(data stored in SCRATCH zone)

HOGENOMDNA: THEAB_1

ID   THEAB_1; SV 1; empty ; DNA; empty ; PRO; 2016657 BP.
XX
AC   NC_011653;
XX
PR   Project: 59095;
XX
DE   Thermosipho africanus TCF52B, complete genome.
XX
OS   Thermosipho africanus TCF52B
OC   Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermosipho.
XX
RN   [1]
RP   1-2016657
RX   PUBMED; 19124572.
RA   Nesbo,C.L., Bapteste,E., Curtis,B., Dahle,H., Lopez,P., Macleod,D.,
RA   Dlutek,M., Bowman,S., Zhaxybayeva,O., Birkeland,N.K. and Doolittle,W.F.;
RT   "The genome of Thermosipho africanus TCF52B: lateral genetic connections
RT   to the Firmicutes and Archaea";
RL   J. Bacteriol. 191 (6), 1974-1978 (2009)
XX
RN   [2]
RP   1-2016657
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (10-DEC-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2016657
RA   Nesbo,C.L., Bapteste,E., Curtis,B., Dahle,H., Lopez,P., Macleod,D.,
RA   Dlutek,M., Bowman,S., Lewis,A., Zhaxybayeva,O., Birkeland,N. and
RA   Doolittle,F.;
RT   "Direct Submission";
RL   Submitted (06-OCT-2008) Department of Biochemistry and Molecular Biology,
RL   Dalhousie University, Sir Charles Tupper Medical Building, Halifax, Nova
RL   Scotia B3H 4H6, Canada
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001185.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2016657
FT                   /strain="TCF52B"
FT                   /mol_type="genomic DNA"
FT                   /organism="Thermosipho africanus TCF52B"
FT                   /db_xref="taxon:484019"
FT   repeat_region   complement(351..560)
FT                   /mobile_element="insertion sequence:S116/IS110/IS902"
FT   gene            complement(658..1605)
FT                   /db_xref="GeneID:8187358"
FT                   /locus_tag="THA_2001"
FT   CDS_pept        complement(658..1605)
FT                   /locus_tag="THA_2001"
FT                   /gene_family="HOG000262441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:254555126"
FT                   /db_xref="GeneID:8187358"
FT                   /translation="MKQKSINKKISRITQDTLIVGIDVAKRTHWIRMMDFRGIDLIKPF
FT                   KINNTMDGIKMLEEKIKSVKEENKLNKVVLGMEPSGHYWKVLAWQMKISKEIDYLVGVN
FT                   PYHVKKSKEFDDNSPGKSDRKDAGVIARLIRDGRYFDIYLPEDIYGELRVITTTREQLV
FT                   NKRKNAKNMVISVMDEYFPEYEKIYKNIFSEGSIKLLKTHPFPKEIIEVGIEEIEKVLK
FT                   KSTNGKDWKSRAQKIYESAKKSIGVREGQKSAKIKLRMLLEEIEFLTSQIEELEKEMEE
FT                   LVEETEEGEYIKSVPGIGPIMTAVILGEIGDIKR"
FT                   /protein_id="YP_003071385.1"
FT   misc_feature    complement(1039..1299)
FT                   /note="Transposase; Region: Transposase_9; pfam01548"
FT                   /db_xref="CDD:144952"
FT                   /locus_tag="THA_2001"
FT   misc_feature    complement(<661..732)
FT                   /note="Transposase IS116/IS110/IS902 family; Region:
FT                   Transposase_20; pfam02371"
FT                   /db_xref="CDD:145490"
FT                   /locus_tag="THA_2001"
FT   gene            complement(1674..2126)
FT                   /db_xref="GeneID:7071087"
FT                   /locus_tag="THA_1"
FT   CDS_pept        complement(1674..2126)
FT                   /locus_tag="THA_1"
FT                   /gene_family="HOG000292416" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076134"
FT                   /db_xref="GeneID:7071087"
FT                   /translation="MESSVLLLRLNEENNNKLNEIMNKLKEITNITKAKMYFLAGAYGY
FT                   FYNTREKIQNNPIDVTRVEFLERSEYKVQKILLNSIYQSQKENLDENINKYKLFEEYAN
FT                   AGVRKLYDIFTESSEIEEFIESLELEVIRIIEALGISTEENSCKEK"
FT                   /protein_id="YP_002333850.1"
FT   gene            complement(2126..4057)
FT                   /db_xref="GeneID:7070792"
FT                   /locus_tag="THA_2"
FT   CDS_pept        complement(2126..4057)
FT                   /locus_tag="THA_2"
FT                   /gene_family="HOG000003775" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA double-strand break repair protein Rad50,
FT                   putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076135"
FT                   /db_xref="GeneID:7070792"
FT                   /translation="MRIESIKLSKFKQFKDFKIEFSKDNNQDNDFHVIVAKMGVGKSNL
FT                   LESINWCLYGKEIFGKITKPTDPDILNNNCLNDDGEHIVRVNLNLSDGKESYLILRESK
FT                   FKVNDKKAISLNESHLSFSKEMGIILKDIDAKKEIENLLPEDLRDQFFFNGERLDNYFD
FT                   ENQGVKISYVIKKMSGLDILESFKDTLEKIKSRYLRDIKVNENNLNKKKDLEKKLDRIK
FT                   DNKKETEKLLQDQILDLEKTKKRLEDVNHELEKLKEYEVYKKQLESIKNLIQEFENKKR
FT                   EILEKKAQVVFELSTLIFGWSAIEKVYHENKDIEVNYDYLPTEIVRNALNENKCPICEK
FT                   ELDENHRKVLEKYLSLDKEFIISVKDYNDLTKKILELESVRKDLNSQLGEVLTKIEEYN
FT                   NKLKSVERNLSDIHAEKLIKLYNEKKELENQIEIINQKIGEFNNQIKFFEKEEKEIESE
FT                   LEKIATGDSNKIFEKIKFVENLQQIILNTIINRREEIKKEILDYIKENLEKLMWKKDLI
FT                   SDVEFSSNFSLNVYDKYRNMILNRLSGGEKSVLTLSFALAMHKASGVNAPIILDRPLAN
FT                   ISGDTYDKLIEMFSKISKEKQIIIMITDKEYQQSVELLNELATTIHILEMNENSEVKIV
FT                   EKYAKEVI"
FT                   /protein_id="YP_002333851.1"
FT   misc_feature    complement(<3752..4057)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(3929..3952)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(order(3926..3934,3938..3943))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(<2744..>3250)
FT                   /note="chromosome segregation protein SMC, primarily
FT                   archaeal type; Region: SMC_prok_A; TIGR02169"
FT                   /db_xref="CDD:162740"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(2222..>2437)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(2405..2434)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(2342..2356)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(2324..2335)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="THA_2"
FT   misc_feature    complement(2243..2263)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="THA_2"
FT   gene            complement(4063..4266)
FT                   /db_xref="GeneID:7070793"
FT                   /locus_tag="THA_3"
FT   CDS_pept        complement(4063..4266)
FT                   /locus_tag="THA_3"
FT                   /gene_family="HOG000292415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076136"
FT                   /db_xref="GeneID:7070793"
FT                   /translation="MLKSSAPKLYESLEKMTFSKFGEKEGEKVFNLLWEIFSEYTNRSE
FT                   SDENKFVDYAKKLIDNYFENRG"
FT                   /protein_id="YP_002333852.1"
FT   gene            complement(4284..6377)
FT                   /db_xref="GeneID:7070794"
FT                   /locus_tag="THA_4"
FT   CDS_pept        complement(4284..6377)
FT                   /locus_tag="THA_4"
FT                   /gene_family="HOG000275847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076137"
FT                   /db_xref="GeneID:7070794"
FT                   /translation="MSFKDLILKRTYSSEVDDILNDFYIPVLKESISYFRISGFFTSES
FT                   LSIAARGILGLIKNEGKMKLIVSPRLTFEDVETIKEANQDPSKYINSILEKNIELLENE
FT                   FVRDHLFALGWMIANNKLEIKIALLYSLEGNVMLSEEIIDSGLFHQKIGIFTDKEGNII
FT                   SFSGSINETLLGWQRNVEEFKIFRSWIDVENEYVKEDLKKFEKYWSNNATNLKVIEIPE
FT                   AIKQKLVKIVPKDFDINSLEKWYKKDNDNKLKKITLFEHQNEAINRWKSNNFKGIISMA
FT                   TGTGKTYTAIGAIDRILKNNQKHFIVISVPYSHLIEQWNNSIKKFGLNVNFIVKCFSEN
FT                   SKWHSDLKRYVRKLLLGQIKNLLIISTHDTLVSNKMKDILLNIKTDIETILVADEVHSI
FT                   GSLKRRENLSNIFRYRLGLSATPKRMYDDFGNSFLKEYFGEIVYEFSLCDAIYKINPLT
FT                   YNTFLTPYYYYPYLCILTENETKKYNYLTLKILNLVKNSSENIFDEIDTDEKLKMLLIK
FT                   RSKIIKAAKNKIKVLEDIISDIEKNNGEISHTIIFTDDKLINETIDLLKSKNIYAVKFT
FT                   QELSNKQRIDVLENFGKGIIQVLVAMKILDEGVDVPESKIAIIMSSSTNPREFIQRIGR
FT                   ILRISENKKYSYIYDIITKPKYIEDAVLNLEDSLFKAEKERVKIIAKCALNYKEVMDKV
FT                   NEI"
FT                   /protein_id="YP_002333853.1"
FT   misc_feature    complement(5025..5627)
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="THA_4"
FT   misc_feature    complement(5112..5552)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="THA_4"
FT   misc_feature    complement(5517..5531)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="THA_4"
FT   misc_feature    complement(5187..5198)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="THA_4"
FT   misc_feature    complement(4431..4787)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="THA_4"
FT   misc_feature    complement(order(4566..4574,4647..4652,4710..4718))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="THA_4"
FT   misc_feature    complement(order(4464..4466,4473..4475,4485..4487,
FT                   4548..4550))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="THA_4"
FT   gene            complement(6798..6911)
FT                   /db_xref="GeneID:7070795"
FT                   /locus_tag="THA_5"
FT   CDS_pept        complement(6798..6911)
FT                   /locus_tag="THA_5"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076138"
FT                   /db_xref="GeneID:7070795"
FT                   /translation="MLSSLNLSDFYYGRVLSMLINKGLNPILIENSDERRI"
FT                   /protein_id="YP_002333854.1"
FT   gene            complement(6926..9433)
FT                   /db_xref="GeneID:7070796"
FT                   /locus_tag="THA_6"
FT   CDS_pept        complement(6926..9433)
FT                   /locus_tag="THA_6"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076139"
FT                   /db_xref="GeneID:7070796"
FT                   /translation="MKYVIHKDFIEIKLGIGDRRLKKFYYVFFNTRNNKFNLTYDFLNM
FT                   LYQEDPTILEKLGFKTDYENLTVKLRFVNKIDSSTIKFKYNEEIDLVINERFLVNSNKG
FT                   VILFLNSEVYDAFSFILYNNSKIVEKINKLNQLKKKYNISYIAPKKIEIINKYNLKVNE
FT                   ESDGEVIDYTIFGIPKKESFVLSGSLVTNKKVYYIDESTKKDLLILEKYRDPKSKKIII
FT                   NENNIEKFHEDYLHSFSDEFIEKLSDRIKFLTFQPSNILIRKNVSPISKEELFNYNIIH
FT                   FHDLLNGGVENLELTPELKEKIENAKKENKNFVFYKGSWIRLDTLPEEVVEEIKTKSFE
FT                   PHKEPKSKLFDLEIKENIEKLEYSKFKKEEKKQTQEEKLDLKYFEGKLKKFQEIGVKKV
FT                   ISAYLEGFRGFLLADDMGLGKTAQAIAFMTWLLEEKELFPVMIVVPNSLLENWRKELER
FT                   FSPEIYKHFNTKDLVLINYEKLLRNEKLLIRDWNLIITDEAQRYKNYRSKTTRIIKGYK
FT                   FKFHLALTGTPVENSIDELWNIIDAITPGLLGKLKDFNNKYNVINSDPTSEEAQEKSLE
FT                   ILNSIDPVFLRRNKEDKEVEINFPKKEEFFIESYLTQTQEDKYLDTYLKYKKKNANKKD
FT                   FLGLAIKLLQVCDFGADYFDENFYKHSGKLNKLKDLMIEIKNKKEKALIFTKFIMTQQI
FT                   IKAFLRNELGIESEILNGTVPIETRNYIVKQFNDGKIDVLIINPRVGGVGLNLVAANHV
FT                   IHYTPEWNPAVTSQATDRAYRIGQDKDVYVYYFFSKFRNNHNKTIEEYFMKLLERKKQI
FT                   KNILLDNIITNKEFENLKKEFFE"
FT                   /protein_id="YP_002333855.1"
FT   misc_feature    complement(7796..8287)
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="THA_6"
FT   misc_feature    complement(7850..8212)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="THA_6"
FT   misc_feature    complement(8171..8185)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="THA_6"
FT   misc_feature    complement(7934..7945)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="THA_6"
FT   misc_feature    complement(7082..7450)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="THA_6"
FT   misc_feature    complement(order(7214..7219,7223..7225,7298..7303,
FT                   7364..7375))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="THA_6"
FT   misc_feature    complement(order(7112..7114,7121..7123,7133..7135,
FT                   7196..7198))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="THA_6"
FT   gene            complement(9430..11232)
FT                   /db_xref="GeneID:7070797"
FT                   /locus_tag="THA_7"
FT   CDS_pept        complement(9430..11232)
FT                   /locus_tag="THA_7"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076140"
FT                   /db_xref="GeneID:7070797"
FT                   /translation="MQMLYNIIEVVKIENKNNLISNKNDFFSIEFINKLLDKKFITKSY
FT                   KYFWFYALLEEIIEGNTTIKFRTLSIRMIANAWLIFKTILVKEKNRDLFNEIVDYLDNN
FT                   YNIPTKISKNELIKKFEEIYYQDNTLKNLSERLLLYVPYRFLSPFFSEIRGINDTLKNE
FT                   EIEKLSKKSLNVLYKIDSKYEVIYINKAWFEFINKNKNFISKLIYQKLSEYYNFNYNML
FT                   TTEDFEKILNEQLFQNSKNSLENNYYDLTIEPKNLRKFMKEFNDFYSKFKSRFEKSKYD
FT                   KLKEMFLKDSIDTLIEKIPKNYYKIILKLYKNENDLRTKILEFISNQKFEFKEIIEDEF
FT                   QNSFFTDNDFKNLLISLYDDLKQMYENDPIKKLIYYIKNVNDLNDISKYMMIKNKKLKN
FT                   FVERTFKAYKYPSNSELIKSYVKFLEDFNYYKYYKKLILEIFERHVLEVDDFNLRFLEL
FT                   IFKLNGWETYNFSDTEYVSSLLTKLGLSLYVINKIKKYILKEHIEDFFKKDNERLEFWR
FT                   NYTNKMINVKMKNYNNTKAIIMYFYKYDIVEFEDVGNALYIYKKGIVDGLYDLKNRNKC
FT                   YERLPHSGKIWKTKFYHRLKELGI"
FT                   /protein_id="YP_002333856.1"
FT   gene            11317..12558
FT                   /db_xref="GeneID:7070798"
FT                   /locus_tag="THA_8"
FT   CDS_pept        11317..12558
FT                   /locus_tag="THA_8"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="viral A-type inclusion protein repeat, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076141"
FT                   /db_xref="GeneID:7070798"
FT                   /translation="MFLSFLKGFFTVLLNPFTVIYMLIEFLFFAYYLFKKGSLQNSLNR
FT                   EDNELTEEEIISFTNFWPSFFITLGILGTFIGIIIGIINLDFENENSLKNSINSLLSSM
FT                   GTAFFSSIIGVIFSIAAQIINKPVVKGLSKITKTNKEKLLDEIIGIRNDIKEFLANPFE
FT                   TISEKANQTVEQYSSSFNQLNETLNNTFEQNINRFSNIVHNISEELNKQFDSIKQQSEL
FT                   IEKREKVIQNEKELLKDFSLIIEKSRETFNEIFEKQKNTVEKLEKVETLIQSIIENKAD
FT                   LNSLNENVLEVINNFKRFTDEFNSNFNEFISSINRVTQQIPNQMSLKYKNAFEEMENFT
FT                   IEFFSKFKEISVYLYNTIDDFEKSLEYFNYSLNNIRNDIEFAIKDFKNSLIQLLEDYYK
FT                   ISNNINDEEEKKNE"
FT                   /protein_id="YP_002333857.1"
FT   gene            12551..13204
FT                   /db_xref="GeneID:7070799"
FT                   /locus_tag="THA_9"
FT   CDS_pept        12551..13204
FT                   /locus_tag="THA_9"
FT                   /gene_family="HOG000261881" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chemotaxis protein MotB, putative"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076142"
FT                   /db_xref="GeneID:7070799"
FT                   /translation="MNRKFNPWISYSDLFSALLLIFVLLLSLTLLQYTYAIQNKETRLK
FT                   EIIGIKAKIVEELVNTFKDLDLEIQVDPNSGAIIINNDILFNYNDYTLSTKGKNILLKV
FT                   IKTYLNVILKPEYETYIAEFYLEGNSDPTGTYEYNIDLSMKRAFEVFKYLRENLDEIPY
FT                   QELFFKKLVVSGKGYNNPIIENGKINYTKSRRVELKFTLKDQEMIKEILEIFQN"
FT                   /protein_id="YP_002333858.1"
FT   misc_feature    12797..13150
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="THA_9"
FT   misc_feature    order(12812..12817,12938..12943,12950..12952,12962..12967,
FT                   12974..12976,13118..13120,13130..13132)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="THA_9"
FT   gene            13290..13682
FT                   /db_xref="GeneID:7070800"
FT                   /locus_tag="THA_10"
FT   CDS_pept        13290..13682
FT                   /locus_tag="THA_10"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076143"
FT                   /db_xref="GeneID:7070800"
FT                   /translation="MVFKKTTFKYEIAVPFFGFIPDEIMPVWNFYTQNFYLSSYICPEC
FT                   GKLMMKTVFPNDYPFETNDGIKKVPRIFTCGDCKTLHIPAPGYKLSSNNGYYYKAKSDE
FT                   EFEKIIKKIDKNGSLIGRQNTLYNEN"
FT                   /protein_id="YP_002333859.1"
FT   gene            complement(13897..14688)
FT                   /db_xref="GeneID:7070801"
FT                   /locus_tag="THA_11"
FT   CDS_pept        complement(13897..14688)
FT                   /locus_tag="THA_11"
FT                   /gene_family="HOG000242995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076144"
FT                   /db_xref="GeneID:7070801"
FT                   /translation="MQIGNYVCKEINGLFLCRSSLLCQFNKLFHIVTTRKVNKNQFNFD
FT                   ELDMSFNNENFKDHYILLSDNLGLDLNKFIFTNQVHENKVEYVTSKNLKGEFYENVISK
FT                   TDGLITDEKGIFLVTKYADCMPIIAYDPIKNVVGVAHSGWRGTLIDMPKHLIIKMMNEF
FT                   GSNPENIFVSIGPSIGPESFEVGKDVAESFAKKFGDMFIMESNDKYFVNLWKIAENQIY
FT                   EMGVRNIEISLIDTYRNTDYFYSYRKEKTKKRFAVIVGLIP"
FT                   /protein_id="YP_002333860.1"
FT   misc_feature    complement(13903..14616)
FT                   /note="Multicopper polyphenol oxidase (laccase) [Secondary
FT                   metabolites biosynthesis, transport and catabolism];
FT                   Region: yfiH; COG1496"
FT                   /db_xref="CDD:31685"
FT                   /locus_tag="THA_11"
FT   misc_feature    complement(13906..14595)
FT                   /note="Multi-copper polyphenol oxidoreductase laccase;
FT                   Region: Cu-oxidase_4; cl00650"
FT                   /db_xref="CDD:174330"
FT                   /locus_tag="THA_11"
FT   gene            complement(14701..14838)
FT                   /db_xref="GeneID:7070802"
FT                   /locus_tag="THA_12"
FT   CDS_pept        complement(14701..14838)
FT                   /locus_tag="THA_12"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076145"
FT                   /db_xref="GeneID:7070802"
FT                   /translation="MYKKKKHMEKLRDKLENEIPNTERNEKLLIKVWDIADILVNKFLL
FT                   "
FT                   /protein_id="YP_002333861.1"
FT   gene            complement(14966..15700)
FT                   /db_xref="GeneID:7070803"
FT                   /locus_tag="THA_13"
FT   CDS_pept        complement(14966..15700)
FT                   /locus_tag="THA_13"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076146"
FT                   /db_xref="GeneID:7070803"
FT                   /translation="MFLNKPLPNTNYITYFSTNLVGTRSDVEQFFSWHKNKKLITTFSF
FT                   SLIVVIFAILTIFIKKMPKSKVIFKVLTTFTIFLIALLNSSGSEFLIVTGLLFGMIGDF
FT                   LLEFEDKFLHGMFSFLIGHIFYSLSFLIKFGIPNILVFFIILPILLILYFVILFKKAEN
FT                   FKLPILVYTVAIGIMFSFTFAPAFKDIYYLRCMLPLAGGLFVFSDFLIAIEKFVRKIKY
FT                   SEIIILGTYFLAQLIIALSTIF"
FT                   /protein_id="YP_002333862.1"
FT   misc_feature    complement(14978..15451)
FT                   /note="YhhN-like protein; Region: YhhN; cl01505"
FT                   /db_xref="CDD:154439"
FT                   /locus_tag="THA_13"
FT   gene            complement(15785..16606)
FT                   /db_xref="GeneID:7070804"
FT                   /locus_tag="THA_14"
FT   CDS_pept        complement(15785..16606)
FT                   /locus_tag="THA_14"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase, catalytic region"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076147"
FT                   /db_xref="GeneID:7070804"
FT                   /translation="MVKEGFSISEAVRYLKISRSTYYYKPKEYKRKKNNESILKLIQKL
FT                   KQKHPYWGYRRIYAMLRKQGKKINHKKVYRIMKENGLLLKQKKKKARRVFQSKIIPSRP
FT                   RQVLGIDMTKVLTKDGGWVNYIAVIDWYTREVLGSQISLRGRTEEWLKALNNALNKGYK
FT                   DGVRGREVILVSDNGTQPTSRRFMEECKILGIKQIFTSYNNPKGNANTERYFRTYKEEV
FT                   VWPVEEMSYSELVARTKEYEEFYNSKYPHSALKYRSPREVYEEYLSFTKVS"
FT                   /protein_id="YP_002333863.1"
FT   misc_feature    complement(15941..16309)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="THA_14"
FT   gene            complement(16615..16905)
FT                   /db_xref="GeneID:8187316"
FT                   /locus_tag="THA_2002"
FT   CDS_pept        complement(16615..16905)
FT                   /locus_tag="THA_2002"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase repeat family ISCc3"
FT                   /transl_table="11"
FT                   /db_xref="GI:254555127"
FT                   /db_xref="GeneID:8187316"
FT                   /translation="MRKKFSAEEKMAIVLEGLRGKKTIAEICRKHSISQGQYYKWRDKF
FT                   LEGAKTALETSGNSSQAAQYQRKIQELEQIIGKQAIVIETLKKTIIHPGGK"
FT                   /protein_id="YP_003071386.1"
FT   misc_feature    complement(<16762..16902)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="THA_2002"
FT   gene            complement(16947..17333)
FT                   /db_xref="GeneID:7070805"
FT                   /locus_tag="THA_15"
FT   CDS_pept        complement(16947..17333)
FT                   /locus_tag="THA_15"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076148"
FT                   /db_xref="GeneID:7070805"
FT                   /translation="MKKIIFILFVIIATTFFSIQFEIKLPIFDKNNGVYQIYTFEHQNK
FT                   LEVTVVFWDEDHPNSLIDFIYDIYRFFKWGRFYDIETFFILDDKVIFEDDYCNSQSYFQ
FT                   TEKLHNYKELSTNTLYCSPEGLDS"
FT                   /protein_id="YP_002333864.1"
FT   gene            complement(17403..17576)
FT                   /db_xref="GeneID:7070806"
FT                   /locus_tag="THA_16"
FT   CDS_pept        complement(17403..17576)
FT                   /locus_tag="THA_16"
FT                   /gene_family="HOG000080426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076149"
FT                   /db_xref="GeneID:7070806"
FT                   /translation="MKRGEIVGATTLLGLGIGFFTKSSSHFVGSLLIGIGVGLLIDYIT
FT                   FVVSERKKKSSS"
FT                   /protein_id="YP_002333865.1"
FT   gene            17888..18442
FT                   /db_xref="GeneID:7070807"
FT                   /locus_tag="THA_17"
FT   CDS_pept        17888..18442
FT                   /locus_tag="THA_17"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076150"
FT                   /db_xref="GeneID:7070807"
FT                   /translation="MFKKFSVILLSLLVLSASIFAYGPWSNSNQPNNVPQNSSIPLFQN
FT                   LPKDAKISDITFSGVIKKINLVPGQGSEILIDADGEEYKVHSGPIWLFKDYLETGKTIE
FT                   VSGKLVTLQDETFVVLEKAVIDGNEFVVRENGFPTYAKRGNNQRGNVSERNNVGRPTQN
FT                   GRSKRGNQRQGGYENRPCRQR"
FT                   /protein_id="YP_002333866.1"
FT   gene            complement(18518..19381)
FT                   /db_xref="GeneID:7070808"
FT                   /locus_tag="THA_18"
FT   CDS_pept        complement(18518..19381)
FT                   /locus_tag="THA_18"
FT                   /gene_family="HOG000292403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UAA transporter family"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076151"
FT                   /db_xref="GeneID:7070808"
FT                   /translation="MHYITAIMSAFSSSVTSIFGKLSLNVGASALQILFLRFFFSLIIS
FT                   GLFFVLLKKKINIKYLLFFGIFGIVNYGIAAYLFFYGLRFLNPAYATVLFFSNPIFVLI
FT                   FQKLIYKGNFSVFNLFAVVLSFTGIILSNLAEKSIGGSENLVFGSLLVILAAIFNALFI
FT                   TLVGDKIKKLQLSPFESSFYTFLGVTILYFIISIANKELYTIKPDYYIYGLLLAVFSTL
FT                   IPLTLNYFSLRKINSTTLSLIMPLEIVFASILSFIFFDEMFNILKVLGFSFVVVAPILE
FT                   RVKIKK"
FT                   /protein_id="YP_002333867.1"
FT   misc_feature    complement(18521..>19153)
FT                   /note="Threonine/homoserine efflux transporter [Amino acid
FT                   transport and metabolism]; Region: rhtA; COG5006"
FT                   /db_xref="CDD:34611"
FT                   /locus_tag="THA_18"
FT   gene            19539..20468
FT                   /db_xref="GeneID:7070809"
FT                   /locus_tag="THA_19"
FT   CDS_pept        19539..20468
FT                   /locus_tag="THA_19"
FT                   /gene_family="HOG000279635" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076152"
FT                   /db_xref="GeneID:7070809"
FT                   /translation="MIYEYDKTIPFNLEIEKYENYSLLKFDTVYEPDIPESKKIYVYKY
FT                   NSENPLGRLIFLHGIGNGHIPYLMWFAEKFSKMGLETYFLIHPYHQKRAKTDWEGGEPF
FT                   YHHSPAHCVVRFHQAVKDVRRTIDLIEEIENKLPIGIMGFSFGGMIATISMALDKRIKA
FT                   GVLSFTGGDWRWINWYSPYLEPVREGYKKYSNEWGCKDETKCVKLREESFNKLNELKNI
FT                   NEIFSLKPGCFHYDPISYAKFVDQPVLFFKGMFDKIMPKNASNNLYNKLQHARKVTIPS
FT                   GHKSSYFFRRVIARKSLHFFKNTLNKKL"
FT                   /protein_id="YP_002333868.1"
FT   gene            complement(20463..21200)
FT                   /db_xref="GeneID:7070810"
FT                   /locus_tag="THA_20"
FT   CDS_pept        complement(20463..21200)
FT                   /locus_tag="THA_20"
FT                   /gene_family="HOG000114880" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076153"
FT                   /db_xref="GeneID:7070810"
FT                   /translation="MAILLYLFLFFAGISAGFINVLAGGGSMLTLPVLTLLGLDISVAN
FT                   GTNRVGILLQNIIATKNFKKHRLFTLKEGFSIALPATIGAIFGTFTVLNLNKELLEKII
FT                   GTIFLFMSFFILYKPKLWEEGKKVKRNYLITFIVFFAIGFYGGFIQAGVGFFLILGLVL
FT                   VEGNNIIKTNALKVFVVLNYTVFSFLIFLLNGKVDILKGLVLAAGTMIGANLGTKTALK
FT                   TGAKFVRIFVFLMIVISAIKYIL"
FT                   /protein_id="YP_002333869.1"
FT   misc_feature    complement(20469..21191)
FT                   /note="Predicted permeases [General function prediction
FT                   only]; Region: COG0730; cl00498"
FT                   /db_xref="CDD:176927"
FT                   /locus_tag="THA_20"
FT   misc_feature    complement(20472..21176)
FT                   /note="Sulfite exporter TauE/SafE; Region: TauE; pfam01925"
FT                   /db_xref="CDD:145216"
FT                   /locus_tag="THA_20"
FT   gene            complement(21392..21847)
FT                   /db_xref="GeneID:7070811"
FT                   /locus_tag="THA_21"
FT   CDS_pept        complement(21392..21847)
FT                   /locus_tag="THA_21"
FT                   /gene_family="HOG000292399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076154"
FT                   /db_xref="GeneID:7070811"
FT                   /translation="MVVKSRFVIVPMPVMQFVMKARPANAGRAYLYLYSMSIAVGKKVT
FT                   PWISYRDLADYFGVKYGTIELSMRLLQRLNAIVPIARKNKKGYGQKYIVNVPEYVNGEF
FT                   IFVDLEESSIFDDLVLDENSKTFVSVIKRFKSRKEKAMKDQLKLFDD"
FT                   /protein_id="YP_002333870.1"
FT   gene            complement(21908..23617)
FT                   /db_xref="GeneID:7070812"
FT                   /locus_tag="THA_22"
FT   CDS_pept        complement(21908..23617)
FT                   /locus_tag="THA_22"
FT                   /gene_family="HOG000279142" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="penicillin-binding protein 2"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076155"
FT                   /db_xref="GeneID:7070812"
FT                   /translation="MYFIFVILIFIEIVKLFEVNKIEENTIVYEKIPSLRGKIYGCNNQ
FT                   LLATSLPFYVAYFDVDFFKRLYNPSYDLDIKLLESRFNVKIDFNKRFVKLGESFDINVL
FT                   KQKIPVELRKFVNISINEKRLRLENFGLEQIIGIVRDGNGVNGVEKSFNEKLSKKQDGE
FT                   INLKVSGGVTKEASIIQYIPPINGESIVLSIDTNIQKILYEIAFDSKINYHAENVGIIL
FT                   METKTGKIRALVTTNNWPDYFMGYIEPGSAMKPMFYSAALDLGVITEDSTFVCKGYIYP
FT                   DSDLDIKISDIHPHGLLDLKEAISESCNVAAVSTSKKIIEEYNYETLYNIFKTFGFGEQ
FT                   TGIELPNEIEGVLNSPDKWSKIEWAYLPIGYSIGVTPLQLITAFNSIFNDGILIKPTLI
FT                   ENGIPKKYRVMSTNTANKMKNFLKEVVENGTGIFAKIPGMDIYGKTGTSEIPGKEGSYI
FT                   MTFEGNFSLNNIDYTALVWVTNPEGYSLSSYVAAPIFKQVVLKLKKYYSKDNRMIYVTP
FT                   GLVPNIVGWNIRQVFALEKYFKIKIVGKGLYVKKQFPEPGSFNEEIVVYLGE"
FT                   /protein_id="YP_002333871.1"
FT   misc_feature    complement(22100..23563)
FT                   /note="Cell division protein FtsI/penicillin-binding
FT                   protein 2 [Cell envelope biogenesis, outer membrane];
FT                   Region: FtsI; COG0768"
FT                   /db_xref="CDD:31111"
FT                   /locus_tag="THA_22"
FT   misc_feature    complement(23111..23524)
FT                   /note="Penicillin-binding Protein dimerization domain;
FT                   Region: PBP_dimer; pfam03717"
FT                   /db_xref="CDD:146381"
FT                   /locus_tag="THA_22"
FT   misc_feature    complement(22124..22963)
FT                   /note="Penicillin binding protein transpeptidase domain;
FT                   Region: Transpeptidase; cl01039"
FT                   /db_xref="CDD:154162"
FT                   /locus_tag="THA_22"
FT   misc_feature    complement(21914..22060)
FT                   /note="PASTA domain. This domain is found at the C-termini
FT                   of several Penicillin-binding proteins (PBPs) and bacterial
FT                   serine/threonine kinases. It is a small globular fold
FT                   consisting of 3 beta-sheets and an alpha-helix. The name
FT                   PASTA is derived from PBP and...; Region: PASTA; cl02768"
FT                   /db_xref="CDD:141692"
FT                   /locus_tag="THA_22"
FT   gene            complement(23646..23918)
FT                   /db_xref="GeneID:7070813"
FT                   /locus_tag="THA_23"
FT   CDS_pept        complement(23646..23918)
FT                   /locus_tag="THA_23"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:217076156"
FT                   /db_xref="GeneID:7070813"
FT                   /translation="MAISVQAKRSRVEKLSKLSVLELLKKFFLVAIPALLIFTMVYVVV
FT                   HFSTLNVEIQTQKEAYQRELVELNTKLINLNKSIESLTIGLENIR"
FT                   /protein_id="YP_002333872.1"
FT   gene            complement(23933..24808)
FT                   /db_xref="GeneID:7070814"
FT                   /locus_tag="THA_24"