACCA TGTCTTGAAG ATCCAACCAG CTAAAATCAG GAATGCCGCA     23460
     TCATTTCCTA CTGCAGCTTT TGATGCGTTT ATTACTATTA TGTTCCCGGG CTTGAATAGT     23520
     TCCTTATCAT CTATCTTACT CCTACTGAAT ATCTTTAGGA GAAGAGGGTT TGTCCCTAAC     23580
     ATCTCAAGCC TCGACACAGC TGAGAGGAAG CTCTGTTCCT GCATGTTTTG GAACATCCCT     23640
     AATTTATTTT CCCAAGTAGG ATCATCAACT GGGAGATCTA TCTCACCTGT CCTCAGTTTG     23700
     TAAATAATTC TGTATAGATC TCTAAATGTA GGTTCTGGAG TTTTAGAATA AAGTAGCTGC     23760
     ATTGATACTT GAATGATATA TTTTACGTAA ACTGCGGTAT CCTTAAGTCC AAATAGTTTC     23820
     TCGAATATTT CCATAACATT GCTGAACCCT AGTAGCAAGG CTTGTTCTTT ATTTGGGATG     23880
     TTTGGCAGTG CTAATGGGTT GATTGAAATC CCTGATTCTA CAGGGTGGAA GTAGATTAGT     23940
     TTTTCGTCAT CTGCAAAATA TGAAGCAACC TCTTCAGCCA TGTCTCCGTG CGGGTCAAAA     24000
     ATCATGATTA TCGTGTTATT GTAAGCTTTC TTTATAGCAG TTATCAAGGA AATAATTGTT     24060
     GTAGTCTTCC CAGCACCAGT GCCACCTATG ACATATCCGT GTCGATAAAG ATCTTCTAAC     24120
     TCTAACATGT AAGATTTACC AGATTGGATA GTTTTGCCTA TTTCGAAACC ATTCCTGTTA     24180
     GGAGGAAGTT CCGGAAGTAT CCCCCCGGTT ACGAAGTTCA CTGGGATTAT TGATGGATTG     24240
     GGAATTACAG CTACTTTATT TATTTTCTCT TCATCAACCC AGAGCCATCT CTTAATTTTT     24300
     AATGAATGAA ATCTAGGCAC CCTGGGGATA TTATCTTCCC ATCCCTTAGT TTTCCTAATT     24360
     TCTAGTCTTA ATTTTCTAGA CCTAGTTAAA ATAAATTGCT GAAGCTCCTT AGTCAATTCT     24420
     TTTATTCTTT TTTTATCATC TGAAAGAATG TATGGTTGTA AATAGTATAT GTTATCTTTC     24480
     GCAAATTGCT CTAATCTCGA AGCTAGGACT TCCCTCTGTC TTTTGCCTAT TATAGATTGG     24540
     TTCCTTTTCA ATTTATCAGA ATATTTGAGA AATATCTCGT TGAGCCGTGG CTCAAGGACT     24600
     ATCCAGAGCC TTAGTTGTTC CCTTGGCCGC AATTTAGTAA GAAAACTGTT GAAATCGTTG     24660
     AACTCGGCAC CCCAGTAGAA ATCTTTCTCG TTTTTGAACA AAATACGACC TACGAATTTA     24720
     GGGACTGGAA TGTTAACATT TTCGTTAACA CCGAAGTCCT TCCTTAAAAC TTCTAGTTGT     24780
     GTATTTGTGT AAGCATAGAG GTGCATTAAA TCTTTGTCTT TAAAATATAT GATCTCGAAG     24840
     ACATGTCCTA GAGAATTTAG GATGTTGAAT GTCTTATCGT ACTCGACTTT TGGGAATAAT     24900
     TCGTAGTATT TGATTACTTC TTTTTTGCCC CACATCAGAA GAATATTATT TAAAAAGGGC     24960
     TCAGTGTGGC AGTCTTTCCT CATACTCTCA GCATGTCATC TCTTCATCAT TGCCCTAAAT     25020
     TTCTATATGT AGAGAAAGTT TTATAAACTT TGAATAAACT CCCCAGTTTA ATGAGAAAAA     25080
     ATGAAATAAC TTTAGTGAGC TAGGAAGAGT ACTACTATTA AAAATAGCCA ACCAGCTACT     25140
     AATATGTAGC CTAATATTTT CTTAGCAACC TCAGCAAAAA CTAATAAAAT GTAAATAGCA     25200
     GTTAGCGGGA TTAACCATGC TATAATATTA GCATATGTTG AAGCTAAGCC TGGGTCTTGC     25260
     TTTAACAATG TGTTCTGCAA TATACCCTGA ATAATCCCCA CTAACCAATT ATATCCCTGA     25320
     GCTACAAGAT TAAGAATTCC CTGGAAGAAA TTTGAAGGAG GAGCTGGGAT TTTCTGAGCA     25380
     TAGCTCTGAA TCTGTGTCGA ATTGATAATA CTGTTGTTTG TAGTTGTTGC AGTCACAGTT     25440
     ACTCCTAATA CTATTATAAC GAATAGAGCT AATAGAGTCC TCATTTTTGC CCAGAATAAA     25500
     GTATTTTAAA AAGCTATTAG GTGATGGACT GGTTTCTGTC ATTATTTAAC ATTATATTAG     25560
     TTTTAGTATT CTATGAGGTG TTTCATGGGA TACTTTACTA CAAAAGTAGG GAAGTGAAAA     25620
     GGGAAGGAAG GATAAGCGTG AGAGTTTTAA ATATTAACGA AGAAAACGCG GTAACACTTA     25680
     ACAGTATATT CTTTAGAAAC ACTATAGTTT TTCTCTCTAA CAAGATAGAT GAGAAAATCT     25740
     TAACACATGA AGAAGGACAT ACTAAACAAT TCAATTACAT TTATGCTTTT CTGATAGCAG     25800
     TAGCTGCTTT GTTATCAATT AGTACTTTGT TAGCAATCCC AGCTATTCTG GTAGGGAAAT     25860
     TCTTATTATG GAAAATGGAA AGGGATGCGG ATCTTTACGC ATATACTAAA TATAATATAA     25920
     AATACGAAAG CGTTGCTGAG AGGCCTAAAT CTAAAATTGA TAGAATAAAA GCTTGGGTCT     25980
     TTGATACTCA TCCACCTGAC TGGGTAAGAG AAAAAGAAGA ATATTATGAA AAAAAGATTA     26040
     GTTTGATCAA ATTATTTATT CAAGATCTGA CTTCTTAATC TCCTATACTC AACTATGCCT     26100
     CCGATCAGAC TTACGAACCC AATTAACGCC AGAAAGTCCG TTATGTAGCT AGCATCGCTC     26160
     CCCAGTAAGC TGCTAAAGCT GCTGTCGAAA GTACTAGCTA TAGCTCCTCC TAACAGCGCT     26220
     AACCCGGCTA TGAAACCTCC CACTGCAGCC TCATGGTTGC CCTTCCTATA CTTCGTTACT     26280
     GGCATCTTCA CTACTGCTTT TGCCTTACAT TTTATCACTT GTAGCCTTTT CATTGCGCCT     26340
     CATCTTATCT CTTTTTAAAA ACCCCCTATC TTAGAATGAA GCTAAGAGAA TTAACAGTAG     26400
     GTTGGCTATA CACGACAAGT GGAATAGATG AGAAAAGTTT CCCTATCGGA ATAAAGAACG     26460
     TGAATATGAA AGAATTACTA GTAATATTTC CACTGCTAAT ACTGACTATC AGTTTTGCTT     26520
     TTAAGAATAT AATGATAGCA ATGGCATTTA TAGCACCAGT GTTCTTCTTC GTATTTTATG     26580
     AAGAGAAGTC CATGGATGAA TTTCAGTACA TATATCATTT CCTCAGGTTC TATCTCAACG     26640
     ACTTCCTGGC GCCTAAAGAA GAGAAAAATA AGAAAGAGAG TAAGAAGAAA GTAAAAACTT     26700
     TTGACATAAA GAAGTTTAAA GATGAAATAA TAATTACTGC ATCGGCGTTA TTAGCATTAA     26760
     CAAACGTAAA TGCGTTCATA AATACGTTTC AGTTGAAGTT TTACTACCCA ACCTCATTGA     26820
     GTCAAGATCT ACTCTTCGCC GTTGGAACTG GTGTAGCAAT AGGATTTATT ATATCGAAAA     26880
     TTAGAAAGTA AAAAATAAGT TAATCTATTT TTATCACATC AACTTTTCTT TTGCTTTTTA     26940
     GTCCTGCAAC TATTTTAGGG TCATTGATAT ACAGCGTAAG TTCCATAGGA AATGCCCTAT     27000
     ACTTTTTTGC TAGTTCTATT ATCTCTTCTG GATCCTTACT TCTTATTGCC AGCATCAAAT     27060
     ATAATTATAT CTACAGGCTA ATAAATTAAA CAAAACGATT GCTTTCCCTA AAATTACGTT     27120
     AAGCCGAAGA TCAGTTTAAA CTAGTTGCTT AAGAGAAAAT AAGGAAAAAC GGAACTGCTG     27180
     TTAAAGTTTT CAACTCAACT TGTTTATTTC TTCATTTATC TTCTTCTGCA CTTCACCTAT     27240
     CAAGTCGTTC AAACTGACTA CCTCATACCT TACTTTTCCG TTCCTTATTG CATCCCTAAC     27300
     TTTTCTTTCT CTCTCAGTTA GAGAACTAGA TTTCCCGCTC TTAACTTCAA TGAAGATTAC     27360
     CTCTGGGTGT ACATTATCGT CAGAAAGTCC TTTGAAAGCA ATGTAATCCA CTGGACTACC     27420
     TAAATGCCTG AAGTCCTTAG GATTAACTTG ATATTTGTCT GCCAGAAGTA GAGGAGCAAA     27480
     TTCTTCCCCT ATTCTTCCTA AAAGAGTATT AACTGATCTA GCTATAGCGT CCTTTCTTAT     27540
     CATTTGTTCA TTCTGTTGTT TCCACATTTC CAACTGCGCT TCATATTGCT GTTTTATTGA     27600
     TTGTTCTAAT TGCTTCTGTA ATTGTTGTGA GTGTTGATTA ACCCAGTTAT TGAACATCTG     27660
     TTGAGCTATT TGTTGCGAAT TAAGCTGAAC TTCTGTTATC TTCTTATTTA GTTGCGAAAC     27720
     CTTCCTTGAA TAATATGCGA TAACTATTAT TAGGACTATT AGAAGTAGAG CTGATACCCC     27780
     ACCTAAAATT TCCACTAACA TATTTTCTAA ATCGAAAGAG AGAATTATAA CTTTTAGCAC     27840
     TTGTAAAGTT TGCCCTTATT TTACCTTAAG CACCTAGTAT AAACATCCCT TTTGCTTAAG     27900
     GTGGTTTTAG GACTAACTCC CGTAGAGTTT AAAGTTAAAA CAGAAAAGTA TTTAGCTATA     27960
     GAAGGAGAAT AAAAAAGTGA ATGACGATGA GGAAGTTTAA CTATAACGAA ATAGTAATCC     28020
     TCAACCCATT GCAGACTAGG TACCAAATGA TGTCTTCTAG GGTATTCATC TCTCTCCATG     28080
     CTGCAGCAAA CGACGGAATT TACAGAATGA ATAGAAGAAA GTTTGTGACA AAGTACGGTC     28140
     CAAAGACTAT AGGAATATAT ATGCTAGGAG CTTTCGGCGC TCTCATTTTA CTTATAGGTA     28200
     TAGGTATGGC AGCTTATCCG TTCACTCAGA CTACTGGGAT GACTAGTGCT GATGGTCTAA     28260
     TTGCTATAGT CATAGGAGGG CTTATGTTAT ATTTTGCTAT AAAGAATGCA AAGAAAACGG     28320
     TTCAGAAAAT AAATGAAGAG AAAGGGATTG AAGGGGAACT TGTAGTCCCA TGGAATCAAG     28380
     TTAAGACTAT AACTGTCATG AATGTGAGGC AAGAAAACGT AGCTAATAGG CCTAGCTTAG     28440
     TTCTCAATAC TATAGCTCCT ACTTACAAGG AAATAGGTGA CTGGCATGTA CTTACCATAG     28500
     ACGGGAGGGA CATAACAATA CCTAACGTAG ATGATCCTTA TAATAAGCTA AATTACGTAA     28560
     AAAATAGATT TAATTTAAAT TTTAGTTGAT TTTTTACATA TATCTTCCAG GTGGTGGTTC     28620
     TGAGGACGTA GATCCGCCAC TATTATTTTC TACTACTACG GTATTTCCGG ATCCTCCTCC     28680
     GTTTTTCTTT CTGAATGCTC CCATCATATG TTCTCCTGGT CTTAGTCCGA AGACAAAGAA     28740
     AGCTAGAGTG AACAAAAATT CCCCATCCAT AGCTATAGGG TCGATAGCAA ACATTAACGC     28800
     TCCCAATGGC AGTGTTGCCA ATATAGCGAA TGTTACTGCA GCTATCAGCC CAGCAACCAT     28860
     AAGTCCTATC AATAAGTCTA TGACCACCAT AGCAATTTTT CTTGTCCATT CGAATATCCA     28920
     TAGAGTAGCC CATAAGGGAA TTGTGTCTAC TATCGCTAGC ATTACAGCGT ACTTAATCGT     28980
     TGCTATTGCT AAAGTAATAG CTAATAAGAA CATAACGAGG GACAAGAACA TCGACAACGC     29040
     ATCACCAAAC CCAAACGGGA TGCCATTCAT TAAGGCAAAT AATGCAGTAA ACAATGTAGC     29100
     TCCCCCTGTA TATTCAACTG TTGCGATCCC TAAGTAAGGT CCTGCAACAG AATATATTAT     29160
     AGAATTAATG AAATTCGCAG CGTAAGTATA AATTGTTAGG CCACCCGCGA AGAACAGTCC     29220
     CCAAACAGAT AATTTGTACA TTACGTCTCC AGCAAGATCC ACGAGATCGG CATACTCTCC     29280
     CCTTATAGCG TTATAGGCGA TTGAGAAAGC TATGAAAAGC ATTGCGAGCC CAACGCTAAA     29340
     GTCTTTCATT TGGTTGTAAA TTGATTGTGA CGCTGGTGAC ATGGTAGGAG TAGGAGAATA     29400
     TGTCATCCAT TCCAGAGGTG CTCCAAAAAT CTGTAGTAAT GTTGTTAGGA ATCCTGTAAA     29460
     CGCATTAGCG ACAGAGTTAA TTAATCCAGA AATTGCGCCT GTGATTGCTC CTTCTATCCA     29520
     CCCAAGAGGT GAAGGGGGGT TTGTAACTGT AACCAGAACT GCCCCAGAAC CTCCAGCAAA     29580
     ATTCTGTTGA TTAATTACAC TTGCTGCAAC TATGTATTTA CCTGGATCAT TAAAAGTATA     29640
     GGTAAAAGAA GTACCTCCAG TAGCGTTGTA CACTATACTT CCATTATATA GAACAGTCCA     29700
     TATTACAGTT CCAGACATGG AAGGACTCCA TGAGACTGTA TAAGTTTCAG TATTGCCTGT     29760
     GTACGCTGAA GTAGGACCAG AAACTTTTAC CTGTAGTTGC ACTAGCGTAA TTTGTACATT     29820
     TCCTCCTATC TTACCTCCTG TAGCAGCTGC AAGAAATATC GCTGATGCCA TAGCAGCAGC     29880
     AAACAACACT AACGCATAAC GCTGGTCGTA TCTGTTAGCT AATATTGCTA AGAGTATGAG     29940
     AGCTGCTGGT ATCAGTGTCT GCAGTGTAGC TATAAACTGG CCTAAGCCAC CTGGACTTCC     30000
     TCCTCCACCT CCTTGTGCCG TTGCTATAAT ATTTCCTGCT CCTGAAAGCA GTGATGGAAG     30060
     TACTAATATT ATTAATAGGA TAGTTAATGC TTTCCTCATT TTCCACTCCT AATCAAGCTC     30120
     TTTTTAAAAA GCTCAGTTGA ATAAACTCCC CAGTTTACTG AAGAAAAATT CAAGCCTAAT     30180
     CTCTTTTTTC AAACTCCTTA ACAAACCTAC TAACTAGTCC TAACACTTCC TTAATCTTAG     30240
     GTAAAAAAGC GGATAAGGGA ATATAGTAAG CATTCTCCAA GCTTATGTCT GGTTCCCTTG     30300
     AGGCGATAAC TATTAAATAA CTTTTATCAC ACGACCTGCT TTGTGGGTTA CTTCAGAATT     30360
     ATACAAAAAT TTATAAATAA TTATACCGAG TATTACTCAT GGGAAAGAGT AAGTACAAGA     30420
     GGGATTGGAG CAAGTACGAC GAGAACGTTA TAACTAGATA CGAGCTAATG TTCCCCTTCT     30480
     ACGTCTTCCA ACACTGGTGG GAATTACTAG CAGAAGAGAA TAGGAATGCC AAGAAAACCT     30540
     ACAAGGCGCC AAAGGAGTTC AACGACTTCC TAGCGTTCCT GCACTTGTTC CTACCTTATA     30600
     GGGCCATAGA AGGAGTATTG AGAGCATTAG AAAGACTGAA AATCATCCCA ACAAGCCTAG     30660
     ACTACTCAAC AATATGGGAA AGAGTAAGAA ACATGAACAT AAAATTCCCA GAGGCAAATG     30720
     ACCAACTTGA AGTAATAGCA GACGCAACGG GAATAAGCAC AAACAAGGGA GGACAATACA     30780
     TTATAGCAAA ATGGGGAAAA ACCAAGGACT CAAAATTCCT CAAGATCGAA ATAGTAATGG     30840
     ATAAGGACCA ATTCAACGTA ATAAACGCTG AAGTAACCAG CAACGAGGTT CAGACTGCAG     30900
     TTAAGACGGT TAAGGATTTA CAAGATAAGG GAAAGAAGGT CAAGAAGTTT TATGGAGATA     30960
     AAGCTTATGA TGCTAATGAG GTTTACAAGA CTGGGGTTGA GGTTGTTGTT CCACCTAGGG     31020
     AGAACGCCTC CACTAGACGC GGTCATCCTG CTAGGAGAAA GGCTGTAAGG GAGTTCAAGA     31080
     GGTTGGGTTA TAATCGTTGG AGGGAGGAGA GGGGTTACGG TGTTAGGTGG AGGATTGAGT     31140
     CCTTATTCTC TGCTGTGAAG CGTACTTTTG GGGAATCTGT TAGGGCTACA AGTTTTTTAG     31200
     GACAAGTGGT TGAGGCTAAG CTCAAGTTCT GGGCTTATGC ATGGATGGTC CACTTGGCTA     31260
     ATTCTTTAGT TGGTAGAGCT CCGGGTATTA GGGTGTGAGC TTGCGAATAA CGTTGAAATA     31320
     AATATTAATT ACTGAAAAAT TCTCAGTGCA TCATATCATG CTTATGAAAT AAATTGAAGA     31380
     GATCAACAAA GCACACACGA CCTTAATTCC CTCAAACCTT CCAGTTCTTC CGTAAGTTGG     31440
     TCTTTGTCTA TACCGTTACC GCTCTTGACC TCAAAGCCTA TGCATAAGCT CTTCAATTCG     31500
     GCATCCGTAG CTATATATAA CGCATCTATA GCCCTATCGT TGGGCAGTTT AACCTCCTTA     31560
     GAGGAGTACT TTATGCCGAT AATTTTCCTA GCCCAATCGT CGGCATTAGC TTGTAAAAGC     31620
     GTCATTACGA AGTTAGGGTT GTAAACTATT ATCGTCTGTA TTATGTCGTG TACATATACA     31680
     AGGTTAGAAT AGTTGGCTAC CATTCCCTAA CCCTCCTTAC TACCTCTGAA GGCAATCTGT     31740
     AGAATACTTT ATAGAAGTAG GAGTAGAGGT CTGGTTGGAG TTTCTCGCTA ACTAAGAAGA     31800
     GCTTGTCAAA TACTTCACCT ATGGGCGGTA TACTTTCGTT CCTCCATATT AGGTCACTCA     31860
     AATACTCCTT ATTTGATGAA AGTATGAAGT CCTCTGGGTG GTCGTCGTTA GCTCCGAAGT     31920
     AAGGCGGGTC GTAGATATGG CTCATCACTT CCGTGTTCTC TGAGATTTCG TTAAGCAATA     31980
     ACTTGTTATG TTCTAACAAT AGTTTAGTTG AATTCCTCCT AACCTTAGTG AGGACAGATC     32040
     CCAATACTCT AGGATTATCG AAACTGCTCC ATATGTATTT AGGCAAAGCC TCCTTAAGGA     32100
     ATATGAGCAT TGCGTTAAAG GCCTCAATGG TACCATCTTC TGGGATTATT AAATAGTCCG     32160
     AAGCCCTCAG AACAGGCTTT ATTGTGACTA CGTCAGAAGG TGAGGTATCT ATCAGTATGA     32220
     AGTCATATTT TTCTCTGAAG TTCTCTAACT CTTTCTTAAC TGCAAACTCA TCGAACATTG     32280
     GGAAGTAGCC TTTGAACATT GCGTGGAAAG TAGATACGTA GGATCCCGGG ATTATGTCTA     32340
     ATGAAACTTT TACTTCTCCC TTAGAAGTCT TGGAGACGTG GAGAAAGTTC TCTACAATTA     32400
     CGTCCGATAT CTCCCTTATT CGGTAGACCC AAAATCACCT CCTTGAAAAT AAATCTATAT     32460
     TATTAATAAG CGGTTCTATT GATTTAAATA GAAAATCTTT TAGATAGAAT AAATCATCAG     32520
     AAAACAAGAG TATTAGGAGT ATCCTGAACT GCTCCCTCCT CACCTCCCCC TTGAACACGG     32580
     TGTACAGGGA GTAGAAGGCC ACGGCCAGCA CGAAGATCAA CGTGCGGAAA ACAAACTTAG     32640
     TAGAACTAGT AAATGGAAGA AAAGCCTTAA TGTTCCTATA AGAGGTCTCT ATGGGACCCC     32700
     TTACCTTATT GTACAAATCC AACACCTCCC CCTTCGGTAG GTCTAGATTA GTAGCCCTAG     32760
     CAAAATAAAC AACACTCTTC TTCTTTCTCC TCACTTTTTC CTTGCTGTAC ACGAGAAGCC     32820
     TGAACTTGAC CTGCTCATCC CTCCTATGCC TCTTACTATT AGTTGCGTAA TCCCCGTCAA     32880
     ACTCCTCATA AACCTTAACA TCCCCAACAG GCACAGCAAC TATATACTTA AACTGTGAAA     32940
     TGAAGTTGAG CACATCAACA GTATAGAAAC CTGCGTCAAG AGTTATCAAC CTTATCTTGA     33000
     ACCCCATCGC GACGACTTGC TCCACGAGGG CCTTCACGAT CTCTTCCTTA GTCATCCCCT     33060
     TGACTTGAGT GACGAAGGCC AGTAGGAGCA CTTTCCCATT AAACTTTGTC GTCGCAGTTG     33120
     CGTAGTTCCA AGAGTTTCCC TCCTCCGAAC TCCCGAGCCC TCCCACCGGT CTCCCGTACC     33180
     AGGTCTTGGT TGTCCAGTCT ATTGAGACGT CTATCTCCTT GACTCCCTTC AGTACCTTCA     33240
     AGGATATCTT CCTGGCGCTT TCCAAGAGTT TCTCAATAAC TTCCATCCCT TGCTCCTCCA     33300
     CGTAATTCCT CACGGTCTGT GGGGACACGC CATACGCCCT CGACTTGCTT TCCACCGAAT     33360
     CGTTCCATAA ACACGCTGAG ATGAGGGTTC TCGCCACCTC TTCCCCTTTC TTTCCCTTGA     33420
     AGTTCAGCAT GGAAAGTAAT TTATATCCTA TTTGTTGAAT GTTATTTTGG TGAGGGAGTA     33480
     CCGGTGTTAC CATCTCACTT ACTCACGTGG TAATACCACA TCTCCCTCAG CTTAAACCTT     33540
     TCTTCAACTG AATTCTTAAT ACTCATATAA ATCCTGTTAT CTATCATGAA TCGATATTAT     33600
     TCTGTCAGAA TTATTTTTCA TAATACGATT TTGGGTCTAC CGTATTAGGG CGTAAGCACT     33660
     CCTATCCGAT TCCGGTCTTA TAGACTGTTG TAGGATTTCC TTCCTTCTCT CCTCCTTAAC     33720
     GAATATCTGT GTTAAGGACA TTTGTGGGTC GAAGTCTATC AGCAATACTC TGTGGTTTAC     33780
     TGCTAAGCCC ATTCCAAGAA CTGCCGTTAG CGTAGTCTTA CCTACACCGC CCTTGAAGTT     33840
     ATGTATAGCT ATAACTTTAC CGTTCATTTC ACCACCCCGA ATTCCTCCTT TGGGTAAAGC     33900
     CTCATGTTTC CTTTAACGAA CTTGTAGAAG AGTTCCTCCA GCTGTTGTCT GTTTAAATGA     33960
     GAAGATAGTA GGGGTTCTGC TACATTATGC CAGTTTATTG ATAGGTTTTT GAAGGCTATC     34020
     TGGAAGTTCC TCCAAACTTC TACCATGGTA AGAATGGCCT CTTCATCCAG TTTCTTCTCT     34080
     TCATAGAGTT GTTTAATTTC TGGGCAATTG GATAACATCT CCTCCTTTAG TTTGGCTACA     34140
     GTCTGTAACC ATTTTTCATG GTTTATTCTG GTTATCTCTT CTGCAGGCGA GTGAACTTCA     34200
     GTATTAAACT GGGGAGTTAA CTGTTGTTTA GCCTCTTCCT CCTTCTGAGC CCATTCCTCT     34260
     ACGAAAGAAT ACTCATCACT TTCAGCCTCC TCTCCCTCAT CAGTTTCGAC TTCCTCTCCT     34320
     TCGTCTTCTT TCTCTTCTTT TACCTTGGAT TTCTTCTTAG ACCTTTGCAG TTTCTCTTCG     34380
     GTCTTCAGCT TATTAATTGC TTGAGAAACT GCCATCCTAT GGTTTACTAT CTCCTCAAGT     34440
     AGATCCTTCC TCTCATCCAA AATTATCTTT CTTCCATCGG TAAGTAATGT ATTTCTTTCG     34500
     TAAGGAGGTA ACTTAGCTAC AGCTTCTAGT AAGCCCATTT CTTGTAGTTT AGTATAGATA     34560
     CTGTAGGCAG GATAGATTCC CAGTTTTCCT TTTAGTATAT AATCGGTTAG CCATGGTGCA     34620
     TTTTCCTTAA TCCTAATATA GTAGTCTAGT GCTCTATCAT CAACCTTTAC ATTATACTTC     34680
     TTTAGCTCTT CTTTTACTGC ATTCCTTAAA TCAGTGAGGC TTTGAATTTT TTTATTTTGA     34740
     CTTTCACTAA GTTGAACGGG TACCCGTTCA ACTTTCGTCT CTTTAGGATT ATTTTCACTA     34800
     TTTTGGTTCT TTTTTAATAT CTTAGTCTTC TCTTCTACTG CTTTCTCTAT TAACGCTAGG     34860
     GCTTGAGCTT TACTCAGTTG CCTCTGTGTT AAATTTGTAG ATACTAATAG ATCGTATTCA     34920
     TCAGCTCTGT CAGTCGTTTC ATATACCGCA ACTGGAACCT TTTTTATTCC TAATTCCTTA     34980
     GCTATCTTCA GCCTAGTGTA TCCGTTAATT AACTCGTAGT TTTGATTAAC GATAAGCGGT     35040
     ACCTTTATTC CATTTTTAGC TATATCTTCT TTGATTTTAT CATACATGTT ATTTTCAGGG     35100
     ATGAAGGTTC TGAATTCATC AACTTCCTTA ATTTCTTCGA TAGAAATTTC TTTGTACTCT     35160
     TTCAGCTTAC TCATTGAACC ACCTCAATCA ATTTTCTAAT TTTTTCAAGT TCTGTCGTTG     35220
     CTAAATGTCT CCCTTTATCC GTTAAGACGT AATAGATTTC TTCACCTTCT TGTTCCTTTA     35280
     TTACATATCC CTCTGCTAAT AACCACCTAA TATTCTGTAT TACGGTCTGG TATGGGATTT     35340
     GTGTACTTTC GGCTATTTCA CTTGCTTTTG CCTTACCTAC CTTTAGGAGG TAAATAACGA     35400
     TATATGCCCT GGGAGTTAGG AAGATGTATT TATCTGTGGA TATTTTTCCC ATGTTTGCTC     35460
     TATGTTAATC ATAGAGCATA ATAATATTTA AATCTTCTCT TTACATATCG CATAAACCAT     35520
     AGATTACTCT TTTCATTGTA TGTATAACAT CAACCATATG AAAGAAAATT ATCGCGTTCT     35580
     CAGTGAGACC GAGCAGTATA TCCTATTATA TTTAATTAGT ATAAAGGAAG GGGTGGCGGT     35640
     AAAGGAAATT TATGAGGAAA TGAAACTAAG TCCTAACGCT GTTACCCAAG CTGTTAATAA     35700
     ACTATTAAAT GAGGGACTTT TAACAGAGAA AAGGGAGGAA GTATTCCCTA GAAGAAGATT     35760
     AATATATTTA AGTGAGAAAG GGAGGAAAAT AGCTCAATTA CTTCTTCAGA TGCAGGAAAT     35820
     TATAAAGGTA AATCAATAGC GTGTTAAGTG GAAAGTATTA AAGTGAGAGT TGAAGAATAT     35880
     TAGATTAGTG AAAAGAGATG GCTAAAGTTG AGGAAGGAGA AATAATTCTA GATACTGAGG     35940
     AGGAAGTTAA CAACTTAATT GAGGCTATAA GGAAAGAGAA GGTTGATGAA GAATTAATTA     36000
     AAAAAGCGTT ATTGTTAAGC AAGAAAAGCC TTGTATCTAA CCTCTAACAC GTTTTTATAT     36060
     AATGAGTAAA AGTAATTCGC ACCTCCGCTC TTATCTTCAT AAATTAGCTG GAAACCGAGT     36120
     TTTTCATAAA ATTCCTTAGC TGTCTTTGTA TAAACTAAAA TTCCTATACA ACTATTATTA     36180
     ATACAATAGC CTAACGAATA GGGAATTATG AAATTCTTAA CAAAAACACT CCCTACCCCT     36240
     TTGCCTTGAT ATCTTTTATC TATACCTAGC TGTCCTAAAA GGATTACGGG TAGTTTCTTG     36300
     AAACTTATAT TGAACTCATG AGGTAAACCT CTTCTGTTAA ACTCCTCCTT CATTACCTCC     36360
     CTAATCTTAC CTATAAAACC TTCAGCGAAC GCATAAGAAT AACTGGAAAA TGAAACAAAG     36420
     CCCGCCAAAT CATTATCACA AATTAGTAGA AAAGTATGGT TTATTCCAGC TAGATAATGC     36480
     CCTACAGCAA GCCTTCTTAT AAACTCGTTT TGTTCCTTCT CTCCACAATC AAAACTACCT     36540
     AACCTATTTA TGAAAGATGA GTGAATAGTA TAAACATAAC AATTGCCTAA AGGAGTAGAA     36600
     ATAGTATCGA AAGGTTGAAT ATTAGTACTC AACTCCTTAT CGATATAAGA TAGTCAATTC     36660
     GACAGATAAA AATTACTTCC AATGCTATAA CTTTGCCCTT ATATTATGCT CTATTGTTTA     36720
     TGTAAAGCAT AAAGTTTATA TACTATCTAT GCTTTATGAT TAACATAGAG CAAACATGAT     36780
     TTCCACACAA ACCCCCAAAA ATCCGATTAA AAGGTTAGAT GTTTTTTACG TATTATCTGA     36840
     AGGTGTAGTA GTAGCTGGAG ACGTAGAGAG TAAGAGTAGG AAGGGATTAT TGCATTATAC     36900
     TAGGATTGTT CTGGATCCTC TAACAATGAA GATTACTAAG GCTTCCTGCG ACTGCGAGGG     36960
     TTATACTTTC AGGCACAATT GCTGGCACAT CAAGACTTTA GAGCAGATGA TTAAGGAGGA     37020
     CAGGGAGTTA AGGGAAAGGA TAGAGAAGGC AAGGCAGGAA ATGATGCAAA TAGAAGAAGA     37080
     CATAGCAAGC TGGGGATGAG CTATGAGTGA GGTACTGCAG ACTCAGAGAA ACTTAGAAGA     37140
     GTTAGTAAAG CTATTGAGGA TATACTTTCA ACTTGATGAG ATTCTCAGTT TCGCAATGGA     37200
     AGAGTTAGGA GGCGATGAAA TAGTAGTTGA AATATCAGCA GTTAAGGACA GAGTTAGAAA     37260
     AGTGATTGAG AGAATGATAA GTTAGAATTT TTCTTATTAA ACTAGGGAGT TTATTCTAAT     37320
     TTTTCTAACT ATTTGTGCTA CATGGGTTTT TAAAACGGCT CTTTTTGAGA GCATGAGTTT     37380
     CCTTAACTTA TTCAAAAAAC CAAGTCAGCA AGCAGTAAAG AAGGATAAAA CTAAATACTA     37440
     CAAGCTGGAA GGGATCCCGT TCTTCCTTCT AGCGCCAGAA GATAGAGATA TGAAAATGAA     37500
     GGAATTAAGT GCTCTTTTAA GTCAAGCTGA AAAGGGCTAT ATTTACATCA GTCGTAAGCC     37560
     AGATACCTAC GAGTTTGAGG GGACTAAGTT CCCTATTATT ACGTCTTCTT TCAATTTGAT     37620
     AACAGAGAAA GAACTAGACT TAGAGACAGC CGAACCTCCG CAGAGGCCTA AGATTGTTAA     37680
     AGAATATGCA AAATATTTAC AAACTACAGA GGGTTACGCT AGAGTTCTGG TTAGTTATGC     37740
     ATACTCGACT AAAATTTACG AAGGTGCGCT TGGCAGAATA GACTTCAAAT CTTTACGCCC     37800
     TGAGCTCTTT GAGTTAGTTG TTCAGTTCCA GAAAATTTCA CCACTTTCTG TAAGAAATTA     37860
     CCTCAACAGC CTAGAAGTGA AGAAACAGAA GATGGCCAGG TATGCCTCTT CATCAGTTCA     37920
     AGTTGAGGAA ATGTTGGTAA GAGGGGCTCA ATTGAAGAAA GACCTTGATG AGGAGGCTGC     37980
     AGATCCCCTC AAGTTCAGAT TCGTATTCAT TATACACAGT AAGACAGTTC AAGAACTTGA     38040
     ATCTTTGACA AGAGAACTCA CTCAAACTGC CCAGGAAAAT GGTATACTAT TAGATGTTCC     38100
     TTGTTGTGCT CAAAAGGAGT TATATAGTTT TGAAGGGAGC GTAGGTTACA GAATAAGCAG     38160
     TAACATCAGT CTTAGCAAGT TCTATCCGAT CATAGGTTTT AGTCTAATTG AGCCTGGCGG     38220
     GATATTTCTA GGTACCGATG ACAAAGGTGC TCCAATTGCT ATCAATCCCT ACTTGTCGGT     38280
     CAACGGGCGC CAGAACCCAC ATTGGGCCAT CACTGGTACA ACCGGTGCAG GTAAAACAAC     38340
     AACTGGCGCT GTTCTCATTG ATAGACTGAG AAAAGCTCAC GACGATGTTT ACGTAATAGT     38400
     CATAGACCCT ATGAGTAACT ATAACAGATT CTTTGAAAAT GAAGCAGATC TTAACATCGT     38460
     TTTCGGAGAT AATGATTATT TAGGATTGGA TCCTGTTAGT TTAGCTAACG AAGGAGTAGT     38520
     AAGCTCTGGT GACATTGCTG ATTTCTTAAT AGAATCATAT GGAATTCCAG CTGAGCTTCG     38580
     AGGCATTTTA GTAAGCCAGC TCGAGCAAAA TAAATCGTTA AAAGAGCTCA TGGACAATTT     38640
     AGAAGACTTA GCAAGCAAGA AATTTGCTAC TGAATACAGA AAATTAGAGA ACTTCCTATT     38700
     GAATATGACA ACGGGTTCTG ATAAGTATGT CTTTCAAGGA TCTCCGCCTA GTCTAAAGAA     38760
     TAAGAAATTC GTCATTTTGG GATTGAAAAC TGAGGACACT AGGAAGAAGC GTTTGGCAGC     38820
     AACTATGCTA ATGCTTTATG CATATTCACT AATTAATAAA CTCCCCAAGG ATGTCGAGAA     38880
     ATTAATCCTC ATCGACGAAG CCCACTTCCT CTTCGAGTAT CAGTCAGTAG CTAAGATCAT     38940
     TGCGATCATT TACCGAACAG CCAGGGCTTT ACGGACTTCA ATGATCACTA TGACACAACT     39000
     GATACAACAT TATAATATGA ACAACTATAG TAGAGAAGCC TGGCAATTGG CTAACAACAA     39060
     ACTAATATTA AAACAAGAGA AGGAGGCAAA AGACGACCTA GTTAATTTAG CTCATCTTTC     39120
     TGAAGAAGAG ATTGACTATA TCCTGAAATC TTCACGTGGA AGGGGAATTC TGAGGACTGG     39180
     CGCAATTACT ACACACATTC AAATCCAACT CACTGACGAA GAAAAAGAAC ATTGGAGGAC     39240
     TGAGTGAAAT GAGCTTAGTT CAGCTCATTG AAAAAGCTGC GAAGAAATAT AATATCAAAA     39300
     TAAATTCTCT CCCTAATGGT GTGATAATTC TTGTAAAAAA TGACATAGGC TATGTGCAAA     39360
     TAGCTGCAGT TAGAAATGTT TACTATGTCA GATACTTAAC GAAAAATGAA GCGTATATTA     39420
     TACGTAACTT AAACGAAAAG ATCATAGAGC TTATACTGGA AGAAAAGTTA GAAGAAACTG     39480
     AAGCTATCAA AATCCCTGAT GTTTAATAAA AGTAAAGTTC TTTCAATTTC TTTCATTCTC     39540
     TCTTCTTCAA ATAATTTTTC TTTCAATTTC TGGTCAGATA AATACTTTAG TAATATCTTC     39600
     TTTCTCGTCT CAGCTTTTCC ATACATAATC CCTTTCTTTT TCAACAACTC ATATATTCTC     39660
     AATGCCTCTT CCTTGTCACC ACTATATTCA TATATATAAT GTATAATAGG ATCCTCCCTA     39720
     ACCACGTGCC TCAGAAGTTT CTTCTTCTGC CTAATCGCGT GTCTGCCTAG TCCTTTCATT     39780
     TTTAAGAATT TGATATAGTC TCTGGTTACC ACTTTTCCTT CTCTTTCTAG AATATATTCG     39840
     TAAATCGCTA AGTAAAAAGA CGCGTCCAAT TTTTTCTCAT CAATCTTTTG CAAAATTTTA     39900
     TAGAACATCT CTTTCTCTTT TTCTGTCATA ACGCTCTGAA GATAATTCAG TACTATTTTC     39960
     TTCATATCTT TGATTTCTTT CTCAGTTTCT CTCTTTTGAG AACTTGCTCT TTCGTAATAC     40020
     TCTAGATTTG AATAATCTTG ATATGTATAA TTATCAAAGT CTACTACTTC TCCCGTACAC     40080
     GAGTCCACCA GAAACCCTTC GCTGTTCCTT ACTTTGTAGC ACTCTTGCAT CAGAAAATAG     40140
     AAGTATTTTA AAAGCCTGTA AGGATTTTGA TGGGGAAATC AGTATTACCA GTAAACTCCC     40200
     CAGTTTACTA AGAAAAAAGA CTTAACTTAC CCAAACTGTC CCGTTCCAGA TCGCTATTAT     40260
     TTCTGTTTTG ACTGCTGCAG TGTATTGAAA TGTAGCATAG AATATGTTAG GTATGTAATT     40320
     CGCTGACGTG AAGCATAGAG TTTCATGTAA ATATGGAATA TGTTGTCCAG TAGTATTAAG     40380
     ATAGAAGTAA GTCGTCTCAT TGTTAAGTGG ATTAAAATAG TAGTATATGT TGCCAAACGG     40440
     GACTTTATTG AACCCACTGT AATATAATGC ATTGTAAATA TCGACAAGAT ATATTTCATA     40500
     ATTTCCAGTG ATATTCATAA ATATTGTATT ATTGTAAATC TGTGGGATTC TGCTTATGTT     40560
     AAAGAACATT ATCTGATAGT TGAAATATTG CAATTTAGGC CATGCAGACA AATTTAGGAT     40620
     ATTAGCAGTT ACTAAGCTCC AGTTCTCGTA GAAAGATTCA AGCTCTAGAA GATTAGTAAA     40680
     AACAGAAGAT GTAGTATTGA AAGTATACAT AACAAATTGT GATGCGAGAA CGAAATACTC     40740
     AAACTTCCAA TATTGAAAGT CTGTTTTATT AATTGTTTTC ATGATATAAT TATACAATGT     40800
     GTGTGCTAAC GTAGCGTTTT GCTCTAAATA GAACCACGAA ATCGCTGCAG ACTTGCTATA     40860
     AATCATTTTT TGAGAGATCC AGTAAGGAGG CTGTACTGTA TTATCCTGAA CGTTGAAAGT     40920
     AAGATAGTAG TTTATTGTGT TCCAGTCTTG TTGTGTGTTT AATAGTGGAA TAATTTCTAT     40980
     ATTACCAGCG TGCCAAATTC TTTCAATAGT ATAATTTGCT ATCTGTATGT GATCGTAAGT     41040
     AACTATCGTA GTACTATTCG CAATCGGATC TGAGCTCCAC GTAGTATACG TAAAGTAAGC     41100
     TGTAATATTT CTAGAATTGT AGATTTTATT ATTAATAAGT GTCTGTGGAT CTGAACCGTT     41160
     GTAGACTATT ACCATTATTG GTAATGTCAC GTTATACTCA TACCAGTTGA AATTATAACT     41220
     TGTAGTAGAT AAATAAGGCC CTGTAGGGTA GTATATATAA TAAATATATG TTGTATTATT     41280
     AACAGTACGT TGATAATGTT TATATCCAGC TCCAGCACTT ATACTATAGC TTCCATAAAC     41340
     TTCTTGTGTA CTTTCTGGAG GTACTGTAAT CGTTCCATAG ATGTAATTAG GCCCATATTC     41400
     CCCTCCATAC CAATAGAAAG TTGTCGCGAA ACTCTGAGAA TTTATCAGCT GATTATTTGC     41460
     ATACAGATAG GCTGTACCCC AAACTTTCAT CGCGTAATAC TCATAAACAT AAGTAACGTT     41520
     ACCTTGATTG TGCGTATATT TATTATATAA ATATGTATAT TCGTTATATT GAACGTTTAC     41580
     GCTAGTTTTT ACAGAAGTTT CATTAATTAT TTTGTAAACT GGGGGGTTTA CTGAAATTAG     41640
     ATCTGACGGA GGATAGCTCC AGCCAGACTG AAATCCATTA GGCGCCTCGA GTGTTTTCCC     41700
     ATATTTTACT ATTATATCCC ATTTTGAATA GTTTTCTGTA TCATTTTCAT TTAATGGGAA     41760
     CGGCTGGAGT GAAGTATTCT TATAATTGGT AATATTGACA TAGGCACTGC TAGCTATAGA     41820
     TAATAGAGCA CCGTATGGCC CTGGAGCAAT TTCACTTGCG TTTCTAGCCA ATGCATCAAA     41880
     TAAGAGATTT AACATATTGT TGTCAGGCTT TGAGAAGTTG AATAAGATAT ATGCTTCTGG     41940
     AGAAATATTG TAATAAGGTG CTGGTAGATT ACTGTAGCTT CCCCTAACAT ATTGTAGATC     42000
     TTGTAACGAA GGGCTTAATG TTACTGTTTT ATTATAAATG TACTTAGGCC CTGGGACGCT     42060
     GTAAGACCCA GAACTTCCTC CTCCACTTCC TATTTGTATT GAAGAATTCT GTTGAGGTAC     42120
     TTTTAGATTT GCAAAACTCG CTATAAATGC CAGAATTATT ATTATTGCTA TAAATAAAAC     42180
     AGAGAATCTT CTAATATCCA TTCCGAATAT ATTATCTCCC ATTTTCACTT CCCTACCTTT     42240
     AGGGG                                                                 42245
//

If you have problems or comments...

PBIL Back to PBIL home page