(data stored in ACNUC8465 zone)

HOGENOMDNA: SULIY_1

ID   SULIY_1; SV 1; empty ; DNA; empty ; PRO; 2702058 BP.
XX
AC   NC_012622;
XX
PR   Project: 58923;
XX
DE   Sulfolobus islandicus Y.G.57.14 chromosome, complete genome.
XX
OS   Sulfolobus islandicus Y.G.57.14
OC   Archaea; Crenarchaeota; Thermoprotei; Sulfolobales; Sulfolobaceae;
OC   Sulfolobus.
XX
RN   [1]
RP   1-2702058
RX   PUBMED; 19435847.
RA   Reno,M.L., Held,N.L., Fields,C.J., Burke,P.V. and Whitaker,R.J.;
RT   "Biogeography of the Sulfolobus islandicus pan-genome";
RL   Proc. Natl. Acad. Sci. U.S.A. 106 (21), 8605-8610 (2009)
XX
RN   [2]
RP   1-2702058
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (29-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2702058
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Glavina del Rio,T., Dalin,E.,
RA   Tice,H., Pitluck,S., Sims,D.R., Brettin,T., Bruce,D., Detter,J.C., Han,C.,
RA   Kuske,C.R., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
RA   Anderson,I., Whitaker,R.J. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (30-JAN-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001403.
CC   URL -- http://www.jgi.doe.gov
CC   http://www.life.uiuc.edu/S.islandicus
CC   JGI Project ID: 4023468
CC   Source DNA and archaea available from Rachel Whitaker
CC   (rwhitaker@life.uiuc.edu)
CC   Contacts: Rachel Whitaker (rwhitaker@life.uiuc.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Meta information:
CC   Organism display name:  Sulfolobus islandicus Y.G.57.14
CC   Culture Collection IDs:
CC   GOLD ID:  Gi01318 http://genomesonline.org/GOLD_CARDS/Gi01318.html
CC   Sequencing Status:  Complete
CC   Phenotypes:  Acidophile
CC   Diseases:  None
CC   Habitat:  Fresh water, Hot spring
CC   Oxygen Requirement:  Facultative
CC   Cell Shape:  Coccus-shaped
CC   Motility:  Nonmotile
CC   Sporulation:  Nonsporulating
CC   Energy Source:  Lithotroph
CC   Temperature Range:  Hyperthermophile
CC   Biotic Relationship:  Free living
CC   Isolation:  Hot spring in Yellowstone National Park.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2702058
FT                   /strain="Y.G.57.14"
FT                   /mol_type="genomic DNA"
FT                   /organism="Sulfolobus islandicus Y.G.57.14"
FT                   /db_xref="taxon:439386"
FT   gene            467..763
FT                   /db_xref="GeneID:7805674"
FT                   /locus_tag="YG5714_0001"
FT   CDS_pept        467..763
FT                   /locus_tag="YG5714_0001"
FT                   /gene_family="HOG000107826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577819"
FT                   /db_xref="GeneID:7805674"
FT                   /translation="MVIRRTFIKSTLAVSFSISYLLYIIAKISFGSGKLAFIIALLQLY
FT                   PYFLIDYLPTVQVVSLFFQSLLLLLFAIFILLITYMLFLFYKLYKMVKTSILK"
FT                   /protein_id="YP_002836217.1"
FT   gene            838..2025
FT                   /db_xref="GeneID:7808610"
FT                   /locus_tag="YG5714_0002"
FT   CDS_pept        838..2025
FT                   /locus_tag="YG5714_0002"
FT                   /gene_family="HOG000230140" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577820"
FT                   /db_xref="GeneID:7808610"
FT                   /translation="MNVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIA
FT                   IRYFVKNEVKFSNLFLGLTGTGKTFVSKYIYNEIEEVKNEDQGYKDVKQAYVNCREVGG
FT                   TPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIKAIIYLDEVDTLVKRRGGDI
FT                   VLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEY
FT                   GLIKGTYDGDILGYIAAISAKEHGDARKAVNLLFRAAQLASGGGMIKKEHVDKAIVDYE
FT                   QERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISEL
FT                   DMFGIVKIRIVNRGRAGGVKKYALVEDKEKVLRALNETFEDSIGIGDFVDDVGEN"
FT                   /protein_id="YP_002836218.1"
FT   misc_feature    880..1929
FT                   /note="orc1/cdc6 family replication initiation protein;
FT                   Region: TIGR02928"
FT                   /db_xref="CDD:163076"
FT                   /locus_tag="YG5714_0002"
FT   misc_feature    1714..1950
FT                   /note="Winged-helix domain of essential DNA replication
FT                   protein Cell division control protein (Cdc6), which
FT                   mediates DNA binding; Region: Cdc6_C; cd08768"
FT                   /db_xref="CDD:176573"
FT                   /locus_tag="YG5714_0002"
FT   misc_feature    order(1765..1767,1828..1833,1885..1887,1891..1893,
FT                   1912..1920)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176573"
FT                   /locus_tag="YG5714_0002"
FT   gene            2006..2326
FT                   /db_xref="GeneID:7808611"
FT                   /locus_tag="YG5714_0003"
FT   CDS_pept        2006..2326
FT                   /locus_tag="YG5714_0003"
FT                   /gene_family="HOG000270602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical M protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577821"
FT                   /db_xref="GeneID:7808611"
FT                   /translation="MMWEKIKRLEERLYELRKEIEEVEKELEELPSGHLEVKTINGNVY
FT                   YYLRYWEDGRLRSKYIGKFASDIKEKLLKSEQLRRRLTQLKEEEKKLSNIIDKIEKIIT
FT                   DY"
FT                   /protein_id="YP_002836219.1"
FT   gene            2396..3229
FT                   /db_xref="GeneID:7808612"
FT                   /locus_tag="YG5714_0004"
FT   CDS_pept        2396..3229
FT                   /locus_tag="YG5714_0004"
FT                   /gene_family="HOG000270790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TM helix repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577822"
FT                   /db_xref="GeneID:7808612"
FT                   /translation="MILVIIASAQTSVSQALSGIATSIIDAIPSIIVFIIILIIGYIIA
FT                   NIVSYSIRAFLGRIFREEHVRASVDIIAGTIKALIILIALSIALSFLQLGAASGYVQQI
FT                   ANYLPKLAGAIVLLTIGLTLVNILVDYMQRQIGARSQDDLITAIFNVLRFGLYAAIITV
FT                   AAALAIFSVIPYVDPYVFYAVILGAVILYAAYALIDKVLVPFANSNPDLAYVANYGRLI
FT                   LYIIVLLIAIAIIVEPFGNVTSIIYALSWGLAIAFAIALIPLVIALVKKFLAEIK"
FT                   /protein_id="YP_002836220.1"
FT   misc_feature    2675..2833
FT                   /note="Conserved TM helix; Region: TM_helix; pfam05552"
FT                   /db_xref="CDD:147627"
FT                   /locus_tag="YG5714_0004"
FT   gene            3277..3576
FT                   /db_xref="GeneID:7808613"
FT                   /locus_tag="YG5714_0005"
FT   CDS_pept        3277..3576
FT                   /locus_tag="YG5714_0005"
FT                   /gene_family="HOG000007680" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577823"
FT                   /db_xref="GeneID:7808613"
FT                   /translation="MSGIFSKGLEELKNNGWLILEDGKKIKKEFKFKDFKQSIDFLKDI
FT                   QPSADALDHHPDVCIYYNRVIVELTTHDMGGLTDLDYKLAIKIDELYKMKTSNL"
FT                   /protein_id="YP_002836221.1"
FT   misc_feature    3322..3549
FT                   /note="PCD_DCoH: The bifunctional protein
FT                   pterin-4alpha-carbinolamine dehydratase (PCD), also known
FT                   as DCoH  (dimerization cofactor of hepatocyte nuclear
FT                   factor-1), is both a transcription activator and a
FT                   metabolic enzyme.  DCoH stimulates gene expression by...;
FT                   Region: PCD_DCoH; cd00488"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="YG5714_0005"
FT   misc_feature    order(3379..3381,3391..3393,3439..3441,3448..3450,
FT                   3490..3492)
FT                   /note="aromatic arch; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="YG5714_0005"
FT   misc_feature    order(3379..3381,3391..3393,3403..3405,3424..3426,
FT                   3439..3462)
FT                   /note="DCoH dimer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="YG5714_0005"
FT   misc_feature    order(3382..3387,3403..3408,3415..3417,3424..3429)
FT                   /note="DCoH /HNF-1 dimer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="YG5714_0005"
FT   misc_feature    order(3382..3384,3403..3408,3415..3417,3427..3429)
FT                   /note="DCoH tetramer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="YG5714_0005"
FT   misc_feature    order(3433..3441,3484..3486,3490..3495)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="YG5714_0005"
FT   gene            complement(3644..4222)
FT                   /db_xref="GeneID:7808614"
FT                   /locus_tag="YG5714_0006"
FT   CDS_pept        complement(3644..4222)
FT                   /locus_tag="YG5714_0006"
FT                   /gene_family="HOG000222789" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577824"
FT                   /db_xref="GeneID:7808614"
FT                   /translation="MSSTKRSFTALFASRDRAEKEEKMSEKITPIFSLGNFVMDKLGNV
FT                   TQYTFFYYYDPENYYASLTREMLDKEIEVVKGNMQSFLDVEKIIINDRSTRAKVVSTDI
FT                   FLLDITHPVIEFIITFRGKLRKGLNVYENFYEEEITEYPYEAIWRFPGKILNVKMKGQI
FT                   SILENFLKIKVNKGVKVGGRERIEFFLTS"
FT                   /protein_id="YP_002836222.1"
FT   gene            complement(4150..4863)
FT                   /db_xref="GeneID:7808615"
FT                   /locus_tag="YG5714_0007"
FT   CDS_pept        complement(4150..4863)
FT                   /locus_tag="YG5714_0007"
FT                   /gene_family="HOG000107827" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577825"
FT                   /db_xref="GeneID:7808615"
FT                   /translation="MKCSTKSIREIRGFSFLVPNCDSTLLREKFESFRKLSNEENKTYI
FT                   IRIADSNYFKFEVLMLPKSITLLTISTVRGTNNINLRDFEMVDELQTLACCAYQKEELK
FT                   TATSNFLSPTAQIAEAEVVDLISTDEEFECQTECNNISWNEIKLPESTEGKWTTTELAS
FT                   TGKLYLKALSGQAKFLTISTERPQNSIKFTSMERLGALCCFLTELKRKLNECPALKEVL
FT                   QPYLQVEIGRKRRKR"
FT                   /protein_id="YP_002836223.1"
FT   gene            complement(4897..5724)
FT                   /db_xref="GeneID:7808616"
FT                   /locus_tag="YG5714_0008"
FT   CDS_pept        complement(4897..5724)
FT                   /locus_tag="YG5714_0008"
FT                   /gene_family="HOG000270908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577826"
FT                   /db_xref="GeneID:7808616"
FT                   /translation="MKCARSYKMLILPKRLIDILSESMSLKEAYTQYKNRNLNYALKLL
FT                   DELITQDPDLKEAYSLKGKILFELGKLQEAYENFQKAEDKIGMAKVLIAQGLYRDALTY
FT                   LDDNSKESSKLRGLIYLKLENYEKALDETKTIEDEDPLIYKIRGISELKLGRYNDAIID
FT                   LSFAIEKYPTDAELYFYRALAQRGLGNYKEAESDLEMAINLNPYYAEVYFSLGELKESR
FT                   GLLQEAVDMYSKTININPLYRSAYVRRAKSLMKLGREDEAYADIRKANELDSS"
FT                   /protein_id="YP_002836224.1"
FT   misc_feature    complement(<4903..>5640)
FT                   /note="putative PEP-CTERM system TPR-repeat lipoprotein;
FT                   Region: PEP_TPR_lipo; TIGR02917"
FT                   /db_xref="CDD:163072"
FT                   /locus_tag="YG5714_0008"
FT   misc_feature    complement(5005..5298)
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="YG5714_0008"
FT   misc_feature    complement(order(5059..5064,5071..5076,5083..5088,
FT                   5164..5169,5176..5181,5185..5190,5275..5280,5287..5292,
FT                   5296..5298))
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="YG5714_0008"
FT   misc_feature    complement(order(5020..5022,5029..5031,5041..5043,
FT                   5077..5079,5122..5124,5131..5133,5143..5145,5179..5181,
FT                   5224..5226,5233..5235,5245..5247,5281..5283))
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="YG5714_0008"
FT   gene            complement(6215..7045)
FT                   /db_xref="GeneID:7808617"
FT                   /locus_tag="YG5714_0009"
FT   CDS_pept        complement(6215..7045)
FT                   /locus_tag="YG5714_0009"
FT                   /gene_family="HOG000270601" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AIG2 family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577827"
FT                   /db_xref="GeneID:7808617"
FT                   /translation="MYLFVYGSLRYGFELNHLVAKSRFIGLGYIEGYEMYDLGNYPGII
FT                   KGDGIVWGEVYEIDENLIKLLDEVEDYKGSPDDLYVREKTRVYFDQKRKYYLDNVYFYR
FT                   YNREIANDMEKIEDGDYSAWSGMPIIVNYFAYAENTNEKILRQRGVDIMLSEIPAYMKG
FT                   YRLIFNVPCKYGYCANLLEDENGIICGYLQKVFLHTLNSLDKAEQHLIKYIREVVKVYD
FT                   RNGKEYFAYAYVSSHKDDREKPSEEYLKMIREGLMRGWGNECVSTGLYDEAGIS"
FT                   /protein_id="YP_002836225.1"
FT   misc_feature    complement(6782..7039)
FT                   /note="GGCT-like domains, also called AIG2-like family.
FT                   Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
FT                   formation of pyroglutamic acid (5-oxoproline) from
FT                   dipeptides containing gamma-glutamyl, and is a dimeric
FT                   protein. In Homo sapiens, the protein is...; Region:
FT                   GGCT_like; cd06661"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(order(6806..6808,6836..6841,7019..7024,
FT                   7028..7030,7037..7039))
FT                   /note="putative active site pocket; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(order(6788..6790,6794..6808,6902..6904,
FT                   6908..6913))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(6836..6838)
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(6344..6649)
FT                   /note="GGCT-like domains, also called AIG2-like family.
FT                   Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
FT                   formation of pyroglutamic acid (5-oxoproline) from
FT                   dipeptides containing gamma-glutamyl, and is a dimeric
FT                   protein. In Homo sapiens, the protein is...; Region:
FT                   GGCT_like; cd06661"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(order(6407..6409,6425..6430,6629..6634,
FT                   6638..6640,6647..6649))
FT                   /note="putative active site pocket; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(order(6344..6346,6353..6355,6389..6391,
FT                   6395..6409,6494..6496,6500..6505))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   misc_feature    complement(6425..6427)
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:119400"
FT                   /locus_tag="YG5714_0009"
FT   gene            complement(7048..7332)
FT                   /db_xref="GeneID:7808618"
FT                   /locus_tag="YG5714_0010"
FT   CDS_pept        complement(7048..7332)
FT                   /locus_tag="YG5714_0010"
FT                   /gene_family="HOG000107828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577828"
FT                   /db_xref="GeneID:7808618"
FT                   /translation="MKPAEYKKLIDMLTRRGFDVRENGEELLAIFYPPTIEEAGGEGEI
FT                   PNQRYYVIKFKIRNGLAYYDSTTLMENDKPIKVLNIDEVELWLESFLGE"
FT                   /protein_id="YP_002836226.1"
FT   gene            complement(7313..7687)
FT                   /db_xref="GeneID:7808619"
FT                   /locus_tag="YG5714_0011"
FT   CDS_pept        complement(7313..7687)
FT                   /locus_tag="YG5714_0011"
FT                   /gene_family="HOG000107829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF107"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577829"
FT                   /db_xref="GeneID:7808619"
FT                   /translation="MAHPVAITLIIIAVLIAILVITGYISDPIIDIPTLALLGFLTYRV
FT                   INVVIKTRGRNLYSYEGKIGKAVDDIKSGQEGYVIVEGEYWRALALEDIKKNEDIVVVK
FT                   REGMKLMVRKKVSDIETSRV"
FT                   /protein_id="YP_002836227.1"
FT   misc_feature    complement(7343..>7594)
FT                   /note="NfeD-like; Region: NfeD; cl00686"
FT                   /db_xref="CDD:120037"
FT                   /locus_tag="YG5714_0011"
FT   gene            7723..9051
FT                   /db_xref="GeneID:7808620"
FT                   /locus_tag="YG5714_0012"
FT   CDS_pept        7723..9051
FT                   /locus_tag="YG5714_0012"
FT                   /gene_family="HOG000270600" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Peptidase A5, thermopsin"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577830"
FT                   /db_xref="GeneID:7808620"
FT                   /translation="MYKVLLIIILLLPLSMPLTIHTISQPSSLAFPSGVTSYPLNTVIY
FT                   TDFVMGKINISYLNIGSSYLPGGEYFTTGNASLQLNAMVLGKYWAQNVILFHQISNNTF
FT                   YATPIVNLWNLSGPFSNTTGNSLVYQGLGVICYQGPTFKVNLPLSISLFMEIVNSTLDF
FT                   GYNINEERGIYFRYPLIGLFQLGGLSLLGLPNDLELVWGGPGGGSVVFMNVSSVANLYY
FT                   FNGNGLSIVPNAYSIGFDTAEAAFGVKIYSTFPSLFSPIAIETSGLNVPSVLWPIPPHV
FT                   LVNQTSDRITVKLSISNKSLSGQAVYLETGFPPSVVSSTLTNSSGIAVFPNNNYSFYVV
FT                   YFPGNFTLSSAYYFSSPILNSLSSKFHSYYQDLLNFLNSAQNSFKKGIKSILSKQETSI
FT                   TTTTLTSTTSSSPQFGVNLYIILYILAFVIGMVISAILIRFKL"
FT                   /protein_id="YP_002836228.1"
FT   misc_feature    7801..8469
FT                   /note="Thermopsin; Region: Thermopsin; pfam05317"
FT                   /db_xref="CDD:147481"
FT                   /locus_tag="YG5714_0012"
FT   gene            9076..9879
FT                   /db_xref="GeneID:7808621"
FT                   /locus_tag="YG5714_0013"
FT   CDS_pept        9076..9879
FT                   /locus_tag="YG5714_0013"
FT                   /gene_family="HOG000217040" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="band 7 protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577831"
FT                   /db_xref="GeneID:7808621"
FT                   /translation="MAINVGDIVGIVFLIIIIIIFIAMSFRVVREWERAVVLRLGRFLR
FT                   IKGPGIIFLIPFVDRPLIVDLRVNTVEVPPQTILTRDNVTVSVDAVVYYKVVDPQKAVL
FT                   SVYNYNVAVLNLAQTSLRDIVGQMELDELLSKREEINKRIQEILDVTTEGWGIKVTAVT
FT                   IRDIRLSQDLLSAMAKQAEAERLRRAKVILSEGERQAASILADASTYYKDNPSALQLRF
FT                   LETLSDISQRGGLIIVVPAGNEIYPTLGTSAALSTLSKKLQTETK"
FT                   /protein_id="YP_002836229.1"
FT   misc_feature    9160..9798
FT                   /note="Band_7_stomatin_like: A subgroup of the band 7
FT                   domain of flotillin (reggie) like proteins similar to
FT                   stomatin and podicin (two lipid raft-associated integral
FT                   membrane proteins). Individual proteins of this band 7
FT                   domain family may cluster to form...; Region:
FT                   Band_7_stomatin_like; cd03403"
FT                   /db_xref="CDD:48215"
FT                   /locus_tag="YG5714_0013"
FT   gene            complement(9910..11001)
FT                   /db_xref="GeneID:7808622"
FT                   /locus_tag="YG5714_0014"
FT   CDS_pept        complement(9910..11001)
FT                   /locus_tag="YG5714_0014"
FT                   /gene_family="HOG000107830" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577832"
FT                   /db_xref="GeneID:7808622"
FT                   /translation="MNINEIIKKVNELATKDVDERGKINMATNLIFDDITSNNSELKIG
FT                   ILEEIIDSDHIACAVDGSKYEIELSDVTLILARAVKILGKKKDKKSVPSEIAEDFKIIE
FT                   NYYDKNVISNKSILFMLSLETGLIEKCEDCDVIFVDGPIVDPPTYYEEDVEIENILSLD
FT                   KLALYRSTVLRRLKGKNKLIMGIVKNFSHRILIKEFLNSYPALIKARENYIISNIMYKY
FT                   RLEKSEFNKPIFLGWINWDSLINNQIILDDLKGISKAYNQYKKAFNYSLSIYSLYYQYN
FT                   ITSPIVRIDMLSEKEPDFTPIKYLNTWAMQGIREVTLLNKLADELSEINSQDAKKYALL
FT                   FNLARENYLDMNDKLAELMMRKT"
FT                   /protein_id="YP_002836230.1"
FT   misc_feature    complement(10015..10839)
FT                   /note="NurA domain; Region: NurA; cl09134"
FT                   /db_xref="CDD:158430"
FT                   /locus_tag="YG5714_0014"
FT   gene            complement(10998..11687)
FT                   /db_xref="GeneID:7808623"
FT                   /locus_tag="YG5714_0015"
FT   CDS_pept        complement(10998..11687)
FT                   /locus_tag="YG5714_0015"
FT                   /gene_family="HOG000107857" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577833"
FT                   /db_xref="GeneID:7808623"
FT                   /translation="MDLDEFIEKLTQYKQNLDVEKLREEDRKITEMIEELEVSKQSLKE
FT                   SLKKLRSLEKKINELNKYEDNLEEIKADIERLGKLNSAEEIIRYVEKIKGKIDSLEKDV
FT                   EQDLNKIIDDKIKNIEEINDRLKLYAKILYHFLKIQKDVKTFSIPKEKSLSKLNEVEIQ
FT                   AKQHLNELYEIIVNELGKLNLNENEINILIILIDKGEIKISKDNLEEAIKVMKMLVERN
FT                   ISIKVKV"
FT                   /protein_id="YP_002836231.1"
FT   gene            complement(11674..14712)
FT                   /db_xref="GeneID:7808624"
FT                   /locus_tag="YG5714_0016"
FT   CDS_pept        complement(11674..14712)
FT                   /locus_tag="YG5714_0016"
FT                   /gene_family="HOG000107859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577834"
FT                   /db_xref="GeneID:7808624"
FT                   /translation="MSCYKRISETASDSSYIYQIFSCISENPLYINRLRFFKQVKDEID
FT                   RISKTKQSPEIISLVADWGQGKSTFLDIIEEYAKSKNISVIKVPFVELLSKTEDLLTFR
FT                   NNIYLIDEVESSVDYFAEYQNEIKDFWSKVKELANSTGNSIVYLSMTPSAYSKIFGTGG
FT                   LIYNLFSETYPSLLERIRKVSIENPSKLEFLLMLKCMLKMANVKDFKILQYMDLPYWVI
FT                   DQERRKYVRFFNDILCDNLPNIDRIFNELARSEKGISLNSEGETIKLDTLTKMENELDS
FT                   QESSNLYRVLMSRIFTDEKLIIKQLEGHVVKGVLLPYLKWIEIFPKGQEYVEDFLLTYY
FT                   QDDFHVFISDNIESVVYESIDTSKLKENIKKLTLFSKTEAYALSWNFFESVANTNIGGL
FT                   VVEFKSREIRDKALQFVNTYITDREKELESLEYFMEVLGIKIDSANRTRDYIRFLKIVD
FT                   RNDKITIILAKPSNEDEIKSLIKEIKESDDIIHGIILIEPQIGKEELSKTLDELSIPLI
FT                   ELKITTPKKRQLLYLLFSKIYGQSRIRLDSIELRLGDLKNSISSLLLKIRDNLNLKQLP
FT                   IPKNKRLIQSFNWIIFYPSIKMANADEVFDKVNDIINEKFRMYGSKQFHLEDIETSNTF
FT                   IEDVITYFYNNYIIKIRTNYIDFEDLAGDSLSSFSKLFAGLIRQKYKQEAEDVVFNYIM
FT                   YYVNPQDTRRKDNKNNPLAFAYQIFNPDKKIGQNPTLDFLVYSSIVSGEVAKYLNKDSI
FT                   YMKINDQIRKIKEKLDNPYSAYGYFITAKKRGAAVRSLEEMREAIETYEKSCTENKDIR
FT                   LCYDYLYLSNIYLELLRETEKSVIETDKIVEEISKKLEVVEKAKRYIKINEKIEEIEKV
FT                   REIVRELKDNFKIHMDKLAKRIQEINERGETESFKRYLDYLLTTIHVEDNSNLYFILFK
FT                   LLKETLNGIAIVGEELKGTIVDEITSLSKVGIQLNNIETIVNELEKISPELPKLRENVE
FT                   RNTQKITQLIQEIKEVLEEHGFG"
FT                   /protein_id="YP_002836232.1"
FT   gene            complement(14717..16330)
FT                   /db_xref="GeneID:7808625"
FT                   /locus_tag="YG5714_0017"
FT   CDS_pept        complement(14717..16330)
FT                   /locus_tag="YG5714_0017"
FT                   /gene_family="HOG000232387" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF87"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577835"
FT                   /db_xref="GeneID:7808625"
FT                   /translation="MLMEKGEIIGIVLQKSEANELQGLIRADEEINIGQLLLIDDSEKL
FT                   SLVRVENYEFLNEFFDERGDIAKSILKEPSIYEILDMNTIIKATLHLIKKYDHSTTPKP
FT                   GSFVRKLPEIKSEKDLLSFYGIKSKKGLIEYGALAGSEIPLLLDLNAITMHIGVFGETG
FT                   SGKSYNMRYLIKLLSNIKIGDNITALPMIVIDANGDYIDLASTNLDIVSRGRGWIKRYI
FT                   LKDPKEQNDIKLTIDLSIFTPRELSEFIMSLKYGEASYNTLQLNFLEQVLANHDSKEYN
FT                   TLLGTAIGIENLRNEILTMAQNKDIGITTSTARGIASALEIFKNKVISRLQLVNSSASL
FT                   TENTLEVIWRNRGLAIIDFSAEGSPGIDVLTKQLIVSYITRLIFNYLTKSKYNGNQRFL
FT                   GFVIEEAQNYIPSVDYPVNANLTKDVLVTLATQGRKFGASLILVSQRPAFIDKYVLSMI
FT                   NTFCFHRIYHEDVRYVMSASGGLPESLTRNLTSLETGHVIVSGLMSIMKSPALVRIPWD
FT                   ARLGSYAGNVERIDLILSEG"
FT                   /protein_id="YP_002836233.1"
FT   misc_feature    complement(14768..16330)
FT                   /note="HerA helicase [Replication, recombination, and
FT                   repair]; Region: COG0433"
FT                   /db_xref="CDD:30782"
FT                   /locus_tag="YG5714_0017"
FT   misc_feature    complement(15182..15934)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="YG5714_0017"
FT   gene            complement(16375..16941)
FT                   /db_xref="GeneID:7808626"
FT                   /locus_tag="YG5714_0018"
FT   CDS_pept        complement(16375..16941)
FT                   /locus_tag="YG5714_0018"
FT                   /gene_family="HOG000107860" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577836"
FT                   /db_xref="GeneID:7808626"
FT                   /translation="MSSACERLYEYLKPDFTRISKKDNTDDLFRHPVVMRWHHYFLENW
FT                   NSDKEIGLLLPCTVVKPYSLSPTHKIAYATLNKYNLEEKVQVYSVSEPMLLVPKELEEC
FT                   YPFNNYDYPPRLMSKEEKEEFIMLLTKPLIKVSMLHNRLIGILPRHHYEIVKRAAEISN
FT                   LKITIYPYGRLAFKTIANVITSISS"
FT                   /protein_id="YP_002836234.1"
FT   misc_feature    complement(<16378..>16941)
FT                   /note="Queuine tRNA-ribosyltransferases, contain PUA domain
FT                   [Translation, ribosomal structure and biogenesis]; Region:
FT                   COG1549"
FT                   /db_xref="CDD:31738"
FT                   /locus_tag="YG5714_0018"
FT   gene            complement(16913..17797)
FT                   /db_xref="GeneID:7808627"
FT                   /locus_tag="YG5714_0019"
FT   CDS_pept        complement(16913..17797)
FT                   /locus_tag="YG5714_0019"
FT                   /gene_family="HOG000223141" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577837"
FT                   /db_xref="GeneID:7808627"
FT                   /translation="MKIILGIPDLKIPVWTFKQPLMVNQLNWNNLSWENETWVDSGGYQ
FT                   IMVKGIKVEIEKVVEKYKILDATQYMSLDIPSNPCHKPSELNYKYFEYLYAVFDKKIVP
FT                   VIHAYDVESIKKSIDFYSQYTDLVAFGGIIPPTLNKSGNKKLAVTIYHLVRKLWKGKIH
FT                   VLGAGSPFMRKVYFNANSVDTSTYRIKGIHGMVIIPGKGERYVGERKIVWGTRRASEEE
FT                   LETLLSFLDRTKYPFPIRLDNWVDRSLINAWVLLNSEYEINNPLIEYSKKLDSFPEDEI
FT                   EEEVNELCMRATI"
FT                   /protein_id="YP_002836235.1"
FT   misc_feature    complement(16916..17797)
FT                   /note="hypothetical protein; Region: PHA01745"
FT                   /db_xref="CDD:107058"
FT                   /locus_tag="YG5714_0019"
FT   gene            18040..18720
FT                   /db_xref="GeneID:7805917"
FT                   /locus_tag="YG5714_0020"
FT   CDS_pept        18040..18720
FT                   /locus_tag="YG5714_0020"
FT                   /gene_family="HOG000107861" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577838"
FT                   /db_xref="GeneID:7805917"
FT                   /translation="MSKGAEILILFTVFVFTLNIISNAYVVNVKILSPFPVTLLFSDSH
FT                   GVKLVSSNQTLNVNSSNLRIQAFVLAPYSYSILINGNNTNELNVNLSNYSEFNLTVIVI
FT                   PSYAFLKVDVVGKGTVYIELNNGTIIAVRNSSVVKLYNGSNVLLEASGDLLNWSNGGNT
FT                   MTIWYTVNGNSTITAFFGNSSILLKSGTVKPIVNYTEVGLSLFAIGFFVLYKIYSRKDQ
FT                   DTNV"
FT                   /protein_id="YP_002836236.1"
FT   gene            18762..20693
FT                   /db_xref="GeneID:7805918"
FT                   /locus_tag="YG5714_0021"
FT   CDS_pept        18762..20693
FT                   /locus_tag="YG5714_0021"
FT                   /gene_family="HOG000231201" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF255"
FT                   /transl_table="11"
FT                   /db_xref="GI:229577839"
FT                   /db_xref="GeneID:7805918"
FT                   /translation="MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDV
FT                   GAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVDRDEMPDLDRLLQNAAMAITGESGW
FT                   PLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPNMLI
FT                   ARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGK
FT                   KLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATN
FT                   DIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEGKYYTWTEDELKGALGNDYGI
FT                   AIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRK
FT                   MPYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPED
FT                   YAAALLASISAYEVLSEEKYYDLAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLS
FT                   LLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMAHIVVVDEKDGLAERLH
FT                   RTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKI
FT                   KQLLKTKL"
FT                   /protein_id="YP_002836237.1"
FT   misc_feature    18762..20687
FT                   /note="Highly conserved protein containing a thioredoxin
FT                   domain [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG1331"
FT                   /db_xref="CDD:31522"
FT                   /locus_tag="YG5714_0021"
FT   misc_feature    18831..19202
FT                   /note="TRX domain, SSP411 protein family; members of this
FT                   family are highly conserved proteins present in eukaryotes,
FT                   bacteria and archaea, about 600-800 amino acids in length,
FT                   which contain a TRX domain with a redox active CXXC motif.
FT                   The human/rat protein...; Region: SSP411; cd02955"
FT                   /db_xref="CDD:48504"
FT                   /locus_tag="YG5714_0021"
FT   misc_feature    order(18909..18911,18918..18920)
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48504"
FT                   /locus_tag="YG5714_0021"
FT   gene            20705..21424
FT                   /db_xref="GeneID:7805919"
FT                   /locus_tag="YG5714_0022"