(data stored in ACNUC8465 zone)

HOGENOMDNA: THEBD_1

ID   THEBD_1; SV 1; empty ; DNA; empty ; PRO; 4189976 BP.
XX
AC   NC_014165;
XX
PR   Project:48999;
XX
DE   Thermobispora bispora DSM 43833 chromosome, complete genome.
XX
OS   Thermobispora bispora DSM 43833
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Pseudonocardineae; Pseudonocardiaceae; Thermobispora.
XX
RN   [1]
RP   1-4189976
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Mikhailova,N., Chertkov,O., Brettin,T., Detter,J.C., Han,C., Larimer,F.,
RA   Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
RA   Wu,D., Jando,M., Schneider,S., Klenk,H.-P. and Eisen,J.A.;
RT   "The complete genome of Thermobispora bispora DSM 43833";
RL   Unpublished
XX
RN   [2]
RP   1-4189976
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (17-MAY-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4189976
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Mikhailova,N., Chertkov,O., Brettin,T., Detter,J.C., Han,C., Larimer,F.,
RA   Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
RA   Wu,D., Jando,M., Schneider,S., Klenk,H.-P. and Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (15-JAN-2010) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082801
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4189976
FT                   /note="type strain of Thermobispora bispora"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:469371"
FT                   /isolation_source="decaying manure"
FT                   /strain="DSM 43833"
FT                   /organism="Thermobispora bispora DSM 43833"
FT   gene            270..1853
FT                   /db_xref="GeneID:9170132"
FT                   /locus_tag="Tbis_0001"
FT   CDS_pept        270..1853
FT                   /locus_tag="Tbis_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="GI:296267999"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:9170132"
FT                   /translation="MEGVDLDAVWARALRTLLDEGVSGQQRAFLQMTQPSGLINDTILL
FT                   AAPNDFAKEVIEVRLRPLIAHALAQELGRPVRIAVMVDPSAVPDAGVDRPDRQPMTQPG
FT                   QTGYPQHRPQTQPGFSTGLTTGSPGLATGGESAARHEAGPYSSSVPRPGGLAGEPRPEP
FT                   RPEPAHQRWDSRPSRSSSEPARLNAKYTFETFVIGASNRFAHAAAVAVAEAPAKAYNPL
FT                   FIYGDSGLGKTHLLHAIGHYAQSLYDGARVRYVSSEEFTNEFINSIRDHKADEFRARYR
FT                   AVDILLVDDIQFLEGKEQTQEEFFHTFNTLHNASKQIVISSDRAPKQLVTLEDRLRNRF
FT                   EWGLITDVQPPELETRIAILRKKAVQEGLAAPPEVLEYIASRISTNIRELEGALIRVTA
FT                   FASLNRQPVDIELAEMVLKDLISEESSPEITISLIMSTTAEYFGVSIDDLCGSSRSRAL
FT                   VTARQIAMYLARELTDLSLPKIGQQFGGRDHTTVMHAERKIRSLMAERRSMYNQVNELT
FT                   TRIKQRARNG"
FT                   /protein_id="YP_003650631.1"
FT   gene            2390..3526
FT                   /db_xref="GeneID:9166471"
FT                   /locus_tag="Tbis_0002"
FT   CDS_pept        2390..3526
FT                   /locus_tag="Tbis_0002"
FT                   /gene_family="HOG000071793" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: bsu:BSU00020 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:296268000"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:9166471"
FT                   /translation="MLFRIDRDQLAEAVAWTARSLPTRPSMPVLAGMRLEVTDDHRLKL
FT                   SGFDYEVSAEVTLDLETGEPGVVLVSGRLLAEITRALPAQPVNFTLDGAKAVVTCGSTR
FT                   FTLLTMPVEDYPSLPVMPPAAGRVGSDVFASAVAQVAVAVGKDDTLPMLTGVRMEIEGD
FT                   LITLAATDRYRLAVRELKWEPAQPGLQAVAMIPGRTLADIAKALGGTGAEVEIALSSGG
FT                   TGEGMIGFSSAGRRTTTRLLDPEFPKYRSLLPTEFSARADVATSAFVEAVKRVALVAER
FT                   NTPVRLTFRGGEVVLEAGSGDEAQAVEVLPVDFEGDEITIAFNHQYLLDGLAVLDSDVA
FT                   RMQFTTPTKPAIITAGKPAGEEAASDYRYLIMPIRLSS"
FT                   /product="DNA polymerase III subunit beta"
FT                   /protein_id="YP_003650632.1"
FT   gene            3637..4581
FT                   /db_xref="GeneID:9166472"
FT                   /locus_tag="Tbis_0003"
FT   CDS_pept        3637..4581
FT                   /locus_tag="Tbis_0003"
FT                   /gene_family="HOG000255146" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.44"
FT                   /transl_table="11"
FT                   /note="KEGG: dde:Dde_3470 6-phosphogluconate dehydrogenase-
FT                   like protein; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein"
FT                   /db_xref="GI:296268001"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="GeneID:9166472"
FT                   /translation="MQIGMVGLGKMGGNMAERLRRGGHEVVGYDRNPAISDVGSLRELV
FT                   DRLQAPRTVWVMVPAGDPTRTTIERLGELLSAGDLVVDGGNSHYRDDQVHADRLGARGI
FT                   GFVDVGVSGGVWGLREGYALMAGGAPEHIERLMPIFTTLKPPGEDGFVHAGKVGAGHFV
FT                   KMVHNGIEYGMMQSLAEGWELLEASDLVTDVLATFRSWRSGTVIRSWLLELLVRALEED
FT                   PHLSELKGYAEDSGEGRWTVQAAVEHAVPLPAITAALYARFTSRQADSPAMKMIAALRN
FT                   QFGGHPVASAEGQTGKGADSPGADVIPPAEAER"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /protein_id="YP_003650633.1"
FT   gene            4719..5924
FT                   /db_xref="GeneID:9166473"
FT                   /locus_tag="Tbis_0004"
FT   CDS_pept        4719..5924
FT                   /locus_tag="Tbis_0004"
FT                   /gene_family="HOG000269561" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: afw:Anae109_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="GI:296268002"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:9166473"
FT                   /translation="MYVASLSLTDFRSYAGVELELEPGVSAFIGANGQGKTNLVEALGY
FT                   VATHTSHRVATDAPLVRHGAQRAIVRAAVVRDGRRALIELEINPGRANRARVNRALMPR
FT                   PRDALGLLRTVLFAPEDIALVKGDPAERRRYLDELLIARAPRFAGVRADYERVLRQRNA
FT                   LLRSAAAARSGRRGARRAEDEAAFAAIGAGDVLATLDVWDAHLVRHGAELTAARMELVD
FT                   ALRSLTAKAYAALAPSSGAVDLEYRSAAVDAAAAAPSTGGPGGGDRREAVAEWLRAALA
FT                   QARQAELERGVTLVGPHRDDLLLTLKGMPARGYASHGEAWSFALALRLAAYELLRADGG
FT                   DPVLILDDVFAELDHDRRRRLAEIVAPAEQVLITAAVPDDVPDELSGARFDVTGGCVTR
FT                   VR"
FT                   /protein_id="YP_003650634.1"
FT   gene            5914..6465
FT                   /db_xref="GeneID:9166474"
FT                   /locus_tag="Tbis_0005"
FT   CDS_pept        5914..6465
FT                   /locus_tag="Tbis_0005"
FT                   /gene_family="HOG000235671" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   gsu:GSU0638 hypothetical protein"
FT                   /db_xref="GI:296268003"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="GeneID:9166474"
FT                   /translation="MSDETPEVPRSIGEGRQSPAAAAARGAALARAKLAEAKADAARRG
FT                   RLPRTEPRRDGGARPQPRGSGDPQPFARAIRELLAARGWERQAAIGGVFGRWAEIVGPE
FT                   LAAHTRPVSFADGELVVATDSTAWATQVRLLAGTLVRRLNEELGDGTVARVKVHGPGTG
FT                   PRPAGPLRVRGGRGPRDTYG"
FT                   /protein_id="YP_003650635.1"
FT   gene            6961..8904
FT                   /db_xref="GeneID:9166475"
FT                   /locus_tag="Tbis_0006"
FT   CDS_pept        6961..8904
FT                   /locus_tag="Tbis_0006"
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: bsu:BSU00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:296268004"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="GeneID:9166475"
FT                   /translation="MSYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEIVDNAV
FT                   DEALAGHNDRIDVTLLADGGVRVADRGRGIPVGIVPSEGRPAVEVVFTVLHAGGKFDRK
FT                   SYAVSGGLHGVGASVVNALSKRLEVEVRTDGHVWRQSYVQAKPTGPLQKGEPTDDHGTT
FT                   VTFWPDETIFETTTWNFETLSRRFQEMAFLNKGLTITLTDERPEYINGEPKVVTYHYEG
FT                   GLADFVTYLNSKKEPIHGSVIYFEEHGDGISVEVAMQWNASYTESVYTFANTINTAEGG
FT                   THEEGFRAALTSVVNRYAREQRYLKEGKDDNLTGDDVREGLAAIISVKLANPQFEGQTK
FT                   TKLGNTEAKSFVQKACNDHLRDWFERNPGEAKEIINKAIQASRARIAARQARDLTRRKS
FT                   LLESGSGLPGKLADCQWSDPEKCELFIVEGDSAGGSAKGGRDPRFQAILPIRGKILNVE
FT                   KARIDKVLRNNEIQALITALGTGVHDDFDISKLRYHKLILMADADVDGQHITTLLLTLL
FT                   FRFMRPLIEAGHVYLAQPPLYKIKWDRKGEDASYAYSDRERDAIIEAGIAQGKRDPRLH
FT                   DGVQRFKGLGEMNASQLWETTMNPETRILRQVTLDDAAQADELFSVLMGEDVEARRQFI
FT                   IRNARDVRFLDV"
FT                   /product="DNA gyrase subunit B"
FT                   /protein_id="YP_003650636.1"
FT   gene            8933..11437
FT                   /db_xref="GeneID:9166476"
FT                   /locus_tag="Tbis_0007"
FT   CDS_pept        8933..11437
FT                   /locus_tag="Tbis_0007"
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: bsu:BSU00070 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="GI:296268005"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:9166476"
FT                   /translation="MTEVNTPPGPPADRIEVIDLQAEMQRSYMDYAMSVIVSRALPDVR
FT                   DGLKPVHRRVLYAMFEGGYRPDRGYFKSSRIVGDVMGSYHPHGDASIYDTVVRLAQPWS
FT                   LRYPLVDGQGNFGSPGNDPAAAMRYTESRMAPIAMEMLRDIDKDTVDFQPNYDGRSREP
FT                   VVLPSRFPNLLVNGSSGIAVGMATNIPPHNLRETGEAVQWALEHPELSDEELLEGLIER
FT                   IKGPDFPTGALIVGRRGIEEAYRTGRGSIIMRAVVELEEDAKGRQCLVVTELPYMVNPD
FT                   NLALTIAELVREGKISGIADVRDESSSRTGQRLVIVLKRDAVPKVVLNNLYKHTQLQTT
FT                   FGANMIALVDGVPRTLRLDQFVRHYIRHQIDVVVRRTRFLLRKAEERAHILRGLLKALE
FT                   RIDEVIELIRRSPSATEAQTGLMALLEIDEVQAQAILDMQLRKLAALERQQIQDEYDGL
FT                   MAQIADYNDILGSEMRQRRLVSEELGEIIAKYGDERRTKITAYEGDMSEEDLIAEEDVV
FT                   VTITRGGYAKRTSIDAYRAQRRGGKGVRGAQLRQDDIVEHFFVTSTHHWLLAFTNKGRV
FT                   YRFKAYELPEAARDARGQHLANLLAMQPDEHVMEILSLRNYDEAPYLVLATRSGMVKKT
FT                   RLAEYDSPRSGGLIAINLRDDDEVIAARLVSEEDDLLLVSKNAQAIRFKATDEVLRPMG
FT                   RATAGVIGMRFAEGDELLAMEVIRDGDEEVLVATEGGYAKRTPADQYPVQGRGGKGVLT
FT                   AKIVQSRGKLIGAIMVRPEDEVFAITSNGGVIRTRAAEIKRSGRQTMGVRLMHLSEGDS
FT                   LVALARNAESLNNEENGAGDGV"
FT                   /product="DNA gyrase subunit A"
FT                   /protein_id="YP_003650637.1"
FT   gene            11529..12353
FT                   /db_xref="GeneID:9166477"
FT                   /locus_tag="Tbis_0008"
FT   CDS_pept        11529..12353
FT                   /locus_tag="Tbis_0008"
FT                   /gene_family="HOG000235682" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: CG32656"
FT                   /db_xref="GI:296268006"
FT                   /db_xref="GeneID:9166477"
FT                   /translation="MSETGKPRTPGAPVEGAARPASSSKQDAVSEAKGVTGATSASAKA
FT                   APADKATETVRVRPPAADRKWQGEPARNGGEPADGASGTESTAVYPRPSFDRPVASGGS
FT                   PTPGAPPAGPAPARSGADGAAQQGQRPAAFGAAESQAAGQKSNRTPRRAHLVVRRIEPW
FT                   SAMKFSFIISLVAFVVLFVAVAVLYGVLSSLGVFSTIIDTVTQLTGSGENGQQPVFDIA
FT                   SWFDPVRILGYTALVGAVNVVLITALSTIGAVIYNLSAELVGGIEVTLTESE"
FT                   /protein_id="YP_003650638.1"
FT   gene            12504..12577
FT                   /note="tRNA-Ile1"
FT                   /db_xref="GeneID:9166478"
FT                   /locus_tag="Tbis_R0001"
FT   tRNA            12504..12577
FT                   /db_xref="GeneID:9166478"
FT                   /locus_tag="Tbis_R0001"
FT                   /product="tRNA-Ile"
FT   gene            complement(12943..13275)
FT                   /db_xref="GeneID:9166479"
FT                   /locus_tag="Tbis_0009"
FT   CDS_pept        complement(12943..13275)
FT                   /locus_tag="Tbis_0009"
FT                   /gene_family="HOG000223633" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02694"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   bsu:BSU08120 hypothetical protein"
FT                   /db_xref="GI:296268007"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="GeneID:9166479"
FT                   /translation="MTIARSILLFVLAALAEIGGAWLVWQGVREQRGLWWAGAGFLVLG
FT                   LYGLVATFQPDPHFGRILAAYGGVFVAGSLIWGMVVDGFRPDRWDLIGAAICLLGVGVI
FT                   MYAPRG"
FT                   /protein_id="YP_003650639.1"
FT   gene            complement(13508..14350)
FT                   /db_xref="GeneID:9166480"
FT                   /locus_tag="Tbis_0010"
FT   CDS_pept        complement(13508..14350)
FT                   /locus_tag="Tbis_0010"
FT                   /gene_family="HOG000024514" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce7051"
FT                   /codon_start="1"
FT                   /product="putative periplasmic substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce7051 putative periplasmic substrate-
FT                   binding protein"
FT                   /db_xref="GI:296268008"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="GeneID:9166480"
FT                   /translation="MSTRPAGGRPGLPCSGYGDRVEYDDLGLPVPVPDTVRRVVSLVPS
FT                   LTEAVAATDESLLAGATNWCTHPPGLDVPRVRGTKNPDLELIRSLRPDIVLANFEENRE
FT                   PDLAALRESGIPVWTTVIRTVDEALRSLDRMLTVACRLPRPAWLDRAAEAWRAPAPAFA
FT                   PARRAAIVVWRRPWMVVGRDTFTGDVLARLGVTNVFSGHPERYPKMPLDRIRETEPDLV
FT                   VLPDEPYRFTEDDGPECFPGIPAALVSGRHLSWYGPSLIEAPGLLTGQLRDAKARSAG"
FT                   /protein_id="YP_003650640.1"
FT   gene            14699..15592
FT                   /db_xref="GeneID:9166481"
FT                   /locus_tag="Tbis_0011"
FT   CDS_pept        14699..15592
FT                   /locus_tag="Tbis_0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268009"
FT                   /db_xref="GeneID:9166481"
FT                   /translation="MGALDAGRSSNFSMTVSVSGPVTEGGRLPLAELARIASGLQMTLE
FT                   RLALASTGTSIKPGRRPRDVVDAVRLDFTGFHEGSAVLEVSRPQEEAMNDLLRESLRML
FT                   GEGIEFLRQGHPLPAYLTPPVLNGLRELAGGISPHGVSRIQFQHPGGGFVIDSVFREAL
FT                   RRTPAQATEREVTVVGRLHMGDFSPATLRCRIDTYAGSILADFGSDLRDVILDAMDQLV
FT                   MASGRAELQPDGVTVRVMHLETVKRLTGAPITPLDRLAQEQGVRPIGNVDELRGDPIDD
FT                   LEEFLEVITAARRGEE"
FT                   /protein_id="YP_003650641.1"
FT   gene            15589..15990
FT                   /db_xref="GeneID:9166482"
FT                   /locus_tag="Tbis_0012"
FT   CDS_pept        15589..15990
FT                   /locus_tag="Tbis_0012"
FT                   /gene_family="HOG000121274" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /codon_start="1"
FT                   /product="PilT protein domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   gur:Gura_1138 PilT domain-containing protein"
FT                   /db_xref="GI:296268010"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="GeneID:9166482"
FT                   /translation="MRYVFVDTDVFSYLWQGVNVERYRRHLEGVIPALSFASVGELYYG
FT                   AAKKGWGAKKLQSLEEAIRRYLIAPYHEDIARLWGTLRARAAAQGHALGAPQQANDLWV
FT                   CATAIYYDAPLLTGNHRHFANFPGLSLLV"
FT                   /protein_id="YP_003650642.1"
FT   gene            complement(16061..18298)
FT                   /db_xref="GeneID:9166483"
FT                   /locus_tag="Tbis_0013"
FT   CDS_pept        complement(16061..18298)
FT                   /locus_tag="Tbis_0013"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /codon_start="1"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: bcb:BCB4264_A3829
FT                   copper-translocating P-type ATPase"
FT                   /db_xref="GI:296268011"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001756"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:9166483"
FT                   /translation="MASLTHRDPRATGATVELSITGMTCASCANRIERKLNKLDGVIAT
FT                   VNYATEKATVTIPEGFDPELLVAEVEKAGYGARLSSAERPSDEDADGLAALRARLITSV
FT                   VLAVPVIAMAMVPALQFPYWQWVSLALTLPVVLYGGWPFHKAALANLRHRATTMDTLIS
FT                   IGTIAALGWSLWALFFGTAGEPGMTHGFEFTVSRDGGTGDIYLEVAAGVTAFVLAGRYF
FT                   ELRSRRRTGAALRALLDLGAKDVAVLRNGREVRLPVAHLKVGDRFVVRPGEKIATDGVV
FT                   EEGASAVDVSMLTGESVPVEVRPGDPVTGATVNTSGRLVVRATRVGADTQLAQMAKLVE
FT                   EAQSRKAEVQRLADRISGVFVPIVIVLALGTLGFWLATGAGATAAFTAAVAVLIIACPC
FT                   ALGLATPTALLVGTGRGAQLGILIRGPEVLESTRRIDTIVLDKTGTVTEGRMRLTGLTT
FT                   AEGTTEEEALRLAGALEHASEHPIAQAIARAAAERLGELPTPEAFSNVEGLGVHGVVDG
FT                   RAVTVGRAAFLTERGHHLPGGLAEALRAAEAAGRTAVLAGWDGEVRAVFTVADTVKPTS
FT                   AEAVARLRELGLTPVLLTGDGEAVAKAVAAEIGVDEVIAEVLPADKVDVIKRLQAEGRT
FT                   VAMVGDGVNDAPALAQADLGLAMGSGTDVAIEAADLILVRGDLRAAADAIRLSRRTLRT
FT                   IKGNLFWAFAYNVAALPLAAAGMLNPMIAGAAMAFSSFFVVSNSLRLRRFR"
FT                   /protein_id="YP_003650643.1"
FT   gene            complement(18495..18722)
FT                   /db_xref="GeneID:9166484"
FT                   /locus_tag="Tbis_0014"
FT   CDS_pept        complement(18495..18722)
FT                   /locus_tag="Tbis_0014"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00003"
FT                   /codon_start="1"
FT                   /product="copper ion binding protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: copper ion binding protein; PFAM: Heavy
FT                   metal transport/detoxification protein; KEGG:
FT                   bpy:Bphyt_6893 heavy metal translocating P- type ATPase"
FT                   /db_xref="GI:296268012"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="GeneID:9166484"
FT                   /translation="MTATYTIKGMTCGHCVSSVKEEVGAIPGVTRVDVDLETGRMRVES
FT                   DAPIDPAAIVAAVEEAGYQVVTEPASGTGE"
FT                   /protein_id="YP_003650644.1"
FT   gene            complement(19035..20330)
FT                   /db_xref="GeneID:9166485"
FT                   /locus_tag="Tbis_0015"
FT   CDS_pept        complement(19035..20330)
FT                   /locus_tag="Tbis_0015"
FT                   /gene_family="HOG000014142" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /codon_start="1"
FT                   /product="citrate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Citrate transporter; Arsenical pump membrane
FT                   protein; KEGG: bcy:Bcer98_2196 citrate transporter"
FT                   /db_xref="GI:296268013"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="GeneID:9166485"
FT                   /translation="MTITAWLATFVFLAVYVLIATEKIHRVKAALLGAGILLLIHGTDA
FT                   ESAFFSERSGVDWNVIFLLLGMMVIVGVLRRTGVFEYLAIWAAKRAQGRPFRLMVLLTV
FT                   ITASASALLDNVTTVLLVAPVTFLVCERLALPVAPYLIAEALASNIGGTATLVGDPPNI
FT                   IIASRAGLTFNDFLVHLAPLVVLLMVAFLGLCRLLFRKAFTYDPERAAEIMQLDEKAAI
FT                   RDHVLLKQSLGVLSVVMAAFVLHPVLHYEPSVVALLGAGLLMLITKVKVEDVVRDVEWP
FT                   TLVFFIGLFVMVGALVNTGVIGTVSEAAASAGAGRPFLTSMVLLWGSAGLSAIVDNIPY
FT                   VAAMSPIVEHLVQQMPEGGTNGHVLWWALALGADLGGNATAIGASANVVILGLAERNKS
FT                   PISFWQFTRYGAVVAFATIAISMPYLWLRYLV"
FT                   /protein_id="YP_003650645.1"
FT   gene            complement(20327..20770)
FT                   /db_xref="GeneID:9166486"
FT                   /locus_tag="Tbis_0016"
FT   CDS_pept        complement(20327..20770)
FT                   /locus_tag="Tbis_0016"
FT                   /gene_family="HOG000050315" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /codon_start="1"
FT                   /product="CBS domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mno:Mnod_6174 CBS domain containing membrane protein"
FT                   /db_xref="GI:296268014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:9166486"
FT                   /translation="MRARDLMVPSPAVSLDSPVIDAANLMIESKLPGLIVLDERGTPYS
FT                   ILSGTQVLRLAIPQYCQEDPALARVIDEAHADRFAEALSRRTVRQVLPDRPSELPIADP
FT                   DATLLELAALMARTRCPLVAIVEKGRLLGAVALHPLMNRLFSA"
FT                   /protein_id="YP_003650646.1"
FT   gene            21240..21773
FT                   /db_xref="GeneID:9166487"
FT                   /locus_tag="Tbis_0017"
FT   CDS_pept        21240..21773
FT                   /locus_tag="Tbis_0017"
FT                   /gene_family="HOG000108712" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06571"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   scl:sce8498 hypothetical protein"
FT                   /db_xref="GI:296268015"
FT                   /db_xref="InterPro:IPR010556"
FT                   /db_xref="GeneID:9166487"
FT                   /translation="MFTVGHGARRIDEFLAVLREAGVTTLADVRRFPGSRRHPHFGREA
FT                   LAAALAEAGIRYEWHGKALGGRRSRRPRSRHTALRHAAFAGYADHMDTPEFRTAVQELA
FT                   ERARDERIAVMCAETVWWHCHRMLIADALAMRGVSVVHLLAVGRREPYRPHPAVRRGDD
FT                   GWPVYDVPDTLPGL"
FT                   /protein_id="YP_003650647.1"
FT   gene            complement(21805..22563)
FT                   /db_xref="GeneID:9166488"
FT                   /locus_tag="Tbis_0018"
FT   CDS_pept        complement(21805..22563)
FT                   /locus_tag="Tbis_0018"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pde:Pden_0297 ABC transporter related"
FT                   /db_xref="GI:296268016"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9166488"
FT                   /translation="MIEITNVTKRYGEHVVVDRVSLTIPRGGVTSIIGANGAGKSTLLS
FT                   IISRLIPADEGTVTVDGMDVATTPTERLARRLAILRQDNHMPVRLTVRELVAFGRFPHT
FT                   QGRLTAEDHRLVDEAMRYFELTDLADRHLDQLSGGQRQRAFVAMVLCQDTDYVLLDEPL
FT                   NNLDMRHSVHMMRRLRRMADDYGKTVVIVVHDINFASCHSDTIVAMKNGKVIAQGPTAE
FT                   MMTPEILAEVYDLGIDVHELSGHRIGVYFA"
FT                   /protein_id="YP_003650648.1"
FT   gene            complement(22560..23594)
FT                   /db_xref="GeneID:9166489"
FT                   /locus_tag="Tbis_0019"
FT   CDS_pept        complement(22560..23594)
FT                   /locus_tag="Tbis_0019"
FT                   /gene_family="HOG000099129" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /codon_start="1"
FT                   /product="transport system permease protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4491 ferrichrome ABC transporter (permease)
FT                   homolog"
FT                   /db_xref="GI:296268017"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="GeneID:9166489"
FT                   /translation="MTTTAESTVAPTRTGAAARSTGEAFAAARRRERRTIAVLALLALG
FT                   AVAAFAFAGIAGNWEFALAIRSRKIATMAVVGVAIAWSSVLFQTVTGNRILTPSIMGFD
FT                   QLFVLIQTVLVFLFGALALASADPRLLFSGQVVAMVGFAVLLYRWLFGRRGRDLYVMVL
FT                   AGVIFGTLFGSLSSLAARLINPNDFVVLQDSLFASVNQVDPGLLGFSALLIGAMAIWAI
FT                   RLCRRLDVVALGRDHAVSLGVDHAAVVNRALVIVAVLVSVATALVGPITFLGLLVANLA
FT                   RQLTGTFRHGALLPAAALIAVITLVGGQLILERVFTMDTALTVIVNFIGGIYFIVLLIR
FT                   ESRR"
FT                   /protein_id="YP_003650649.1"
FT   gene            complement(23591..24586)
FT                   /db_xref="GeneID:9166490"
FT                   /locus_tag="Tbis_0020"
FT   CDS_pept        complement(23591..24586)
FT                   /locus_tag="Tbis_0020"
FT                   /gene_family="HOG000045408" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /codon_start="1"
FT                   /product="transport system permease protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bmc:BAbS19_II05310 FecCD transport family"
FT                   /db_xref="GI:296268018"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="GeneID:9166490"
FT                   /translation="MRKPSSAGRLRAWHLAAGVVLLAALAAASLFIGVGDMTPAGLLHA
FT                   REEDVRLLVESRLPRLLAVLLAGTAMSVAGLVMMHITGNRFVSPSTAGTTESATLGVLV
FT                   ATLFAGGEAVIVKMALAVACALAGTFVFMTLLRRLTFRDMILVPLAGIMFGGVIGAATT
FT                   FVAYRYDLLQTLGAWTSGDFSAVLRGRYELLWIAGTVTLLGYLYADRFTVAGMGRSFAI
FT                   NLGVRYDRVVNTGLVLASVITAVVVVTVGEIPFVSLIVPNLVTLALGDNLRYALPATAL
FT                   TGALFVLLCDVAGRVIRFPYEIPVSTVLGVIGSAIFLVLLLRGGRRLGVR"
FT                   /protein_id="YP_003650650.1"
FT   gene            complement(24586..25551)
FT                   /db_xref="GeneID:9166491"
FT                   /locus_tag="Tbis_0021"
FT   CDS_pept        complement(24586..25551)
FT                   /locus_tag="Tbis_0021"
FT                   /gene_family="HOG000099140" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /codon_start="1"
FT                   /product="periplasmic binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   oan:Oant_3797 periplasmic binding protein"
FT                   /db_xref="GI:296268019"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="GeneID:9166491"
FT                   /translation="MRSQPLVRRLFALMLVPALLVLAACGGERSGSRDTAATPQQSAEQ
FT                   VTVAHAQGSTSVPKNPQKVIVFDVGVLATLDELGVKVAGVPSVENLPDNLAKYAGDEYP
FT                   KVGSLFEPDYEKVNSLSPDLIIVAARSAAAYGELTKIARTVDLSIDFSDFLGSFRQRME
FT                   AIGAIFGKEAEVKQRLDAIDAAVQETKAKAGDRTGLIVLTTGGKMSAFGPGSRFGLIHD
FT                   VIGVKPADPNLKVDTHGEAITAEFIAKTDPDLLYVIDRDAAIGEEGQPAQKVLDNALVN
FT                   GTKAAKNNKIIYLDPFTWYIAPNALSSVENMVKAVGDSLS"
FT                   /protein_id="YP_003650651.1"
FT   gene            26118..26618
FT                   /db_xref="GeneID:9166492"
FT                   /locus_tag="Tbis_0022"
FT   CDS_pept        26118..26618
FT                   /locus_tag="Tbis_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268020"
FT                   /db_xref="GeneID:9166492"
FT                   /translation="METEASSGRDTSFLKNFLRVLTGRELRELREERRRFLDDKNALLA
FT                   ELRSVVDEANRVTTALRETADEAVNEIKKAVEEIQQETDSAPSMGERLSHELLQHWKQE
FT                   RNWNTSAIMSLEALAVNGKTDLAQWAAAELRNGGTISLGRDAKKRLILLSEGKVTPGAG
FT                   ARR"
FT                   /protein_id="YP_003650652.1"
FT   gene            complement(27246..28928)
FT                   /db_xref="GeneID:9166493"
FT                   /locus_tag="Tbis_0023"
FT   CDS_pept        complement(27246..28928)
FT                   /locus_tag="Tbis_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: mxa:MXAN_4017 serine/threonine protein
FT                   kinase"
FT                   /db_xref="GI:296268021"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:9166493"
FT                   /translation="MGVGPYSAVQDADDLPRRVGPFRITHRLGAGGMGVVYAGIDARGR
FT                   RAAVKLVHPELAHDSEFRARFAREVVVLRRVAGTCTVRLLDADVDAKRPWLATEYVPGP
FT                   TLEQHVTAAGPLTGDQLLALAAGLAEAIKATHAAGVVHRDLKPSNVILSPSGPRLVDMG
FT                   IARLVDETSLTRTGVLVGSPGWISPEEYRGAEVGPPADVYGWGLLVLYAATGRTAFGRG
FT                   RPEVIAMRVLTDAPDLEGVPEPLKDLVAKALAKDPGERPDAAHLLESVSRIWRPDAEAS
FT                   GSAEEEVTRLLDQTWVMPAPEETDWIVPGRRRPWRSLGLAVAVTVACAALIGAVTVFGA
FT                   GRDTDQQAAARRQPPASPVAGAVQSPAAAGQPTAIPAEASITAPASPVTASPTPSARAG
FT                   RRVTMVQGYSFVLPDDWMYFPNNTHDINAFCLRPKDKEDDEYWFCHQYGMAIWPWQDDA
FT                   GEFRLEDISDPDEITGTRNPYGPCGESDPLARPGRMLKSGLYRIGDRKAYYRKAKSYCK
FT                   SGTTVETEILVLPVTRLTILIDELPAERRAQVDDILRSFRFPK"
FT                   /protein_id="YP_003650653.1"
FT   gene            complement(28888..30606)
FT                   /db_xref="GeneID:9166494"
FT                   /locus_tag="Tbis_0024"
FT   CDS_pept        complement(28888..30606)
FT                   /locus_tag="Tbis_0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: azo:azo3774 putative serine/threonine protein
FT                   kinase"
FT                   /db_xref="GI:296268022"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:9166494"
FT                   /translation="MADQEPTPLREDDPRVIGPYRLVHRLGVGGMGTVFAAVDDQGRRV
FT                   AVKRVHPELARDREFRERFRREIALLGRVQGEFVARMLAADPDAAEPWLATEYVPGPTL
FT                   TQRIAKQGPLGEQEVIGFAAALAEAIGSLHDVNVVHRDLKPSNLILSPIGPRLIDLGIA
FT                   RALDQTSLTRTGMVVGSPGWISPEEYRGDEVGPAADVYGWALLVLYAATGRPPFGTGRP
FT                   EVLATRVLTEVPEVSGVPAPLDELVRSALAKEPERRPDLAAIREGCRRAWRAVEAEAED
FT                   VTRFLERTWVMPATDEPEWRVPAPARRRLVVPALAAMLGMAVLGAGALAVTGLPGGPVA
FT                   TEAGPRAQPQVRGTALSAPPAVSTSPVSTPSSTVTASASGTTPASDATRYAVRARSADG
FT                   WLFLHPPGWTVTKEAGASGGETCVRPPDSPDCAARGVIIAYGVGVGREINLDIPEHTFP
FT                   LGFSLGGTYCADMHGISVDQRELRFNNVGHAYEFRKYQVICKNDRTFTAYSAYIRALDS
FT                   LIIGHRVAESDMNLIVGSFGRKYEYQGRLTNPVAPSNRSYVSHGRRSLLRSARRG"
FT                   /protein_id="YP_003650654.1"
FT   gene            complement(31386..32066)
FT                   /db_xref="GeneID:9166495"
FT                   /locus_tag="Tbis_0025"
FT   CDS_pept        complement(31386..32066)
FT                   /locus_tag="Tbis_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: AHDC1; AT hook, DNA binding motif, containing
FT                   1"
FT                   /db_xref="GI:296268023"
FT                   /db_xref="GeneID:9166495"
FT                   /translation="MTADRTAHVSNPELTPDGHKRWLTTLKQVFSGKTPWPWTSHGQRG
FT                   DVRVAVCELGTDILAPRTARRFVVDVLRRWDMPDVRDDVELVVCELVANAINHGLRNTA
FT                   HLTPIRLLMFGVSRSLLCMVLDPSSEPPRPRSLDRTAETGRGLQVVAGISERWGWSPLP
FT                   TGKAVWASFTAPPPPESAVPPAVVRTQPVSAPAYGAPARPASMPPGGVRRTVSPARPGF
FT                   TCAT"
FT                   /protein_id="YP_003650655.1"
FT   gene            32651..32770
FT                   /db_xref="GeneID:9166496"
FT                   /locus_tag="Tbis_0026"
FT   CDS_pept        32651..32770
FT                   /locus_tag="Tbis_0026"
FT                   /gene_family="HOG000053419" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268024"
FT                   /db_xref="GeneID:9166496"
FT                   /translation="MKKLLVLALVALGGLLIWRKVQADRAELDLWTEATGSEN"
FT                   /protein_id="YP_003650656.1"
FT   gene            32810..33526
FT                   /db_xref="GeneID:9166497"
FT                   /locus_tag="Tbis_0027"
FT   CDS_pept        32810..33526
FT                   /locus_tag="Tbis_0027"
FT                   /gene_family="HOG000239090" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /codon_start="1"
FT                   /product="HAD-superfamily hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: predicted protein"
FT                   /db_xref="GI:296268025"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="GeneID:9166497"
FT                   /translation="MAPVTLACLDLAGTTIGDIDMVERAFAEAIATQGIVPGTSAYARA
FT                   MVHVHRSRGCPKIEVFRGIFPGNEAQAQAANLAFERSFESALERTGLVSLPGTVEALEK
FT                   LRDNGIKIALISGFSRNTLSRVLSNLSWADMLDLALCPEDAGRGRPYPDMVLTAVLRLG
FT                   IDDVRQVAVVGDSESDMLCGRRAGASLVVGVLTGVHSRERLISGGATHILDSFADFPAL
FT                   VLDSEPDTPETVTSAR"
FT                   /protein_id="YP_003650657.1"
FT   gene            33646..33721
FT                   /note="tRNA-Ala1"
FT                   /db_xref="GeneID:9166498"
FT                   /locus_tag="Tbis_R0002"
FT   tRNA            33646..33721
FT                   /db_xref="GeneID:9166498"
FT                   /locus_tag="Tbis_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(33957..34805)
FT                   /db_xref="GeneID:9166499"
FT                   /locus_tag="Tbis_0028"
FT   CDS_pept        complement(33957..34805)
FT                   /locus_tag="Tbis_0028"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268026"
FT                   /db_xref="GeneID:9166499"
FT                   /translation="MVKYRWVHNGRVVGKGTVKVIRDKRISYTFKPNESHKGWVALEIV
FT                   SPRYGRSAHNAYQVTCEEPEPPAPPVETAASATAPEDYTGACPITRVFTGTVSVNRIEP
FT                   GGTTVQYRWMGPDFQGPTETLTFAEGDPLTKNVSHSVEVTASGPVQRWIEISSPNPAVS
FT                   ATAQTQVECQPLQITILNIQRSIDLSACGTPGYGPAITFSSPVQVNGPVRVEYRWDFNE
FT                   GELTVPGSFETTGPSTVTVSHRLESSPLTARDLMRVRLMITSHNVSGRVLDFTPPPCPA
FT                   S"
FT                   /protein_id="YP_003650658.1"
FT   gene            complement(34833..35450)
FT                   /db_xref="GeneID:9166500"
FT                   /locus_tag="Tbis_0029"
FT   CDS_pept        complement(34833..35450)
FT                   /locus_tag="Tbis_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GK10816 gene product from transcript GK10816-
FT                   RA"
FT                   /db_xref="GI:296268027"
FT                   /db_xref="GeneID:9166500"
FT                   /translation="MISTGLARLAAAGVTALTALASGLLATPAAAGTAPVASTALAAGT
FT                   APVAGTALAAGTAPAKPAVSVKTPTVSPQRYVGRCPATLTFSAKVRLKVRGKTTVAYRW
FT                   VLSNGAKSAVKTTTVKGNGIKTVTFVKKVTFKKSAMGWMALQLLSPRKVTTGKTYFAVS
FT                   CQLPVRLKPGKPGHGKKPDFVKAYVHVPDYTGVCPPSRGVTA"
FT                   /protein_id="YP_003650659.1"
FT   gene            complement(36117..36611)
FT                   /db_xref="GeneID:9166501"
FT                   /locus_tag="Tbis_0030"
FT   CDS_pept        complement(36117..36611)
FT                   /locus_tag="Tbis_0030"
FT                   /gene_family="HOG000023714" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dole_1383"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dol:Dole_1383 hypothetical protein"
FT                   /db_xref="GI:296268028"
FT                   /db_xref="GeneID:9166501"
FT                   /translation="MSVGGEAGGRFRDPRIHVWQLTHTVLVRCPACGGCALVLRDLDAA
FT                   DRVPELSSALSGRRRLRCRACGFGKDEFFSEFLFGGPVDPFFRLPLWLQAGCRGHVLWA
FT                   YNVQHLDLLESWVAARLRERRAVPGSLSMLARLPAWVTSAKNRDDVLRAIHRMRASLPR
FT                   S"
FT                   /protein_id="YP_003650660.1"
FT   gene            complement(36798..38630)
FT                   /db_xref="GeneID:9166502"
FT                   /locus_tag="Tbis_0031"
FT   CDS_pept        complement(36798..38630)
FT                   /locus_tag="Tbis_0031"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268029"
FT                   /db_xref="GeneID:9166502"
FT                   /translation="MQLADRLFVPDERWGFEFREPEPIRANPYLDQEPVWQEPPLPEEL
FT                   VDLLQAQQEAEAKRKDRIRYMITMLACATLPPLMFILLPVAAWFGFQWFIRPNLNKQRI
FT                   DQLQHEYRKVRDAAFAQYQVAVQNWKQAVAAYDEAERRRWETAVSWYPIRLVSAPSRVD
FT                   VFGGTPEGWASLLATAGGSLLGARQDLVLLDFTEHDVGGGLAALTAVRGIPVNRIALPN
FT                   ELHRIDLLATASTDECAELLAEAVHGLRQSTNHADARALHADLLNAVLQRLSGPLSFTR
FT                   IAAGLAVLQGAYEPSGGGPLHSAEVERLSAYAGTLGQSEFTLKELRFLSNTLHLLAVDG
FT                   GARRMASDGTEPGTGYDSPWNLRGLTIVATFDNNRRRKEFTDHVLAQELVRALSNREPQ
FT                   GVVVVAGADHLGLQTLEAITKYARRADVRLVLLIEHLRGELQQLMGGTDSATFLMCLRN
FT                   HQEATTAADYIGRGFRFTLSQITEQVGRTLVTGGAESWGVQHQEGESWGSSWSTSRGPD
FT                   GTTKSGGGHHSTSESWSRSWQETRKWATADSETVGRTMSRVYEYMVEPTTLQSLPTTAF
FT                   ILVETGPAGRRIIAGDCNPGIALLDNVSDRPWPS"
FT                   /protein_id="YP_003650661.1"
FT   gene            39113..41599
FT                   /db_xref="GeneID:9166503"
FT                   /locus_tag="Tbis_0032"
FT   CDS_pept        39113..41599
FT                   /locus_tag="Tbis_0032"
FT                   /gene_family="HOG000000070" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="GI:296268030"
FT                   /db_xref="GeneID:9166503"
FT                   /translation="MSGEPWPAPGARWPSRRHPVDRRVPAAAPLIAVLLSLIAVVFGAV
FT                   SPASATAVPASPSAVAPVPGRAPAAAAATPATAPHASPPASPAREPAAAVSPPASAAGE
FT                   PAVASVSVSTAGEPAVASAPPAAAAAAPQPREARSGTVSPADQAQRVAVIGVPGLRWGD
FT                   LDPERTPNLWQLATEGAVASLSTRTIPPEGTSVNCPVAGWLTVSAGQRAAAPGPGCPPA
FT                   PEPVRAADGSATVPGWSELAALQRSSAYQASIGLLGQAITAAGGRVAAVGPGAALAAAD
FT                   QNGRVATYARTPGELPDLTPYAAVFAEAGEIARAWWRAGQGRAVELDDAARATAVRAAD
FT                   RTVGELLRHLPPETLVLVAGLSDAGSLAHLHVAIALGPGRGEPYWRSTLTAASTRQDAL
FT                   VTITDVTATVTHVLGLPTPEGAVGRPWRPAGPAPEDPVAELAAADLAGQVLREIRPSFY
FT                   TALVIVQLAFYGIAAAVVRRFRRMLTAVQVVAVVSGAVPVATFLAQLVPWWSAGRPMLA
FT                   LNAVILGFAVLIAGLAFAGPWRRHVLGPLTVVAGVSSLTLLIDVMTGSHLQVNAVTGYE
FT                   PVTGGRFYGFGNIAFAVFATGTILFLAGLWRLRCGLLRPVVLGYALFAIVVDGWPGWGA
FT                   DFGGVPSFVLGVAVFALLAFGLRISPGRLGLIALGGAVLIAALSVADWLRPADRRTHLG
FT                   AFVDQVLAGEGWPIVTRKLSAMLNTLGNVWLTLLALVAVAFLFLVLHKPSRWGASALSQ
FT                   AYGRAPELRAGLFGALATAICGFVLNDSGIAIPAMALTVAVPLTLAAAVRALRLGPPTT
FT                   ADRSSAESARTAPPTP"
FT                   /protein_id="YP_003650662.1"
FT   gene            complement(41499..43154)
FT                   /db_xref="GeneID:9166504"
FT                   /locus_tag="Tbis_0033"
FT   CDS_pept        complement(41499..43154)
FT                   /locus_tag="Tbis_0033"
FT                   /gene_family="HOG000159110" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: afw:Anae109_0338 hypothetical protein"
FT                   /db_xref="GI:296268031"
FT                   /db_xref="GeneID:9166504"
FT                   /translation="MAAETARPAWPFGRSGVRPLNGTAAARFAVAASWLSILCTITIGL
FT                   LGPSAMVPALPGPAWHPPYSLGLAPDGHLVIALAAAAIVLGAAGLATGLLAAERLPGAR
FT                   TLVAAGCAAAAVLAFLPPSGSADHLNYAAYGRIAVLGHDPYVTVPADLPGDPVTGAVEE
FT                   WRNTPSVYGPVATALQTLAGHIGGESVRLTVFVLALANAAAFIATGLFLHHATRGDRGR
FT                   QRRAALLWIANPLLIYQLAAGMHLDTLAIAFAVAGLVACAGVPLGLGVAVKVTAGLVAP
FT                   GLAWELRRRPARLALVVVTATATVLVAYRLAGPHALDQVLNASRSISLATPWKLVQRAL
FT                   QALFGPGAYRPWIQAGSLALLASLAGLLLRRLLARDRAARASGPAGAVGPSGAAEAAGP
FT                   LGAAGAAEPSRPVDRSSGAEGPGDPAGSALPPATAVAGTPAAVPYREGAAVALALTAAW
FT                   LFAAPYVLPWYAGLAFALLALVPASALEAFLVAHLTALSLGYLPARQHGQPADLGWLVS
FT                   VVREWAVPCALIPLTIGLLWWAARAGARAPRPRA"
FT                   /protein_id="YP_003650663.1"
FT   gene            complement(43212..43952)
FT                   /db_xref="GeneID:9166505"
FT                   /locus_tag="Tbis_0034"
FT   CDS_pept        complement(43212..43952)
FT                   /locus_tag="Tbis_0034"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="family 2 glycosyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bha:BH2769 dolichyl-phosphate mannose synthase"
FT                   /db_xref="GI:296268032"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:9166505"
FT                   /translation="MNERITPDTAVVIPAKDEAERIGATVTAAAKLPGVDLVVVVDDGS
FT                   ADETARVAAEAGARVVRHSRNRGKAAAMETGAEAVRLLDGEQPRHLLFLDADLGDTAAA
FT                   AHALITPVRSGAADMTIANFTTRVKLGGHGMVVRLARDGIKRLTGWEARQPLNGQRCLT
FT                   RAAFEAALPLAFGFGVETGMTIDLLRAGFRVLEVEVDMAHRATGTDWRSQLHRAKQFRD
FT                   VALALAAREPVIAQGVRTIRALRR"
FT                   /protein_id="YP_003650664.1"
FT   gene            complement(43959..44309)
FT                   /db_xref="GeneID:9166506"
FT                   /locus_tag="Tbis_0035"
FT   CDS_pept        complement(43959..44309)
FT                   /locus_tag="Tbis_0035"
FT                   /gene_family="HOG000270156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /codon_start="1"
FT                   /product="anti-sigma-factor antagonist"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   sat:SYN_02356 anti-sigma F factor antagonist"
FT                   /db_xref="GI:296268033"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="GeneID:9166506"
FT                   /translation="MELKVATRSSGGTAIVAVSGEIDLYTAPQLQAEFARLISTSPQRV
FT                   VIDMSEVEFCDSTGVNVLLSALKRLRERGGDLEVAAPRSAVRKILQVTGLDSVFTVHDA
FT                   VPDDLLTTEHKG"
FT                   /protein_id="YP_003650665.1"
FT   gene            44517..45068
FT                   /db_xref="GeneID:9166507"
FT                   /locus_tag="Tbis_0036"
FT   CDS_pept        44517..45068
FT                   /locus_tag="Tbis_0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268034"
FT                   /db_xref="GeneID:9166507"
FT                   /translation="MGPEKMSSGIPEDPSRQRVREHLEIIQSRGAKASIWRETIEPLRQ
FT                   LINREGHVPVTTRLTPEDLDFLAEARDDVLTLTELVLRLLELHQPRDAGGITTDPSRPI
FT                   LRCRSCMWRWPCPTFRAMSEAFAPRERPERINRYPIGTAWQAQRGLHRAGEGAAGPRVP
FT                   GIPEPAGGGEAAGHDVPGEP"
FT                   /protein_id="YP_003650666.1"
FT   gene            45108..45281
FT                   /db_xref="GeneID:9166508"
FT                   /locus_tag="Tbis_0037"
FT   CDS_pept        45108..45281
FT                   /locus_tag="Tbis_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268035"
FT                   /db_xref="GeneID:9166508"
FT                   /translation="MARIALTVLGIFLALWLVFGFVLPTLFAIFKFLLFAAVLAFLGFV
FT                   AVTLVGKVSGRS"
FT                   /protein_id="YP_003650667.1"
FT   gene            complement(45442..45897)
FT                   /db_xref="GeneID:9166509"
FT                   /locus_tag="Tbis_0038"
FT   CDS_pept        complement(45442..45897)
FT                   /locus_tag="Tbis_0038"
FT                   /gene_family="HOG000269271" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: cak:Caul_4555 signal transduction histidine kinase"
FT                   /db_xref="GI:296268036"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="GeneID:9166509"
FT                   /translation="MLPYAPSSVAIARQRLSAELQAAGLVSSAVDDVVLVLSELLSNAL
FT                   RHAHPLPSGKLRVAWSCSESHVEVQVSDGGAATEPRAGCLTLSSLGGRGLSIVDYVAER
FT                   WGVRHEDRQTTVWARITASWESKNGTGPHTAEHPPGAAGRTETRGNR"
FT                   /protein_id="YP_003650668.1"
FT   gene            complement(46026..47942)
FT                   /db_xref="GeneID:9166510"
FT                   /locus_tag="Tbis_0039"
FT   CDS_pept        complement(46026..47942)
FT                   /locus_tag="Tbis_0039"
FT                   /gene_family="HOG000105673" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: gur:Gura_1221 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; GAF domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="GI:296268037"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:9166510"
FT                   /translation="MGDVDGSWVTDGDADGVAGAVVASAPDAIVAFDRDLAVVSWNAAA
FT                   ERLFGWQAEELVGKRAPIVPRELMAEHNAVLERVRTGGRVSLRSRRYHRDGRLLDVRVD
FT                   TSALRSPTGALLGYVSVYHSVEDDDAAQGGAARRARLVRRLTDVVADINADLDLPIVLD
FT                   RIAASLTELTGADAGAFASIEGDRLRLVGLHRLPEEARGSTAELATSLVGKLLRTGRPV
FT                   LLETGVGDGCEEPLRAYVPGVHTIAVGLAAVGGRPYGALYALFARHRASHVELELLELL
FT                   AGHVGIAVGNAMAYQEAVRQRAHERAVFDACADGIAVLDGESRVVRWNAAAAELTGLTA
FT                   AEVIGKPPPFPLPAPGEKLTFRLPSGRWLDVLCNEIPETGEAVVDFRDVTRAKELEEAK
FT                   DLFLAVTGHELRTPITIVRGFASTLDRRWDALSDAERRSAVRTIAERANALGRLMDHLL
FT                   LGAWAGTGALTITTEPFDLGERIRAATLGLPALSDRHRIEVDVQPGLPLVHGDALATEI
FT                   LLGQLLENAFKYSPDGGLIRVAAWAEGDRVVVVVEDEGVGIAPADRERIFERFVQADSG
FT                   NRRRFGGVGLGLYIVRSLARAQGGEVTAHPRPGGGTRMRVVLPCAVPDSGQGKQKAPMT
FT                   TDQ"
FT                   /protein_id="YP_003650669.1"
FT   gene            48039..48602
FT                   /db_xref="GeneID:9166511"
FT                   /locus_tag="Tbis_0040"
FT   CDS_pept        48039..48602
FT                   /locus_tag="Tbis_0040"
FT                   /gene_family="HOG000244137" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /codon_start="1"
FT                   /product="methylated-DNA/protein-
FT                   cysteinemethyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: pol:Bpro_1637
FT                   methylated-DNA--protein- cysteine methyltransferase"
FT                   /db_xref="GI:296268038"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="GeneID:9166511"
FT                   /translation="MSSGDLEALLRVTAPGYKGEPAPDIALGTTDGPVGRLVLAVTARG
FT                   VVACSYEDEDTVYARIHKSLGGSIGSDPRRIDPVRRELDAYFEGRLRAFSTPADLQLAA
FT                   PFVRTVLQMMLSVPYGTTTTYRDIAARIGRPQAVRAVSSALSANPVCLFVPCHRAVESA
FT                   ESLGGYAGGAEAKGYLLRLEGALA"
FT                   /protein_id="YP_003650670.1"
FT   gene            complement(48668..50041)
FT                   /db_xref="GeneID:9166512"
FT                   /locus_tag="Tbis_0041"
FT   CDS_pept        complement(48668..50041)
FT                   /locus_tag="Tbis_0041"
FT                   /gene_family="HOG000218719" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /codon_start="1"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /transl_table="11"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: bxe:Bxe_A3437 nucleobase/cation symporter,
FT                   (NCS1) family"
FT                   /db_xref="GI:296268039"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="GeneID:9166512"
FT                   /translation="MTSGRVGSDRSEAPLTLDEEPPKTLGLLDQGAFWANLGVSLLGFS
FT                   GALFLLDPLGGEPLTFPAALLAAVIGSLIGTAMVGVSAIPGTQTGRPAMVLLRGLFGTR
FT                   LSYVPTVLNIVQMLGWGAFELWVIARGAQAIFGPGTPYALWVVLAGVVTIALTIRPLGS
FT                   LRLLRRYVTAGVIVSMVWLSVVLFARVPSLGEGSWHAFAPAVDYVIALSVSWVPLAADF
FT                   TRHSRSSAAAFTGVVGGYTIAQVACLALGIAALAIVGNDPDRVWDPFVAAPLGGLFFGI
FT                   LVLREVDQSFANVYSTTMSIQNLRPRLDRRVISVAVGVVTILIALVADVTAYGAFLSVI
FT                   GAVFVPMFAVLAVDYFVLGGASRWNTAEDAPARWLMLVPWLLGFAAYWLVTATPTVGWW
FT                   DAIWAAARSAIGFTSPPWLNAALAAFVISAAGTLLAGPIVRRRRMAEAERRDPALTGR"
FT                   /protein_id="YP_003650671.1"
FT   misc_binding    complement(50031..50147)
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 49.44"
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT   gene            complement(50326..50649)
FT                   /db_xref="GeneID:9166513"
FT                   /locus_tag="Tbis_0042"
FT   CDS_pept        complement(50326..50649)
FT                   /locus_tag="Tbis_0042"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /codon_start="1"
FT                   /product="rhodanese domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: bch:Bcen2424_5472 beta-lactamase
FT                   domain- containing protein"
FT                   /db_xref="GI:296268040"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9166513"
FT                   /translation="MTVHEVDASEVPENAFLLDVRELDEWRAGHAPQAVHIPMGDLRSR
FT                   IGEVPDAQPIYVICRAGGRSAQAAAWLNHIGKQAINVGGGMQSWAAAGRPMVSETGMPP
FT                   YVA"
FT                   /protein_id="YP_003650672.1"
FT   gene            complement(50792..51670)
FT                   /db_xref="GeneID:9166514"
FT                   /locus_tag="Tbis_0043"
FT   CDS_pept        complement(50792..51670)
FT                   /locus_tag="Tbis_0043"
FT                   /gene_family="HOG000020886" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /codon_start="1"
FT                   /EC_number="4.2.99.18"
FT                   /transl_table="11"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycosylase catalytic
FT                   domain protein; DNA glycosylase/AP lyase, H2TH DNA-
FT                   binding; KEGG: afw:Anae109_0505 DNA-formamidopyrimidine
FT                   glycosylase"
FT                   /db_xref="GI:296268041"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="GeneID:9166514"
FT                   /translation="MPELPEVEALAAFLRARAGGRTVAGADVVAVQALKTVNPPPAALV
FT                   GRAITGVHRHGKFLDLECEGLHLVAHLGRSGRLRWRDDLTGARPARSGRGPLAARVRLS
FT                   PDPEGRAPGFELHEAGPRKRLALYVVHDPAEVPGIAGLGIDPLSDGFTVARLREIVRAG
FT                   CTQVKGLLRDQRLISGIGDAYSDEILHAARLSPFKLADSLTDDQVAALHSAIVTVLGEA
FT                   VAEARALAAERPEPHPRLRMRVHGRTGEACHACGDTIREVSFADSALQYCPTCQTGGRP
FT                   LADRRLSRLLR"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /protein_id="YP_003650673.1"
FT   gene            complement(51729..52346)
FT                   /db_xref="GeneID:9166515"
FT                   /locus_tag="Tbis_0044"
FT   CDS_pept        complement(51729..52346)
FT                   /locus_tag="Tbis_0044"
FT                   /gene_family="HOG000225158" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /codon_start="1"
FT                   /product="TenA family transcriptional activator"
FT                   /transl_table="11"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG:
FT                   ret:RHE_CH00249 TenA family transcription regulator"
FT                   /db_xref="GI:296268042"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="GeneID:9166515"
FT                   /translation="MRFMGISQELQAIGRPMLDAQLAHPTVRGIANGDLPEEVFRSWLE
FT                   QDYLYLHDYVRVFCRLAWQAPDKHLGDLVDLAYSTFHDELNLHRSLSAEFGADLEGAVK
FT                   GPACAAYTSFLLEAAANYAEGLAALYPCMWGYSTLGQILAKNPPAEPRYRRWVETYADP
FT                   NFAALADRIAVMLDEANPDPERAKALFIEGMNHELAFWDVPV"
FT                   /protein_id="YP_003650674.1"
FT   gene            52385..53041
FT                   /db_xref="GeneID:9166516"
FT                   /locus_tag="Tbis_0045"
FT   CDS_pept        52385..53041
FT                   /locus_tag="Tbis_0045"
FT                   /gene_family="HOG000079147" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BH0832"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bha:BH0832 hypothetical protein"
FT                   /db_xref="GI:296268043"
FT                   /db_xref="GeneID:9166516"
FT                   /translation="MTLTIAEELLLLGYHDETGRPQAGSVELDAAVAGALLAELAVAGR
FT                   IDLRDDMVVVTDRSPVGDEELDAVLARVHGEPKPRKAQWWVERLRSGELRKRLLRRLAE
FT                   RGVLSEETTKLFGLIPLRRYPERDPSAEQEIRRRIENVLTGADPDPRTAVLISLLHAAR
FT                   LDRKAFPKTHRRRIKEIAEGEWAGAAVYRAIVAVQAAVTAAVAAAIAATSAAAGS"
FT                   /protein_id="YP_003650675.1"
FT   gene            complement(53193..54155)
FT                   /db_xref="GeneID:9166517"
FT                   /locus_tag="Tbis_0046"
FT   CDS_pept        complement(53193..54155)
FT                   /locus_tag="Tbis_0046"
FT                   /gene_family="HOG000019913" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /codon_start="1"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   bcr:BCAH187_A5364 transcription antiterminator, LytR
FT                   family"
FT                   /db_xref="GI:296268044"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="GeneID:9166517"
FT                   /translation="MGGGRSLGKVIRTTLVCALVLLLVFVVGGYFWIGSRLTTTEAFSD
FT                   YPGRPEETPGTDWLLVGSDSREGLTAAERKRLATGSVGGRRTDTVMLLHIPRDGRPTLV
FT                   SLPRDSYVPIDGHGRNKLNAAYAFGGPELLVKTVEQVTGIRIDHYMEIGFGGFVDIVDA
FT                   IGGVEICVKQNIKDPKAGINLKKGCQVMDGGTALGYVRTRATGAIPDLERTQRQRQFLA
FT                   ALVSKAASPGTLLNPFSSVPLALSAADAVTVDPGTGPIDLLRLALAMRDKPISTAVPIG
FT                   ALPTINGMAVVKWDTEKALRLFNALKEDRPVPKDVLSNK"
FT                   /protein_id="YP_003650676.1"
FT   gene            54640..56202
FT                   /db_xref="GeneID:9166518"
FT                   /locus_tag="Tbis_0047"
FT   CDS_pept        54640..56202
FT                   /locus_tag="Tbis_0047"
FT                   /gene_family="HOG000062295" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   pde:Pden_3115 protein of unknown function DUF21"
FT                   /db_xref="GI:296268045"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="GeneID:9166518"
FT                   /translation="MSAAIGLLAVVIITFATGFFVAQEFAFVAANRTVLREQALRGDRS
FT                   AERALTVTSRLSFMLSGAQLGITVTTLLVGFIAEPAIAAGVRGPLLAIGVPEEMVPGVS
FT                   ITLGIAFATVLQMIFGELAPKNLGIARPEPVARFLARPTLVYLKVAGPVIRLFDSAANR
FT                   LIRLAGMEPVEELEHGVTARELARIVDESAAAGELPRRLADLLDRALEFGDRTTEDVMV
FT                   PRPRVVSLRADRPVGDLLEALRSHGHSRYPVLGEAPDDVVGVTGLTEYVRAGSPRTGVI
FT                   RDITRPAMLVPATLPLHALLERMTAAGETFACVIDEYGGLAGVVSIEDLAEELVGELVD
FT                   ENDPEPLGVVRVGDDGWNVPGTLRLDEVERATGVRLPESEDYETIAGLVLARLGRMAEV
FT                   GDEVAVAVLPDDDLFAEEEQRHAALGVLSVRRRVPEWVRLTLRMGPPPNPGDDSTAEPD
FT                   VRWAHGRRLPVSPPQGRGAGRPMGGPAAPPPVNGAAVPEGEPVSPRAASEAGSSEPLGW
FT                   RAR"
FT                   /protein_id="YP_003650677.1"
FT   gene            56199..57203
FT                   /db_xref="GeneID:9166519"
FT                   /locus_tag="Tbis_0048"
FT   CDS_pept        56199..57203
FT                   /locus_tag="Tbis_0048"
FT                   /gene_family="HOG000062296" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; KEGG: shl:Shal_2700 hypothetical
FT                   protein"
FT                   /db_xref="GI:296268046"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="GeneID:9166519"
FT                   /translation="MTDLGAILLGVLLLIGNGLFVAAEFAVVSAQRHRMEELARAGGRP
FT                   ARIAARAAVRSSRELSLMLAGAQLGITLCSLGLGMVAEPAVEHLLGPVLVFLPEAIHTP
FT                   VAYLVALGLVTFLHMVVGEMAPKSLALTHPERAALGLALPFRGFVWIVRPLLALLNGLT
FT                   NATLRLVGVRPRDELAVAKTPRQLAMLVAESGRMGMLDRHKHDLLLRAFRAQTRRVEEL
FT                   MLPVDQAPAVPAGASADLIRATAARDGGHRMLVVSPDGVLGVLHVRDALINPDRPPETL
FT                   ATAAPRIPAGTTVPDAVTVLQEARAQLGLVTDERGAVIGVVDLTRLIGELLAA"
FT                   /protein_id="YP_003650678.1"
FT   gene            complement(57614..57697)
FT                   /note="tRNA-Leu5"
FT                   /db_xref="GeneID:9166520"
FT                   /locus_tag="Tbis_R0003"
FT   tRNA            complement(57614..57697)
FT                   /db_xref="GeneID:9166520"
FT                   /locus_tag="Tbis_R0003"
FT                   /product="tRNA-Leu"
FT   gene            57850..58587
FT                   /db_xref="GeneID:9166521"
FT                   /locus_tag="Tbis_0049"
FT   CDS_pept        57850..58587
FT                   /locus_tag="Tbis_0049"
FT                   /gene_family="HOG000235804" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_1361 FHA domain
FT                   protein"
FT                   /db_xref="GI:296268047"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:9166521"
FT                   /translation="MGVLQRFERRLEGLVEGAFARAFKSDLQPVEVASAIQREMDERAA
FT                   IVAQGRTLVPNDFVVELSITDGERLQVYADSLCQELANLAREYAKEQGYSFVGPVRVRF
FT                   ETADDLAVGLFRIRSGVIRGATVEQDEIRHPVTDMPVRKGVFRGRPRLLVSTQDDPTGQ
FT                   RSFELTTPVTLLGRGTDCDLRLVDPGVSRHHAELRIEGDKVVLVDLGSTNGTFVNGQPV
FT                   RRIEMQDGTRVTLGRTTLVFRRD"
FT                   /protein_id="YP_003650679.1"
FT   gene            58606..59076
FT                   /db_xref="GeneID:9166522"
FT                   /locus_tag="Tbis_0050"
FT   CDS_pept        58606..59076
FT                   /locus_tag="Tbis_0050"
FT                   /gene_family="HOG000235793" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: bbt:BBta_4519
FT                   hypothetical protein"
FT                   /db_xref="GI:296268048"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:9166522"
FT                   /translation="MSELTLLLIRIAFLALLWLFVIAAVGVIRTDLFGPRTAPAPGRSP
FT                   ARQGMALPKLKPKRGQPRQLVVTAGPLQGTVIDLTDSPITIGRASDATLVLNDDYASSR
FT                   HARLFPQDGQWIVEDLGSTNGTYLERSKVTRPTPVPVGVPIRIGKTVLELRK"
FT                   /protein_id="YP_003650680.1"
FT   gene            59073..60353
FT                   /db_xref="GeneID:9166523"
FT                   /locus_tag="Tbis_0051"
FT   CDS_pept        59073..60353
FT                   /locus_tag="Tbis_0051"
FT                   /gene_family="HOG000235782" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.16"
FT                   /transl_table="11"
FT                   /note="KEGG: nmu:Nmul_A1997 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="GI:296268049"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="GeneID:9166523"
FT                   /translation="MTIALRYAARSDVGLLREGNEDSAYASGRLLAVADGMGGHAHGEV
FT                   ASSVAIAALSSLDRDTSGSDLVSDIEAAFRDANHQLQELVNRDPSLKGMGTTLTAMLWN
FT                   GLRFALAHVGDSRAYLLRNGELYQITHDHTLVQSLVDDGRITQEEAANHPQRSILLRAL
FT                   DGTAEVDPDLQDREAQVGDRYLLCSDGLSTVVSPETLHHTLTTIEDPEEVVRQLIDLAN
FT                   RGGGPDNITCVVADVIEIDDPEPPQTKAAIVGAAGSGRLEALSRDLGLGNGLGNRSAVT
FT                   APQPVITDEDLDDAPAGRAGRRARGRRTWLRVLGGITVTAAALGAGGYGAQQWINSQYY
FT                   VGAQGDRLVVYQGIDAELGPLSFKKVAYTENVRLSSLPAVQQSQIRSGIQVEDLQDGIE
FT                   TLKRFAASAQPSTETIDTLSSPSGSGQ"
FT                   /product="protein serine/threonine phosphatase"
FT                   /protein_id="YP_003650681.1"
FT   gene            60350..61732
FT                   /db_xref="GeneID:9166524"
FT                   /locus_tag="Tbis_0052"
FT   CDS_pept        60350..61732
FT                   /locus_tag="Tbis_0052"
FT                   /gene_family="HOG000282687" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /codon_start="1"
FT                   /product="cell cycle protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cell cycle protein; KEGG: dps:DP2425 cell
FT                   division protein (FtsW)"
FT                   /db_xref="GI:296268050"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="GeneID:9166524"
FT                   /translation="MSAIPSPQVPTTAKRRVVQLGMLTFAMLVVMAAYAGVGLGINGQV
FT                   PSGMLGYGLGLGGLVFAAYLVLARFAPWADPLLLPLVTLINGIGLVMIYRIEQAGQPGA
FT                   NATTQLMWTALGVVMFAVTLIVLRDHRILQRFTYTAGFAGLVLLAIPAILPSSLSEVQG
FT                   AKIWIRIGGFSIQPGEFAKLALVVFFAGYLVAKKDVLSLAGRRLLFIDLPRGRDMGPIL
FT                   ITWLLSLGVLVLEKDLGTSLLLFGAFIAMLYIATQRTSWVLIGLLLFVGGAYLAGQIFS
FT                   HVEARFEGWLHADDNEIYNRTFGGSYQLMQGLFGIGSGGILGTGLGRGHPELIPLSFSD
FT                   FIFPAVGEELGITGLMALLMVYMLIVERGLRTALGARDPFSKLLAGGLSFILAWQVFII
FT                   VGGVTRLIPLTGLVTPFMSAGGSALLANWMLIAMLVRMSDAARRPPPQAIQNEGETQVM
FT                   RR"
FT                   /protein_id="YP_003650682.1"
FT   gene            61729..63186
FT                   /db_xref="GeneID:9166525"
FT                   /locus_tag="Tbis_0053"
FT   CDS_pept        61729..63186
FT                   /locus_tag="Tbis_0053"
FT                   /gene_family="HOG000235771" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /codon_start="1"
FT                   /EC_number="2.4.1.129"
FT                   /transl_table="11"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sat:SYN_00551 cell elongation specific D,D-
FT                   transpeptidase"
FT                   /db_xref="GI:296268051"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="GeneID:9166525"
FT                   /translation="MNSTVKRTAVACLFMFLLLMGNVTYIGAVQAEGLKNDPRNARAFF
FT                   ARYNIDRGWITANNGKVTLARTKDTGDATFRFKREYPGGKAFSHVVGYFAPESATGIEA
FT                   AAGRYLDGTHPDLVVRRAIDLVSGKPAKGANVDLTLDVQAQRVAYRLLNGTGKRGAVVA
FT                   LDPKTGAVLAMVSSPSYDANPLAQPNKAKVNAAWQKLNKDDNKPLINRAIEQTYPPGST
FT                   FKVVTSAMFLSEDTSRDENTVVDAPDALPLPGVVQPLRNYRGESCGGQATMLRALAISC
FT                   NTPFAKIGMDLGYDRLKEQAERFGVGKPLEIPLYVQPSDIGPQEDKAALAQTSIGQRSN
FT                   RMTPLQMAMVAAGIANNGTVMKPYLINKIVAPDGTELEVTEPEELTEAVSPEVAAELTR
FT                   MMVGVVQQGTGRAAQVPGITVAGKTGTAETGPGQPSHAWFICFAPAEDPKVAVAVIVES
FT                   GSAGSDATGGAVAAPIAREVIQAVLGR"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /protein_id="YP_003650683.1"
FT   gene            63183..64589
FT                   /db_xref="GeneID:9166526"
FT                   /locus_tag="Tbis_0054"
FT   CDS_pept        63183..64589
FT                   /locus_tag="Tbis_0054"
FT                   /gene_family="HOG000037187" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: azo:azo3774 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="GI:296268052"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:9166526"
FT                   /translation="MNPDTVLGGRYRLISRIAAGGMGEVWRALDESLGREVAVKVMHSH
FT                   VAADPSFRTRFRTEARITAALTDPGIAQVYDYGESDSVAYLVMELVHGEPLAAILSRNG
FT                   ALDPQVTLDIIEQAAKGLYAAHRNGVIHRDIKPGNLLVTEDGQVKITDFGIARALEAAR
FT                   LTRTGTVLGTAQYVSPEQASGSELTPASDIYSLGVVAYECLAGRPPFTADTPVALVLKH
FT                   INTPPPPLPETVPQAVRDLVSAMLAKDPAARPADGAELARRVRALRATLTGEPARRLGA
FT                   LTDPSGFPVARTAGLPPQEPRDLPTTKPELPETAAAGPGPGSGRRTGRRPVIIGGVVAG
FT                   CALAAVIGVLAPRFTESAVEPPRERPASPTPEVSPTPVQPSRSPAVRPTQRVVQVPSAT
FT                   PFPTPSATVITSAPATWTPTPSASPTPSLSQTPPSTPTHQPTDTAAPTASPTETSPPDD
FT                   EGTDEKGVDD"
FT                   /protein_id="YP_003650684.1"
FT   gene            64631..66478
FT                   /db_xref="GeneID:9166527"
FT                   /locus_tag="Tbis_0055"
FT   CDS_pept        64631..66478
FT                   /locus_tag="Tbis_0055"
FT                   /gene_family="HOG000037185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="PASTA sensor domain-containing serine/threonine
FT                   protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: bsu:BSU15770
FT                   protein kinase"
FT                   /db_xref="GI:296268053"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:9166527"
FT                   /translation="MIQPRLLGGRYQLESVVGRGGMAEVYRARDIRLDRIVAIKTLRSD
FT                   LARDHTFQARFRREAQSAASLNHPSIIAVYDTGEDVVDGTPVPYIVMEYVEGRTLRDVL
FT                   RTERKVLPERALELTDGILRALDYSHRGGIVHRDIKPANVMLTNSGEVKVMDFGIARAM
FT                   ADSAATMTQTAQVIGTAQYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPV
FT                   AIAYQHVREDPIPPSHIDPEIPKWADAIVLKAMAKDPFQRYQSAAEMRADIQRVLSGLP
FT                   VDPQTMALATSYQQYGGAADRTRTMTATDVPSVQATQAIPDYEYGPPERNGRYDRRRGG
FT                   GNTALKTALWIVIPLLIIGAFIGIGYAFLSPGSSGTTKVKVPQLVNQTKEAAEKALTDL
FT                   GLKVAYGPAEYHDEVPKNSVIRTEPAADTEVSLGDTVTVILSKGRELVSIPTDIIGKTP
FT                   EEAKAELEALGLNVSIVMKTAPGKPQGKVYDTNPKPGQRVAKDTLVRLYVPRELAQVPS
FT                   VVGIPEDEARATLEGAGFKVKVVTRNSDVPVGNVIDQSPAPGTKLQPGTTVTLIVSSGP
FT                   AVQQNPDDGLPTEPPMDDLPTDDGEDDGAGIDLNGDPFG"
FT                   /protein_id="YP_003650685.1"
FT   gene            complement(66847..67437)
FT                   /db_xref="GeneID:9166528"
FT                   /locus_tag="Tbis_0056"
FT   CDS_pept        complement(66847..67437)
FT                   /locus_tag="Tbis_0056"
FT                   /gene_family="HOG000025029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pde:Pden_2136 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="GI:296268054"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="GeneID:9166528"
FT                   /translation="MTATRVLVVDNHDSFVHTIVQYLRRLGAHCDVRPRDRVGLTDTAG
FT                   FDGVLISPGPGSPEAAGISVPLVRHAAEHRLPLLGVCLGHQAIAVAYGATVARAPELMH
FT                   GRTSPILHDGRGVFRSLPSPVTMTRYHSLAVVPGTVPPELEVSAVTPDGVIMGVRHRTA
FT                   PIEGVQFHPESIASEHGHRLLKNWLEMCNTRPL"
FT                   /protein_id="YP_003650686.1"
FT   gene            67590..67835
FT                   /db_xref="GeneID:9166529"
FT                   /locus_tag="Tbis_0057"
FT   CDS_pept        67590..67835
FT                   /locus_tag="Tbis_0057"
FT                   /gene_family="HOG000235738" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="GI:296268055"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="GeneID:9166529"
FT                   /translation="MPKSKVRKKAVYTPPKRAQAVKTSPRWLAPLMVTCWIVGILWIAV
FT                   YYIAPQTPGIETLGNWNLLVGFGLIILGVILSTRWR"
FT                   /protein_id="YP_003650687.1"
FT   gene            complement(67943..68803)
FT                   /db_xref="GeneID:9166530"
FT                   /locus_tag="Tbis_0058"
FT   CDS_pept        complement(67943..68803)
FT                   /locus_tag="Tbis_0058"
FT                   /gene_family="HOG000235716" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /codon_start="1"
FT                   /product="rhomboid family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhomboid family protein; KEGG:
FT                   aba:Acid345_1881 rhomboid-like protein"
FT                   /db_xref="GI:296268056"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="GeneID:9166530"
FT                   /translation="MTSQPPPSPPHPPGAAVPTCYRHPDRETYVRCQRCDRSICPDCMR
FT                   EAAVGYQCLDCVQEGNRTVRRARTVFGGAPVTTARVSWTLLAINLLAYVAEVLDPERVI
FT                   SAYGMWSIGVYQGEWWRLITSAFLHAPPPSFWHILFNMWALYVIGPDLERLLGSARFAA
FT                   LYLLSALGGSVAIYLFGVAALGASGAIYGLFGALFVVARRLGTDVRGVLWLIGINVLIT
FT                   FVVPGISWQGHLGGLVTGTVVAAGLVYAPERHRTLVQSAVAVAVLAALICAVTLLPPYP
FT                   LALFR"
FT                   /protein_id="YP_003650688.1"
FT   gene            complement(68869..69399)
FT                   /db_xref="GeneID:9166531"
FT                   /locus_tag="Tbis_0059"
FT   CDS_pept        complement(68869..69399)
FT                   /locus_tag="Tbis_0059"
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="5.2.1.8"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: lpp:lpp1946 hypothetical protein"
FT                   /db_xref="GI:296268057"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="GeneID:9166531"
FT                   /translation="MAETLIANLRTNHGTIRIKLFPDKAPNTVRNFVELAEGTREWRHP
FT                   ATGERMTTPLYNGTIFHRVIDGFMIQGGDPIGQGTGGPGYMFDDEIHDKNRFDRPYLVA
FT                   MANAGKWRGRGTNGSQFFITVAPQPHLDRNHTIFGEVIEGTEVVDSIARTPTDHRDRPL
FT                   QDAVIEEVTIERS"
FT                   /product="peptidylprolyl isomerase"
FT                   /protein_id="YP_003650689.1"
FT   gene            69535..70017
FT                   /db_xref="GeneID:9166532"
FT                   /locus_tag="Tbis_0060"
FT   CDS_pept        69535..70017
FT                   /locus_tag="Tbis_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268058"
FT                   /db_xref="GeneID:9166532"
FT                   /translation="MRTSMGRGGRRESMLNPQDLMGRVRSAAKKAGVRMTPVAGTARDV
FT                   AAQRIEDARLWAAPKLDQAAHSVEEQIAPVVSAFLTELARRLESTAPKKTRRWPLAALC
FT                   TGAAIGAIGVAMYRGNAKRWAESVRDTVRGVEQPTTDWSQERTGSMQQGAEQTRRP"
FT                   /protein_id="YP_003650690.1"
FT   gene            complement(70076..71641)
FT                   /db_xref="GeneID:9166533"
FT                   /locus_tag="Tbis_0061"
FT                   /pseudo
FT   gene            72490..73785
FT                   /db_xref="GeneID:9166534"
FT                   /locus_tag="Tbis_0062"
FT   CDS_pept        72490..73785
FT                   /locus_tag="Tbis_0062"
FT                   /gene_family="HOG000219323" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   yen:YE2035 putative membrane transport protein"
FT                   /db_xref="GI:296268059"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:9166534"
FT                   /translation="MRARNRRTSGLGQDLGILRDRRFTLMLAARMFSALGLAFAPVALA
FT                   FGVLELPGATAATLSLVLAAESTPMVLFMLVGGVIADRMPRDRVMMAGETFNAIGYFSL
FT                   GAMLLTGWAPVPALAAAAAFSGIASAIVVPAMTGIVPDVVPAARLQTANALLGLVTNVS
FT                   RIAGLVLSGAAVALLGGGWALVASGAMFAAAAVLIALLRLTPAERAENGSGSIIADLRL
FT                   GWREFASRQWLWVVVAQFSIVVMAVNAAHGVLGPLIAKEHLGGAPAWSVFLTGEAVGML
FT                   TGVLIAMRIRPQRPVLITALLAIPSALPYLLLGGGAPLWAVVAGAFVLGVSFDVLGVLW
FT                   NTTMQREIPPEALSRVSSYDALGSLMFGPIGLLVAGPAALMIGPRPALIGCAVIIVAVS
FT                   LVAVLFPGVRGLRAPAPAPAAAADGSVTAPAQ"
FT                   /protein_id="YP_003650691.1"
FT   gene            74110..75369
FT                   /db_xref="GeneID:9166535"
FT                   /locus_tag="Tbis_0063"
FT   CDS_pept        74110..75369
FT                   /locus_tag="Tbis_0063"
FT                   /gene_family="HOG000183770" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: lpn:lpg1638
FT                   drug:proton antiporter"
FT                   /db_xref="GI:296268060"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:9166535"
FT                   /translation="MAGVQERLRRVALDTRPLSFAPYRRLLVGQGVSFIGFQLTAVAVS
FT                   GQVYAISGSSLWVGMLGPVSLVPLVVFGLWGGAFADAIERRRLLLIGSVISWSATVALL
FT                   LHAWSGLNSVPVVLAAVAVQSIGFAITSATRGAIIPRLLPTERVAAANTLNFMVSNFGT
FT                   VVGPLLAGAVLHFGGFALAYLLDAILFGAGFYAAVRLPRIEPLGEISRPGLRSVLDGLR
FT                   YIATQPIVLMSFVVDIIAMALAMPRALFPEMTAERFGGSSVAFGWLSASIAIGSVTAAL
FT                   FSGWVGRVRRQGVALTLVIALWGLAVAAAAFARPLWLVVTLLAIAGAADLASAVWRQTI
FT                   LQTYAPDELRGRMQGVFMVVVAGGPRLGDLRAGAMASAYGLVTAWALGGLLCTVLVLIV
FT                   GFAVSSFRRYDAFARRQETG"
FT                   /protein_id="YP_003650692.1"
FT   gene            76172..77542
FT                   /db_xref="GeneID:9166536"
FT                   /locus_tag="Tbis_0064"
FT   CDS_pept        76172..77542
FT                   /locus_tag="Tbis_0064"
FT                   /gene_family="HOG000158927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="PAS sensor protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PAS sensor protein; KEGG: bba:Bd1322
FT                   putative sensory protein"
FT                   /db_xref="GI:296268061"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="GeneID:9166536"
FT                   /translation="MSLQRVAVPNGVEQKVGADELFFSTTDRQGRIRSGNSVFARISQF
FT                   SIEELVGSPHNIVRHPEMPAGVFRLIWDRLYADRPVGTYVKNLARDGSSYWVFATVTPL
FT                   GTDGYLSVRMAPRTPLFTTVQRIYEYVLEAEREAAERDGLNRREVARLGKERLEEMLRR
FT                   LGFHSHDEFLAEALSGEVAARGRMASGTYARPWAEGAIAEVLSSSGALEEILASLVQRL
FT                   DSYRTLSERLERASTNVLDIARRLERTVDTAQAASARVADTAPVLHNVARVMATPARTA
FT                   VAELEQLGPRLRELRGYLTELRFRIALASLHNDMVAAFAAEVADGAAPASSLSEVPHLC
FT                   DTMHDSVLEMSAKMQEVNRTLHDVVAEVNLASERLQDFYRFLGQWRILVVRRGAERTLA
FT                   DLVQPIDEEFAASWSGMDMLRDLVREFQAAIARFDVDAVEAQLTRIRSAAAASRALV"
FT                   /protein_id="YP_003650693.1"
FT   gene            complement(77768..79189)
FT                   /db_xref="GeneID:9166537"
FT                   /locus_tag="Tbis_0065"
FT   CDS_pept        complement(77768..79189)
FT                   /locus_tag="Tbis_0065"
FT                   /gene_family="HOG000147530" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_0926"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_0926 hypothetical protein"
FT                   /db_xref="GI:296268062"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:9166537"
FT                   /translation="MAKLRGETDVPVIAIVGGGASGTLTAVHLLRLSRSHGVPMRVVVI
FT                   DRYGRHGVGQAYATDDPLHLLNACADKMSAFPDDPGHLLRWARTIGLEVAGSDFLPRQV
FT                   YGRYLCHVLDTAVAEAWPYGRLARVTGTASELHVPGPRGPVRVALSDGTGVDADAVVLA
FT                   TGNLPTADWPVAAAAGHRYIADPWEPGALGRIRGGRAVLVIGTGLTMIDVALTATRARS
FT                   DAVVHAISRHGLLPRPHRCPPPAPVPTDLPDGPLRLAELVRAVRRAVRDNGGEWQAVVD
FT                   GLRPHIPRLWARLGHDDQRRFLRSVARYWEVHRHRLPPAAAARIAELRSSGRLHVLRGT
FT                   LTGVTAEGELLTARVTGANGRTRDLVVDRIVNASGPSSPLSGNPLYRRLFAAGLARPDR
FT                   LHLGVDADEDGAVLDATGRPSDRIFTLGPPLRGLRYETTAIPEIRAQAAALAPRLLETV
FT                   AAASSPRLQPGGLPR"
FT                   /protein_id="YP_003650694.1"
FT   gene            complement(79520..80668)
FT                   /db_xref="GeneID:9166538"
FT                   /locus_tag="Tbis_0066"
FT   CDS_pept        complement(79520..80668)
FT                   /locus_tag="Tbis_0066"
FT                   /gene_family="HOG000263790" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00937"
FT                   /codon_start="1"
FT                   /product="chromate transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   mxa:MXAN_6347 putative chromate transporter"
FT                   /db_xref="GI:296268063"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="GeneID:9166538"
FT                   /translation="MRRRNGTIKEVALVFLRLGTIAFGGPAAHIAMMRDEVVRRRGWVT
FT                   DQRFADLIGATNLIPGPNSTELAIHLGFDRGRWRGLITAGVCFILPAALIVTALAWAYV
FT                   RYGGTPAVAGVLYGVTPVVVAIIAHALAGLVRTVIKGVWLGVLAAGVLAGYLLGVNELV
FT                   LLFGGGAVAGLAHLIRHPPSPGGRHALVSAPLLLTARPGFPAADGADLAQLFLTMLKIG
FT                   AVLYGSGYVLLAFLDGDFVDRLGWITERQLLDAVAIGQVTPGPLFTTATFVGYLVAGPL
FT                   GAFLATVAIFLPSFVFVGLLTRLTDRLRSRAWTGALLDGVNAASLALMAGVSAELARQA
FT                   VVDPLTLAVAVAALGLLWRTRIHHAWLIAGGALIGVAHALLT"
FT                   /protein_id="YP_003650695.1"
FT   gene            complement(80978..81865)
FT                   /db_xref="GeneID:9166539"
FT                   /locus_tag="Tbis_0067"
FT   CDS_pept        complement(80978..81865)
FT                   /locus_tag="Tbis_0067"
FT                   /gene_family="HOG000220525" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transporter inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0946
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:296268064"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9166539"
FT                   /translation="MIATSKPAPRTASRPRSRRQGVGERPNWIGGAVAWLWLLVVIVPI
FT                   YWIVITSFKTQANYYATNPLLPPTEPVLDNYRLVIESDFPRYFRNSVIVAVGAVVPAVA
FT                   FSFMAAYAIVRAGAASRFLRLVNSLFLMGLAIPLQAAVIPIYLIIIKLRLYDSLTALIL
FT                   PSIAFAIPLSVLVLSNFIRDVPKELFESMRIDGAGEMKMLWRLALPLTRPAVVTVTIYN
FT                   ALTIWNGFLLPLILTQSPDKRTLPLALWTFQGQYSVNVPAVLASVVLTTLPILILYAVG
FT                   RRQLLSGLTAGIGK"
FT                   /protein_id="YP_003650696.1"
FT   gene            complement(81862..82788)
FT                   /db_xref="GeneID:9166540"
FT                   /locus_tag="Tbis_0068"
FT   CDS_pept        complement(81862..82788)
FT                   /locus_tag="Tbis_0068"
FT                   /gene_family="HOG000220406" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transporter inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0945
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:296268065"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9166540"
FT                   /translation="MSRIARSTLTPQAAAGRGSAGGGLGWLALPALAVFVAFGVVPLIG
FT                   VLALSFTSWDGLGEIRWTGLTSWREVLTDPGLPHALWVTFLVMAFSWLVQTPASILIGV
FT                   FLAGHQRYREVLAVLYFIPLLLSSAAIAITYKALLDPNFGLGAGLGVDLLVQDWLGEPV
FT                   LAFGVVIFTVSWQFIPFHALIYQGGVRQIPRSLYEAAEIDGAGRIRKFFSITLPQLKYT
FT                   IITSSTLMVVGSLTFFDLIFVLTEGGPGDATRVLALEMYKRGFQANLMGPASAIAVVLV
FT                   LLGLVLALLLRRIGGRDPGASQLEGAS"
FT                   /protein_id="YP_003650697.1"
FT   gene            complement(82785..84131)
FT                   /db_xref="GeneID:9166541"
FT                   /locus_tag="Tbis_0069"
FT   CDS_pept        complement(82785..84131)
FT                   /locus_tag="Tbis_0069"
FT                   /gene_family="HOG000236156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vei:Veis_0944 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="GI:296268066"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9166541"
FT                   /translation="MESRTFTRRSFLGLSIGLPLGATLAACGTSGPTGTGSSPGGGGGG
FT                   AKATYWFLSGQPQEGVRMGAVERFNKANPGGQIEPTTFQNDAYKTKIKTAIGAGQAPTI
FT                   IWGWGGGTLRSYVQAGQVEDLTSWFEEHPEVKDRLFPSSFGAATIDGRIYAMPCETVQP
FT                   IVLFYNKRVFEKVGVEPPQSWGDIMALVPKFNAHGIAPFSLGGQSRWTSMMWLEFLFDR
FT                   IGGPEVFQAVFDGEKDAWSHPAALDALTKIQELIKAGGFVKGFSSITADSNADQALLYT
FT                   GKAAMMLHGSWSYGIQAAEGGDFVSSGALGFMNFPPVEGGKGDPSNTVGNPGQYLSISS
FT                   AATPEQKEIAKKFFATGVLDEEEQKGWVETGGVPIVKGVDKFFANSKDAEFLNFVYGIA
FT                   SNAKSFAQSWDQALSPTAAEVLLDNIAKLFQLSISPQQFVDNMNAVIGK"
FT                   /protein_id="YP_003650698.1"
FT   gene            84613..85980
FT                   /db_xref="GeneID:9166542"
FT                   /locus_tag="Tbis_0070"
FT   CDS_pept        84613..85980
FT                   /locus_tag="Tbis_0070"
FT                   /gene_family="HOG000000071" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ret:RHE_CH03421 hypothetical protein"
FT                   /db_xref="GI:296268067"
FT                   /db_xref="GeneID:9166542"
FT                   /translation="MTDGDKTRVRPPAWAWALALVVIAAATAPLIHHWLTNPEDQRLVD
FT                   LEVYRAGGAALLLGRPLYEVITPAPQLLPFTYPPIAAMLAMPFAMLPWAVAQWVWTLGI
FT                   VAVLAVTVAVCFRPLVAAATAAPAGPPWWRRLMRSGAAVPLLIALLTAACAYLMPIRDQ
FT                   FRFGQVGVFLMALCVLDCTVRRPWWPRGMLIGLATAIKLTPGVFLIYLAITGFPRRDGD
FT                   PEQRRALYMAVFTAALLTLLPFLLVFDDARDYWFRALLDSGRVGANNATTNQSLRGMLL
FT                   RLYWPAPLTTALWLAAVAVIGWYGFRRARRAYRAGDPMTGIALTGLMAVLLSPVAWIHH
FT                   LAWLVVALAALAGTGRDPRRLLAAAAVWLYFTVPIPWWGVSIKALEIPVLSPVVGKLVQ
FT                   NGFGLGAVALVWVLGSGVLDRPARRPAVRPKARTEAAGENGPVGTVEGGDRRKAGR"
FT                   /protein_id="YP_003650699.1"
FT   gene            86020..86994
FT                   /db_xref="GeneID:9166543"
FT                   /locus_tag="Tbis_0071"
FT   CDS_pept        86020..86994
FT                   /locus_tag="Tbis_0071"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.51"
FT                   /transl_table="11"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="GI:296268068"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="GeneID:9166543"
FT                   /translation="MEWTDRTPSTHQLRYPFPMAKLAYLGPQGTFCEAALRRLQPDAER
FT                   MPCPNVGAALDAVRNGEADGAVVPMENSVEGAITETLDELAWGAPLLITGEYLLPVEFS
FT                   LLARPGTELGQIKRILTHPAAHTQCRGFIEKELPGAVVIAASSTAAAAQEVASPASPYD
FT                   AAISPAIAGEYYGLVELASNIGDRKDTVTRFVQVSPPGRLPEPTGADRTSLVAFLRDDH
FT                   PGALLEMLSEFAVRGVNLSRIESRPTGDGIGRYFFHFDCEGHIADARVGEAISGLYRLC
FT                   SGVRFLGSYPRADRVAPKIKPGTTDTDFETAAEWLARIRAGQV"
FT                   /product="prephenate dehydratase"
FT                   /protein_id="YP_003650700.1"
FT   gene            87439..88704
FT                   /db_xref="GeneID:9166544"
FT                   /locus_tag="Tbis_0072"
FT   CDS_pept        87439..88704
FT                   /locus_tag="Tbis_0072"
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.11"
FT                   /transl_table="11"
FT                   /note="KEGG: bcz:BCZK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="GI:296268069"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="GeneID:9166544"
FT                   /translation="MIDLRTLREDPDRLRASQRARGEDETVVDRLLSLDERRRTALTRF
FT                   ESLRAEQKRLGKSVSRASGDERQALLDRAKELAAEVKAAEAEAEALGQELDELLMTVPN
FT                   IVEEGAPQGGEDDFVVLEHVGEPPTFDFTPRDHVELGELLGAIDIDRGAKVSGARFYYL
FT                   TGAGARLVHGLLTMAMHQAIEAGFTPVIPPVLVKPEAMAGTGFLGAHSAEVYRLEADDL
FT                   YLVGTSEVSLAAYHADEILDAAALPLRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFSFCRPEDAHEEHLRLLGWQKQMLDKIEVPYRVVDIATGDLGTSAARKYDCEAWLPSQ
FT                   GRYRELTSTSNCTDFQARRLRVRYRDEDGTTRHVATLNGTLATTRWIVAILENHQQRDG
FT                   SVVVPKALRPYVGLDVLEPVSR"
FT                   /product="seryl-tRNA synthetase"
FT                   /protein_id="YP_003650701.1"
FT   gene            complement(89300..89503)
FT                   /db_xref="GeneID:9166545"
FT                   /locus_tag="Tbis_0073"
FT   CDS_pept        complement(89300..89503)
FT                   /locus_tag="Tbis_0073"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ank:AnaeK_2588 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="GI:296268070"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="GeneID:9166545"
FT                   /translation="MAQGTVKWFNPDKGFGFIAPDGGEPDVFVHFSAIIGSGYRNLEDG
FT                   QRVEFDIVSSPKGPQASNVRGI"
FT                   /protein_id="YP_003650702.1"
FT   gene            89734..90543
FT                   /db_xref="GeneID:9166546"
FT                   /locus_tag="Tbis_0074"
FT   CDS_pept        89734..90543
FT                   /locus_tag="Tbis_0074"
FT                   /gene_family="HOG000184780" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /codon_start="1"
FT                   /product="HAD-superfamily hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; KEGG:
FT                   aha:AHA_3603 phosphatase YbhA"
FT                   /db_xref="GI:296268071"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR013200"
FT                   /db_xref="GeneID:9166546"
FT                   /translation="MTLPRLVATDLDGTALRSDGTISARTAAAFARVEKAGATLVFVTG
FT                   RPPRWMHEVAGAVRHHGLAICANGAITYDLHNEEVVEAHLIEPGILEECVHRLRTHLPE
FT                   LRFSAEYENHFGYEPGFRIGVLDSRHNAGAQLKLSTLTSRPCAKLLAQHPYLPSDELYR
FT                   RTLDLVGDLVTPTYSSDSETRALIEMSAHGVTKATALAAFAAGHGIDAAEVVAFGDMPN
FT                   DVPMLTWAGRSYAVANAHPEVLAAVDHVTAANNEDGVALVLEELFPE"
FT                   /protein_id="YP_003650703.1"
FT   gene            complement(90561..91100)
FT                   /db_xref="GeneID:9166547"
FT                   /locus_tag="Tbis_0075"
FT   CDS_pept        complement(90561..91100)
FT                   /locus_tag="Tbis_0075"
FT                   /gene_family="HOG000239023" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268072"
FT                   /db_xref="GeneID:9166547"
FT                   /translation="MSADEGAPQIVVVGPQGMSVAGGDSRQSEREERSVADMVEQPAKV
FT                   MRIGSMIRQLLEEVRAAPLDEASRKRLKEIHESSIKELQEGLAPELVEELERLSLPFSD
FT                   DPDSPPTEAELRIAHAQLVGWLEGLFHGIQTTLFAQQMAARAQLEQMRRALPGGGTHQQ
FT                   QSHQEDHHRGGGGPYL"
FT                   /protein_id="YP_003650704.1"
FT   gene            complement(91179..92141)
FT                   /db_xref="GeneID:9166548"
FT                   /locus_tag="Tbis_0076"
FT   CDS_pept        complement(91179..92141)
FT                   /locus_tag="Tbis_0076"
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /codon_start="1"
FT                   /product="NAD(P)H quinone oxidoreductase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="GI:296268073"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="GeneID:9166548"
FT                   /translation="MRAIVIPEHGGPEVLTWQEMPDPHPAPGEVVIEVAASAVNRADVL
FT                   QRQGLYPPPPGASEIPGLECSGVIAEIGENVEGFSVGDRVCALLAGGGYAERVAVPYQQ
FT                   VMPIPDGVSLTEAAAFPEVACTVWSNVFMTAGLREGETLLVHGGGSGIGTFAIQLAKAR
FT                   GARVLVTAGSAEKLQRCFELGADDGVNYRVEDFAERFAGQADVILDIIGAAYLPRNIAA
FT                   LATGGRLVVIGLQGGTRGELNLGTLLAKRASVHASGLRARPVAEKAVICREVVEHVWPL
FT                   IGAGRIRPVVHAEVPLQEAARAHRMLEASEHVGKILLVR"
FT                   /protein_id="YP_003650705.1"
FT   gene            92965..94884
FT                   /db_xref="GeneID:9166549"
FT                   /locus_tag="Tbis_0077"
FT   CDS_pept        92965..94884
FT                   /locus_tag="Tbis_0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG0455"
FT                   /codon_start="1"
FT                   /product="chromosome partitioning-like ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296268074"
FT                   /db_xref="GeneID:9166549"
FT                   /translation="MDEGSPGGTAERGADALSGPLSGAAAGPGAGPLSDEAGGAGGTGT
FT                   GDTGIGTGGTDRTGTGGTEWTGGGTGVRGGAEQIGTGIGAGRDADQIGAGTGVGGGADP
FT                   IGAGGTDEPVSGARSLLDAALPLPPKPPERSFSWFSGPVQPAEEGGRREPGQERKDEPV
FT                   TGAAEGLAVPRDGGAPGAAPAPAGAAGVEQTAEPVSADEPTRAWFTSGTFAETMPVEPP
FT                   AEAASGSAGTPAEFPAAAPAMPPITGPGTPPATGTVGSSVGSDGPGVSQPSSSVPPGDP
FT                   AEPYAPGAQTGAAAEREPYQTGRRAASSGVPLSGSGRPSAESLDPDTLLKGRKKGPSRG
FT                   WRRAVYTMSGGLINPGEPPDVRRRHELIARARTPVAGGHHRVAVLSLKGGVGKTTTTVG
FT                   LGATLAQVRGDRVIAVDANPDRGTLSDKVELETSATVRDLLNERAQVKRYADIRAFTSQ
FT                   TPSRLEILASDRDPSVSEAFSGEDYQAVAEVLENFYSICITDCGTGLLHSAMSGVLRLA
FT                   DQIVLVSSPSVDGARAASATLDWLEAHGYGDLVRAATVVLCNVRPRSKSKVDLKKLQEH
FT                   FAARCRAVVRVPYDPHLEEGAEIDLERLQQATRDAYLELAACVGDGFAGPRSQRGLSPA
FT                   LQPS"
FT                   /protein_id="YP_003650706.1"
FT   gene            95029..95117
FT                   /note="tRNA-Ser1"
FT                   /db_xref="GeneID:9166550"
FT                   /locus_tag="Tbis_R0004"
FT   tRNA            95029..95117
FT                   /db_xref="GeneID:9166550"
FT                   /locus_tag="Tbis_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(95334..96704)
FT                   /db_xref="GeneID:9166551"
FT                   /locus_tag="Tbis_0078"
FT   CDS_pept        complement(95334..96704)
FT                   /locus_tag="Tbis_0078"
FT                   /gene_family="HOG000223680" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; KEGG: dac:Daci_1611
FT                   integrase family protein"
FT                   /db_xref="GI:296268075"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:9166551"
FT                   /translation="MNTSTDVKFWGIRRNKSSKTPSYEVRWTVAGRQRSRSRRTKALAE
FT                   HFLSELRQAAKRGEPFDVETGLPVSMVKVKQAVTWFSFVVAYVDMKWPHAAAKTRDSLT
FT                   DALATVTPALVDEDAPGKPDLALLRKALRQYVLPPVARHLPRPADVAAAVAWLERHSLP
FT                   LAELGKVRNVRLGLDALTLRLDGTPAAPTTIARKRAVFYNVLQYAVDLEELPSNPLDKV
FT                   KAWRPPKVREVVDRRVVVNPTQARELLTAVTYVGRPDRGRHLRAFFACLYFAGLRPAEA
FT                   LGLRLQDCHLPESGWGRLIISRSKPQANRRWTDTGEAHDDRGLKHRAQGEGRTVPIPPE
FT                   LVAILREHVDEFGVHDDGRLFRTSRGGVVSIATYCEAWQQARILALPPEQVASPLAARP
FT                   YDLRHAAVSLWLNAGVSAPEVAERAGHGVDVLLRVYAKCIDGGAEIASQRIEDALRM"
FT                   /protein_id="YP_003650707.1"
FT   gene            complement(96701..96892)
FT                   /db_xref="GeneID:9166552"
FT                   /locus_tag="Tbis_0079"
FT   CDS_pept        complement(96701..96892)
FT                   /locus_tag="Tbis_0079"
FT                   /gene_family="HOG000223681" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /codon_start="1"
FT                   /product="phage transcriptional regulator AlpA"
FT                   /transl_table="11"
FT                   /note="PFAM: Prophage CP4-57 regulatory"
FT                   /db_xref="GI:296268076"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="GeneID:9166552"
FT                   /translation="MTRNDRLLTVPEVLAELGGVSRRTFYRWRELGCAPRCIKLPNGEL
FT                   RIWRSDLMAWLESLREVA"
FT                   /protein_id="YP_003650708.1"
FT   gene            complement(96889..98274)
FT                   /db_xref="GeneID:9166553"
FT                   /locus_tag="Tbis_0080"
FT   CDS_pept        complement(96889..98274)
FT                   /locus_tag="Tbis_0080"
FT                   /gene_family="HOG000071950" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268077"
FT                   /db_xref="GeneID:9166553"
FT                   /translation="MPTAHALAGLITRLHDPQYARWAAQIRRTGGCRRPVHLRGTVEHY
FT                   DRATGRLLHRYSTSTEPDGVLRVPCKTRRASRCPSCAETYRADTYHLIRAGLIGGKGVP
FT                   ETVTSHPCLFVTLTAPSFGPVHTRRENNGTVLPCHPRRDAATCPHGRVMSCTARHGSDD
FT                   ARLGEPLCPDCYDYTGSVLFNALAPELWRRFTLALRRHLAKLGGLAPRAMRDQLMVSFA
FT                   KVAEYQRRGVVHFHAVIRLDGPDGPTSPPPAWATLDLLGEAVRHAASAVTATIPALDGQ
FT                   PERVLRWGDQLDIRPISMDGELTAQAVAGYIAKYATKYATKAAECVGTLDQRILPTADL
FT                   AALPVRDHARRLIAECLRLGALDELACLRLTQWAHMLGFRGHFATKSRRYSTTLGALRE
FT                   ARAAHKRDEQISVGRLPLFDEDTVLVIAHWQYAGQGLSAGDALLAAAITGVPMPSAVGG
FT                   DAR"
FT                   /protein_id="YP_003650709.1"
FT   gene            complement(98391..98507)
FT                   /db_xref="GeneID:9166554"
FT                   /locus_tag="Tbis_0081"
FT   CDS_pept        complement(98391..98507)
FT                   /locus_tag="Tbis_0081"
FT                   /gene_family="HOG000159208" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268078"
FT                   /db_xref="GeneID:9166554"
FT                   /translation="MTELALIPPRRWQCCHCGGTGLDSYGDTCPHCQGLGLC"
FT                   /protein_id="YP_003650710.1"
FT   gene            complement(98504..98680)
FT                   /db_xref="GeneID:9166555"
FT                   /locus_tag="Tbis_0082"
FT   CDS_pept        complement(98504..98680)
FT                   /locus_tag="Tbis_0082"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268079"
FT                   /db_xref="GeneID:9166555"
FT                   /translation="MRIHIEGTNAEIAYTLSKIRTILPVGRISPITPIRRRPHTWRVIV
FT                   DTAPQRAECRWAR"
FT                   /protein_id="YP_003650711.1"
FT   gene            complement(98695..99426)
FT                   /db_xref="GeneID:9166556"
FT                   /locus_tag="Tbis_0083"
FT   CDS_pept        complement(98695..99426)
FT                   /locus_tag="Tbis_0083"
FT                   /gene_family="HOG000053308" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: similar to C6orf97 protein"
FT                   /db_xref="GI:296268080"
FT                   /db_xref="GeneID:9166556"
FT                   /translation="MNSILSRLAVRLADTGPVVVLAAIAGAGSFTHIRDTAAESGQTGW
FT                   MSWAVAVCVDLTCVMAARERQRDKKTGRTQRGLVSWPTIVLVAGIALSLAANLHQAEPT
FT                   LWGRLTAGTPAGAFLIAVSMLERRASGPRLVPSAVPASSPVTDPGSATVPASSPTSEAS
FT                   SPTGGTSSPAPALVRAGQHGKDGTRGPSPALVDFARRVADEHRAKHGKPITRDQLRAHL
FT                   GVSNQLASDLLRTLRSTPDAP"
FT                   /protein_id="YP_003650712.1"
FT   gene            complement(99459..100841)
FT                   /db_xref="GeneID:9166557"
FT                   /locus_tag="Tbis_0084"
FT   CDS_pept        complement(99459..100841)
FT                   /locus_tag="Tbis_0084"
FT                   /gene_family="HOG000053310" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /codon_start="1"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /transl_table="11"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: cvi:CV_2479
FT                   cell division FtsK transmembrane protein"
FT                   /db_xref="GI:296268081"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="GeneID:9166557"
FT                   /translation="MPLPPVPRPVLLAVALVLVLVCWRQWAPVSYWYLFGFPCKAVWLR
FT                   WSWRHVASGCGLTKKRNRWWFTTVPGLVSSTGVVRVKRRLQRVAVDTKPWMGLPRPTRH
FT                   GFRVTFHLLDGQIPEDYAKVCDRLAHAWRIEAVRVVGSRPGRVTLQGINRDPLAHVIPA
FT                   VAPVEPPDGWRAEDLLRPVVGVLETGAPWRMDFRLIPHWMNAGATQSGKSNLINALIVG
FT                   LAPQPVALVGFDLKGGVELSPYTPRLTALATTRGECLDLLADLIGVMGARMLACRWLAV
FT                   RDIWQLPDASRPIPVVVMVDEIAELFLTADKAEKDQVTRTATALLRIAQLGRAFGIHLV
FT                   LSGQRIGSDLGPGVTALRAQIGGRVCHRVNDPETAVMTLGDLDPDALVAARSIPPELPG
FT                   VAVVTGSDGRWYRARSGYVSTAVAEQVATAYAHLTPSWAQVATSGLGHDLAPASENPQI
FT                   AA"
FT                   /protein_id="YP_003650713.1"
FT   gene            complement(100841..101176)
FT                   /db_xref="GeneID:9166558"
FT                   /locus_tag="Tbis_0085"
FT   CDS_pept        complement(100841..101176)
FT                   /locus_tag="Tbis_0085"
FT                   /gene_family="HOG000071972" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268082"
FT                   /db_xref="GeneID:9166558"
FT                   /translation="MRTIPIPVDVSMLRISCAKAPRPRLVSKETGEIKRDRDGNPIYEV
FT                   TLLVEDEAGRMELVKVYVTPEPQIAPGDEVVPVGLAASIWEQAGRWGIAYRARSIIPAG
FT                   SAGAGVG"
FT                   /protein_id="YP_003650714.1"
FT   gene            101315..101695
FT                   /db_xref="GeneID:9166559"
FT                   /locus_tag="Tbis_0086"
FT   CDS_pept        101315..101695
FT                   /locus_tag="Tbis_0086"
FT                   /gene_family="HOG000259573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: xau:Xaut_3372 GntR
FT                   domain-containing protein"
FT                   /db_xref="GI:296268083"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="GeneID:9166559"
FT                   /translation="MIEKTGRPAYMQIADELRRQIRSGSLPPGTALPSITQLCRRYDVS
FT                   ASVVKAAISVLRTEGLIVGQQGKGVFVRDPGSAAGREVAETSEIMEQLVEIRATLRDLR
FT                   ERVADLESAVFQEPKRSGERGK"
FT                   /protein_id="YP_003650715.1"
FT   gene            101961..102998
FT                   /db_xref="GeneID:9166560"
FT                   /locus_tag="Tbis_0087"
FT   CDS_pept        101961..102998
FT                   /locus_tag="Tbis_0087"
FT                   /gene_family="HOG000146496" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bxe:Bxe_A1993 P-loop ATPase protein"
FT                   /db_xref="GI:296268084"
FT                   /db_xref="GeneID:9166560"
FT                   /translation="MKSTQRPGWIPSRLREHREAHGLTLEAAGDLLRETARRHGLAVPA
FT                   ANFQTLWGHENGSIYPGPHYRRAYCLMYRATEPQLGFRPPLPGETEKAEIMISDLPAPS
FT                   DPAADEAAAKVIEEAVAKASVGGIQPDNPQQVALRNRIVDAWRRRHGGGSPRPILTLVG
FT                   GYAGSGKTEFSRFLSDITGWAFLDKDSLTRSMTERLLVSLGGDPNDRHSELYLTEVRPL
FT                   EYRFLMEAAWDNLNAGTSAILSAPFIAELNDEAWFKRLENRCAAKGIDLAAIWVRCDAE
FT                   SMREYIEFRGAARDAWKLANWETYLAGLDLEESPPTVHITVDNRLGSAITLADQTRQTL
FT                   KRILS"
FT                   /protein_id="YP_003650716.1"
FT   gene            102995..103621
FT                   /db_xref="GeneID:9166561"
FT                   /locus_tag="Tbis_0088"
FT   CDS_pept        102995..103621
FT                   /locus_tag="Tbis_0088"
FT                   /gene_family="HOG000106578" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rso:RSc2155 guanylate kinase"
FT                   /db_xref="GI:296268085"
FT                   /db_xref="GeneID:9166561"
FT                   /translation="MSAPPVGVGLYGPPCSGKSTITTALHQLDPRFRLLRKLKVGTGRA
FT                   DEYDMVTAEQLDQLRRAGRLLVQTYRYGNIYAVDRRQIEDMSSAGHAPVVHMGNIADLR
FT                   RLVGRTPDAWLRVLLWVPREVTERRSKDRGDTDTAERLRAWDETLADLTANTDEAFFHL
FT                   RLCTDRLDAEAAAKEIITAFHALTKAAEPRTAGGRQEDAPARRKE"
FT                   /protein_id="YP_003650717.1"
FT   gene            complement(103779..104075)
FT                   /db_xref="GeneID:9166562"
FT                   /locus_tag="Tbis_0089"
FT   CDS_pept        complement(103779..104075)
FT                   /locus_tag="Tbis_0089"
FT                   /gene_family="HOG000109990" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268086"
FT                   /db_xref="GeneID:9166562"
FT                   /translation="MDDLAELLESCPGLHPAAPQKGYTRVKWRESRPRADRIRVRGHTC
FT                   DCQPIVYELCQAGGLRFIRRFYRSDEVLVHESEWTRAAEAEQLWMKILLGQAR"
FT                   /protein_id="YP_003650718.1"
FT   gene            complement(104080..104328)
FT                   /db_xref="GeneID:9166563"
FT                   /locus_tag="Tbis_0090"
FT   CDS_pept        complement(104080..104328)
FT                   /locus_tag="Tbis_0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268087"
FT                   /db_xref="GeneID:9166563"
FT                   /translation="MDLEQIAAKYPGWVIWRGASEAGPGAWYATRRGTSLSYEQLNAGL
FT                   EQTVCGDDASALVVELERQAKIAARLAAEQGAKGRPR"
FT                   /protein_id="YP_003650719.1"
FT   gene            104440..104859
FT                   /db_xref="GeneID:9166564"
FT                   /locus_tag="Tbis_0091"
FT   CDS_pept        104440..104859
FT                   /locus_tag="Tbis_0091"
FT                   /gene_family="HOG000106634" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bam:Bamb_4443 GntR
FT                   domain-containing protein"
FT                   /db_xref="GI:296268088"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="GeneID:9166564"
FT                   /translation="MTIDPSADRPVYKQLADLIRARIQSGEYRPGQRLPAENDFVAEYG
FT                   ISRDSVRRAMAVLRGEGLIVTELRGSRVREVGEAVTVSISPGTQVAARMPTEPERKQLG
FT                   IAEGVPILIITEPDGETRKLPADRTIIEASKEQQG"
FT                   /protein_id="YP_003650720.1"
FT   gene            106536..107603
FT                   /db_xref="GeneID:9166565"
FT                   /locus_tag="Tbis_0092"
FT   CDS_pept        106536..107603
FT                   /locus_tag="Tbis_0092"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ypi:YpsIP31758_B0061 hypothetical protein"
FT                   /db_xref="GI:296268089"
FT                   /db_xref="GeneID:9166565"
FT                   /translation="MEDCEGWIDPQRGFAEFEIRQEGIGMFRRGNFEKLKFETRPCIHS
FT                   HENDPPSVYDEVRNIIYPVIRVTSSDGTTCIEISPNSPLCTPLLPLDDDGRPARVQTLK
FT                   IFLAGPTEKLELLRRSRELANSFLFELNVRHGSHYSLRSRVVGPSRPRRAVRTHDTVRF
FT                   PRTRVPNNVATLFSIPSEFGIRNNYTLAYLSYYQILEYYLPIVHRRDTIERVRRILRSL
FT                   DFDEEEDFSVLQIVTSVERSHGASEIDQLRTLIEKCVPESKLKEFFSLDHNGHFGKRGP
FT                   ISGVPAIYPTSGESLASQVAKRIYKLRNRIVHAKDDARYSESTVLLPFSHEAMQLYPDI
FT                   ELLRLLAIEVIVSNQ"
FT                   /protein_id="YP_003650721.1"
FT   gene            complement(108291..108851)
FT                   /db_xref="GeneID:9166566"
FT                   /locus_tag="Tbis_0093"
FT   CDS_pept        complement(108291..108851)
FT                   /locus_tag="Tbis_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268090"
FT                   /db_xref="GeneID:9166566"
FT                   /translation="MSLEFDLTLKRLRRKEKRDFHLALTGKAGPYGEVTVTVGRTTKRA
FT                   DLSSATLPQAWVTDPDMDREGLVPLGKRSCLVVGDEQAELTQNRRALGKEDRALHIKLG
FT                   DRRYSYLAIKRNVEELRGADQEPLVRVRVIRGGRKISVLTETDPIDLALGLILQGADLR
FT                   GLTITRTVLFNVLDFLDTGKGEA"
FT                   /protein_id="YP_003650722.1"
FT   gene            complement(109303..109680)
FT                   /db_xref="GeneID:9166567"
FT                   /locus_tag="Tbis_0094"
FT   CDS_pept        complement(109303..109680)
FT                   /locus_tag="Tbis_0094"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268091"
FT                   /db_xref="GeneID:9166567"
FT                   /translation="MLLAKHRHYRASRPWYARVFGYLLDGMVGYGYRPGRAALWMLTLL
FT                   AAGSVFFAHHRPEPIKPGEHPHYHPVLYAADVLLPIINLGQESAFKHQGLGQWVASVLI
FT                   LLGWVLATAVVAGVTRVLTRT"
FT                   /protein_id="YP_003650723.1"
FT   gene            complement(110124..110858)
FT                   /db_xref="GeneID:9166568"
FT                   /locus_tag="Tbis_0095"
FT   CDS_pept        complement(110124..110858)
FT                   /locus_tag="Tbis_0095"
FT                   /gene_family="HOG000252095" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_0701
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:296268092"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9166568"
FT                   /translation="MSEAAENAAGVTRRERLRQQLMRDVMAAAREIAAEGLEGFTLTAV
FT                   ARKVGVSPPALYRYYDGKKGLIQALYRDLTEELMREVREAVERQDEDDIAAQLYASTKA
FT                   VLDWSVANREGFNLVFGATYPMIAGSGERIPRLISEELGGMYGRLFGRLWRQGVLTYPA
FT                   DEEIAPELRDQLKTYRDAITPDLPVGVVYLMITCWRQIYGVLTMAVNKHLDFAIDDIEP
FT                   LFNDMFGGLIRLLGLEPPSQAR"
FT                   /protein_id="YP_003650724.1"
FT   gene            111370..111885
FT                   /db_xref="GeneID:9166569"
FT                   /locus_tag="Tbis_0096"
FT   CDS_pept        111370..111885
FT                   /locus_tag="Tbis_0096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268093"
FT                   /db_xref="GeneID:9166569"
FT                   /translation="MATGYWTVRVRIDDGWLWIGNEAFPLRHISHVGQRTLEVDRQAAW
FT                   RRFGKLAGISLLLFVPLIAIAGDVFTIVLLAVLTALLWWLLSRLHKPALYGLVIHVGGT
FT                   RRDALWTAVKSELDHLVREITRAIGRPDAVKTTFYVEHAVQGDYLRRYGAGGHGEQQHL
FT                   GLAGGTAG"
FT                   /protein_id="YP_003650725.1"
FT   gene            113180..115207
FT                   /db_xref="GeneID:9166570"
FT                   /locus_tag="Tbis_0097"
FT   CDS_pept        113180..115207
FT                   /locus_tag="Tbis_0097"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: mxa:MXAN_5176
FT                   serine/threonine protein kinase"
FT                   /db_xref="GI:296268094"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:9166570"
FT                   /translation="MATGEASLGSQYVLLDEIGAGAMGAVWRARHRETGELVAVKLLRD
FT                   GLTGDQELVMRFVQERNVMRSLRHPNIVTVRDFVIEGDRLAMVMDLVEGGSLQALLRRH
FT                   GTLPPAEAARMMAEVADALAAAHAAGVVHRDVKPANILIEQATGRVRLTDFGVARIVYG
FT                   PGLTQSTAIIGTPMYLAPETAMGEKPTPAVDVYAIGLILYQLLAGRPPFIGDHPVALIK
FT                   QHSSAAPRRLPGMPDALWSLIARCAAKNPADRPTAAQVAAELRRAMPALAGLPPLPPVP
FT                   WDADPSITSEPLPASAAGPAPAVQRPGGAPGTGRPGGMPGAAGMPVPPGTADTAPGGTG
FT                   GTLPKGGKQAAGVPVPGFIGVPGAGGGTGAGSAGAPATGSGGAAGTGPAGVLATGSGGV
FT                   PQVGSTGVPGLPGAASRWSAKKRWLLAGTSTAAAGAVVLSVVFFAPWRSDGEAHTRALG
FT                   SASPGALATAMDSASAYPDDGDRDPVPTPAWEDQARRSPSPKATTARPSPSLTEVPRPV
FT                   VPPPTTQPRQTTAPRPQQSKTAQPRKTRVVQPEPKATTVKADEPPPSLNWQCRSWFDTG
FT                   QGVQMSPCMAMVGDTFYLLGRVQGSSAAKWDILVGLFDSDNDVFVSKTFTCLNGTAPYE
FT                   CGPFTVKVPRKGVKTDVRQRWRKSGTPSFGGGVESPWILW"
FT                   /protein_id="YP_003650726.1"
FT   gene            115606..116439
FT                   /db_xref="GeneID:9166571"
FT                   /locus_tag="Tbis_0098"
FT   CDS_pept        115606..116439
FT                   /locus_tag="Tbis_0098"
FT                   /gene_family="HOG000079046" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AN3511.2"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296268095"
FT                   /db_xref="GeneID:9166571"
FT                   /translation="MPESTDASVYFIGNATTIIRCNGFTLLTDPNFLHRGQQARLGWGI
FT                   RTRRRTEPAMSVADLPPVDLVVLSHLHGDHWDEIAERGLDPYVPIVTTPHAADVLRGRG
FT                   FGNAIGLETWQTYQVHRNSGVLSITAVPARHAPGPLDRLLPPVMGSVLDFCRGDDLDLR
FT                   LHISGDTVLDPCLAEIPRRFPEIDAAIVHLGGTRIFRVLVSMDGVQGAEWLQLIKPEVA
FT                   LPVHYDDYEAFTSPLSEFQHHVRRLGLTHAVHYLMRGETCRLPLRTRPRPVARPR"
FT                   /protein_id="YP_003650727.1"
FT   gene            complement(116605..117480)
FT                   /db_xref="GeneID:9166572"
FT                   /locus_tag="Tbis_0099"
FT   CDS_pept        complement(116605..117480)
FT                   /locus_tag="Tbis_0099"
FT                   /gene_family="HOG000245939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pla:Plav_1556 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:296268096"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:9166572"
FT                   /translation="MAAKDGDGWALCARGHQHWGIHGATGLLAVHHTLDGMPYVLLQKR
FT                   SWWTHHGGTWALPGGALDSHEDAISGALREVREETVLSTDLFRVQGIYVDDHGGWSFQT
FT                   VIAEAAGMLDAAPANGESVDLRWVAADEVASKPLHPGFADSWPKLRPALSPLVLVLDVA
FT                   NIIGSRPEELWWKDRARAANRLLNEVQPLATEGLRETPDGLPELARWFPRIVVVLEGAA
FT                   AVAADPEAHGTNLSVVVANGSGDDAIVQAVRERKPWERVLVVTADRALRERVTALGALV
FT                   AGPRWLLNQL"
FT                   /protein_id="YP_003650728.1"
FT   gene            complement(117524..117775)
FT                   /db_xref="GeneID:9166573"
FT                   /locus_tag="Tbis_0100"
FT   CDS_pept        complement(117524..117775)
FT                   /locus_tag="Tbis_0100"
FT                   /gene_family="HOG000162908" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268097"
FT                   /db_xref="GeneID:9166573"
FT                   /translation="MSGWLHLDPLPPVWPPDRFEVRSIRPGPEAPAADRYHFSALAQEA
FT                   ALRLRDIGLATQIQVIRLADGAILYDLAAGVHRPLAEW"
FT                   /protein_id="YP_003650729.1"
FT   gene            complement(118498..119562)
FT                   /db_xref="GeneID:9166574"
FT                   /locus_tag="Tbis_0101"
FT   CDS_pept        complement(118498..119562)
FT                   /locus_tag="Tbis_0101"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; PFAM: NHL repeat containing protein; KEGG:
FT                   bca:BCE_2353 triple helix repeat-containing collagen"
FT                   /db_xref="GI:296268098"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166574"
FT                   /translation="MLARWIKATVANRRTGISGQPQVRVRRSRLRSAITAVALVTGLTA
FT                   TASLPAPASADQTRQARQVAYVTNLNDDTVSVIDVASNTTIATIPVGNAPLGVAASPGG
FT                   TRVYVTNNGSNTVSVIDTATNGVIAVIPVGALPYDVAVSPGGTRAYVTNQGAGTVSVID
FT                   TATNIVIATIPVGNEPQGVAITPGGTRAYVANTGSNTVSVIDTATNTVIATIPVGAQPF
FT                   GVAVTPGGTRVLVTNRANSTVSVIDTATNTVIATIPVGAQPFGVAVTPGGTRAYVANTG
FT                   ANNVSVIDVARNSVITTVPVGTQPLGVAVTLGGTRAYAVNLTTVSVINTATNTVEATLG
FT                   VGNNAIEVAIANVP"
FT                   /protein_id="YP_003650730.1"
FT   gene            complement(119913..120377)
FT                   /db_xref="GeneID:9166575"
FT                   /locus_tag="Tbis_0102"
FT   CDS_pept        complement(119913..120377)
FT                   /locus_tag="Tbis_0102"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="GI:296268099"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166575"
FT                   /translation="MIDTATNTVIATIPVGNAPRGVAFSPGGTRAYVTNRSDDNVSVID
FT                   TATNTVIATIPAGDGPSEVAVTPGGTRAYVTNQTSGDVTVIDTATNTVITTIPTGASPT
FT                   GVAVTLGGTRAYVANFNSGTVSVINTATDTVEATLGAGVNPDYVAIANVP"
FT                   /protein_id="YP_003650731.1"
FT   gene            complement(120391..120969)
FT                   /db_xref="GeneID:9166576"
FT                   /locus_tag="Tbis_0103"
FT   CDS_pept        complement(120391..120969)
FT                   /locus_tag="Tbis_0103"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="GI:296268100"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166576"
FT                   /translation="MLIRSLTRRRTGRSGQPQVRVRRSRLRSAITAALVTGLTVLVPLP
FT                   TPVSAGETRQARQVAYVTNLNGNTVSVIDVAGNTTIATIPVGLGPTGVAASPGGTRVFV
FT                   VNQGSRTVSVIDTATNGVIATIPVGVTPFNVAITPGGTRAYVTNLGSDNVSVIDTATNT
FT                   VIATIPVGNGPIGVKVSPGGHPRLRHQPA"
FT                   /protein_id="YP_003650732.1"
FT   gene            complement(121532..122593)
FT                   /db_xref="GeneID:9166577"
FT                   /locus_tag="Tbis_0104"
FT   CDS_pept        complement(121532..122593)
FT                   /locus_tag="Tbis_0104"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="GI:296268101"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166577"
FT                   /translation="MLTRWSTTARAHGRTRGRGRRMRWARFRSAVTAVALATGLAALAP
FT                   VPAPATAGEARQGRQVAYVANRLDNTVSAIDVATYATIATIPVGAAPNGLDASPGGTRV
FT                   YVANQNAGTVSVIDTATNTVIATIPVGTSPADVAISFDGRRAYVSNTFSNDVSVIDTVT
FT                   NTVIATVPIGIGSFDLVVSPCGTRVYASNAFTGNVSVIDTATNTVIATIPVGTTPSGIA
FT                   ISPRGTRVYVTNAASDDVSVIDTATNTVIDTIPVGDAPNAVVITPGGTRAYVGNSGSNT
FT                   VSVIDTATNTVIATIPVGLGPVGMAVTPGGTRVFVADQSSDTVSVIDTATNTVIATLTA
FT                   GNVPSDVAIATVP"
FT                   /protein_id="YP_003650733.1"
FT   gene            complement(122958..123380)
FT                   /db_xref="GeneID:9166578"
FT                   /locus_tag="Tbis_0105"
FT   CDS_pept        complement(122958..123380)
FT                   /locus_tag="Tbis_0105"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: gur:Gura_3003 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="GI:296268102"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166578"
FT                   /translation="MLTRRSMTTAAHRRTGTSGQARVRWSRFRSVITALATGLAVLASL
FT                   PAPASAGDARQGRQVAYLTNQGNDTVSVVDITTNTVIATVPVGTQPFGVAVTAGGTRAY
FT                   VCNVDSMSVIDTATNTVIATLSLPDGPFEIAIAEVP"
FT                   /protein_id="YP_003650734.1"
FT   gene            complement(123923..124922)
FT                   /db_xref="GeneID:9166579"
FT                   /locus_tag="Tbis_0106"
FT                   /pseudo
FT   gene            complement(125305..126123)
FT                   /db_xref="GeneID:9166580"
FT                   /locus_tag="Tbis_0107"
FT   CDS_pept        complement(125305..126123)
FT                   /locus_tag="Tbis_0107"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="GI:296268103"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166580"
FT                   /translation="MLTRWFTTAAENRRSGISGEARPAVRRSRLGSAITAMALATGLTA
FT                   LASLPAPATAGDARQGRQVAYITNQDDNTVSAIDVATNTTIATIPVGNGPRGVAASPGG
FT                   TRVYVTNLGSDTVSAINTATNGVIAVIPVGADPFDVAVSPGGTRVLVTNSIDNTVSVID
FT                   TITNTVIATIPVGTAPNQLAVTPGGTRAYVANQGSNTVSVINTATNAVITTVPVGTGPI
FT                   GVAVTLGGTRAYVTDSGSDTVSVINTATNAVEATLTVGNTPTEVAIANVP"
FT                   /protein_id="YP_003650735.1"
FT   gene            complement(126435..127499)
FT                   /db_xref="GeneID:9166581"
FT                   /locus_tag="Tbis_0108"
FT   CDS_pept        complement(126435..127499)
FT                   /locus_tag="Tbis_0108"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bca:BCE_2353 triple helix
FT                   repeat-containing collagen"
FT                   /db_xref="GI:296268104"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166581"
FT                   /translation="MRWIRAAAENRRTDISGQTQVGVRWSRLRAVITAAALATGLTALA
FT                   ALPTTAAADETRQARQVAYVSNLTEGTVSAIDVATNTTIATIPVGNGPRGVAASPGGTR
FT                   VYVPNSTSGTVSVINTATNGVIAVIPVGTAPFDVAVTPGGTRAYVTNNGSNTVSVINTA
FT                   TNTVIATIPVGAQPFGVAVTPGGTRAYVTNNGSNTVSVIDTATNTVIATIPVGNTPLGV
FT                   AVTPGGTRVLVANRSDNTVSVINTATNTVIATIPVGSLPSEVAVTPGGTRAYVTNEGSG
FT                   NVSVINVAGNSVITTIPVGTQPFGVAVTLGGTRAYVANFASNTVSVIDTATNTVEASLG
FT                   AGSGPVEVAIANVP"
FT                   /protein_id="YP_003650736.1"
FT   gene            complement(127830..128894)
FT                   /db_xref="GeneID:9166582"
FT                   /locus_tag="Tbis_0109"
FT   CDS_pept        complement(127830..128894)
FT                   /locus_tag="Tbis_0109"
FT                   /gene_family="HOG000137953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /codon_start="1"
FT                   /product="40-residue YVTN family beta-propeller
FT                   repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; SMART: WD-40 repeat protein; KEGG:
FT                   gur:Gura_3003 YVTN beta-propeller repeat- containing
FT                   protein"
FT                   /db_xref="GI:296268105"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="GeneID:9166582"
FT                   /translation="MLTRWFTTAAENRREISHVQVGVRRSRLRSVIMAAALATGLTGLA
FT                   SLPTTATAEEIRQPRQVAYVTNNADNTVSAIDVASNTTIATIPVGAAPDGVAASPGGTR
FT                   VFVANNADNTVSVINTATNGVIAIIPVGAGPTGVAVTPGGTRAYVANSGAGTVSVIDTA
FT                   TNGVIATIPVGTAPTDVAVTPDGTRAYVTNNGSNTVSVINTATNTVIATIPVGVAPTGV
FT                   GVSPGGTRVLVTNETDGTVSVINTATNTVIATIPVGTTPSDVAFSPNGARAYVTNSGDG
FT                   TVSVINTAGASLITTVTVGTTPIGVAVSLGGTRAYVANSGDGTVSVIDTATNTVEATLT
FT                   VGATPTEVAIANVP"
FT                   /protein_id="YP_003650737.1"
FT   gene            complement(129232..129431)
FT                   /db_xref="GeneID:9166583"
FT                   /locus_tag="Tbis_0110"
FT                   /pseudo
FT   gene            129516..130340
FT                   /db_xref="GeneID:9166584"
FT                   /locus_tag="Tbis_0111"
FT   CDS_pept        129516..130340
FT                   /locus_tag="Tbis_0111"
FT                   /gene_family="HOG000067825" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00342"
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: xac:XAC0253 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="GI:296268106"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:9166584"
FT                   /translation="MAWYVAAPVAPDLSRDLVTAWTVRTEGRHRLVPDGCVDVLWIDNG
FT                   TVWVCGPETSAWSFRLPPGTQAVGVRFRPGRASAVFKIAAHELRDRRVALEDVLGSRAH
FT                   RLLAEQVGYAADEAARLRVMEDHVRRWVAEAPVADAVPAAVVRMLTRDIGTSITALADA
FT                   VGLGERQLHRRCLTAFGYGAATLRRILRLQGFLELARTAGDVTGLATLAAAAGYTDQPH
FT                   LSRDCRAIAGISPRALVAEARAGRLTGGPYDQVSRRISSARSAGRPLALVSG"
FT                   /protein_id="YP_003650738.1"
FT   gene            complement(130847..131074)
FT                   /db_xref="GeneID:9166585"
FT                   /locus_tag="Tbis_0112"
FT                   /pseudo
FT   gene            complement(131110..131868)
FT                   /db_xref="GeneID:9166586"
FT                   /locus_tag="Tbis_0113"
FT   CDS_pept        complement(131110..131868)
FT                   /locus_tag="Tbis_0113"
FT                   /gene_family="HOG000224522" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sun:SUN_0435 hypothetical protein"
FT                   /db_xref="GI:296268107"
FT                   /db_xref="GeneID:9166586"
FT                   /translation="MGERRKRRSAAVLGVAIAGLAACGGGGGTAGPAGSPAAGAASATP
FT                   VASPTATATAERQATPAPEPTFSATITKVTRADLPYSWRPGCPVRPGELRKITMTHWGF
FT                   DGKVHTGELVVHESVAEDVVSVFRTLFGYRFPIRRMEPIDVYKGSDYDSIEADNTSAFN
FT                   CRPATGSTRWSEHAYGRAIDLNPRENPYVYADGSNAHRNADAYVKRPLHKPGVINAGDR
FT                   VVRAFESIGWGWGGYWSGAKDYQHFSKSGR"
FT                   /protein_id="YP_003650739.1"
FT   gene            complement(132058..132510)
FT                   /db_xref="GeneID:9166587"
FT                   /locus_tag="Tbis_0114"
FT   CDS_pept        complement(132058..132510)
FT                   /locus_tag="Tbis_0114"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268108"
FT                   /db_xref="GeneID:9166587"
FT                   /translation="MSFASDPLAMAPQSIPADGLPAPADRLTTKQPGLVIGGGLRRTVR
FT                   ALLTWARHLWARYRWPPLVEGPRRRRTESRWRYARELDGRLQSWEIVITPGLLAREIWT
FT                   AGQVVLAHTTLRLTPASVAPWLAERHAQLHAAGWRIDSISGGPDGR"
FT                   /protein_id="YP_003650740.1"
FT   gene            132874..134049
FT                   /db_xref="GeneID:9166588"
FT                   /locus_tag="Tbis_0115"
FT   CDS_pept        132874..134049
FT                   /locus_tag="Tbis_0115"
FT                   /gene_family="HOG000149616" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Geob_1221"
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: ATPase"
FT                   /db_xref="GI:296268109"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="GeneID:9166588"
FT                   /translation="MDPVRNPYAPGAGQRPPELAGRDRELRQFEIVLERVARGRPERSM
FT                   VLTGLRGVGKTVLLNTFKSMAMQRLWGTGKIEARPDQSIRRPVAAALHMAIRELAPRHR
FT                   APERIEHVLSVLKAFALRDPGKGAANWTPAIDVPAARGRADSGDLVIDLTELFVDAASV
FT                   AADLGVGIALFIDEMQDVRPPDISALCAACHELSQSGGPLIVVGAGLPHLPTVLSASKS
FT                   YSERLFRYTRIDRLDREAADQALIAPAAREGVEFTPGALDALYEAADGYPYFVQAYGKV
FT                   VWDYAPKSPITADDVAVAAPEAEEELAVGFFGSRYERATPAERDYMRAMARLGDDPVPT
FT                   AAVAEVLGRKPSSLSPARDSLIKKGLIYSAERGLVGFTVPHFGRFLRAQPV"
FT                   /protein_id="YP_003650741.1"
FT   gene            complement(134301..134933)
FT                   /db_xref="GeneID:9166589"
FT                   /locus_tag="Tbis_0116"
FT   CDS_pept        complement(134301..134933)
FT                   /locus_tag="Tbis_0116"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268110"
FT                   /db_xref="GeneID:9166589"
FT                   /translation="MTGMSKAGSILKTAVLRLLALAVVAAIGYGGYLFFGPVPRASDEP
FT                   PDSTHDLETLCWYQRRYYPTVDAYQGPAPHPIQIFEESDSQVSDPGWSPARVRQSLPKH
FT                   WNRKHDDPTSVQLVACVEIADEGPRIGECRFRGRPIPMYQGRYRATLYEVRTGEKVAEV
FT                   DDILGRKDFEESMCPAMHVWREDKEPRLLSTPDAAEYQRVFGRYVDG"
FT                   /protein_id="YP_003650742.1"
FT   gene            complement(135376..136188)
FT                   /db_xref="GeneID:9166590"
FT                   /locus_tag="Tbis_0117"
FT   CDS_pept        complement(135376..136188)
FT                   /locus_tag="Tbis_0117"
FT                   /gene_family="HOG000110061" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_3810 hypothetical protein"
FT                   /db_xref="GI:296268111"
FT                   /db_xref="GeneID:9166590"
FT                   /translation="MLQFAAAAALPIVVAMLVLGGVAKLAAGDSAPGALARLGPAVLVP
FT                   ERFARPAMICCAAGEFALAAALVFADHPAARWLPVVFFSIATYVLWDLRKRRPDAGCGC
FT                   FGDVSVAPVGLRSIARSAVLTAMAVLVALERVTGADLPALWSGTVAAWIAGYAALLLLL
FT                   SPEVEELIDRVRYRAPCEQRRIPPGRALSRLKASAAWRAHRPMLAAEEPSDMWRELCWR
FT                   FFTFPAKDGSEVVFAVYLSGRRPAVKAAVVPPDGAPAIADDSRVPISR"
FT                   /protein_id="YP_003650743.1"
FT   gene            complement(136192..137295)
FT                   /db_xref="GeneID:9166591"
FT                   /locus_tag="Tbis_0118"
FT   CDS_pept        complement(136192..137295)
FT                   /locus_tag="Tbis_0118"
FT                   /gene_family="HOG000105517" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268112"
FT                   /db_xref="GeneID:9166591"
FT                   /translation="MVFIPALWPTGINYRKVGEKPFILEEDFCPRTAHRHGNHTAPPLT
FT                   ACEAGNVGNATPYRAVDRRRMLAAAALGREVAPLEPAPGDVAPYGTVRGSIIDVSPHLI
FT                   VVEDDAGEEHRLVIAPWATAWRGAPIAPAELPLRANVIIRALHGGTVADRVWADITRIT
FT                   GTIRSVSGNRDLTIELDCGPHRRPRSVVVPYRATGRIRVRHPQLEPGYLFDAIGMIDEG
FT                   TTLALLPATSQPPYRANAVPPPPPAYRGVQPTISGTAVWGDFEEYGVAYPMLEPGDAGC
FT                   EDAGVSCTGLPYLSLGSVLHVLNECDRRGNRLPIVACGCVAGRFCDRCLECGTSERGRI
FT                   VELSTTAYVELGGELTKGCFNVRVGLG"
FT                   /protein_id="YP_003650744.1"
FT   gene            137418..137918
FT                   /db_xref="GeneID:9166592"
FT                   /locus_tag="Tbis_0119"
FT   CDS_pept        137418..137918
FT                   /locus_tag="Tbis_0119"
FT                   /gene_family="HOG000094755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /codon_start="1"
FT                   /product="LuxR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   regulatory protein LuxR; sigma-70 region 4 domain protein;
FT                   KEGG: bac:BamMC406_4381 ECF subfamily RNA polymerase
FT                   sigma-24 factor"
FT                   /db_xref="GI:296268113"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="GeneID:9166592"
FT                   /translation="MVVNHEEFRAYVQSRGAALLRVANQITGNPSDAEDLLQAALAKTY
FT                   LAWEKIKDRASLDGYVRRAMVNINISWWRRRKLEEFPAERLPDVPIQPEARNRYDELEQ
FT                   ALDRLPARQRTAIVLRYYEDMSEMEIARALGISVGTVKSSVSRGMAKLRDDLLVSADRK
FT                   SLN"
FT                   /protein_id="YP_003650745.1"
FT   gene            complement(138250..139116)
FT                   /db_xref="GeneID:9166593"
FT                   /locus_tag="Tbis_0120"
FT   CDS_pept        complement(138250..139116)
FT                   /locus_tag="Tbis_0120"
FT                   /gene_family="HOG000159109" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /codon_start="1"
FT                   /product="nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: nuclease (SNase domain protein); Excalibur
FT                   domain protein; SMART: nuclease (SNase domain protein);
FT                   KEGG: sea:SeAg_A0011 protein ParB"
FT                   /db_xref="GI:296268114"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="GeneID:9166593"
FT                   /translation="MERPVSPLSRALTMVAAAAALAVPAVWASPAAAASRPKNVPKNSI
FT                   EVTVKKVVDANAIDVVTAKGRTVRIGLLEAESPVRGQCWNEEALKRLKELLPDGKRAYL
FT                   RTVKPLPFDDGRYLVYVWSRSGDFVNRDLVAKGYAQASPFGRKYAYTESILRAQSKAQD
FT                   TRLGIWSEACGEAAQRPLVVDLHVPQDSASVRQGGGTLVMPEIRGTDRPRSPERYIRGA
FT                   NPFEPAQPQPGAPAASATQPSGSGVDPRFRTCAEAIRYGYGDYRRGIDPEYDWYRDADG
FT                   DGVACER"
FT                   /protein_id="YP_003650746.1"
FT   gene            complement(139749..140258)
FT                   /db_xref="GeneID:9166594"
FT                   /locus_tag="Tbis_0121"
FT   CDS_pept        complement(139749..140258)
FT                   /locus_tag="Tbis_0121"
FT                   /gene_family="HOG000221450" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="MarR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ade:Adeh_4108 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268115"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="GeneID:9166594"
FT                   /translation="MSNICAYTESMDLFDDPRLTAMGLFAEVYAGLSAKTTRTFAEAGL
FT                   SEVDFETLIRLARSPERRLRMSDLAAQTSMSTSGITRVVDRLEREGLVERRACPNDRRS
FT                   LYAVLTDAGRKRLEQVLPQHLADIETWFTGLLTPEQLTQFLEALRTIRDVVRPNATAGV
FT                   APRHGR"
FT                   /protein_id="YP_003650747.1"
FT   gene            140326..140889
FT                   /db_xref="GeneID:9166595"
FT                   /locus_tag="Tbis_0122"
FT   CDS_pept        140326..140889
FT                   /locus_tag="Tbis_0122"
FT                   /gene_family="HOG000262659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /codon_start="1"
FT                   /product="YceI family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YceI family protein; KEGG: afw:Anae109_3192
FT                   YceI family protein"
FT                   /db_xref="GI:296268116"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="GeneID:9166595"
FT                   /translation="MSVREWEGLQIPTAGDFVLDQAHTRVGFVVRHMMVSKVRGHFGEF
FT                   EGKIVIAENPLESSVEAVIKAASIDTGVADRDAHLRSDDFLSADKFPEITFRSKRIAEH
FT                   SGNEFKVVGDLTIRDVTKEVTLDVEFGGAATNPWGKHIFGFSAKTEIDREDFGLTWNQA
FT                   LETGGVLVGKKVTIEIEGEAVRAE"
FT                   /protein_id="YP_003650748.1"
FT   gene            141155..141245
FT                   /note="tRNA-Ser2"
FT                   /db_xref="GeneID:9166596"
FT                   /locus_tag="Tbis_R0005"
FT   tRNA            141155..141245
FT                   /db_xref="GeneID:9166596"
FT                   /locus_tag="Tbis_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(141375..141923)
FT                   /db_xref="GeneID:9166597"
FT                   /locus_tag="Tbis_0123"
FT   CDS_pept        complement(141375..141923)
FT                   /locus_tag="Tbis_0123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268117"
FT                   /db_xref="GeneID:9166597"
FT                   /translation="MPDWDNAHAKAAALAGQAGGTAPVRVAVDEGTGCIAGVVSGYDHT
FT                   PEPLWPEEAERNEPSLFLATAFTHPCYYGQRIGRLMAWWALDHTHRLGRLWVRRGTGPY
FT                   PRLVDYYTREPGWALVKKDRAPGDDGLRVPAPGRAAAAPAGARMRLGVHSRPMPHTDRT
FT                   WPPGGDRPPDGESNVAAGR"
FT                   /protein_id="YP_003650749.1"
FT   gene            complement(142153..142362)
FT                   /db_xref="GeneID:9166598"
FT                   /locus_tag="Tbis_0124"
FT   CDS_pept        complement(142153..142362)
FT                   /locus_tag="Tbis_0124"
FT                   /gene_family="HOG000162909" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268118"
FT                   /db_xref="GeneID:9166598"
FT                   /translation="MTHDEAAAVAPGWRIWRSDAGRWWATRIRPFTAAAEAAGAARTVD
FT                   GDDLAELCRAIAEQERLAALAQRP"
FT                   /protein_id="YP_003650750.1"
FT   gene            142512..143750
FT                   /db_xref="GeneID:9166599"
FT                   /locus_tag="Tbis_0125"
FT   CDS_pept        142512..143750
FT                   /locus_tag="Tbis_0125"
FT                   /gene_family="HOG000146581" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: Tetratricopeptide TPR_4; SMART:
FT                   helix-turn-helix domain protein; KEGG: scl:sce3347 protein
FT                   kinase"
FT                   /db_xref="GI:296268119"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="GeneID:9166599"
FT                   /translation="MEDLPAWADRIRRERRNRGWSQKELAKRLAEVAARLGVPMPERAS
FT                   LIRSIRNWEAGRCRPRDPYPMLLARVLGLGEEELFAGSWQPYRPAPGEVLDGLLPEGDP
FT                   VGVLQAGRRIGPGIVAHLAARVHGLRRSDDVLGGGDLIGPVFRELGGIVRLYREGSHDA
FT                   RTGRALLTVIGECAQIAGWVASDAGRHDTAARTYRLGISAARQAGDRTLESHLLGSLGY
FT                   QEVNRGRLREGTELTRSAVRVLDRRSPARARALAWDRLAWAHARTGNAQAAMRALGEAG
FT                   DALAGDDGGETPAYLYWVNPAELQIMEARVYTELRRPLRAVPLLTEVLDRYDSTHAREL
FT                   GLYLSWLAVALVDANEPEEAARTARRMLEVSAGVASARTAERARVVLRRLQPYRDLPEV
FT                   RDVLSVAGDALQG"
FT                   /protein_id="YP_003650751.1"
FT   gene            143948..144406
FT                   /db_xref="GeneID:9166600"
FT                   /locus_tag="Tbis_0126"
FT   CDS_pept        143948..144406
FT                   /locus_tag="Tbis_0126"
FT                   /gene_family="HOG000242265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.17"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.17"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   reh:H16_B0667 acyl dehydratase"
FT                   /db_xref="GI:296268120"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:9166600"
FT                   /translation="MRIFKSLDEMKAAKGEHLGYSDWRQITQEQVNLFADATDDHQWIH
FT                   VDVERAKEGPFGGTIAHGYLSLSLLPSLVKEIYRVEGLRMGINYGLNRVRFPRPVPVGS
FT                   RVRAGAEILDVKDTQNGTLTALKVTLFVEGDEKPACVAETLSLLVPQT"
FT                   /product="enoyl-CoA hydratase"
FT                   /protein_id="YP_003650752.1"
FT   gene            144666..144738
FT                   /note="tRNA-Arg1"
FT                   /db_xref="GeneID:9166601"
FT                   /locus_tag="Tbis_R0006"
FT   tRNA            144666..144738
FT                   /db_xref="GeneID:9166601"
FT                   /locus_tag="Tbis_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(145297..146175)
FT                   /db_xref="GeneID:9166602"
FT                   /locus_tag="Tbis_0127"
FT   CDS_pept        complement(145297..146175)
FT                   /locus_tag="Tbis_0127"
FT                   /gene_family="HOG000109952" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268121"
FT                   /db_xref="GeneID:9166602"
FT                   /translation="MPTRRWAALAVTVLITSMITVNPATAQADAPRPVRAVKRLLRAKH
FT                   GVRVVETTRYFLDEWSKTFGNGVRIRGVLQLGPSGPVAVRFTWWDLPRKADSTAAKPDA
FT                   HRVIRLGKDVYVGRDQYPGPVPAGKKWIRFPKNHLGAMNRDMAQDAGLQPINVYDPSML
FT                   TAVLKRSTSTRVSGGFLYRGTMSYRELSKISKNAIVSWTTGRPIGKKSKGTIAWRLWTD
FT                   RTGLPTRLITTDTAGEGKKALVKRSDTRYTGWGFHLVVTAPPADEVIDEADLLAYVRRQ
FT                   NEPIPPDDKNT"
FT                   /protein_id="YP_003650753.1"
FT   gene            complement(146860..148044)
FT                   /db_xref="GeneID:9166603"
FT                   /locus_tag="Tbis_0128"
FT   CDS_pept        complement(146860..148044)
FT                   /locus_tag="Tbis_0128"
FT                   /gene_family="HOG000136927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bra:BRADO1326 major facilitator superfamily permease"
FT                   /db_xref="GI:296268122"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:9166603"
FT                   /translation="MTAVGTRSAAGGAASLLRVLPLAGASFAAGTGDMVIAGILPALAA
FT                   GLRVSEAAAGQLVTAYAVAYGCGTVLVAALTGGMPRRRVLTWGLAAFTVVNAAAAVVSS
FT                   FGVLLVLRVLAGLAAAACTPAAVAIAAEVAPEERRGRYLALVTGGLTVALVAGVPAGTW
FT                   LGGEYGWRSTMVFVALLGAVSLAGAAGVPFVPAPPSLGLRRRLAPLAVPAVARLLAATV
FT                   VSGIGGMMMLTYLFPVLREAGGVGHQQMTALFTLYGVAGTAAAWLGGRGADRWGPYRTL
FT                   VAALAGYGVTLWAAAALTMAGGVPSAVLGVVVVLLALAAWAINPPLQSMMYGFARGAAA
FT                   EAMALATAALFTGASLGGAMGGILLDGWGPAAIPLAGGVLLLAAVPLIPRRASS"
FT                   /protein_id="YP_003650754.1"
FT   gene            complement(148041..148424)
FT                   /db_xref="GeneID:9166604"
FT                   /locus_tag="Tbis_0129"
FT   CDS_pept        complement(148041..148424)
FT                   /locus_tag="Tbis_0129"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: gur:Gura_3524 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268123"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:9166604"
FT                   /translation="MQIGELARRAGVSTRALRYYEQVGLLAPARAANGYREYDELDLIH
FT                   ARNIRDLLAIGLTTEDIRGYLEKGCLDRPLEETPRCAAELTTVEARLRSLDERISRLQR
FT                   LRDRLARHGEEIRRAIENGEAVR"
FT                   /protein_id="YP_003650755.1"
FT   gene            complement(148610..149203)
FT                   /db_xref="GeneID:9166605"
FT                   /locus_tag="Tbis_0130"
FT   CDS_pept        complement(148610..149203)
FT                   /locus_tag="Tbis_0130"
FT                   /gene_family="HOG000248228" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bsu:BSU17080
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268124"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9166605"
FT                   /translation="MPRVVDHRARRAEIVSAVLDLIAREGAEAVTVRKAAAAAGVSVGA
FT                   LAHYFADKDELLTAAFTEVVARSAFRLRELPPYPDTAELLFQALLASLPLNDARHTEAR
FT                   VWLAFLDRALAREDSTALLRAVYDEWRKAIAEIITKGQKEGRFRADLDPLATAGSLIAH
FT                   VDGLTLQAVFDPAAFDHDTLRRLVHAQVRSLLAD"
FT                   /protein_id="YP_003650756.1"
FT   gene            149256..150092
FT                   /db_xref="GeneID:9166606"
FT                   /locus_tag="Tbis_0131"
FT   CDS_pept        149256..150092
FT                   /locus_tag="Tbis_0131"
FT                   /gene_family="HOG000109382" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /codon_start="1"
FT                   /product="abortive infection protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Abortive infection protein; KEGG: bat:BAS3057
FT                   CAAX amino terminal protease family protein"
FT                   /db_xref="GI:296268125"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="GeneID:9166606"
FT                   /translation="MTTAAHRADLRGLIWFYVLATAVTWVCYIPLVLDAHGRLSIDLDL
FT                   QSLLGLTAIMAPTLTACLLAAVRGGRGELRRLLGMAVRVRFAARWYLVVLLVPFAVPLA
FT                   AVAVESLTSGTAPAAWLVAPTTWTLATFWMAAVGEDLGWRGYALTRALGQWGPVKASVV
FT                   HGSLWALWHLPMFFMPGTAQNDQVFPMFLLQLIGATMIFVRIFIGTGGSVAAMMLMHAT
FT                   ANLAFNTVPVFATEGGNPTRAALVSVIYLLAGVVALATLPRRTSPTAGVTTVTEAA"
FT                   /protein_id="YP_003650757.1"
FT   gene            complement(150344..151981)
FT                   /db_xref="GeneID:9166607"
FT                   /locus_tag="Tbis_0132"
FT   CDS_pept        complement(150344..151981)
FT                   /locus_tag="Tbis_0132"
FT                   /gene_family="HOG000248328" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   afw:Anae109_0527 hypothetical protein"
FT                   /db_xref="GI:296268126"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="GeneID:9166607"
FT                   /translation="MSSVLLALLPALAGAAIAYLVARSRTAAERADLRVAQERYRQARA
FT                   EADGLRSERDKAHERVSGLEREHSKAQTELKTLTGQVTRLQAALEAGQERLQRAEAEAE
FT                   RLKASLETERQRLDERDRLLQEAEKKIAALAAREDKAREEVQELREQLSELTAQKQGLQ
FT                   EQAARLEAARKELDRIRERNNKLLEETLRATAADMLQKSRTELVAEAEERLAAVSKPVK
FT                   EQLALLDRQLQEFSTSRAAAEAKLDQQLATLAEEGARTREETRKLVEALKKPQVRGRWG
FT                   EMQLKRAVELAGLVEHCDFDSQVHLADDDNAQRPDLVIHLSNGRHVVVDAKVPMTAFIA
FT                   AIEASDDAEADKHWADHARQLRQHVDDLASKEYHRRVGASPEFVVLFVPSDAFLVPALE
FT                   HDPALQEYAATKRVMIVTPTILIAMLRTIAYAWTQAALEENLKQVYDIGRELYERLSKL
FT                   GEHFERLGKALNQSVKAYNDTVGSLERRVLVTARKFHSLKLTETQLKRLDPIEQAPRPL
FT                   GAPELTGPAADEASGVTPAPAGGPETIG"
FT                   /protein_id="YP_003650758.1"
FT   gene            complement(152496..153191)
FT                   /db_xref="GeneID:9166608"
FT                   /locus_tag="Tbis_0133"
FT   CDS_pept        complement(152496..153191)
FT                   /locus_tag="Tbis_0133"
FT                   /gene_family="HOG000159109" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /codon_start="1"
FT                   /product="nuclease"
FT                   /transl_table="11"
FT                   /note="PFAM: nuclease (SNase domain protein); Excalibur
FT                   domain protein; SMART: nuclease (SNase domain protein);
FT                   KEGG: bsu:BSU21610 hypothetical protein"
FT                   /db_xref="GI:296268127"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="GeneID:9166608"
FT                   /translation="MRQLPHALLALTTVALTVATATPAEAASRPKGVPKAAITAQVKKV
FT                   VDGDTIHVISRGRTLKVRLLEIDTPDWGQCWYNAATAKTKALLPVGKPVYLLRDRDPKD
FT                   RYGRYLFYVWSHNGTFVNRYLVRYGYARAMLIKPNDKYIKLMRSEEAKAKRQKLRIWSG
FT                   RCDKGGTAKPKTKGGTAEPKTTARTGTDPRFRTCAEANRNGYGPYYRGRDPEYAWYQDR
FT                   DGDGVVCER"
FT                   /protein_id="YP_003650759.1"
FT   gene            complement(153498..154877)
FT                   /db_xref="GeneID:9166609"
FT                   /locus_tag="Tbis_0134"
FT   CDS_pept        complement(153498..154877)
FT                   /locus_tag="Tbis_0134"
FT                   /gene_family="HOG000255106" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /codon_start="1"
FT                   /product="amino acid carrier protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: pde:Pden_0666 amino acid
FT                   carrier protein"
FT                   /db_xref="GI:296268128"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="GeneID:9166609"
FT                   /translation="MEDILSGISDFVWGPFLLIPLLLLTGLYLTIVLRGLQFHKLLYAL
FT                   WLAFIRRKEPEGTGDISHYQALSTALAATVGVGNIAGVATAIHFGGPGAVFWMWVTGLV
FT                   GMATKYCEAFLGVRFRRTDAKGEQSGGPMFYLTYGIGGKFGATLGILFAIFGAIAAFGI
FT                   GNMVQSNSVADAINSQWGVPMWVTGLIITVIAAVVILGGIKSIGAFTSAFVPVMIIFYI
FT                   LGALWVIIANIGSLPSAIATIVTDAFTGTAATGGFAGATVLLAIRYGVARGIFSNESGL
FT                   GTGGIAAAAAKTNEPVRQALVSMTQTFIDTIVVVGMTGLVIVVTGAWQSGENGAPLTSL
FT                   AFSQGLPGEWGGIIVTLGLVFFAFSTLLGWAYYGERCMDRLFGRGAVVPYRLVFIVLIF
FT                   VGTVLELQTVWTFSDIMNGLMALPNLIGLVLLSGLVVRETKAYFSRPDWQTEYRPVSTK
FT                   R"
FT                   /protein_id="YP_003650760.1"
FT   gene            155819..156145
FT                   /db_xref="GeneID:9166610"
FT                   /locus_tag="Tbis_0135"
FT   CDS_pept        155819..156145
FT                   /locus_tag="Tbis_0135"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268129"
FT                   /db_xref="GeneID:9166610"
FT                   /translation="MALVGGGGLDAFAVGAFAGAVYPQVGAPKRDGSLTHFMDIAQYGT
FT                   AEEVVRRLSHPRAANVTELAGELLRISVLVRRKYRFVRWGCWSLLTGVVLSLGSIITGW
FT                   LLTV"
FT                   /protein_id="YP_003650761.1"
FT   gene            complement(156549..157187)
FT                   /db_xref="GeneID:9166611"
FT                   /locus_tag="Tbis_0136"
FT   CDS_pept        complement(156549..157187)
FT                   /locus_tag="Tbis_0136"
FT                   /gene_family="HOG000109971" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268130"
FT                   /db_xref="GeneID:9166611"
FT                   /translation="MKKILRALTAFAAVFAFIGLSGPAHATTADTDPGLAAEWQYAWDT
FT                   YKFYDRTPPAPDSGRSQRTATISIVIDAPFRHVFDAYSNFSNHIGRNPFLTRVVTHKDW
FT                   RKGSLRHINLTAVEEVPYEGTIVTLNTHAQQRLHRSKRYYEVDSWSAPGVVTHQKIVFK
FT                   PLSKRQTKVTEYLTFEADNSLIDFTATNGVAAHQQIQAALKQAIENGEL"
FT                   /protein_id="YP_003650762.1"
FT   gene            complement(157227..158174)
FT                   /db_xref="GeneID:9166612"
FT                   /locus_tag="Tbis_0137"
FT   CDS_pept        complement(157227..158174)
FT                   /locus_tag="Tbis_0137"
FT                   /gene_family="HOG000085330" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="AraC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bsu:BSU05170 hypothetical protein"
FT                   /db_xref="GI:296268131"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:9166612"
FT                   /translation="MLERLNRAVDYIERHLDQRIDGAELARITLMSEYHFRRLFSALAG
FT                   IPLSEYIRRRRLTLAGAEVLAGKETLLDIAVRYGYGSGEAFARAFRALHGVGPAEARRT
FT                   GAALFSQPRISFRLVVEGSSGMRYRIVEKEGFRIVGKKARLPLVHEGMNPAIVAFVQSI
FT                   DPETRRRIEELSDQEPRGILNVSHDLAEGRAEGTEFDFYTAWSPALPRPRTWTCCPCRR
FT                   GRGRSSRSRATSPWRSSTCGGTSSPSGSRRTPIRAGRARRCSAPGSHRTGRGRTRSCGS
FT                   PWSGPRTDHGRPGAGSRDRSECWGECFQFERSVR"
FT                   /protein_id="YP_003650763.1"
FT   gene            158883..159275
FT                   /db_xref="GeneID:9166613"
FT                   /locus_tag="Tbis_0138"
FT   CDS_pept        158883..159275
FT                   /locus_tag="Tbis_0138"
FT                   /gene_family="HOG000162910" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268132"
FT                   /db_xref="GeneID:9166613"
FT                   /translation="MPAFKKILAGLALGTALTGGALTLGATAASATAPTGNFGPCFDNN
FT                   VFFNDCNNFWNNSNFWTSNCWNDSYDDSSAFVVSNGTATISFFDETHRDSYWSNSGWFN
FT                   NNGWFNNTPFFNDCGFGGFGGCGFGF"
FT                   /protein_id="YP_003650764.1"
FT   gene            159576..161072
FT                   /db_xref="GeneID:9166614"
FT                   /locus_tag="Tbis_0139"
FT   CDS_pept        159576..161072
FT                   /locus_tag="Tbis_0139"
FT                   /gene_family="HOG000020735" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: cti:RALTA_B1435
FT                   putative acyltransferase 3"
FT                   /db_xref="GI:296268133"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:9166614"
FT                   /translation="MRAALTRVRELAERTPPTRDRFIDLLRAISIIAVVLGHWLVSVVG
FT                   YDEQGELSGRSALPDLPWAFPITWAVQVMPIFFFVGGYANAASLTAERRRGGNAVEWLI
FT                   SRSGRLVRPTTTLVLVIAAGALAARLWDTDPSRVRLVAWFATIPLWFLVAYLTVVALTP
FT                   PMYALHRRYGLLVPLVLAGLVALGDVARLTGRPLWGYGNYLFGWLAIHQMGFAWYDGRL
FT                   PARPRVALPLLLGGFAALLLLTLAGPYPVSMINVPGERLHNMSPPSLALIAVATAQLGA
FT                   ALLLRERGERWLRRRTPWLVVVAVNTVIMVIFIWHISAAILLAGALHFAGVLPTPEVGS
FT                   PAWFAWRIPWLIMLSAVLALLIMVFGRFEPGGARVTGRVRVALPEAPARVVARPATRLI
FT                   LVIAGFVSVIYALLSNSSFPDAAPAVYGLPEDALITYLGGAAILRLLRSVPRREQARSR
FT                   AAAPDGIGPSRPVDRPGAGPETGRPEDSGGRAAGHPGGDR"
FT                   /protein_id="YP_003650765.1"
FT   gene            complement(161303..162376)
FT                   /db_xref="GeneID:9166615"
FT                   /locus_tag="Tbis_0140"
FT   CDS_pept        complement(161303..162376)
FT                   /locus_tag="Tbis_0140"
FT                   /gene_family="HOG000263663" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /codon_start="1"
FT                   /product="oxidoreductase FAD/NAD(P)-binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; KEGG: bam:Bamb_4089 oxidoreductase FAD/NAD(P)-
FT                   binding subunit"
FT                   /db_xref="GI:296268134"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="GeneID:9166615"
FT                   /translation="MTSTAESAPAAGTAEARPVSMVTADGERLEFPCAPGQSVLEAAAA
FT                   AGAALPASCRQGTCGSCHASVTGGAFDHGPCSPMALPPERREQGEVLLCRTYPQGPLSV
FT                   ALPYESSRILYGGIPRREAVITALETVARETVRLELQLEPDEEAGSGCQFEPGQFMELE
FT                   VPGTDAKRAYSLANTGNWEGRLEFFIRLRPGGLFSTYLQERARPGERLTAHGPQGAFGL
FT                   RETGLRPRWFVAGGTGLAPLLSMVRHMAEWQEPQPARLLFGVNEEADVFGLAELDAVAA
FT                   ELPGFRYEVCVWRPGPSWQGQAGTPADRVAELLAATAEKPDIYVCGPPPMVDAVAQAAL
FT                   TAGVPEERVIRERYLPT"
FT                   /protein_id="YP_003650766.1"
FT   gene            complement(162373..164034)
FT                   /db_xref="GeneID:9166616"
FT                   /locus_tag="Tbis_0141"
FT   CDS_pept        complement(162373..164034)
FT                   /locus_tag="Tbis_0141"
FT                   /gene_family="HOG000007176" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01703"
FT                   /codon_start="1"
FT                   /product="hybrid cluster protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: bvi:Bcep1808_5223 hydroxylamine reductase"
FT                   /db_xref="GI:296268135"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="GeneID:9166616"
FT                   /translation="MLCFQCEQTDRTGLTPGCAGPLGNCGKDPITSDLQDLLIHAVKDI
FT                   ARYAAKARELGAPDDEAAAFIVYAMFTTLTNVNFNPTRFDALIREAASVRDRVRARYEE
FT                   AARANGLQPEPPPASAQWEPAADLDGLLAQAAEARIDAGIDTVGPDIVGLRAFNLYVLK
FT                   GICAYAHHAHVLGHDSAEVFAGIESGLAYLASEPTDAEGLLERALELGRLNFRVIELLD
FT                   KANTGTYGAPQPTAVRVTPVAGKAILVSGHDLRDLAAVLELTKDTGINVYTHGELLPAH
FT                   AYPRLKAYPHLVGNYGGAWQDQQREFAAFPGPILMTSNCIIEPHLSYRRRIFTTGPVGW
FT                   PGVRHLADGDFTPLIQAAKALPGFAEDGPEEFITVGFGRETVLTHADRIIEGVRQGAIR
FT                   HFFLIGGCDGPTPGRDYYRELALSTPDDTVVLTLGCAKYRFNRHDFGEIGGLPRLLDMG
FT                   QCNDSYSAIRVAMALADAFGCGINDLPLTLALAWTEQKAAAVLATLLALGVRGIHLGPT
FT                   LPAYLTPALVDTLVDRFGLRLIGDPKADLAAALGRA"
FT                   /protein_id="YP_003650767.1"
FT   gene            complement(164105..164713)
FT                   /db_xref="GeneID:9166617"
FT                   /locus_tag="Tbis_0142"
FT                   /pseudo
FT   gene            complement(165383..166279)
FT                   /db_xref="GeneID:9166618"
FT                   /locus_tag="Tbis_0143"
FT   CDS_pept        complement(165383..166279)
FT                   /locus_tag="Tbis_0143"
FT                   /gene_family="HOG000221583" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03301"
FT                   /codon_start="1"
FT                   /product="tryptophan 23-dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: tryptophan 23-dioxygenase; KEGG: cak:Caul_5244
FT                   tryptophan 23-dioxygenase"
FT                   /db_xref="GI:296268136"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="GeneID:9166618"
FT                   /translation="MSISPPPPAPAAAELGPTTAEQRAAKAAANRGEPTLDFTGISPYD
FT                   AYVRASTLHTLQRPLSSEPGEMSFLMVSQIMELYFGLICFELCEARRALREDDLPAALA
FT                   PLNRAVLHLTGLNATWHGLSWMTPADFNRFRDLLGEASGFQSAMYRRLEFVLGYRSTSL
FT                   IRPFRRQPEVYQALVDEMRSRSIWDETIALLARRGFDIPHDLLERDFTEEHRPHEAVEA
FT                   AWVTVYREDTPDLRRLGDALAQIAEGFSDWRYEHLKAVKRTMGEKPGSGGSSGVAWLQR
FT                   SLARVVFPELWSARTII"
FT                   /protein_id="YP_003650768.1"
FT   gene            166449..166895
FT                   /db_xref="GeneID:9166619"
FT                   /locus_tag="Tbis_0144"
FT   CDS_pept        166449..166895
FT                   /locus_tag="Tbis_0144"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /codon_start="1"
FT                   /product="AsnC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bcj:BCAM1597 AsnC
FT                   family regulatory protein"
FT                   /db_xref="GI:296268137"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="GeneID:9166619"
FT                   /translation="MDDRDWELLRHLQADARLSFSELSRRVHLSPPAVAERVRRLEETG
FT                   VIRGYHAHVDLARAGWTVVALIRMSCYGPRCVLRDPEVREWPEVFEIHRITGDACCVLK
FT                   VAATSMEGFERLIDRLAPYGRPSSTMVLSTPVAWRPVVPPPSGP"
FT                   /protein_id="YP_003650769.1"
FT   gene            167163..167606
FT                   /db_xref="GeneID:9166620"
FT                   /locus_tag="Tbis_0145"
FT   CDS_pept        167163..167606
FT                   /locus_tag="Tbis_0145"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psa:PST_3778 lipoprotein, RlpA family"
FT                   /db_xref="GI:296268138"
FT                   /db_xref="GeneID:9166620"
FT                   /translation="MITQLAAAGVTAALLAAGASTPSPTPTPTRTVVVGKDGVPEEIVV
FT                   VPIPIDSSGRAEAVSIPMPDFGPTSIQLAADPRSRRRTSGNPAFDDRFWDRHWQVRQPA
FT                   KHKRPKKAKAVRNTASSARKHGAPAAQKPKKAKQARKNARARS"
FT                   /protein_id="YP_003650770.1"
FT   gene            complement(167681..172066)
FT                   /db_xref="GeneID:9166621"
FT                   /locus_tag="Tbis_0146"
FT   CDS_pept        complement(167681..172066)
FT                   /locus_tag="Tbis_0146"
FT                   /gene_family="HOG000053875" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /codon_start="1"
FT                   /EC_number="3.6.3.8"
FT                   /transl_table="11"
FT                   /note="KEGG: hch:HCH_00429 cation transport ATPase;
FT                   TIGRFAM: ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase-associated domain protein;
FT                   cation transporting ATPase domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="GI:296268139"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="GeneID:9166621"
FT                   /translation="MFLTQLFASYAPVLRDVLPEPLRGLVVTPRRVIACPGGLRIDLRG
FT                   IGGPGTERSAALLEERLSALPGVERAEVNGRLGCVFVGCDPEAVDREELLEIARELDEQ
FT                   ERHAHETPVRVVEEHIRSIIRLATGVAGVGTIFTGIALRAPRLSPAVPALVNLLNATPV
FT                   LREELDKRIGRGPANALFHTANLVTQTLTLRPLGLVAHSMAALSRYVETRAAQRSWVAL
FT                   ERRLAEVPGSYRHVRARFRRRPTHLPHGPIERYADLASTAAALTYGFMRFAARQDERAL
FT                   AVLTAITPKIAEYTREAFAGAVRRALGERDTVVFDAEALRRMDRVDTVVLDSDALTTGS
FT                   WAIDRVEPLVDELDLNELYARLYRLLDFTDPGATRIDEEWSAAPLTDPARFPGTHATEW
FT                   RGRGMRLVEVRRADTPVALVGLSREIDPLAVPIVAAAKAAGTVLLAGDEDGTAHRLAID
FT                   QVLPGGADLAHRVFEMQAEGHCVLVVSRRAREALAQADIGFGVMDPGTATVPWDADVAG
FT                   GLPGLHLLLIGLRRAETASRDGVRIGVAGGLIGALFSFAGPASGAVGRAQLVSSLGALV
FT                   AVAWGELAGRALARTPVPLRADPTPWHAMSVPEVLARLGSSPRGISEEEAERRRAAARP
FT                   VEIAAPRSLARTVLGELANPLTPALASGAAIAALIGSAVDSVMISGVMVINAFIGGVQQ
FT                   SQADRELTRLTETTSVRVRVRRPEGTVEIRKEDLVPGDVVELRAGDAIPADGRVIKSVG
FT                   LEVDESTLTGESQLIAKRTEPTIAAAIADRASMVYEGTTVAAGTGLAVVVATGEMTEAR
FT                   RAAQLGTAPPRVSGVELRMRELSRRVLPLSVGSGLFLLVTELLRGRSLAAALVPAVSLT
FT                   VAAVPEGLPFVATAAELAAARRLSRRAALVRNPKTIEALGRVNVLCFDKTGTLTEGRIS
FT                   LQYVSDGRAGRPVEELTHHLRRVIAAAVRASPKTGGGRVLAHPTDRAIHEAAERLSITP
FT                   REGLQVWERVDEMPFEPGRGYHAVLGRTEHGHLLSVKGAPEIVIDHCTTALRGTEVVPC
FT                   DDAVRHELTREVARLARQGYRVLAVAQRPASDRSDLDESRIDELCFLGFLGLADPVRAT
FT                   AAESVDRLMRAGVRIVMITGDHPSTAEAIAVELNTLNGGRIMTGPELDELDDETLTKLL
FT                   PEVSVFARVTPAHKVRIVSCLRRAGEVVAVTGDGANDAPAIRIANVGIALGSRATPAAR
FT                   SAADLVVTDDRIETVVDAIVEGRAMWSSVRDALSILVGGNLGEIIYTIASSLIGATALN
FT                   ARQLLLVNLLTDLAPAIAVALRPPTSTEPERLLTEGPEASLGASLMREIYVRAGVTALA
FT                   AAMGWLAGRATGTRGRAATIGLVALVTAQLLQTLSGGGTNRTVVLAVLASFALLCVIVT
FT                   APGVSGFFGCRPLGPVGWTVGLGSAGLAALIGEVVQRWLLRPVASAAPRPALTPAPAAA
FT                   "
FT                   /product="HAD superfamily ATPase"
FT                   /protein_id="YP_003650771.1"
FT   gene            complement(172896..173405)
FT                   /db_xref="GeneID:9166622"
FT                   /locus_tag="Tbis_0147"
FT   CDS_pept        complement(172896..173405)
FT                   /locus_tag="Tbis_0147"
FT                   /gene_family="HOG000232026" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cvi:CV_3594 hypothetical
FT                   protein"
FT                   /db_xref="GI:296268140"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9166622"
FT                   /translation="MPVQRLNHAVLYVRDLARSVAFYQEALGFRVIGDIALRGAAFLQA
FT                   PGSTNDHDLALFEIGPHAGPSTAGRHTVGLYHLAWEVDTLAELERIARKLQEMGALVGA
FT                   SDHSTTKALYAQDPDGLEFEVCWVVPADRLTDEIIAGRSTIRPLDLAKEIERYGAHTQG
FT                   GIGVSR"
FT                   /protein_id="YP_003650772.1"
FT   gene            173520..173732
FT                   /db_xref="GeneID:9166623"
FT                   /locus_tag="Tbis_0148"
FT   CDS_pept        173520..173732
FT                   /locus_tag="Tbis_0148"
FT                   /gene_family="HOG000109987" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268141"
FT                   /db_xref="GeneID:9166623"
FT                   /translation="MIGDDATRQYEANQALFRAVHEVAVRHAGAPFDQVVSALTGSLPP
FT                   TPRLQADEIRRIAEEISLGRDPSGL"
FT                   /protein_id="YP_003650773.1"
FT   gene            complement(174106..175527)
FT                   /db_xref="GeneID:9166624"
FT                   /locus_tag="Tbis_0149"
FT   CDS_pept        complement(174106..175527)
FT                   /locus_tag="Tbis_0149"
FT                   /gene_family="HOG000150084" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /codon_start="1"
FT                   /product="ROK family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ROK family protein; KEGG: cvi:CV_2895
FT                   transcriptional regulator protein"
FT                   /db_xref="GI:296268142"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="GeneID:9166624"
FT                   /translation="MKRAIRHDAMRARNLALVLGELSARGSLTRAALAEITGLTKTTVS
FT                   KLVSDLIEAGLVTEAGPVRDGERGRPGVEVQVSGDRVAALGLEVNVDYLALRVVDLAHT
FT                   VRLRRTQAVDNRGADPVEVIGSLRTMALSAVDEAVDMGLRVVGGGLAVPGPVDATGTVY
FT                   NAPNLGWREVPVAGLLDLPFPVRVENEANLAALGELWFGTGLPDFVYVSGEIGIGAGVV
FT                   VQGRLFRGTHGFAGELGHVVVRPEGPPCRCGGRGCLERYAGQEALLAAAGITGPGDAHR
FT                   PGSAHGPSTAQGSSIGRGSNTAHGSGSAQGSNTAHGPGIGQGSSTAQGPGTAEGPGTTE
FT                   GPGSAHGPDTAQGLDVTAEAPAAGVRDLLARLEAGDEAALAACEQAGAALGVALCSAVN
FT                   LLDPDAIVLGGIYAPLFPWLAEPVTEALTTRLGRMRPTVPPVVVSRLGTEAAALGAAGQ
FT                   VIEQVIADPAALLSG"
FT                   /protein_id="YP_003650774.1"
FT   gene            175636..176781
FT                   /db_xref="GeneID:9166625"
FT                   /locus_tag="Tbis_0150"
FT   CDS_pept        175636..176781
FT                   /locus_tag="Tbis_0150"
FT                   /gene_family="HOG000022596" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02631"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.5"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_0903 xylose isomerase; TIGRFAM:
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="GI:296268143"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013453"
FT                   /db_xref="GeneID:9166625"
FT                   /translation="MYTPTPEDRFSFGLWTVGWQARDPFGDATRAPLDPVETVHRLAEL
FT                   GAYGVTFHDDDLLAVEPDRTKAIERFKKALSETGLKVPMATTNLFTHPIFKDGAFTSND
FT                   RDVRRYALRKVMRNLDLAAELGAKTYVCWGGREGAESDAAKDVRAALDRYKEALDILCQ
FT                   YVIDKGYDIRFAIEPKPNEPRGDILLPTIGHALAFINELEHPERVGLNPEVGHEQMAGL
FT                   NFVHGIAQALWHGKLFHIDLNGQHGPRYDQDLIFGHGDLISAFFLVDLLEHGGYDGPRH
FT                   FDYKPMRTEDKEDVWESAAANMRMYLILKEKSKAFRADPEVQEALAAARVPDLSQPTLA
FT                   EGETIDDLLNEEFDPDAAAERGYHYTRLNQLAMEHLLGVRG"
FT                   /product="xylose isomerase"
FT                   /protein_id="YP_003650775.1"
FT   gene            176793..178184
FT                   /db_xref="GeneID:9166626"
FT                   /locus_tag="Tbis_0151"
FT   CDS_pept        176793..178184
FT                   /locus_tag="Tbis_0151"
FT                   /gene_family="HOG000222138" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /codon_start="1"
FT                   /product="xylulokinase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: pfl:PFL_3075 xylulokinase"
FT                   /db_xref="GI:296268144"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="GeneID:9166626"
FT                   /translation="MTLVAGVDSSTQSCKVVIRDAETGALVREGRAPHPDGTEVHPDHW
FT                   WTALQAAIEEAGGLDDVAAIGVAAQQHGMVCLDENGEVVRPALLWNDVRSAKAASDLVA
FT                   ELGGPERWAEAVGSVPVASFTVTKLRWLAEHEPENARRTRSVCLPHDWLTWRLAGRPEV
FT                   ITTDRGDASGTGYWSPITGSYRMDLLELAMGATPEVPRVLGPTERAGTAGDAVLAPGTG
FT                   DNMAAALGVGMGPGDVVISIGTSGTAFAVSDTPSRDPSGTVAGFADATGRFLPLVCTLN
FT                   AARVLEAAARILGVSHDRFSELALQAPPGAGGLVLVPYLEGERTPNLPDATGSLHGLRL
FT                   ATSTPAHLARAAVEGMLCGLADALDALKIEPRRILLIGGGARSEAVRRIAPAVFGRPVL
FT                   VPEPAEYVANGAARQAAWVLSGKPEPPEWRLGEMARYEADPTPGLRERYREATALVAGG
FT                   AVAGA"
FT                   /protein_id="YP_003650776.1"
FT   gene            178389..179075
FT                   /db_xref="GeneID:9166627"
FT                   /locus_tag="Tbis_0152"
FT   CDS_pept        178389..179075
FT                   /locus_tag="Tbis_0152"
FT                   /gene_family="HOG000109988" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MXAN_2746"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_2746 hypothetical protein"
FT                   /db_xref="GI:296268145"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="GeneID:9166627"
FT                   /translation="MIRPLSPVIACAGLGTAMIALLAGLVGTGAPADPVSMTISDHVAR
FT                   GGGVLRPALAVLGAASLVLVAGLRAAGAPVRGRPAAWLAGWGVALITAAVLPVRAATGG
FT                   AEAPWEAHLHHGVMIAAFVSVPVAALQLVGRFERDERWRVAARPVEWLTLPAGLGLTAL
FT                   TYVMLPGQGVMIGVVEGALLAVDTAILGVLAVRLLRLTWGPVPRRGRRPAGGGAVARPR
FT                   ISAAPR"
FT                   /protein_id="YP_003650777.1"
FT   gene            complement(179056..179631)
FT                   /db_xref="GeneID:9166628"
FT                   /locus_tag="Tbis_0153"
FT   CDS_pept        complement(179056..179631)
FT                   /locus_tag="Tbis_0153"
FT                   /gene_family="HOG000021469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   dac:Daci_0776 protein of unknown function ATP binding"
FT                   /db_xref="GI:296268146"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="GeneID:9166628"
FT                   /translation="MAFAPSDEPVALKILVAGGFGVGKTTLVGSISEIRPLRTEEVLTD
FT                   RGVGVDDLYGVEGKTTTTVAMDFGRITIREGLVVYLFGTPGQERFWFMWDELAYGALGA
FT                   VVLADTRRLTDCFPSIDYFEQRGTPFIVAVNCFDGAERHDPEDVRIALDLDPDVPVLLC
FT                   DVRRRASVKVVLITLVEHALKMLTAAQR"
FT                   /protein_id="YP_003650778.1"
FT   gene            complement(179612..179977)
FT                   /db_xref="GeneID:9166629"
FT                   /locus_tag="Tbis_0154"
FT   CDS_pept        complement(179612..179977)
FT                   /locus_tag="Tbis_0154"
FT                   /gene_family="HOG000049105" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="GI:296268147"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="GeneID:9166629"
FT                   /translation="MTDPWWIDEEAGPLVRPYALTGGRTRSSGDHLDLIAMVTTTGEPP
FT                   GDANIGPEQRRILEIARHGASVADIAADVDLPVGVVRVLLGDLRDLGLIRVRPPAHVAP
FT                   LPSTSLLKEVINGLRAL"
FT                   /protein_id="YP_003650779.1"
FT   gene            complement(179991..180398)
FT                   /db_xref="GeneID:9166630"
FT                   /locus_tag="Tbis_0155"
FT   CDS_pept        complement(179991..180398)
FT                   /locus_tag="Tbis_0155"
FT                   /gene_family="HOG000049116" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /codon_start="1"
FT                   /product="roadblock/LC7 family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   lch:Lcho_0658 roadblock/LC7 family protein"
FT                   /db_xref="GI:296268148"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="GeneID:9166630"
FT                   /translation="MTGKATTTGELNWLLDDLISRVAAVRQAVILSNDGLVVGASQGLS
FT                   REDAEHLSAVAAGFQSLARGAGRHFGGGEVRQTIVEMENAFLFVTAAGQGTCLAVLAEA
FT                   DADVGHIAYEMAMLVKRVGQHMSTNPRQVTP"
FT                   /protein_id="YP_003650780.1"
FT   gene            complement(180395..183112)
FT                   /db_xref="GeneID:9166631"
FT                   /locus_tag="Tbis_0156"
FT   CDS_pept        complement(180395..183112)
FT                   /locus_tag="Tbis_0156"
FT                   /gene_family="HOG000253355" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08376"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Nitrate and nitrite sensing domain protein;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   rpb:RPB_0321 OmpA/MotB"
FT                   /db_xref="GI:296268149"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="GeneID:9166631"
FT                   /translation="MSSRNRSIRFKIFLLLLLPLLVLSAMWGFVLKVTIGDVVSLFRAN
FT                   ALYEAIGVTSADLGLELQAERAITVRLLSSGQTGSNELAAQQTKTTAAMEKFTSAARDP
FT                   STRDAMSGELLTSVDSLLAQLDRLPSIRESVTLGRFDRLQTLDAYNGLLDQLFALYERL
FT                   VALPDLDIYRQAAAMQGMGNAYEMIAREDTLIRGALVSGVLTDAERSRLSDWVATRRFL
FT                   VEKNRPILAGAMREPYEEVLSSSVFTRFTELETQILTRVRAGGELPDAAQNWAGTVDSL
FT                   LSRLDQARTRASEALTKEATSVATGIVTRLAIAGGLGLVAIVATILFSARFGRRLTGEL
FT                   TDLRNAALDLAEVRLPRLVERLRRGEEIDACAEAPPIKVNGPAEIEDLAHAFSTVQRTA
FT                   VESAVGEAHLRRGINQVFLNIARRKQSLLQRQLKLLDAMQRRTEDPQLLEDLFQLDHLT
FT                   TRMRRHEENLIVLSGAPPGRTWRKPVPFIDVVRGALAEVEDYRRITLGPIPEAALRGES
FT                   VADLVHLLAELLENATVYSPPSTRVDVRGEIVANGLVVEIEDRGLGLSAEEYAEINRRL
FT                   ADPPEFDPAGSDRLGLFVVGRLAARHGVQVVLRGSPYGGTSAIVLIPRTLVAHEDATGT
FT                   VPDDAGRGRAHGRPERIENRLGQEEPPAQEDRAARPEPAEQGASLFAPPARPQTPAPDQ
FT                   PPAQADGSGGAAALDGAARPGGPSPLPRRVRTTPAAPDRGTPPPAQPASATPPDQRIPA
FT                   PAQAAPEGETGAPQAGRPGAAPEPAGEPAGTAPAPARAEGGSGETAGQDSPAPQRGVLR
FT                   SGVERARVSITNGTYNGLPRRVRQASLAPQLRNRPLSAPTPAGGIAERPPEQVRALFSA
FT                   IQRGAQRGRAESQDPSGSASADHVPDTYREKGDE"
FT                   /protein_id="YP_003650781.1"
FT   gene            183231..184040
FT                   /db_xref="GeneID:9166632"
FT                   /locus_tag="Tbis_0157"
FT   CDS_pept        183231..184040
FT                   /locus_tag="Tbis_0157"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: RDH12; retinol dehydrogenase 12
FT                   (all-trans/9- cis/11-cis) ; K11153 retinol dehydrogenase
FT                   12"
FT                   /db_xref="GI:296268150"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:9166632"
FT                   /translation="MIAVITGAGSGIGAAAALELAKRGYRLVLVGRTPEKLAGVADRIA
FT                   SVTETRPDTITADFASLDQVRYLADQLLRRYDDIHVLINNAGVMTSQRRITADGHELIM
FT                   QVNHLAPFLLTNLLFDRLKFASARVISTSSIAAYSGTIDPSDLSRERRWWNSWLQYFDS
FT                   KQANALFTVSLAERGLNATCFHPGVVRTPFAGDTLTMKLMLMIPGLAKPPATAAARLVH
FT                   LVTHDDGINHPGRFFMGNGPAWVPRRMKDPELAEALWEASCAATGLR"
FT                   /protein_id="YP_003650782.1"
FT   gene            complement(184142..185083)
FT                   /db_xref="GeneID:9166633"
FT                   /locus_tag="Tbis_0158"
FT   CDS_pept        complement(184142..185083)
FT                   /locus_tag="Tbis_0158"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bat:BAS2719 hypothetical protein"
FT                   /db_xref="GI:296268151"
FT                   /db_xref="GeneID:9166633"
FT                   /translation="MGTTVFAAVYVRNQGARRHPGGPAVDRMSTHDAAHTVRRRMSHLV
FT                   RLAKFLVPVIIAVEAVLVLSGVTSIGDATMVVIATEVLLFWLIVIEIVEIRRAYRRFAR
FT                   EEPDRFTAAMRAVESVLPEPVGRLIAHELMLQRALVLLVLRKRGVPPGGQGIPHHRPVM
FT                   GFLGAVLGLTAVEMLGVELAVPWPTVRWILLAVSLIGCWWLAGFAAGLVVQPVTVGPDT
FT                   LRIRYSCFADLSVPLAAIDRVVPLPRSRGRRRTAMAHGDEPVVEVGKQQHGAPPGEPVP
FT                   IRLRGGAPREVRRVHLWVDDPQALAAAVAEYR"
FT                   /protein_id="YP_003650783.1"
FT   gene            complement(186042..188126)
FT                   /db_xref="GeneID:9166634"
FT                   /locus_tag="Tbis_0159"
FT   CDS_pept        complement(186042..188126)
FT                   /locus_tag="Tbis_0159"
FT                   /gene_family="HOG000057251" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="family 2 glycosyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bcz:BCZK4970 bifunctional hypothetical
FT                   protein/glycosyltransferase"
FT                   /db_xref="GI:296268152"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:9166634"
FT                   /translation="MAETDETRLPDETPDAPRFTRLGPVNWLPEERKIVERYEERIRDL
FT                   EKRLAIAEARAEYATWKLKATQAQRPYRVAQALTGATKPGKFVRLPRDLSKAIKVRKAP
FT                   KPPLPVTEAAKLAEAKGPEVTIPTLQWPDGPVVRPDLRVAVILDDFSRLAFRYEWDQIE
FT                   FGLHDWREIFAEKRPDLLFCESAWHGNQGRWRYQMTGTNAPKKELRELVAWFKEQGIPT
FT                   VFWNKEDPPNFDHFIETAKLFDYVYTCDGDMIPKYREILGHDRVGVLQFAAQPRIHNPI
FT                   QTRLGRPYDIVFAGMYFRDKHPERREQMETVLAPLRELGLHIFARNATVADKYAWPEEY
FT                   RPHIVGELPYEQMLAAYKMYKIFLNVNSVIDSPTMCARRVFELSACSTTVLSGWSRAIE
FT                   ETFGDLIPVAHTQEEAYNLALYFLNSPELRARQGHLAMREVLSKHTFSHRVDQILRDLG
FT                   WPVRPRSRSVSVVLPTNRPGQIEHAISQVARQRHRNLELVLVLHNMSEDPSVVRDKALA
FT                   AGIPEVKVLTADPDWTLGEVLNHGIAHAEGELIAKMDDDNIYGEHYLSDLIRAFDYTDA
FT                   EMVGKGAHYTYFPDQDITVLRLPGLEHRYAHLIQGATILAKADLLRAMPFEPVNAGEDT
FT                   RLVRRCKEEGIRIYSADRFNFIYIRGADAKAHTWQAADHKLTRNAQFCFAGNPERHVLI
FT                   "
FT                   /protein_id="YP_003650784.1"
FT   gene            complement(188553..189680)
FT                   /db_xref="GeneID:9166635"
FT                   /locus_tag="Tbis_0160"
FT   CDS_pept        complement(188553..189680)
FT                   /locus_tag="Tbis_0160"
FT                   /gene_family="HOG000076049" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /codon_start="1"
FT                   /EC_number="5.1.3.14"
FT                   /transl_table="11"
FT                   /note="KEGG: ade:Adeh_4279 UDP-N-acetylglucosamine 2-
FT                   epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="GI:296268153"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="GeneID:9166635"
FT                   /translation="MRDNPLVLHVLGARPNFVKAAPVVHALAELGVRQAIVHTGQHYDA
FT                   LMSDVFFADLNLPEPIANLGVGSGTHARQTAALLVGLEDVLQEHAPALVVVYGDVNSTL
FT                   AAALVCAKLHIPFAHVEAGLRSFDREMPEEVNRVVTDALADLLFCTSPDALSHLANEGV
FT                   DPAKVHFVGNPMIDSLFAALPKLDPEPIKRRLGVDGRYAVATLHRPANVDDPEAARELV
FT                   SAVLGVAEHVRVIVPLHPRGRTRLAEAGLVDRENLKIIEPLGYVDFLSLVRGAALVVTD
FT                   SGGVQEETTMLGIPCLTVRPNTERPITVTHGTNRLVTPASLPAAAAKALADGAATPAGE
FT                   LPPLWDGKAGPRIARVIAAWLRGDNLSPAGRGTVG"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /protein_id="YP_003650785.1"
FT   gene            189794..191467
FT                   /db_xref="GeneID:9166636"
FT                   /locus_tag="Tbis_0161"
FT   CDS_pept        189794..191467
FT                   /locus_tag="Tbis_0161"
FT                   /gene_family="HOG000159112" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="group 1 glycosyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   dar:Daro_2409 glycosyl transferase, group 1"
FT                   /db_xref="GI:296268154"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:9166636"
FT                   /translation="MPTGSRSTSTSKIDAKKARADLGRFLRGFVKNPVVVSRIFVSKVR
FT                   SDPMRVAQAAAEAMPAPLRPLVGRVAWPVARYVKVTTRKVVRRMADGPLEKAKDLFDQG
FT                   RMSEAIKVLRPHQRWPFIRRRIAYYEGEMAALGPNPIPPQPKVTVADRVPGRVLHLVTN
FT                   ALPYTQAGYTVRTHRIVTAQRAAGLDPHVVTSWGWPMLQGHTDAAPYEDIDGIPYHRLL
FT                   PKGEVPSESRGRMILGAAEVTELVKTLRPQVLHAATDHRNGSVALAVRERTNTPFVYEV
FT                   RGFLEETWVSRDPRRVGSERHRMQREREAQIMREADAVVTLAETMAAEIVERGVPRERI
FT                   YLAPNAVDDSLLTAEFDGAALRRRYGIGDDEIVVGSVSSIVAYEGFATLLDAAALLREA
FT                   GTPVRVLLVGDGAERPALLEQVERLGLKDLAILPGRVAPDEALQAQAALDIFVCPREDL
FT                   RVCRLVTPLKPVEAMALGKPVVLSDLPALAELVGSGEAGVLVPPGDASALARAIAELRD
FT                   DPARRREMGEAGKAEVAAKRTWSSLAKTYQNIYRTVTDGR"
FT                   /protein_id="YP_003650786.1"
FT   gene            191578..192840
FT                   /db_xref="GeneID:9166637"
FT                   /locus_tag="Tbis_0162"
FT   CDS_pept        191578..192840
FT                   /locus_tag="Tbis_0162"
FT                   /gene_family="HOG000153774" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /codon_start="1"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase ; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; KEGG: sus:Acid_4597 UDP-glucose
FT                   6-dehydrogenase"
FT                   /db_xref="GI:296268155"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="GeneID:9166637"
FT                   /translation="MTGFDLTIIGLGYVGMPLAKEATAAGLRVAGLDVDPHKIEELKAG
FT                   RSYIDDLTDGDLDAMLSAGFTPTVDPSVLAGSSTIVICVPTPLDEDRRPDLSAVVNASR
FT                   TVAGQLRPGTLVVLESTTWPGTTDEVVRPILEESGLRAGVDFHLAFSPERIDPGNPKYG
FT                   VRNTPKVVGGYTEACRERACAFYSRFIERVVPVSGTREAEMAKLLENTYRHVNIALVNE
FT                   MAIFCDELGVNLWEAIEAAATKPFGFQKFLPGPGVGGHCIPVDPSYLSYTVRKLGYPFR
FT                   FVELAQEINERMPSYVVTRVQRLLNRARKPVNGSHVVLLGVTYKPDISDTRETPAVPVA
FT                   EALLELGADLSYCDPFVKEWSVKGRVIPRRESLEEAVEEADVAVLLQQHSAFDLDTVER
FT                   KARLVLDTRGVLTESDRVERL"
FT                   /protein_id="YP_003650787.1"
FT   gene            192854..193942
FT                   /db_xref="GeneID:9166638"
FT                   /locus_tag="Tbis_0163"
FT   CDS_pept        192854..193942
FT                   /locus_tag="Tbis_0163"
FT                   /gene_family="HOG000104708" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /codon_start="1"
FT                   /product="group 1 glycosyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: bha:BH3662
FT                   glycosyltransferase (biosynthesis of lipopolisaccharide O
FT                   antigen)"
FT                   /db_xref="GI:296268156"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="GeneID:9166638"
FT                   /translation="MHVLVMTVVHHPEDARILHRQIRALVDAGHEVTYAAPFTARGVTP
FT                   RPWVTGVDLPRAAERRRIAAIWAARRLFKRMRGKVDLVLIHDVELLLAVVGVRNRPPVV
FT                   WDVHEDTPATLSLKPWLPAFLRPPVRFLARLLEGTAERHLHLLLAESAYAQRFKRQHLV
FT                   VPNETWVPDHVVPPGDDRVVYLGWLSEARGVHEAVEVARLLRPHRVSVELIGYADPQSR
FT                   PLLTAAVNEGLLEWRDFMPNDEALKRLDGALAGLSLLHDEPNYRHSMPTKIVEYMAHGI
FT                   PVITTPSPRAVELVERYRCGTVVPWRDPAAVVQAILHYRDNQEERVHTGGRGYAAARAY
FT                   HHWPNSARRFVAQLEAWAAGRE"
FT                   /protein_id="YP_003650788.1"
FT   gene            193990..195819
FT                   /db_xref="GeneID:9166639"
FT                   /locus_tag="Tbis_0164"
FT   CDS_pept        193990..195819
FT                   /locus_tag="Tbis_0164"
FT                   /gene_family="HOG000109989" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268157"
FT                   /db_xref="GeneID:9166639"
FT                   /translation="MRWLTIFLGLVILAGVAATVIVLREGSPDPGATAARSAPPQATAK
FT                   PSPTESSFTDPCGTFETVQRTPYPVSGYWLVPTSDPCTWRRQLEAIHRLGGDTVIRLGF
FT                   GLAPRPVNDQGQVLEAPDFSGDKKPKPDKRYLACVEDGLPCVKAAERDLKAAHPDNRIS
FT                   WTYVYRTDERFGSGIFRCPTMERQIEVGGAVYYRLIAPEDGSDDPSCDFSSKGRAYHLI
FT                   LIRGETKDSLTELLDLGDRFGIQVFPALPSAPRDPVASTTANPRHIGTLTTLTRRILQD
FT                   YGDRFKDRASLGGVYQPFELQLREWPDPSKVQTLQVYEEQHRIVEQELPGKPILVSPYI
FT                   DSRRERDFTATPAQVAEGFKAVARTGVEIIAPQDGRGTGKVGLYWPNLKNKPVDERLEP
FT                   VVGKSTYAQAYYGSTRDYYRAMARAREELAAEGVDVELWANVEAFEPAATPATKCAAQT
FT                   RGRTDKARLDTQVALATPYVSKLISYMWSDFFTCGSPSLSEEIAQDWNRPIAVEARRVR
FT                   RDIQDGLEIRGFHLQGAKVTLTWAGISTPRVVDSTAVGWHDPTPIEGLPAGVERVWIPV
FT                   DWGSVPGDVWVRVTVTAPDGRKAAESVYYHNAA"
FT                   /protein_id="YP_003650789.1"
FT   gene            195852..196511
FT                   /db_xref="GeneID:9166640"
FT                   /locus_tag="Tbis_0165"
FT   CDS_pept        195852..196511
FT                   /locus_tag="Tbis_0165"
FT                   /gene_family="HOG000261973" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aeh:Mlg_0745 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:296268158"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:9166640"
FT                   /translation="MIPRIAVSVDLVVLTVRNQQLSALVWRRDRPPYEGKWALSGGFIK
FT                   LDEDLPAAAARVLAERAGLKDAPVHLEQLQTYGYPARDPRRRVLSVAYLGLAPDLPAST
FT                   EAHMSWQPVSELTDMAFDHRRIMLDGVERARAKLEYTSLGAAFCPPEFTVAELRRVYEI
FT                   VWGRRLDPRNFHRKVTKAKGFLVSTGRTTTRDGGRPAMLYRRGPAVLLHPPMLRSS"
FT                   /protein_id="YP_003650790.1"
FT   gene            196692..197750
FT                   /db_xref="GeneID:9166641"
FT                   /locus_tag="Tbis_0166"
FT   CDS_pept        196692..197750
FT                   /locus_tag="Tbis_0166"
FT                   /gene_family="HOG000288510" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /codon_start="1"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: maq:Maqu_1024
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="GI:296268159"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="GeneID:9166641"
FT                   /translation="MPRFRSILETMPTYKPGKTVVSPEGKSYKLSSNESPYGPLPSVVE
FT                   AIAKAATEINRYPDPGATRLTEAIAERLDVPPGHVALGAGSVAVAAQILEAVAEPGVEV
FT                   LYAWRSFEAYPLLADLAGATSVTVPLRDETHDLEAMADAVTPRTRLIFVCNPNNPTGTV
FT                   CRKAEIERFLDRVPEDVLVVFDEAYREYVRDADVPDALVYYRERPNVAVLRTFSKAYGL
FT                   AGLRVGYLIGQEPVAAAVRKTPPPFSINHLAQAAAVASLQAEDELMARVESVIKERSRV
FT                   REALIADGWTVPPTEANFVWLRLGERTTAFAEHCAGYGVAVRPFAGEGVRVSIGDPEAN
FT                   DAFLAAARSFPR"
FT                   /protein_id="YP_003650791.1"
FT   gene            complement(198212..199558)
FT                   /db_xref="GeneID:9166642"
FT                   /locus_tag="Tbis_0167"
FT   CDS_pept        complement(198212..199558)
FT                   /locus_tag="Tbis_0167"
FT                   /gene_family="HOG000105518" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296268160"
FT                   /db_xref="GeneID:9166642"
FT                   /translation="MGRTLVERTEEGPRGSRLGTVTPELTIGVVGSHDLVERVMLMGSI
FT                   SAPLPCRLIAVAYRDEREAADKVLRLGPSVDACLFASPVPYEIAQRAGALTMPATHVQF
FT                   GGPSLTAAIARAALDERVDPRRVSVDGLSRAEIEEAYADLDLPSTEVTTREEPGPVSTI
FT                   TAFHERLLRQGVTTAALTCVRAVAERLTAAGFPAVPIRPTTAAIRNALQTAALLGARHR
FT                   LEESQLAVVLVEVPTLREPVRRSAPRYWREELRLSLHRLLVQEANRISAGVWPIDGHSY
FT                   LVVATMGSIAAVTDGFRVMPFAARIREELGLIAEIGVGLGRTIHEAEAHAKGALTRSQG
FT                   GKQPHGFAIDREGRALVPPPRSASAQNGMTKRKGMEILSRLAAKLDSRDWVVDAETTGK
FT                   LLGVTPRTARRLLRTLVDEGLAWPLPPNRSPQPGRPRQLYRLIVEKLSR"
FT                   /protein_id="YP_003650792.1"
FT   gene            complement(199712..200989)
FT                   /db_xref="GeneID:9166643"
FT                   /locus_tag="Tbis_0168"
FT   CDS_pept        complement(199712..200989)
FT                   /locus_tag="Tbis_0168"
FT                   /gene_family="HOG000075602" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /codon_start="1"
FT                   /product="UDP-N-acetylglucosamine1-
FT                   carboxyvinyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bsu:BSU36760 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="GI:296268161"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="GeneID:9166643"
FT                   /translation="MVRYRVRGGNVLRGTAFIQGAKNAVLPMIGAALLATEGRTVLRNV
FT                   PVIEDVRRAVELAQAVGATVEFHESERTLVIDASRLTSPVLPAAIANRFRGTVLFVPAL
FT                   LHRLGEAVIEGIGGCNLGSRNLDFHYNGYKRLGAVVNEQESVIHIKAGKLVGAPLYLDT
FT                   PSHTGTENLVMAATLAKGTTVIENAALEPEVLDVIAMLTRMGAKIRGGGTGFITVEGVE
FT                   NLKAVEHTVMPDRLDAGVFAMAAAITGGEVTLVGAELQHLGVVRWKLEQMGVEFETNGA
FT                   VLHVRREKPLRPINVITDTYPGFATDLQSPIMAVACLADGTSYIHERIFDGRFALAGEL
FT                   NKMGAKIEVQGSRAVVHGPTPLRGTQVTAHDLRSGIALVLAGLVAEGETVIESGYLIDR
FT                   GHSAVAERMRALGANVEREISTPADR"
FT                   /protein_id="YP_003650793.1"
FT   gene            complement(201157..202008)
FT                   /db_xref="GeneID:9166644"
FT                   /locus_tag="Tbis_0169"
FT   CDS_pept        complement(201157..202008)
FT                   /locus_tag="Tbis_0169"
FT                   /gene_family="HOG000230360" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /codon_start="1"
FT                   /EC_number="6.3.2.6"
FT                   /transl_table="11"
FT                   /note="KEGG: psa:PST_2788 phosphoribosylaminoimidazole-
FT                   succinocarboxamide synthase; TIGRFAM:
FT                   phosphoribosylaminoimidazole- succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="GI:296268162"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="GeneID:9166644"
FT                   /translation="MVKHLHSGKVRDLYETEDGLLLMVASDRISAFDHVLQPEIPDKGK
FT                   ILTQLSLWWFDQLADIVPNHVVSTDVPPEYAGRAVLCRKLRMVPVECVARGYLAGSGLT
FT                   DYRKDGAISGVPLPPGLTEGSRLPEPIFTPSTKAPKGEHDRPMTFDEVVAEVGQEVAEE
FT                   LRRITLAVYERGARIAAERGIILADTKIELGWDENGVLTLGDEVLTPDSSRFWPLGEWK
FT                   PGRPQPSFDKQFVRDWLLSPESGWDRASGAAPPPLPDEVVARTRERYIQAYELLTGRRF
FT                   EP"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamides
FT                   ynthase"
FT                   /protein_id="YP_003650794.1"
FT   gene            complement(202165..203427)
FT                   /db_xref="GeneID:9166645"
FT                   /locus_tag="Tbis_0170"
FT   CDS_pept        complement(202165..203427)
FT                   /locus_tag="Tbis_0170"
FT                   /gene_family="HOG000033464" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /codon_start="1"
FT                   /EC_number="6.3.4.13"
FT                   /transl_table="11"
FT                   /note="KEGG: cak:Caul_4544 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="GI:296268163"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="GeneID:9166645"
FT                   /translation="MNRDNEWVRVLVIGSGGREHALCRALRRDPAVSEVHCAPGNAGIA
FT                   DDAVLHSVRPTDGEAVANLAKRIGADLVVIGPEAPLVAGVADAVRQAGVPCFGPSERAA
FT                   MIEGSKAFAKEVMAAAGVPTARSFVCTTEQEAAAALDAFGPPYVVKDDGLAAGKGVVVT
FT                   EDRDRALAHARACERVVIEEFLDGPELSLFALCDGSTAVPLQPAQDFKRAYDGNKGPNT
FT                   GGMGAYTPLPWIPGDLTERVMSEIVTPTITELAERGTPYTGVLYAGLALTSAGPKVVEF
FT                   NARFGDPETQVVLDRLATPLGGLLYACATGDLAAHGPLRWHGGAAVTVVLAAENYPADP
FT                   VKGDPILGLPSDVEGAYVLHAGTARDESGRLVSAGGRVLNVVGTGADLAEARSRAYEAI
FT                   GRITLRGSHYRSDIALNAAAS"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /protein_id="YP_003650795.1"
FT   gene            204186..205283
FT                   /db_xref="GeneID:9166646"
FT                   /locus_tag="Tbis_0171"
FT   CDS_pept        204186..205283
FT                   /locus_tag="Tbis_0171"
FT                   /gene_family="HOG000226537" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /codon_start="1"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: bbt:BBta_0881 putative metal ion transporter"
FT                   /db_xref="GI:296268164"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="GeneID:9166646"
FT                   /translation="MRSSLLFPRIRPRVLPARLTTPAPEPSPEPATGHSVVEFGAYIGG
FT                   EKITVRSVPEAVRLVREHNAEGARDDAFVWVGLHEPAAPEVEWLGEVFGLHPLAVEDAI
FT                   KAHQRPKVERYGDSLFVVLKTVSFREHDRASGDIIDTGEIMIFVGHDFVVTVRHGDNCP
FT                   LGGVRQRLEGDPKWLRRGPTGVLHAIADHVVDKYLQVVDLMQAELEEVEAAVFAEVSSR
FT                   DINRIYQLKREMLELKRAVQPLQAPFDSLPQRRIIPSEMREYFRDIGDHLSRVCEQVQA
FT                   SNELSDSILQAALARSNALANEDMRKISSWVAIISVPTMIAGIYGMNFTHMPELDTKFG
FT                   YPVVLGVMVIACTLLHRAFRRNGWL"
FT                   /protein_id="YP_003650796.1"
FT   gene            complement(205480..206106)
FT                   /db_xref="GeneID:9166647"
FT                   /locus_tag="Tbis_0172"
FT   CDS_pept        complement(205480..206106)
FT                   /locus_tag="Tbis_0172"
FT                   /gene_family="HOG000043629" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rlt:Rleg2_0103
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:296268165"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9166647"
FT                   /translation="MSEPLGLRERKKLRTRRALVEAALRLFGEQGYQETTIAEITAAAD
FT                   VSARTFFSYFGSKEDVLFFDHQERTDEALKLLADRRPDEPIRDVLLRLVEHGLRASLLP
FT                   ADMASELSSVRYRLVSSVPALRARGLRLLFETERRLAAALHETYPGELDRTEAAAVIGA
FT                   LSGAANLAVQVSMDRGEPPERAWEAGRRAAEIAMGGLAVLGRGTV"
FT                   /protein_id="YP_003650797.1"
FT   gene            206222..207409
FT                   /db_xref="GeneID:9166648"
FT                   /locus_tag="Tbis_0173"
FT   CDS_pept        206222..207409
FT                   /locus_tag="Tbis_0173"
FT                   /gene_family="HOG000243678" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /codon_start="1"
FT                   /product="cytochrome P450"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome P450; KEGG: bxe:Bxe_C0945 putative
FT                   cytochrome P450"
FT                   /db_xref="GI:296268166"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="GeneID:9166648"
FT                   /translation="MTESLNHVACYPIHREHIFDPPEALTRWAEQAPIHPLTFPDGHEG
FT                   WLVTGYAAVREILADRRFSARPELVHSPFFDRIERDPQRQEGFFIRMDPPEHTRYRRLL
FT                   AGEFTVRRMMRLEPRIKEIVTEHLDRMELAGPPVDLVQAFALPIPSLVICELLGVPYAD
FT                   REKFQRDSATMLDLESTPEQVQAAVDDLLAYLGDLVTRKREHPEDDLLSVIAPKLTLEE
FT                   AAGVGLLLLVAGHETTANMLGLGTLALLSNPDQLAVLRGDAELIGNAVEELLRYLTIVQ
FT                   IGLARAALEDVEIAGTRIRAGQTVLLMLPTANRDPERFPGGDALDLTRPAHGHLAFGHG
FT                   IHQCLGQQLARLEMRIAYPALFERFPGLRLAVPVAEIPLRTSMVVYGVHRLPVTW"
FT                   /protein_id="YP_003650798.1"
FT   gene            207430..207651
FT                   /db_xref="GeneID:9166649"
FT                   /locus_tag="Tbis_0174"
FT   CDS_pept        207430..207651
FT                   /locus_tag="Tbis_0174"
FT                   /gene_family="HOG000044619" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06902"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1271; KEGG:
FT                   rec:RHECIAT_PB0000290 cytochrome P450 monooxygenase
FT                   protein"
FT                   /db_xref="GI:296268167"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="GeneID:9166649"
FT                   /translation="MKIKADTGRCIGAGMCVMTLPEVFDQSEEDGTVVVLAPDPPGELH
FT                   ALVRRAVTLCPSGALSLEETPVSSNSTG"
FT                   /protein_id="YP_003650799.1"
FT   gene            complement(207629..208540)
FT                   /db_xref="GeneID:9166650"
FT                   /locus_tag="Tbis_0175"
FT   CDS_pept        complement(207629..208540)
FT                   /locus_tag="Tbis_0175"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bja:blr6584 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:296268168"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:9166650"
FT                   /translation="MYGYVELHGHRGARGLRPENTLPALMHALELGVDVLEFDLVMSAD
FT                   GELVLCHDLIVSDVTSADTAPAAEGAPYVGKPVISLTLPQLHTLEVGRRRPRCPEDPFA
FT                   ATQVPVPGLRMPTLGAALDLIEALGAGHVRLNLDLKTDPTRPDLSADPRRLTDLVVAEL
FT                   DRRGLLRRSSILAFDWRILEIVRPLGIPRYALVEKPTMSPEWMNGIHLDDFGGSLVEAA
FT                   RAAGATALSPEWVLIDHEVMEHARRHGMPVIAWTVNDVAEAGRLIDLGVSGIVTDYPDR
FT                   MRPLWRSRGFPLPAPLSRCCCC"
FT                   /protein_id="YP_003650800.1"
FT   gene            complement(208975..210258)
FT                   /db_xref="GeneID:9166651"
FT                   /locus_tag="Tbis_0176"
FT   CDS_pept        complement(208975..210258)
FT                   /locus_tag="Tbis_0176"
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /codon_start="1"
FT                   /EC_number="6.3.4.4"
FT                   /transl_table="11"
FT                   /note="KEGG: adenylosuccinate synthase; K01939
FT                   adenylosuccinate synthase; TIGRFAM: adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; SMART:
FT                   adenylosuccinate synthetase"
FT                   /db_xref="GI:296268169"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="GeneID:9166651"
FT                   /translation="MPAVVLVGAQWGDEGKGKATDLLGADVDYVVRYQGGNNAGHTVVI
FT                   KDQKYALHLLPTGVLSPHVVPVIGNGVVIDPGVLLSEIDALTERGISCDRLLISANAHL
FT                   IMPHHKAIDKVTERYLGKARIGTTGRGIGPAYSDKIARVGIRVQDLLDPGILRQKIEVA
FT                   LNEKNQVLTKIYNRRGLEPARVLEEYLGYAERLRPYITDTSLVLSKALDEGKVVLLEGG
FT                   QGTLLDIDHGTYPFVTSSSPTAGGACTGAGIPPNRLTKIIGILKAYTTRVGSGPFPTEL
FT                   LDEQGEWLRQTGGEYGTTTGRNRRCGWFDAVIARYAVRINGITDFFLTKLDVLSGLERI
FT                   PVCVAYDIDGVRHDEFPMTQTEFHHAKPIYEELPGWQEDISDAKSFEDLPPNAQAYVRT
FT                   LEELTGAPISAIGVGPGRDQTLVLRPLL"
FT                   /product="adenylosuccinate synthetase"
FT                   /protein_id="YP_003650801.1"
FT   gene            complement(210769..211209)
FT                   /db_xref="GeneID:9166652"
FT                   /locus_tag="Tbis_0177"
FT   CDS_pept        complement(210769..211209)
FT                   /locus_tag="Tbis_0177"
FT                   /gene_family="HOG000238169" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268170"
FT                   /db_xref="GeneID:9166652"
FT                   /translation="METHENLLAGPPPTLLPDNPEARQMLESGARAADVAARFPAYSAA
FT                   WARLADEYFAAGHAVTSYAFARTGYHRGLDQLRRAGWKGHGPIPWEHEPNRGFLRCLYA
FT                   LQRAAQAIGEMDEAVRCAQFLRDSSPTAAEILNGKASEKAEG"
FT                   /protein_id="YP_003650802.1"
FT   gene            complement(211349..212371)
FT                   /db_xref="GeneID:9166653"
FT                   /locus_tag="Tbis_0178"
FT   CDS_pept        complement(211349..212371)
FT                   /locus_tag="Tbis_0178"
FT                   /gene_family="HOG000227794" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /codon_start="1"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: sfu:Sfum_1469
FT                   fructose-bisphosphate aldolase, class II"
FT                   /db_xref="GI:296268171"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="GeneID:9166653"
FT                   /translation="MPIATPEVYAEMLDRAKAGGFAYPAINVTSSQTLNAALRGFAEAE
FT                   SDGIIQVSTGGAEYFSGTAVKDMVTGAVALAEFARVVAEKYPVNIALHTDHCPKEKLDG
FT                   FMRPLIEISRERVKRGQDPLFQSHMWDGSAVPLEENLRIAAELLEKCAEARVIMEMEIG
FT                   VVGGEEDGIVGEFNEKLYTTPADALATAEAVGLGERGRYLLAATFGNVHGVYKPGKVKL
FT                   RPSVLKEIQEAVGAKYGKEKPFDLVFHGGSGSALEEIHEAISYGVVKMNIDTDTQYAFT
FT                   RPIADHMFKNYDGVLKVDGEVGNKKVYDPRSYGKLAEAGMAKRVVEACEQLKSAGKRIK
FT                   "
FT                   /protein_id="YP_003650803.1"
FT   gene            212563..213252
FT                   /db_xref="GeneID:9166654"
FT                   /locus_tag="Tbis_0179"
FT   CDS_pept        212563..213252
FT                   /locus_tag="Tbis_0179"
FT                   /gene_family="HOG000105368" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /codon_start="1"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   afw:Anae109_1317 SNARE associated Golgi protein"
FT                   /db_xref="GI:296268172"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="GeneID:9166654"
FT                   /translation="MDVLLNLLDPKWWLSMLGAFATIGVIAMIFAETGLLVGFFLPGDS
FT                   LLVCAGIFCTASAAQAFGIPPLNLTALLIGTPLAAICGAQLGHYLGAKVGRKLFERPDS
FT                   RFFKQEHVRKAEYYFNKFGPAKAVIIARFMPIVRTFMNPVAGVLEMDARKFFVWNVAGG
FT                   ILWVESMVLLGYFLGSKVENIDRFVLPGAIVIIILSVLPIVREVLKERRAARMAAPRGR
FT                   HARQRIQ"
FT                   /protein_id="YP_003650804.1"
FT   gene            213308..213739
FT                   /db_xref="GeneID:9166655"
FT                   /locus_tag="Tbis_0180"
FT   CDS_pept        213308..213739
FT                   /locus_tag="Tbis_0180"
FT                   /gene_family="HOG000133848" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268173"
FT                   /db_xref="GeneID:9166655"
FT                   /translation="MGRHRSDRAGAAKPLTIGAAVVLVLAVLVVAVRTLMPDGGSDASA
FT                   AATPAAEAAASENPAERVPTVRLVCQAERCPVFVRIPGGDVLIDRDLSKGEEASYYEPE
FT                   LEIVLDDAGSVRVFENGTPREGGQPGEREAFKVKRDPDR"
FT                   /protein_id="YP_003650805.1"
FT   gene            complement(213717..214253)
FT                   /db_xref="GeneID:9166656"
FT                   /locus_tag="Tbis_0181"
FT   CDS_pept        complement(213717..214253)
FT                   /locus_tag="Tbis_0181"
FT                   /gene_family="HOG000037976" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /codon_start="1"
FT                   /EC_number="2.4.2.10"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce0446 putative orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="GI:296268174"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="GeneID:9166656"
FT                   /translation="MSDREQLLDLIKSKGIVHGRVVLSSGQEADWYIDLRRITLDGEAA
FT                   PLVGRVMLDLTADLDYEAVGGLTLGADPVATAMLHAAAARGRRLDAFVVRKSGKAHGLQ
FT                   RRIEGPDVAGRRVLAVEDTITTGGSVLTAVEALREAGAEVVGIASIVHRGGEERLRATG
FT                   LPYRSAYSLTDLGLA"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /protein_id="YP_003650806.1"
FT   gene            214373..216850
FT                   /db_xref="GeneID:9166657"
FT                   /locus_tag="Tbis_0182"
FT   CDS_pept        214373..216850
FT                   /locus_tag="Tbis_0182"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="ECF subfamily RNA polymerase sigma-24"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   ade:Adeh_0794 sigma-24 (FecI-like)"
FT                   /db_xref="GI:296268175"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:9166657"
FT                   /translation="MRRKNRQSDEELLDAVRRGDTSAYGMLYQRHVLPARALARRLVRG
FT                   DEEVEDVLVETFAGVLEIIRRGGGPGSAFRPFLLASLRRYAAAGEVDLTDPDACYVDPE
FT                   LAGLEQAPLARAYRSLPERWRAVLWHIEVEGATPAETAPLLGMSARRTARFAREARGAL
FT                   REAYLALHESDAHDEACRPVLALLLRHVEGLLPKREARTVDQHIAGCIECRSVFLELTD
FT                   VTQGLRMIVGPLYAGPAAEDYLSDLRRVRQEARRGPVRGVLLPLARLLPGLWRRLPPAQ
FT                   RAAAAGAALLLSAVTVILSAEPVGERRAVGGLALPTLPSPDSAVTGQAGDGPGRPERGE
FT                   RARPRDGHRAGGPGGAPDGLPAGEAGSGPRRGTGAPAGSRASDASARPQPGAGGLPVRR
FT                   PLAARDPGPAPSAAGVPDPAPAGADHPVRLTRRPDLGITVQPLGALVRGRSGIVALGAR
FT                   NTGTARTERVVATVLLPPGVRFRGLVAPERPGAGRPWSCRDAARAVRCTRPGLAAGASA
FT                   TAFLRVKVAEGAPLGRPVRAWARSGERIAFATSSSGVRAMGVPARFAAEGRLLTQVIGG
FT                   VLFGPPGDAPTGVPATVPGGPEANAESGARLTLPARGRVLWAGLYWSAAGHGRLQAGEV
FT                   LVRAPGARGPVTVRPASVIRRDLPGLSGYQAFAEVTGLVRAHGSGQWAVAGASAALRPG
FT                   GPGVLRWARWTLVVVAADPRQPFGRVMVLDTAEVVDDRGRLNVPLTGLAPAASPVRIDL
FT                   AVWTGERDGSAALRDRSRRGASARGDGQGSDVSLATARPLRGLLGQRPVLTLTGVRDTL
FT                   LFGVAAVSAHHWS"
FT                   /protein_id="YP_003650807.1"
FT   gene            217040..218446
FT                   /db_xref="GeneID:9166658"
FT                   /locus_tag="Tbis_0183"
FT   CDS_pept        217040..218446
FT                   /locus_tag="Tbis_0183"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG: Prp2;
FT                   proline rich protein 2"
FT                   /db_xref="GI:296268176"
FT                   /db_xref="InterPro:IPR002790"
FT                   /db_xref="GeneID:9166658"
FT                   /translation="MDRCALFVDAGYLLADGARAVHGTRQREAVSWDLPGLVRFLGKLS
FT                   RDRTGLPLLRCYWYEATVEGRRTPEHDVLADIPGIKLRLSRIRPGRREGMDAQVHRDLM
FT                   TLARNNAICDAVVVSGDEDLVQVICDAQDLGIRVTVVQIAGESGWSSARALRQECDDLI
FT                   EVGGGQLRPYVTLVTATGSPPSPAQGNGRAPGPAGNGQAYDSGPGQYQPKHGAPNGRSP
FT                   GLPSGPQPTPPPPAGAHARQPDQPALPAPLDGPSSPRYSPEPTSAPQLAQQQPAAQPQA
FT                   GQGQPPQGQQNRPAAQPQPQARPPQPAPGPASPLNAPIPPQAPPSAQPASAPAAPSTPP
FT                   PVPAPVSARQPAPQTGYDPGNGYVPTPLGPYTGPQPAPVQTQSATGTMTLAEAVKSAHK
FT                   EGHEFGQSVARDAPPLWLEAVLARKPRMPSDLEARLLQGSSLPIDFLLHEEVRQALRRG
FT                   FWDALERARG"
FT                   /protein_id="YP_003650808.1"
FT   gene            complement(218642..219274)
FT                   /db_xref="GeneID:9166659"
FT                   /locus_tag="Tbis_0184"
FT   CDS_pept        complement(218642..219274)
FT                   /locus_tag="Tbis_0184"
FT                   /gene_family="HOG000034820" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: mxa:MXAN_6734 response
FT                   regulator/sensory box histidine kinase"
FT                   /db_xref="GI:296268177"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:9166659"
FT                   /translation="MPDRAKILLVDDREENLIALEASLSSLDVDPYPVRSGEEALKALL
FT                   THDFALILLDVRMPGMDGFETAAHIKRRERTRNIPIIFLTGLDSAPDLTFRGYAAGAVD
FT                   YLTKPFDPWMLRAKVSVFVELYNVNRRLAEQAQMLRERLSAELAGREQRELGSVLGELS
FT                   DRLTAVEAELGKVRELAGTRADRSLTEALEALDGSVARLRAGLDALR"
FT                   /protein_id="YP_003650809.1"
FT   gene            complement(219267..222911)
FT                   /db_xref="GeneID:9166660"
FT                   /locus_tag="Tbis_0185"
FT   CDS_pept        complement(219267..222911)
FT                   /locus_tag="Tbis_0185"
FT                   /gene_family="HOG000183568" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; GAF domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; histidine kinase A
FT                   domain protein; GAF domain protein; histidine kinase HAMP
FT                   region domain protein; KEGG: scl:sce7807 hypothetical
FT                   protein"
FT                   /db_xref="GI:296268178"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:9166660"
FT                   /translation="MSPTEATPMEAERVYAESDLRPFLEALKAWRNGDLRHRLTDAPPG
FT                   VLSEIGFLLNDFAEQRERTVTELMRVHREIVTERRFDERLTPGPASGIWSGPIDAINEI
FT                   IESLVTQVGNAADVIDAVAKGDLSCRMPHDPKARGEIRRLNKAINGMVDQLAQITSEVT
FT                   RVTKDLGVEGRLGGRARLEGMSGSWRDLAEAVNTMSSRVSAQVRDIAEVTTAVAQGDLS
FT                   RKVTVDAVGEMLQLKNTVNTMVDRLSAFAEEVTRVAREVGTEGRLGGQAQVRGVSGVWK
FT                   DLTDSVNVMANNLTVQVRQIAAVSTAVAQGNLTKKITVDARGEIFELKETLNTMVDQLS
FT                   AFADEVTRVAREVGTEGRLGGRAEVKGVSGVWKDLTDNVNSMANNLTYQVRNIAEVTTA
FT                   VANGDLTRKIDVDAQGEILELKSTINTMVDQLSSFASEVTRVAREVGSEGRLGGQARVD
FT                   GVAGTWKRLTESVNELAGNLTTQVRAIAEVTSAVARGDLTRSITVDAPGELAQLKDNIN
FT                   TMVAALRETTQANQEQDWLKSNLARISRLMQGHRDLKELARLIMSEVPPLVSAHYGACY
FT                   LMEEGELHLVAGYGVQPELSPRSRFALGEGLVGQAALEAKQITIDNVPPGSITVETGLS
FT                   RSTPAQIVVLPIQFEDQVLGVLELASFTSFSEVHMAFLTQFVEATGPTINTIKANSRTE
FT                   ALLKESQRLATELQKRSDELQRQQEELRRSNAELEEKAALLAKQNRAIEIQNFQIEQAR
FT                   RALEERAEQLAISSRYKSEFLANMSHELRTPLNSLLVLAKLLADNAEGNLTPRQVEFAK
FT                   TIHEAGTALLQLINDILDLSKVEAGRMDIHPQQISLPRLVEYMEATFAPLAEDKELAFT
FT                   VRLDPSAPQEIYTDEQRLQQVLRNLLSNAIKFTHEGEVRLEVGRAPADVQYADEALKNT
FT                   PDMLAFRVIDTGIGIAPNKLDVIFEAFRQADGTTSRKYGGTGLGLSICRQIARLLGGEI
FT                   HVASTPGEGSTFTLYLPAVYTGPLSSWDSGAAPAGTAAGSGPEPEQRAESVPPEAAPSS
FT                   ALTGLDSPRPSDADRWQGEDPLNGAKILIIDDDIRNVFALTSVLERHGATVVYAENGRE
FT                   GIEQLERNEDVALVLMDIMMPEMDGWATTSAIRKMPQFADLPIIALTAKVMHGDREKSI
FT                   ASGASDYVPKPVDVDLLLDRLRGWLAQSRSERGPAGRPEPREGGAPDA"
FT                   /protein_id="YP_003650810.1"
FT   gene            223088..224626
FT                   /db_xref="GeneID:9166661"
FT                   /locus_tag="Tbis_0186"
FT   CDS_pept        223088..224626
FT                   /locus_tag="Tbis_0186"
FT                   /gene_family="HOG000226404" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /codon_start="1"
FT                   /product="protein serine/threonine phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: gme:Gmet_2818
FT                   putative PAS/PAC sensor protein"
FT                   /db_xref="GI:296268179"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="GeneID:9166661"
FT                   /translation="MVTIPQAVLAAPIAPGETALPEAKRFTREVLTAWAVMSVSARAER
FT                   LVEELLADRTGEPVELAWIHCGQSIRLEVREKPKERTPASPAGASEWGEAYGPGVRARW
FT                   ATIDLPEEERAPEAGEERAAEARHGAGWLGFLADASDLLAGTLDPDMVPAIIAQVVVPR
FT                   LATWCAVHTAEHAGGPLRLAYVWHADETQLDRLRRRLSDLPEAGADGPELQQIGEWQTL
FT                   AFPLTARGRRLGVMRLGRRDTFPEEIVQIAEDLSRRAALSMDNARLYARQAAAKLALQR
FT                   SLLPPELPVIPGLDFHVIYEPAGEDNEVGGDFYDLFPVGDGAWRFAIGDVCGTGPEAAA
FT                   VTGLARHTLRLLAREGYGVAAVVGRLNQAILEEGERARFLTLLHGEIASGENGVDLTLL
FT                   SAGHPEPLRLRPDGTVEPVATPQTLLGIFPEADYAAERVHLDPGDVLLAVTDGVTERRS
FT                   GSRLLDDDGGLARLLADCAGLSARAVAERIRRAVQEFAAEPSTDDVAILALRVP"
FT                   /protein_id="YP_003650811.1"
FT   gene            complement(224854..225684)
FT                   /db_xref="GeneID:9166662"
FT                   /locus_tag="Tbis_0187"
FT   CDS_pept        complement(224854..225684)
FT                   /locus_tag="Tbis_0187"
FT                   /gene_family="HOG000040121" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /codon_start="1"
FT                   /product="type 11 methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   acp:A2cp1_1787 methyltransferase type 11"
FT                   /db_xref="GI:296268180"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="GeneID:9166662"
FT                   /translation="MLADVIGYLICPVCGSAVALTGGAVRCERGHSFDVARQGYVNMLT
FT                   GSKPPGTADTPAMVAARAAFLGAGHYAPLAGRLAELCRGAAVVADAGAGTGHYLARALD
FT                   DRAVGIALDVSKHALKRAARAHPRIGAVVADVWRRLPVRDRCVDVLLNVFAPRNAAEFA
FT                   RVLRPGGTLIVVTPTDGHLRPLVERLGLLSVDEEKERRLEAALGGRFTRTGHEIIELDL
FT                   ALGHDAVEAVVAMGPSAWHTDPETLAGRIRGLPGTVRVAASFRVTTWRVTELTP"
FT                   /protein_id="YP_003650812.1"
FT   gene            complement(226002..228233)
FT                   /db_xref="GeneID:9166663"
FT                   /locus_tag="Tbis_0188"
FT   CDS_pept        complement(226002..228233)
FT                   /locus_tag="Tbis_0188"
FT                   /gene_family="HOG000241768" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG2409"
FT                   /codon_start="1"
FT                   /product="RND superfamily-like drug exporter"
FT                   /transl_table="11"
FT                   /note="KEGG: bca:BCE_1403 transporter, putative"
FT                   /db_xref="GI:296268181"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="GeneID:9166663"
FT                   /translation="MRQRNFAAAIGGWSARHRWWALLIWVVFVAVATVAGNAVGTAEME
FT                   RWEALNGDSREALRILDEAGFPRVAGEFVLVQARQGSLTADDPRFRQAVLDVKSAVEAT
FT                   GEVQNVRTPYDPEPSPVTQDRRTALIRFEMKGDAATAKDRVRPVLDAVAGVQRAHPELR
FT                   IEQAGDASSDLLINEAIDRDFMRAEQLSIPITVGILLAAFGALLAALVPVALAMTAIFA
FT                   ATGLLAFTSQLLHVHSLTANLMLCIGLAVGVDYSLFYIMRQREERAKGRDPRRAIEIAA
FT                   ATSGRAVLISGITVMVAMAGMFLTGSGIFMGFAEGTILVVFTAVLGSLTVLPALLSLIG
FT                   DKIDSRLIHGTVRAATGGRITWRRVLGVRGGESRLWSAILKPVLRRPGLSVVVAGGLLA
FT                   ALAVPALGLKTGPESIDDLQGDYSIAETFKRINSAFPSGTDPAVVVVKAADVTAPEFTA
FT                   RIEEFKRRALATGQTNEPINVVVNPDKTVAMITIGIKGTGTDAVSEQAIRTLREQVIPE
FT                   TLPGAHVTGMTANGMDFGEQLRRSLPLVFGFVLLFAFLLLLVSFRSVVIAITSIALNLL
FT                   SVGAAYGVLVLVFQKGYGESLLGFRSTGEITDWVPLFLFVILFGLSMDYHVFILSRIRE
FT                   AYDSGMRTEDAVVTGITSTAAVVTSAAIIMVAVFATFATLSLLQFKELGFGLAVAVLID
FT                   ATIVRAVLLPAAMRLLGDRNWYLPRWLGWLPTLSHGDEQEKERTPALVG"
FT                   /protein_id="YP_003650813.1"
FT   gene            228488..228973
FT                   /db_xref="GeneID:9166664"
FT                   /locus_tag="Tbis_0189"
FT   CDS_pept        228488..228973
FT                   /locus_tag="Tbis_0189"
FT                   /gene_family="HOG000013820" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bba:Bd2755 putative
FT                   ATP/GTP-binding protein"
FT                   /db_xref="GI:296268182"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:9166664"
FT                   /translation="MIPPEAFYAGLNKVLAAAAGFITDAAGRVLLVKPNYRDHWGLPGG
FT                   HIDEDEHPEIACARELQEELGLTLPVGRLLVVQWVPPFDGRPYPLIHFLFDCGTVPDGA
FT                   EVVLQEEELEEYGYFTAEEIKDRELVPGFLLARITAGARARATGGTFYLGPSAGAPA"
FT                   /protein_id="YP_003650814.1"
FT   gene            complement(229040..230314)
FT                   /db_xref="GeneID:9166665"
FT                   /locus_tag="Tbis_0190"
FT   CDS_pept        complement(229040..230314)
FT                   /locus_tag="Tbis_0190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: similar to MGC139263 protein"
FT                   /db_xref="GI:296268183"
FT                   /db_xref="GeneID:9166665"
FT                   /translation="MARSGRRDQPIDRRLGPIAEFVDDLRRLRGDRSLEAIGSRMGYHP
FT                   STISRRLNPKELPPWDFVERYVKACGADPGPWRARWRDIQEADTARPAPAERRDAAGEP
FT                   PAEQARHVAGAAEQATGSQASTGTAPGQDHRSTGESTEHDQRGPGEAVGRTTGDDQKAA
FT                   GHATGDRPVSGEAAQRPAEGRPDAAGAAEPATRPYAAGNAPNSPERPPYAAVPAEHAAG
FT                   QAPSGPDGAAGSPTPPGSGRRRIGFPVTIAAVAVVSIGLALYFTFTPDDEEPPRTLTAS
FT                   PTSAPSEPPAGHGFTMRIERMAFRLFSREWTMTAPGDIELWSNNQCPQGTAHYWVALRP
FT                   NGEPVQFACNSWQYHKWIGVPAGTYHLETWKDHDGNAIHGSGVLRSSVPIVVHPKVTPA
FT                   QTASASPDADAPAAPGAEDERSPAP"
FT                   /protein_id="YP_003650815.1"
FT   gene            230884..233211
FT                   /db_xref="GeneID:9166666"
FT                   /locus_tag="Tbis_0191"
FT   CDS_pept        230884..233211
FT                   /locus_tag="Tbis_0191"
FT                   /gene_family="HOG000053696" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /codon_start="1"
FT                   /product="LuxR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="GI:296268184"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="GeneID:9166666"
FT                   /translation="MAVVPLRAGAEHRLPAEVTSFIGRRRETTEARRLLSVARLVTITG
FT                   VGGVGKSRLALRVALDVRRAFPGGVCFVELADVDEPALIGQALADTHSIRIPPSQSPVD
FT                   VLIEHLADRRMLIVLDNCEHLLEDCAVLADGLLRALPDLRILATSRQPLGIASEQTLEL
FT                   APLPVSGAGPLTCSAESDAVRLFAERVAAVRPDFAVTEANLPVVLEICRRLDGLPLAIE
FT                   LAAVRLRALSVEQLLQRLDDRFRLLTTGSRAAPPRQRTLRALIDWSHDLCTAKERLLWQ
FT                   RACVFSDGFTLETAEEVCSGDGIGKAEVIDLITGLVEKSVLIREEGYHEARYRLLDTIR
FT                   QYGRERLAESGEEAIWRRRHRDHYRDLARKAWERHFGPAQLDWHVRLHAEDGNLHKALE
FT                   WSFAEPGEAETGLAMATHLLHHWIRYHPREGRGWLAQGLALCTAPTVLRARALWGCAWM
FT                   SLMQGDEAPAAAMLAECREIAARTGSDYDLAYADLCSGMLAMSRGEAATAAVLYRKAAD
FT                   RCRRLGDHVGVALALIRLCLARSVQGRGEEAQALGEEAVAVCEAHGDVRYRAYALMVLG
FT                   IEAWRRGELQRAAALQKQSLESNRVMDDYTGCGMNLEVLTWIAGSEERYARVARLLGIL
FT                   KSPPWSDDVSMVEFRWLRRHSRVCEAEAVKALGTKAFSAEVTRGARLAPDEAAGFVLEL
FT                   EAPEEPVPAASNGQVPPLTRRETEIARLVSRGLSNKEIASTLVISPRTAEGHVEHILDK
FT                   LGFSSRTQIATWLNEQTRNGKA"
FT                   /protein_id="YP_003650816.1"
FT   gene            complement(233215..233748)
FT                   /db_xref="GeneID:9166667"
FT                   /locus_tag="Tbis_0192"
FT   CDS_pept        complement(233215..233748)
FT                   /locus_tag="Tbis_0192"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: pfo:Pfl01_3355 histidine kinase"
FT                   /db_xref="GI:296268185"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="GeneID:9166667"
FT                   /translation="MSHIATTPRLEMAEHFTTAGEPRSAWLGMTELYRRFSRFVLRIMG
FT                   GSRVQTESWRLSADLHAAARARRLTRDQLIAWGLGHLSDTAMLLVSELVTNALRYTPGP
FT                   ISLTITRMDGVVRCEVADSGGEIPRCDTSENLTLEEEGGRGLMLIDILSSRWGGRTTAA
FT                   GKVMWFELRADRLR"
FT                   /protein_id="YP_003650817.1"
FT   gene            complement(234298..234374)
FT                   /note="tRNA-Pro3"
FT                   /db_xref="GeneID:9166668"
FT                   /locus_tag="Tbis_R0007"
FT   tRNA            complement(234298..234374)
FT                   /db_xref="GeneID:9166668"
FT                   /locus_tag="Tbis_R0007"
FT                   /product="tRNA-Pro"
FT   gene            complement(234405..235361)
FT                   /db_xref="GeneID:9166669"
FT                   /locus_tag="Tbis_0193"
FT   CDS_pept        complement(234405..235361)
FT                   /locus_tag="Tbis_0193"
FT                   /gene_family="HOG000260480" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: msl:Msil_1866
FT                   metallophosphoesterase"
FT                   /db_xref="GI:296268186"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:9166669"
FT                   /translation="MSGMMCSVRRAAAASLSLLGLGAAGLGYAAVFERNWFRLRRFDVP
FT                   VLEPGQRPIRILHISDLHLTPRRTRLIKWVRSLDLLNPDLIVNTGDTIAHPDAVEAYLR
FT                   AVEPLLERPGVFVYGSNDLYAPHFKNPARYLWRTSKGDVRRNTPDLPWEELGAAMTAAG
FT                   WLDLNNKTARLKVGDLDVHVGGIHDSHIDRDRYDEIAGQAPADADLRIGVMHSPEPRNL
FT                   TRFADDGYDLLLAGHTHGGQICIPFYGALVTNCGLDTARVKGLSRHGRAWLHVSAGLGT
FT                   SPYAPVRFACPPEASLLTLVPRRPVGRARGTSTAKVR"
FT                   /protein_id="YP_003650818.1"
FT   gene            235423..235878
FT                   /db_xref="GeneID:9166670"
FT                   /locus_tag="Tbis_0194"
FT   CDS_pept        235423..235878
FT                   /locus_tag="Tbis_0194"
FT                   /gene_family="HOG000015154" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:VFMJ11_2362"
FT                   /codon_start="1"
FT                   /product="GatB/YqeY domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vfm:VFMJ11_2362 GatB/YqeY domain protein"
FT                   /db_xref="GI:296268187"
FT                   /db_xref="GeneID:9166670"
FT                   /translation="MSALKDRLQADLTAAMKARDEVRMRTIRMALAAINVAEVAGEKAR
FT                   ELSDDEVIKVLTKEAKKRREAATAFSDAGRADRAQAELDELAVLEEYLPAQLSDEELNK
FT                   LIDEAIAETGAQGPKAMGQVMKVLTPRIAGRAEGARVAQAVRARLSG"
FT                   /protein_id="YP_003650819.1"
FT   gene            complement(235969..238188)
FT                   /db_xref="GeneID:9166671"
FT                   /locus_tag="Tbis_0195"
FT   CDS_pept        complement(235969..238188)
FT                   /locus_tag="Tbis_0195"
FT                   /gene_family="HOG000041139" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /codon_start="1"
FT                   /product="family 51 glycosyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: gur:Gura_2430 1A
FT                   family penicillin-binding protein"
FT                   /db_xref="GI:296268188"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="GeneID:9166671"
FT                   /translation="MQTNGKPKASVRGGVLRLLGAAGVAGVLTAGIALPAVGTVGMTAK
FT                   SATEALHLAPEELDEPPLPEKTVLLDADGKPFAQFYYQNRESVTLDKIAPIMRKAIVAI
FT                   EDYRFYEHGPLDLEGTARALIKNIVSGGVTQGGSSITQQYVKQVLYNKAETEEEKAAAV
FT                   APTLSRKLTEIRYAMAIEQKYTKDEILERYLNIAYFGAGAYGIEAAAKRFFGKHASQLN
FT                   LAEAATLAGAVQNPNATDPNRGKRFRDRLLARRNVVLDRMAELKIITPEEAEKAKAQKL
FT                   GYKDVPIPGGCEQSEFPYFCLYVRNEILNNPQFGKTQKARSDFLARGGLTIKTTLDRKM
FT                   QRAAEKAIRKYVHPTDNPVAAEALVEPGTGAIKAMAASRKFGTNRKKKEMSINVVADAE
FT                   HGGGTGFQAGSTFKMFTLVTALKKGYKFNDGFNVGPTYVARSPHDFKDCQGNSVGDTRT
FT                   PLHNSEGGRGGFLTLQTGTWKSVNTFFLTLEQKVGLCDVVKTAKDFGIKRADGQKLQEF
FT                   EPFTLGFNEMDPVTVAAAYATLGARGKYCKPMAITEIIDRYGRSTKFKPQCKQVVEPEV
FT                   ADATTYILQGVFTKGTMAGVGGIGRDAAGKTGTGDVSRTAWFAGYTPDLAGAVSLGDPR
FT                   GPVRYPLSGQVMGGRRYGSVYGATIPGPIWKETFLEALKGVPPSSFVPPDMSRFGGCSK
FT                   QCAPPPKKRDKDGRGDERGGRGGDRERGRGPGDRLDLFGGDNPFE"
FT                   /protein_id="YP_003650820.1"
FT   gene            238446..238754
FT                   /db_xref="GeneID:9166672"
FT                   /locus_tag="Tbis_0196"
FT   CDS_pept        238446..238754
FT                   /locus_tag="Tbis_0196"
FT                   /gene_family="HOG000247629" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /codon_start="1"
FT                   /product="transcription factor WhiB"
FT                   /transl_table="11"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="GI:296268189"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="GeneID:9166672"
FT                   /translation="MWITDWTSRAACRNADPDALFVQGAAQNRAKLICRGCPVRTECLA
FT                   DALDNRIEFGVWGGMTERERRALLRRRPDVTSWRDLLAAAKEEYERNLERSKELIAG"
FT                   /protein_id="YP_003650821.1"
FT   gene            complement(238937..240064)
FT                   /db_xref="GeneID:9166673"
FT                   /locus_tag="Tbis_0197"
FT   CDS_pept        complement(238937..240064)
FT                   /locus_tag="Tbis_0197"
FT                   /gene_family="HOG000022527" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /codon_start="1"
FT                   /product="anion-transporting ATPase"
FT                   /transl_table="11"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: mxa:MXAN_5818
FT                   anion-transporting ATPase"
FT                   /db_xref="GI:296268190"
FT                   /db_xref="InterPro:IPR003348"
FT                   /db_xref="GeneID:9166673"
FT                   /translation="MKTAPTLDIDAILDDRGTRIIVCCGAGGVGKTTTAAALGLRAAER
FT                   GRSVVVLTVDPAKRLAQAMGLTELDNTPRLVLGNTAKGGELYAMMLDMKRTFDEIIEAH
FT                   ADPERAHQILTNPFYQSLSSSFSGTQEYMAMEKLGQLSRTGDWDLIVVDTPPSRSALDF
FT                   LDAPERLGRFLDGRLIRILTAPAKAGGRSAFKLFNLGLNVMTGILTKVIGAQVLRDIQL
FT                   FVSALDAVFGGFRQRAEQTYRLLQAPGTAFLVVAAPERDAMREASYFVERLAEDRMPLA
FT                   GLVVNRVHASPAAALSAERSIAAAEELEARGEHELTAAVLRLHAERMQLAAREQREQEH
FT                   FTAAHPTVPVARVPAMPEDVHDLDGLRQIGQLLAM"
FT                   /protein_id="YP_003650822.1"
FT   gene            complement(240116..241141)
FT                   /db_xref="GeneID:9166674"
FT                   /locus_tag="Tbis_0198"
FT   CDS_pept        complement(240116..241141)
FT                   /locus_tag="Tbis_0198"
FT                   /gene_family="HOG000022516" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /codon_start="1"
FT                   /product="anion-transporting ATPase"
FT                   /transl_table="11"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: ade:Adeh_0929
FT                   chromosome partitioning-like ATPase"
FT                   /db_xref="GI:296268191"
FT                   /db_xref="InterPro:IPR003348"
FT                   /db_xref="GeneID:9166674"
FT                   /translation="MNDPTAAGSARDTDWEGVRLHVITGKGGTGKTTVAAAFALALAAG
FT                   GRKVLLVEVEGRQGIAQVFDLPQLPYAERKIAVAPGGGEVYALAIDPEEALLEYLEMFY
FT                   GLKRMGKALDRIGMIDFATTIAPGLRDVLVTGKTSEAVRRRDRSGKRAYDAVVMDAPPT
FT                   GRIVRFLNVTHEVAGLARVGPIKNHAEMVRGVIASPETAVHFVALLEEMPVQETLDGIA
FT                   ELRAAGLPVGGIVINMVRPVFLSEPVLAAARENRFDSGELALGLKAAGIVDESGDASLI
FT                   AEALTQEVIEHAKRVELERREREMLASAGVPCYELPLLADGVDRAGLYELAEALRAQGA
FT                   A"
FT                   /protein_id="YP_003650823.1"
FT   gene            241320..241475
FT                   /db_xref="GeneID:9166675"
FT                   /locus_tag="Tbis_0199"
FT   CDS_pept        241320..241475
FT                   /locus_tag="Tbis_0199"
FT                   /gene_family="HOG000250588" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268192"
FT                   /db_xref="GeneID:9166675"
FT                   /translation="MTKWEYVTVPLLTHATKQILDNWGDEGWELVAVVPGPNPEQLVAY
FT                   MKRPKQ"
FT                   /protein_id="YP_003650824.1"
FT   gene            241472..241933
FT                   /db_xref="GeneID:9166676"
FT                   /locus_tag="Tbis_0200"
FT   CDS_pept        241472..241933
FT                   /locus_tag="Tbis_0200"
FT                   /gene_family="HOG000267216" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bov:BOV_1122
FT                   hypothetical protein"
FT                   /db_xref="GI:296268193"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="GeneID:9166676"
FT                   /translation="MSAPEQRLAELGLALPEVAAPLAAYVPAVRSDAYVYTSGQLPLVE
FT                   GKLPVTGKVGAEVPVEEAQRLARICALNALAAVKSVVGDLSSVVRIVKVVGFVASAPGF
FT                   TGQPQVVNGASELLVDVFGEAGKHARSAVGVAVLPLDAPVEVELIAEVR"
FT                   /protein_id="YP_003650825.1"
FT   gene            242050..242223
FT                   /db_xref="GeneID:9166677"
FT                   /locus_tag="Tbis_0201"
FT   CDS_pept        242050..242223
FT                   /locus_tag="Tbis_0201"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268194"
FT                   /db_xref="GeneID:9166677"
FT                   /translation="MARWEYAVVGFDLGTYRGAQQVLDDWGSAGWELVTVIHLYNTEYN
FT                   SSFVAFLKRRTG"
FT                   /protein_id="YP_003650826.1"
FT   gene            242414..243301
FT                   /db_xref="GeneID:9166678"
FT                   /locus_tag="Tbis_0202"
FT   CDS_pept        242414..243301
FT                   /locus_tag="Tbis_0202"
FT                   /gene_family="HOG000250577" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pna:Pnap_2699 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:296268195"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:9166678"
FT                   /translation="MRLPLRGAAGERARDVLAGRAPVVPARDAATVVLLRDDPLETFLL
FT                   RRKQTLAFAAGAYVFPGGAVDPRDADHAIAWAGPSPAEWAEVLRTDERTARGLVCAAVR
FT                   ETFEESGVLLAGPDTGSVVADTSGDDWEADRRALVDRTLSFAEFLERRRLVLRSDLLKA
FT                   WAHWITPEVEPRRYDTRFFVAALPAGQRTRDVGGESDGVVWMEPKTALARAAAGEMHLM
FT                   PPTLRTLTEIAAFETISEVLAHEREIVTIMPPAVEIDGEVVLLIPGPEPGSETGPEAGG
FT                   EPGPAEGRPAAERP"
FT                   /protein_id="YP_003650827.1"
FT   gene            243377..244168
FT                   /db_xref="GeneID:9166679"
FT                   /locus_tag="Tbis_0203"
FT   CDS_pept        243377..244168
FT                   /locus_tag="Tbis_0203"
FT                   /gene_family="HOG000246878" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /codon_start="1"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   eli:ELI_00475 metallo-beta-lactamase family protein"
FT                   /db_xref="GI:296268196"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="GeneID:9166679"
FT                   /translation="MSGLRIPLDGPDGAGTEHVTNLLAPNPSPWTLDGTNTWVIGGGET
FT                   VLVVDPGPDDEQHLKRVVEHLGDRRVAAILLTHGHRDHSAGAPALAEMVRAPVRALDPK
FT                   HRLGEEGLQDGDVLTVDGLEVRVVGTPGHSFDSLCFWVPEDRAMLTGDTILGRGTTVIA
FT                   SDGHLGDYLRSLDRLRALAETVEASALLPGHGPVLPDPIAALDGYIAHRRKRLDQIREA
FT                   IRRGAKDVAEIVDIVYADVDPSLRRAAEWSVRAQLDYLEGR"
FT                   /protein_id="YP_003650828.1"
FT   gene            complement(244256..244936)
FT                   /db_xref="GeneID:9166680"
FT                   /locus_tag="Tbis_0204"
FT   CDS_pept        complement(244256..244936)
FT                   /locus_tag="Tbis_0204"
FT                   /gene_family="HOG000250566" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /codon_start="1"
FT                   /product="Crp/Fnr family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bja:bll6060 putative catabolite gene activator"
FT                   /db_xref="GI:296268197"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR002373"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="GeneID:9166680"
FT                   /translation="MSTDEILMKAPLFSALDPESAAALRASITEIELSKGQTVFSEGEE
FT                   GDRLYVVLEGKIKLARTSSDGRENLLSVLGPGEMFGELSLFDPRPRTASAIALTHVRLA
FT                   GLGHDDLRPWLTGRPEVAVHLLRALAQRLRRTNDVIADLVFSDVPGRVAKQLLDLADRF
FT                   GTKTEDGVRVHHDLTQEELAQLVGASRETVNKALADFAQRGWLRIEAKAVVILDRDRLH
FT                   HRSR"
FT                   /protein_id="YP_003650829.1"
FT   gene            245018..245737
FT                   /db_xref="GeneID:9166681"
FT                   /locus_tag="Tbis_0205"
FT   CDS_pept        245018..245737
FT                   /locus_tag="Tbis_0205"
FT                   /gene_family="HOG000252208" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /codon_start="1"
FT                   /EC_number="4.2.99.18"
FT                   /transl_table="11"
FT                   /note="KEGG: pca:Pcar_0009 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   iron-sulfur cluster loop"
FT                   /db_xref="GI:296268198"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="GeneID:9166681"
FT                   /translation="MSRNRSAAGESRLALVRRARRIDRILAETYPDAHCELDYSSPLEL
FT                   LVATILSAQCTDKRVNTVTPVLFAKYRTAADYAAADQAELEEIIRPTGFYRAKASNIIA
FT                   MAQALCERHHGEVPDRLEDLVRLPGVGRKTANVVLGNAFGIPGITVDTHFQRLARRFGW
FT                   TKETDPVKIEHEVGELFPKSSWTMLSHRLIWHGRRICHARRPACGACPIATLCPSYGTG
FT                   PTDPEEARKLVKAGPFS"
FT                   /product="endonuclease III"
FT                   /protein_id="YP_003650830.1"
FT   gene            245841..246488
FT                   /db_xref="GeneID:9166682"
FT                   /locus_tag="Tbis_0206"
FT   CDS_pept        245841..246488
FT                   /locus_tag="Tbis_0206"
FT                   /gene_family="HOG000250455" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ade:Adeh_4112 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:296268199"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:9166682"
FT                   /translation="MAPGWLTDLAIKARRQPVPPALRPPADGAGRSAAVLLLFGESPVG
FT                   PDILLIQRSTKDRVHGGQPAFPGGGVDPQDDGPVAAALREAAEETGVDPSGVEVVGTMP
FT                   EVYVWRSRYRVTPVLAWWHTPSAVHPASPDEVDAVERVPIAELTDPANRFLLRYPGGLP
FT                   PSVAFRVRGLLVWGFTARVLDSVLSIGGFERPWDRTRIEDMPPDVLMQVTRA"
FT                   /protein_id="YP_003650831.1"
FT   gene            246679..247863
FT                   /db_xref="GeneID:9166683"
FT                   /locus_tag="Tbis_0207"
FT   CDS_pept        246679..247863
FT                   /locus_tag="Tbis_0207"
FT                   /gene_family="HOG000250554" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /codon_start="1"
FT                   /product="colicin V production protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: eli:ELI_11340 trypsin-like
FT                   serine protease"
FT                   /db_xref="GI:296268200"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="GeneID:9166683"
FT                   /translation="MRGDLLDLILIGLVVAFAVSGYRQGFIIGAFSFIGFVGGALLGMF
FT                   IAPPLAGAIVNGDMERALLAIVIVFLTATLGQFICSTIGAVVRSHVTWEPARVVDAFGG
FT                   SVASGLSVLLIAWLFGSLIVSMSSPVLKEQVVGSIVWQAVDEAIPDSVRALQKPFKDFV
FT                   ETSEWPQVITSIGGQNVPPPDEGVLQGSPALARARKAIVKIEGTAPSCRKHIEGTGFVY
FT                   ARHRVMTNAHVVAGVTEDLKVIDSTGKRHAATVVHYNPDKDVAVLFVPELQVPALRFDF
FT                   TAERGEDAIIAGYPKGRGFTPLAARIRTKLRAESDDIYNRRKVERDVYVIRGKVQPGNS
FT                   GGPLLSTEGRVYGMIFAAATDQEETGYALTAREILPDAKKASAAVARVGTQECD"
FT                   /protein_id="YP_003650832.1"
FT   gene            complement(247982..248515)
FT                   /db_xref="GeneID:9166684"
FT                   /locus_tag="Tbis_0208"
FT   CDS_pept        complement(247982..248515)
FT                   /locus_tag="Tbis_0208"
FT                   /gene_family="HOG000022505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   dvm:DvMF_2231 protein of unknown function DUF309"
FT                   /db_xref="GI:296268201"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="GeneID:9166684"
FT                   /translation="MRDRDEAGRPRNLRPRDEYGRPLPHGAEGVPRIPDDYAPGPLQAI
FT                   EDAKRLLEAGRPFHAHEVFEARWKTGPAEERELWQGLAQICVGLTHVQRGNLPGAATLL
FT                   TRGSARLSAYGSRRPYGLDLRALAIASDRLTGEIDSGQVDAATAIGVILEHLRQAGEPE
FT                   RATTAEASADGSNG"
FT                   /protein_id="YP_003650833.1"
FT   gene            complement(248845..249750)
FT                   /db_xref="GeneID:9166685"
FT                   /locus_tag="Tbis_0209"
FT   CDS_pept        complement(248845..249750)
FT                   /locus_tag="Tbis_0209"
FT                   /gene_family="HOG000028073" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ank:AnaeK_0555 alpha/beta hydrolase fold"
FT                   /db_xref="GI:296268202"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:9166685"
FT                   /translation="MSTEKAVIEIEGPWHHRTVHAGGTRFHVVEAGTGPLVLLLHGFPQ
FT                   FWWTWRHQLVALAEAGYRAVAVDLRGYGASDKPPRGYDLPTLAVDAAGLIRALGEAGAV
FT                   VVGHDWGGLIAWTMSVMDPKVVRRLVVVSAPHPLRLRAALWTTLGQLKAVRHALAFQLP
FT                   ILPERRLTADGGALVARLLKSWSGPGWPPADVADVYRKALLIPSAANCALEYYRWFARS
FT                   QVRPDGFHYAKQMRARIEAPTLQVHGALDPCLLPRTAMGSSRYVAAPYRWRLIEGAGHF
FT                   PHEERPEPFNAELISWLTDL"
FT                   /protein_id="YP_003650834.1"
FT   gene            complement(249755..250225)
FT                   /db_xref="GeneID:9166686"
FT                   /locus_tag="Tbis_0210"
FT   CDS_pept        complement(249755..250225)
FT                   /locus_tag="Tbis_0210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   jan:Jann_2210 hypothetical protein"
FT                   /db_xref="GI:296268203"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="GeneID:9166686"
FT                   /translation="MREDESLGALIAQASHHLSTLVRSEIELAKAELTFDAKRVGMAAG
FT                   FFGAAAFIGHLCLILSSFAIAYVLVAIGVATWLAFVIVTAFYLVVAVILVFVGYRRLKG
FT                   LSGMKRTTRTLRGLRGSGRETSPLEPAAGTASASQRGQERSEPSASVLSDNP"
FT                   /protein_id="YP_003650835.1"
FT   gene            complement(250801..252780)
FT                   /db_xref="GeneID:9166687"
FT                   /locus_tag="Tbis_0211"
FT   CDS_pept        complement(250801..252780)
FT                   /locus_tag="Tbis_0211"
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /codon_start="1"
FT                   /product="acetate/CoA ligase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: aba:Acid345_3520
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="GI:296268204"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="GeneID:9166687"
FT                   /translation="MATETPGRETQETLSNLLTETRRFAPPAELAAAANVTAEAYEEAE
FT                   RDRLAFWERAAERLTWAERWHTTLEWNAPFAKWFVGGKLNVAYNCVDRHVEAGLGDRVA
FT                   YYWEGEPEGHSRTITYAELQREVAKAANALQELGVRKGDRVAIYMPMIPELPIAMLACA
FT                   RIGAIHSVVFGGFSVSALKNRIEDANAKLVITADGGYRRGKPNPLKPTVDEAVAECPGV
FT                   ERVVVVRRTGQEVNWTDKDIWWHDIVDRQPAEHEAVPHDAEDPLFILYTSGTTGKPKGI
FT                   LHTTGGYLTQTSWTHWAVFDLKPETDIYWCTADIGWVTGHSYIVYGPLANAATSVIYEG
FT                   TPDTPHRGRFWEIVQKYKVTILYTAPTAIRTFMKWGADIPAKFDLSSLRILGSVGEPIN
FT                   PEAYVWYREHIGGNRCPVVDTWWQTETGAIMITPLPGITHAKPGAAMRALPGIVADVVD
FT                   DKGESVPNGGGGYLVIREPWPSMLRTIWGDDKRYVDTYWSRFEGLYFPGDGAKRDEDGD
FT                   IWLLGRVDDVMLVSGHNISTTEVESALVSHPKVAEAAVVGASDPVTGQAIVAFVILRGE
FT                   AEESEDIAAELRAHVASTLGPIAKPRQILVVPELPKTRSGKIMRRLLRDVAENRELGDV
FT                   TTLTDSSVMKLIAEKLPAAKSSED"
FT                   /protein_id="YP_003650836.1"
FT   gene            253067..253843
FT                   /db_xref="GeneID:9166688"
FT                   /locus_tag="Tbis_0212"
FT   CDS_pept        253067..253843
FT                   /locus_tag="Tbis_0212"
FT                   /gene_family="HOG000052439" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:A2cp1_0593"
FT                   /codon_start="1"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /transl_table="11"
FT                   /note="KEGG: acp:A2cp1_0593 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="GI:296268205"
FT                   /db_xref="GeneID:9166688"
FT                   /translation="MNDPLAVIAELPGVPEAVQEAREAVDRLYRHPVLRRRSPEVSAES
FT                   ALRGARASAAIEGVDVPLEELRRGEVTDPVVQGALRASTEIGRLTSLWRSAPPQVLARL
FT                   HAVAAVGLTDDPGRPRSTPTDADPLGLGPAPGPEETAARLSMLTRLLTGDTKAPALVLA
FT                   AIVHAELVTLRPFGVADGLVARAAARFTLVERGLDPKSLCAVEVGHAELGDAYPEALRS
FT                   YQTGTPAGLAGWIRHCADAVVLGVRETTAICEALSR"
FT                   /protein_id="YP_003650837.1"
FT   gene            255271..256311
FT                   /db_xref="GeneID:9166689"
FT                   /locus_tag="Tbis_0213"
FT   CDS_pept        255271..256311
FT                   /locus_tag="Tbis_0213"
FT                   /gene_family="HOG000250433" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG0455"
FT                   /codon_start="1"
FT                   /product="chromosome partitioning-like ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: pzu:PHZ_c2999 pilus assembly protein CpaE"
FT                   /db_xref="GI:296268206"
FT                   /db_xref="GeneID:9166689"
FT                   /translation="MQQPLAITHDQELLDDLLRMAVAAGVELDVARSAAQARPYWNHAP
FT                   LVIVGGDIAGDLAAAGLPHRDRVLIVTRETADVDTWRTCVALGAQAVWELPEAERILVE
FT                   ELGEAADPPTRAGDVVCVVGGKGGAGATVLAAALAVTASRAGLRTLLIDADPLGGGIDV
FT                   VLGQEEATGARWPDFVGREGRVGFAALQDALPTFGELTVLSWHRGEPAEIPRQAMRAVL
FT                   DAGRRGCDLVVVDLPRHLGEGGEEALPRAARTLLVVPAEVRGALAAAQTLAVLRRHTSE
FT                   LYAVLRQGSLDPDVVGASLDIPCAGVLPELSGLTETLDRGDPLPLGRAPLGGFCTTLLR
FT                   TLMEAR"
FT                   /protein_id="YP_003650838.1"
FT   gene            256308..257555
FT                   /db_xref="GeneID:9166690"
FT                   /locus_tag="Tbis_0214"
FT   CDS_pept        256308..257555
FT                   /locus_tag="Tbis_0214"
FT                   /gene_family="HOG000119936" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   pzu:PHZ_c3030 Flp pilus assembly protein ATPase CpaF"
FT                   /db_xref="GI:296268207"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:9166690"
FT                   /translation="MTSRARGGAEVMAGEGGMMTRPAGDRTAAQAAVPPELVEAVRVRL
FT                   SRAGAPPTAAQVAAALRAERAVLGDAEVLAIGRILRADLVGAGPLEGLLALPGVTDVLV
FT                   NGPREVWIDDGSGLRKTDVTFSGEEEVRRLAQRLAATAGRRLDDACPYVDARLAGGIRL
FT                   HAVLPPIARDGTCLSLRLPPRRTFTVEELVPGAGAELLRAIVAARMAFLVTGGTGTGKT
FT                   TLLASMLSCADPGERLLLVEDSAELNPRHPHVVRLEARPPNLEGAGGITLRDLVRQALR
FT                   MRPDRLVVGEVRGAEVVDLLSALNTGHEGGCGTLHANNPADVPARLEALACAAGLSREA
FT                   VHSQIAAALDVVVHLVRAPGGGPRRVAEVCLLERDPSGFVTARPSVIFTPEGRAVPGPA
FT                   FGALRDRCPVPLPCLT"
FT                   /protein_id="YP_003650839.1"
FT   gene            258015..258806
FT                   /db_xref="GeneID:9166691"
FT                   /locus_tag="Tbis_0215"
FT   CDS_pept        258015..258806
FT                   /locus_tag="Tbis_0215"
FT                   /gene_family="HOG000053304" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   reh:H16_B0188 flp pilus assembly protein TadB"
FT                   /db_xref="GI:296268208"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="GeneID:9166691"
FT                   /translation="MLILIALAIALAVWVATGPDAGTVRLAALRRPSARRPSGRVRGRP
FT                   GPGHASARSGVPARRVGARFTLRPRRARTAAAWRALSIELCHGIHAELVAGRMPGEALV
FT                   NAIAAVEPPDPAALTPVVAAVRDGGDVAAALLSAAPEEGGEGLVRLAACWRVSTSVGGG
FT                   LAALVDRLAASLREAEAHRQEVAAQLAGPRATARMLAALPLLGLLMATALGVSPLPFLL
FT                   GSPAGHACLLIGLALDAAGVWWTRRLADRAIAAPVTGGGSR"
FT                   /protein_id="YP_003650840.1"
FT   gene            258826..259608
FT                   /db_xref="GeneID:9166692"
FT                   /locus_tag="Tbis_0216"
FT   CDS_pept        258826..259608
FT                   /locus_tag="Tbis_0216"
FT                   /gene_family="HOG000052406" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bte:BTH_I2454 type II secretion system protein F"
FT                   /db_xref="GI:296268209"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="GeneID:9166692"
FT                   /translation="MTLLIAMSVAAAVLLWPVPRSPAGRLRALVTGGRGERAPGTAEGR
FT                   SGGGVMPALKGMPAFTARWDRLVLAAVPGLAGFAVISGVPGLFFGALLAGAALVAAGRR
FT                   EPVEARRRRARIAADLPFAIDLLVACLRAGQPVDRAVEVTADAIGGPLAERMSWVAVQL
FT                   RLGADPGTAWAGLADEPPAAPFARTMIRAAKGGAPVADVLVRLADDARQAARAASSAAA
FT                   RKVGVQVVAPLGLCFLPAFVLLGIIPMIAGLIARIPLP"
FT                   /protein_id="YP_003650841.1"
FT   gene            260324..260551
FT                   /db_xref="GeneID:9166693"
FT                   /locus_tag="Tbis_0217"
FT   CDS_pept        260324..260551
FT                   /locus_tag="Tbis_0217"
FT                   /gene_family="HOG000052395" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268210"
FT                   /db_xref="GeneID:9166693"
FT                   /translation="MRRLVSAARERVRRIGLRWVLLARERPDAGMSTAEYAVGTLAACG
FT                   FAALLWKVVTSAEVKSMLIALIQRALKVAG"
FT                   /protein_id="YP_003650842.1"
FT   gene            260601..260933
FT                   /db_xref="GeneID:9166694"
FT                   /locus_tag="Tbis_0218"
FT   CDS_pept        260601..260933
FT                   /locus_tag="Tbis_0218"
FT                   /gene_family="HOG000022462" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268211"
FT                   /db_xref="GeneID:9166694"
FT                   /translation="MTAEAAVLLPVLLIVLGAALWAVAIVGVQLQCVDAARAGARAAAR
FT                   GEVIDEVRRTVLRAVPAGARVEVIPGTETTRVEVVAVVEPFPGAVLPPVRVTAAAVSAT
FT                   EPGVVP"
FT                   /protein_id="YP_003650843.1"
FT   gene            261172..261609
FT                   /db_xref="GeneID:9166695"
FT                   /locus_tag="Tbis_0219"
FT   CDS_pept        261172..261609
FT                   /locus_tag="Tbis_0219"
FT                   /gene_family="HOG000080082" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268212"
FT                   /db_xref="GeneID:9166695"
FT                   /translation="MAPMGEHPWTGAGPFGDAPGIRADRGRRLSGERGSATVWMITVIT
FT                   VIWAVATAVVAAGMARVARHRAQSAADLSALAGAAWAFSRPALACTHAKEIADANGVVL
FT                   ESCAISEGIAEVAVSLRFTLPIAGARSVRATARAGPVTVQR"
FT                   /protein_id="YP_003650844.1"
FT   gene            complement(261732..264440)
FT                   /db_xref="GeneID:9166696"
FT                   /locus_tag="Tbis_0220"
FT   CDS_pept        complement(261732..264440)
FT                   /locus_tag="Tbis_0220"
FT                   /gene_family="HOG000250411" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /codon_start="1"
FT                   /product="DEAD/DEAH box helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: dvl:Dvul_2723 DEAD/DEAH box
FT                   helicase domain- containing protein"
FT                   /db_xref="GI:296268213"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:9166696"
FT                   /translation="MPNWKPVTAISSRQGGAGELLGRLLAVPARRGLVTHVEHVPAREG
FT                   GDARWPDWVPEPLVGRLRHLGISGLWEHQLATAEHVRRGENVIIATGTASGKSLAYLVP
FT                   AITEIFAGGTVLYLTPTKALAADQLATIRKLRLTEVRAATYDGDTPPEERSWVRRHANY
FT                   VLTNPDMLHRSILPRHGSWASFWRRLRLVVVDECHGYRGVFGSHVAQILRRLRRVCAKY
FT                   GSRPVFLLASATASDPGAAGKRLTGLDMAEVTADASPRGAMTFALWEPPLTELRGERGA
FT                   PIRRTATAEAADLLTDLVVEGVRTLVFVRSRRGAETVALTAKRHLTELEAVLEAGPYGT
FT                   ALSAGATGTAGPVGSAGAAGSPGPAGSGAASGSGGTTAVGEVGEDPAGAATTPAGSPAV
FT                   GDHKEAASGDRRGTSARGDGATTADGHGGTTTGRPGDTTTGGPGDTTTGDHGAGPAGGR
FT                   LADRVAAYRGGYLAEDRRLLEKALRTGELTALATTNALELGVDISGLDAVIIAGWPGTR
FT                   ASLWQQAGRAGRTGQDALVVLIARDDPLDTYIVHHPEAVFGQPVEAIVLDPDNPYVLAP
FT                   HLCAAAAEIPLTEDDLEIFGPAARDVVDDLVRRGMLRQRPSGWYWTHRERAADLADIRG
FT                   SGGNPIHVVESGTGRLLGTVDEPSAHTTVHPGAVYLHQGETYEVESLDLEAGVALVSPA
FT                   DPDYATYPRDVTDIRMIESLRSRPFGPGELHFGTVEVTRQVVSYLKRRTQTGEVLGEEP
FT                   LDLPPRTLCTRAVWWTLPDTALAPLRSAEHGGPVDLGGAAHAAEHASIGLLPLFATCDR
FT                   WDIGGVSTELHPDTGMLTVFVYDGHDGGAGFAERGFARAADWLTATREAIASCECERGC
FT                   PSCIQSPKCGNGNEPLDKTGAIRLLDVLLGS"
FT                   /protein_id="YP_003650845.1"
FT   gene            264587..264937
FT                   /db_xref="GeneID:9166697"
FT                   /locus_tag="Tbis_0221"
FT   CDS_pept        264587..264937
FT                   /locus_tag="Tbis_0221"
FT                   /gene_family="HOG000270156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /codon_start="1"
FT                   /product="anti-sigma-factor antagonist"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bcz:BCZK0894 anti-sigma B factor antagonist"
FT                   /db_xref="GI:296268214"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="GeneID:9166697"
FT                   /translation="MDLKLDHRTEGNLTIVDVEGEIDVYTAPRLRELLIDLVNKGNFHL
FT                   LVNMEKVDFLDSTGLGVLVGGLKRVRAHDGSLELVCTQERILKIFRITGLTKVFGIYAS
FT                   VDEAKEAHARDK"
FT                   /protein_id="YP_003650846.1"
FT   gene            264955..265383
FT                   /db_xref="GeneID:9166698"
FT                   /locus_tag="Tbis_0222"
FT   CDS_pept        264955..265383
FT                   /locus_tag="Tbis_0222"
FT                   /gene_family="HOG000022446" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BCAH187_A1158"
FT                   /codon_start="1"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: bcr:BCAH187_A1158 anti-sigma B factor"
FT                   /db_xref="GI:296268215"
FT                   /db_xref="GeneID:9166698"
FT                   /translation="MATVELTFSALPAHVRTARLVAAAVARRTGVPEAILDEVRLAVGE
FT                   ACLRAVEAHRLRCPAEPVVMRLRDDDGRFEVTVIDAASRNGVSPPAAEANGSPLPEMGD
FT                   LGLAVIAGLADDVEVVPRPEGMSIRMSWPVSPGEPTAA"
FT                   /protein_id="YP_003650847.1"
FT   gene            265754..268090
FT                   /db_xref="GeneID:9166699"
FT                   /locus_tag="Tbis_0223"
FT   CDS_pept        265754..268090
FT                   /locus_tag="Tbis_0223"
FT                   /gene_family="HOG000007098" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /codon_start="1"
FT                   /EC_number="3.6.1.1"
FT                   /transl_table="11"
FT                   /note="KEGG: mms:mma_2575 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="GI:296268216"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="GeneID:9166699"
FT                   /translation="MSAFLAAADGAAVALSGFHFTLVIVVAVVALLALAVAGGLVREVL
FT                   SAGQGTERMQNIARAVQEGAAAYLARQFRTLVVFVVVIPLLLLLLPAPSTSVQIGRSVF
FT                   FVVGALFSALTGFMGMWLAVRGNLRVAAAAKDQGEKAALRIAFRTGGVAGMFTVGLGLL
FT                   GAAIVVLVYKGDAPNVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQGIPED
FT                   DPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGKAAFGTEGLVFPLLVPMI
FT                   GVLTAIIGIFAVRTRSGDRSGMAAINRGFFISAVISAILVAVAAFAYLPSSFAELSGVS
FT                   EEIRALTADPRLIALGAVLIGLVLASLIQLLTGYFTETNRRPVREIGESALTGPATVIL
FT                   SGVAVGLESAVYSALLIGAAVYGAFLLGFGNVTVALFAVALAGTGLLTTVGVIVSMDTF
FT                   GPVSDNAQGIAEMSGDVDGEGAQVLTSLDAVGNTTKAITKGIAIATAVLAATALFGSFR
FT                   TAVETELAAATQGVKDVLGSFASFSLSVDAPNVLVGLVIGASVVFLFSGLAINAVGRAA
FT                   GRVVIEVRDQFRNKPGIMDGTEKPDYGRVVDICTRDSLRELATPGLLAVLTPIAVGFAL
FT                   GYAPLGAYLAGAIAAGTLMAVFLANSGGAWDNAKKLVEDGHHGGKGSEAHAATVIGDTV
FT                   GDPFKDTAGPAINPLIKVMNLVALLIAPAVVAYADNFVIRTVVTAIAVVIVVAAIVVSK
FT                   RRSSGIIPDSGDAGEVKRASETVAR"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /protein_id="YP_003650848.1"
FT   gene            268546..269010
FT                   /db_xref="GeneID:9166700"
FT                   /locus_tag="Tbis_0224"
FT   CDS_pept        268546..269010
FT                   /locus_tag="Tbis_0224"
FT                   /gene_family="HOG000238871" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: gox:GOX2000
FT                   phosphohistidine phosphatase"
FT                   /db_xref="GI:296268217"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:9166700"
FT                   /translation="MTRLIVIRHAEAAGVLGLPDRERPLTAAGESAARAAGAQIRPLKP
FT                   ELVLCSPAVRARRTAELLGLDAPIEIEPVIYHGDSDDLIDLLCRTDQGIGTLALVGHNP
FT                   AVSRLVWELTGRECDAFPPGGYAVIDLNGSWAEAGPGRGTLVSFHRPHQG"
FT                   /protein_id="YP_003650849.1"
FT   gene            complement(269280..270500)
FT                   /db_xref="GeneID:9166701"
FT                   /locus_tag="Tbis_0225"
FT   CDS_pept        complement(269280..270500)
FT                   /locus_tag="Tbis_0225"
FT                   /gene_family="HOG000231114" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.3"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce0663 hypothetical protein; TIGRFAM:
FT                   phosphoserine phosphatase SerB; HAD- superfamily hydrolase,
FT                   subfamily IB (PSPase-like); PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; amino acid-binding ACT domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="GI:296268218"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR013200"
FT                   /db_xref="GeneID:9166701"
FT                   /translation="MNQRSLLITLTGHDRPGVTSRLFAALARFPVTVVDVEQVVIRGRL
FT                   ILGVLVTYPGGGSEEVDSTIGGLWAAVEQVAADLDMELDIATGTLAKEKRRRGRLHVTV
FT                   LGAPLKPAAMAAIAGRIAASGANIDRIERLASYPVTCIEMAVSGADPQALRASLTAEAA
FT                   AQKVDVAVQRSGLHRRAKRLVVMDVDSTLIQNEVIDLLAKHAGCLDEVTKITESAMRGE
FT                   IDFAESLTKRVSLLEGLPEDVFDTVSKEVVLTPGARTLVRTLKRLGYRFAIVSGGFTQI
FT                   TDRLVAELGIDYSAANTLEVVDGRLTGRLVGEILDRPGKARALERFAAEAGVPLSQTVA
FT                   IGDGANDLDMLAVAGLGVAFNAKPAVRKAADAAVNVPYLDSILYLLGISREEVEAADAE
FT                   DGLQPAK"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /protein_id="YP_003650850.1"
FT   gene            complement(270622..271182)
FT                   /db_xref="GeneID:9166702"
FT                   /locus_tag="Tbis_0226"
FT   CDS_pept        complement(270622..271182)
FT                   /locus_tag="Tbis_0226"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: AFL138Wp; K00667 fatty acid synthase subunit
FT                   alpha, fungi type"
FT                   /db_xref="GI:296268219"
FT                   /db_xref="GeneID:9166702"
FT                   /translation="MLFAVTVGATSLVSASPAAAATPPAALAPTSAQAASAASAASSAS
FT                   SAAAAPGWISVRYPIRARAGRVVTYKITLTNRQSRTSQKIFFAAKFPKNVYKVRIYVPK
FT                   GSRYREGCTRERTRSLCLFPGLKKGKSYTLWAKAWVNGSARGTLYGYFGGSFIPNHVKD
FT                   PRYVMRKAGDEIRWIKTRTRLVR"
FT                   /protein_id="YP_003650851.1"
FT   gene            271615..272880
FT                   /db_xref="GeneID:9166703"
FT                   /locus_tag="Tbis_0227"
FT   CDS_pept        271615..272880
FT                   /locus_tag="Tbis_0227"
FT                   /gene_family="HOG000245055" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /codon_start="1"
FT                   /EC_number="2.7.13.3"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce2236 putative two-component system
FT                   sensor kinase; PFAM: GAF domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; ATP-binding region
FT                   ATPase domain protein; SMART: GAF domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:296268220"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="GeneID:9166703"
FT                   /translation="MSPIRLPTGEPMGAPRRRTAGRDRPIRPPPRPGGRAAAYPEGVPD
FT                   ATPPVSERDEVLHAVSSAVLAVTSHLSVQEVLRVIVRSARRLLDAQYAALGVPDSQGAF
FT                   AEFIAEGVTPEQWAVLGTTPRQHGMLDAMLRMDGPVRLADIRKDPRFVGWPRGHPILKD
FT                   FLGVPIRNGGEVLGIVFLSNKRTPGGFTEADEELLTLFAAHAAIAITNARLYERSRELT
FT                   VIEERTRMARELHDAVTQKLFSLRLTARAAATLARTDPARAAQEIEQVERLAGEALAEL
FT                   RAVIVELRPAELDRHGLVETLRKQVALLDRVHPVSFAFHFDGDPPHGLPPAVEVAVLRV
FT                   AQEALHNAVRHANATRIEVRLSHRRPVLTLQVCDDGRGFDPGRVPGLGLASIRDRAEAV
FT                   GGTLTVTTSPGRGTVVHLEVPT"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /protein_id="YP_003650852.1"
FT   gene            272877..273497
FT                   /db_xref="GeneID:9166704"
FT                   /locus_tag="Tbis_0228"
FT   CDS_pept        272877..273497
FT                   /locus_tag="Tbis_0228"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="LuxR family two component transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: bcr:BCAH187_A5591 DNA-binding
FT                   response regulator"
FT                   /db_xref="GI:296268221"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="GeneID:9166704"
FT                   /translation="MIRVLIADDHPVVRQGLRTFLEVHDDITVVGEAADGLETIELARS
FT                   LTPDVLLLDLKMPVRDGLDVLAELHGLGVRVIVLTSVTGRGEVLPAMRAGAAGFLYKDV
FT                   DPEALVQAIRAVHEGQVLLAPEAAEAVLGGPAAPPGEPEIALTAREREVLRLIAAGRSN
FT                   REIARELSVAEKTVKTHVSNVLMKLGVQDRTQAALYAVRRGLV"
FT                   /protein_id="YP_003650853.1"
FT   gene            274102..274890
FT                   /db_xref="GeneID:9166705"
FT                   /locus_tag="Tbis_0229"
FT   CDS_pept        274102..274890
FT                   /locus_tag="Tbis_0229"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_3281 ABC transporter related"
FT                   /db_xref="GI:296268222"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9166705"
FT                   /translation="MGGQVLLLQDVTVRRDGAALLRGIDWSVLEGERWVVIGPNGAGKT
FT                   TLLQVAGALLFPSEGTVEILGEVLGRTNVFELRPRIGLASAALAERIPPDEKVIDVVLT
FT                   ASYAIFGRWKEEYDSSDVSRAVGLIDQLGCAHLIRRRFATLSEGERKRVQIARALMPDP
FT                   ELLLLDEPAAGLDIAAREDLVRRLGVLAQDPKAPTTVLVTHHVEEIPVGFTHVLLLRQG
FT                   SVVAQGPLEAVLTPQNLSETFGMPLTLERSREGRWFARPL"
FT                   /protein_id="YP_003650854.1"
FT   gene            275001..275747
FT                   /db_xref="GeneID:9166706"
FT                   /locus_tag="Tbis_0230"
FT   CDS_pept        275001..275747
FT                   /locus_tag="Tbis_0230"
FT                   /gene_family="HOG000114882" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="GI:296268223"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="GeneID:9166706"
FT                   /translation="MSPLEAFFVFLAGVGAGGINTVVGSGSLITFPTLLAVGLPPVVAN
FT                   VSNNIGLVPGGVTGVVGYRPELKGQRERLLRLGSASVLGSLAGGLLLLWLPESAFRFIV
FT                   PVLIGLACVLVIVQPRLNQWLLRLRVHPHGGPWLWLGVLAAGVYGGYFGAAQGVVLIGL
FT                   LGSFLDDDLQRINAAKNVLALLANTTAALLFVLIAPVDWMAVLMVALGTSVGGYLGARI
FT                   GRRLPTPILRAFIVIVGIAAIVKLIA"
FT                   /protein_id="YP_003650855.1"
FT   gene            275754..276005
FT                   /db_xref="GeneID:9166707"
FT                   /locus_tag="Tbis_0231"
FT   CDS_pept        275754..276005
FT                   /locus_tag="Tbis_0231"
FT                   /gene_family="HOG000000294" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268224"
FT                   /db_xref="GeneID:9166707"
FT                   /translation="MSLLMKGDRVEIVIDAGGTPRTYEVVARKAGRRIEITTGRGVVEV
FT                   TEVTRTGAPVRSARFMASRILALVEHPAGDRERRGDRS"
FT                   /protein_id="YP_003650856.1"
FT   gene            complement(276230..277141)
FT                   /db_xref="GeneID:9166708"
FT                   /locus_tag="Tbis_0232"
FT   CDS_pept        complement(276230..277141)
FT                   /locus_tag="Tbis_0232"
FT                   /gene_family="HOG000071702" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /codon_start="1"
FT                   /product="Rieske (2Fe-2S) domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   scl:sce7049 hypothetical protein"
FT                   /db_xref="GI:296268225"
FT                   /db_xref="InterPro:IPR005806"
FT                   /db_xref="GeneID:9166708"
FT                   /translation="MDEKTRPPRTHRLTRMVPSPEFLRGLERTTTLDAPIRAISKTLRT
FT                   RLGPGRLRDMLHGVPFGHPLHPALAMVSLGCWVSTAVLDVTKADPRASRALIATGLGTA
FT                   LPTAAAGITDWSTLHLEQQRVGVFHALSNLAAAALYTGSLLMRLGGRERTGRVLAFAGL
FT                   GAVSIGGFLGGHLAYRQAAGANHAESVGHLTLLGWHDLCLLKDLPDGRPVRRQLGYIDL
FT                   VVLRLGDTVHVLADGCSHLAGPLHQGRVTVEEGEPCIVCPWHGSTFRVSDGSVVHGPAT
FT                   SPQPAFETRLRHDGVVQVRPAM"
FT                   /protein_id="YP_003650857.1"
FT   gene            complement(277284..277502)
FT                   /db_xref="GeneID:9166709"
FT                   /locus_tag="Tbis_0233"
FT   CDS_pept        complement(277284..277502)
FT                   /locus_tag="Tbis_0233"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268226"
FT                   /db_xref="GeneID:9166709"
FT                   /translation="MVGKLPARVNELLTLIKGGLDHADRVLCVDQDWWALRLNWTVERI
FT                   GFGARRYRDPRFDLIREVEEAGRLFTA"
FT                   /protein_id="YP_003650858.1"
FT   gene            277703..278560
FT                   /db_xref="GeneID:9166710"
FT                   /locus_tag="Tbis_0234"
FT   CDS_pept        277703..278560
FT                   /locus_tag="Tbis_0234"
FT                   /gene_family="HOG000253090" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00530"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:296268227"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:9166710"
FT                   /translation="MPDRSSPTVRRRRLGQELRRLREQAELTGDQVAARLGWSAAKLSR
FT                   IETARTVPRRSDVEALLMIYMVDSEQRHELLALHRDASRKGWWEKYRDTLPEEYTTFLG
FT                   LEAEATVARHWEPQIVPGLFQTEAYVHALMESSQRSTLQAPGDLRDRIQVRMARQEAIL
FT                   SAERPQTLSVVVEESVLLRRFGDSAVMREQLQRLIEVSELPNVDLRVLPLDADHCINTG
FT                   AFIHLTLPEYHDVVYLEALLGGRLLEDEQIVYRYEVAFDYLKGRALDADASRKLIAKTI
FT                   GRWK"
FT                   /protein_id="YP_003650859.1"
FT   gene            278594..278827
FT                   /db_xref="GeneID:9166711"
FT                   /locus_tag="Tbis_0235"
FT   CDS_pept        278594..278827
FT                   /locus_tag="Tbis_0235"
FT                   /gene_family="HOG000253089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="GI:296268228"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="GeneID:9166711"
FT                   /translation="MISGGSDIDMHESDLSQLSWRKSSRSAMNGACVEVAVLPDGRVGV
FT                   RDSKNRSGPVLVFTPAEWRAFIGGVKDGEFDL"
FT                   /protein_id="YP_003650860.1"
FT   gene            complement(278968..280416)
FT                   /db_xref="GeneID:9166712"
FT                   /locus_tag="Tbis_0236"
FT   CDS_pept        complement(278968..280416)
FT                   /locus_tag="Tbis_0236"
FT                   /gene_family="HOG000087852" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /codon_start="1"
FT                   /EC_number="1.11.1.6"
FT                   /transl_table="11"
FT                   /note="PFAM: Catalase domain protein; KEGG: abo:ABO_1845
FT                   catalase"
FT                   /db_xref="GI:296268229"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="GeneID:9166712"
FT                   /translation="MTDRPTTTTDAGIPAPSDEFSLSVGPNGPLLLQDHYLIQKMAHFN
FT                   RERVPERVVHAKGGGAYGILQITEDVSQFTKAKLFQKGKETELFVRFSTVAGELGSADT
FT                   VRDPRGFALKFYTEDGNYDIVGNNTPIFFIRDPQKFSDFIHSQKRRADNHLRDHNMQWD
FT                   FWTLSPESAHQVTFLFTDRGTPRTWRNMHGYGSHTFLWYNAAGEKYWVKYHFKTEQGIE
FT                   NFTDAEAKAMVSEDPDFHIRDLYNAIKRGDHPSWKVNVQIMPFEEAADYRFNPFDLTKV
FT                   WPHSDYPEITIGRIILTRNPENYFAEVEQAAFEPSNMVPGVGPSPDKMLQARLFSYPDT
FT                   HRYRIGPNYNQLPVNQPKVPVHSYNFDGPMRYKNPTDPVYAPNSYGGPVADPSLYEGES
FT                   YHISGEIIRSAYTKHREDDDFVQPRALWENVLSETDREHLVSNIVTHASAPEVTGEMKK
FT                   RIVEYWTNVHKDLGQAVAKGLGVS"
FT                   /product="catalase"
FT                   /protein_id="YP_003650861.1"
FT   gene            complement(280427..280912)
FT                   /db_xref="GeneID:9166713"
FT                   /locus_tag="Tbis_0237"
FT   CDS_pept        complement(280427..280912)
FT                   /locus_tag="Tbis_0237"
FT                   /gene_family="HOG000014143" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /codon_start="1"
FT                   /product="Fur family ferric uptake regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: sfu:Sfum_2668
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="GI:296268230"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="GeneID:9166713"
FT                   /translation="MATVHDVQRLRQAGLRVTAARLAILQTVREGNHLDVESIHRGVCQ
FT                   RVGQVSLQAVYDSLNALHQAGLLRRIEPAGSPARYETRVGDNHHHLVCRECGEVTDVDC
FT                   AVGKAPCLDPVRDAGYLIDEADVIYWGWCPKCRPKVEGTVRARVPSAHDHEHPTTQG"
FT                   /protein_id="YP_003650862.1"
FT   gene            280990..282123
FT                   /db_xref="GeneID:9166714"
FT                   /locus_tag="Tbis_0238"
FT   CDS_pept        280990..282123
FT                   /locus_tag="Tbis_0238"
FT                   /gene_family="HOG000000149" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BCE_1940"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bca:BCE_1940 hypothetical protein"
FT                   /db_xref="GI:296268231"
FT                   /db_xref="GeneID:9166714"
FT                   /translation="MMASSSVVIRKPLALAALYALLLTGCSAAEGERVPGASAEPAATG
FT                   AAEPTPSPSPKPVRRPYTISFAGDVHFEGVLRARLDRNPRTALGPIAAVLRKADITALN
FT                   LETAITTGGTPAPKQFTFRAPPTAFTALKAAGVDVVTMANNHGMDYMESGLRDTLAAIR
FT                   KSRFPVIGIGRNEAEAYRPFRKTVNGNRVAIIGATQVLDTNLIEAWTAKGAKGGLASAK
FT                   EEARLIRAVREARRNSDTVIVFLHWGAELVECPTPVQRQLAVKLVRAGADVIVGGHAHI
FT                   LLGGGYLGRAYVHYGLGNFAFYNWGPKTGMTGVLTLTINGRRILKDEWTPARIEGGVPI
FT                   PLTGAAKQQALRSYHALRGCTGLSAKPRATATGSSQS"
FT                   /protein_id="YP_003650863.1"
FT   gene            282156..282845
FT                   /db_xref="GeneID:9166715"
FT                   /locus_tag="Tbis_0239"
FT   CDS_pept        282156..282845
FT                   /locus_tag="Tbis_0239"
FT                   /gene_family="HOG000267795" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce5559
FT                   HTH-type transcriptional regulator BetI"
FT                   /db_xref="GI:296268232"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9166715"
FT                   /translation="MDSVSRQQSPRTPGDPLRRRPAQRRSARRVERMLDACAELLDEGG
FT                   YDALTTTRVAERAGVAIGSVYQFFPDKRALSQALTKRNVERFAARVGRRFMTEEFAGWW
FT                   DAVDAIIDEYVEMHRTVPGFRSLHFREVFDLNLLESVADTNMVIAGRLRELLLAEFGIA
FT                   DSEELDRAMLVAVEAGDAVLKLAFRHDPDGDPEFVAEAKRLIRGYLSGQLQAARRTAGR
FT                   TDATAGA"
FT                   /protein_id="YP_003650864.1"
FT   gene            complement(282882..283283)
FT                   /db_xref="GeneID:9166716"
FT                   /locus_tag="Tbis_0240"
FT   CDS_pept        complement(282882..283283)
FT                   /locus_tag="Tbis_0240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268233"
FT                   /db_xref="GeneID:9166716"
FT                   /translation="MSRRMICALASATVLSAVVPGVAGYISAQVEALHEARQELARLQA
FT                   KLRMMELSTVRPVAATGCAYGRSTRDRAAASGELPLRPPRDTRPWQDTGRTFAPAIWNT
FT                   FVMPTAAPTEVPTRLTSPGDRHRATSPGR"
FT                   /protein_id="YP_003650865.1"
FT   gene            283448..283978
FT                   /db_xref="GeneID:9166717"
FT                   /locus_tag="Tbis_0241"
FT   CDS_pept        283448..283978
FT                   /locus_tag="Tbis_0241"
FT                   /gene_family="HOG000014230" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268234"
FT                   /db_xref="GeneID:9166717"
FT                   /translation="MTSEQLNRLLDQALLQGDHDALAGRLDALAREYESGEMSRAAVLV
FT                   LAAEQWRLAGRPEIALERYQQAAEDGGDVVIDPRAGIADTLFELGRADEARRALAELWD
FT                   EGGWTPDTALAVAETLVAYGDLPAAHEWATAGVRACQGPTATRDALLRLRYRIRVDLGM
FT                   PEDQLDAMLDGAG"
FT                   /protein_id="YP_003650866.1"
FT   gene            complement(284375..285643)
FT                   /db_xref="GeneID:9166718"
FT                   /locus_tag="Tbis_0242"
FT   CDS_pept        complement(284375..285643)
FT                   /locus_tag="Tbis_0242"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296268235"
FT                   /db_xref="GeneID:9166718"
FT                   /translation="MSKASQRIRGRCLAIAAVTAGVSWLSTGPALARDVTATTGCDAPA
FT                   RTHMARQVSLAPPVGLLSIADTAGAAAARGIPSLPGRSGSAALDQLLGPQGKARALPGT
FT                   KDLLPPLPGGKGGPPVLPDARSLLPDAKPLGALTPITQQAPARLPLSAQADPSASGTVP
FT                   QPPMVPSVPLLDIAPIKAAAPEPRCAPAAQRRGTDAGAVAPQPGSADENRPAAQQAPAA
FT                   DGRRPAQAVPRPATGEGTVAKPRAGVKTGKAAPGTNTGKAVPGKKAGPVKDAAKAHPSG
FT                   KMGHPGHHAKPATASTAERPSRLQAHPAAPAPHKKQGHLPVHKKDLVPGHKKHGLVPGK
FT                   KQGHVKAEAKKVKGKALNGVPHRKAERAGTPALQGKPQQSRVQHQTQPLPRIVDMPGDI
FT                   TAPALATTGAVTRLANTGKGLLP"
FT                   /protein_id="YP_003650867.1"
FT   gene            complement(285741..288326)
FT                   /db_xref="GeneID:9166719"
FT                   /locus_tag="Tbis_0243"
FT   CDS_pept        complement(285741..288326)
FT                   /locus_tag="Tbis_0243"
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /codon_start="1"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /transl_table="11"
FT                   /note="KEGG: ade:Adeh_0385 AAA ATPase, ClpA/B; TIGRFAM:
FT                   ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2 domain
FT                   protein; AAA ATPase central domain protein; Torsin; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="GI:296268236"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR010448"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="GeneID:9166719"
FT                   /translation="MEYKLTQKSQEALSAAVRRATADGNPEVMPAHLLAALLAQTGGIA
FT                   VPLLEAVGADWRRLRARNEELLGRLPKARGATVSAPSTSRQLISVLNTAAERAKRLEDE
FT                   YVSTEHLMVGLASDGGQVAELLRQEGATADALLEAFEKVRGHARVTSETPEDTYQALEK
FT                   YGVDLTERARAGKLDPVIGRDAEIRRVIQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQR
FT                   IVAGDVPETLKNKRLVALDLGAMVAGAKYRGEFEERLKAVLNEIKASDGQIITFIDELH
FT                   TVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRERIEKDPALERRFQQIYVGE
FT                   PSVEDTIAILRGLKGRYEAHHQVQISDSALVAAATLSDRYITARFLPDKAIDLVDEAMS
FT                   RLRMEIDSRPVEIDQLQRSVDRLKMEELALAKETDAASRERLEKLREELANKQEELNAL
FT                   ISRWEREKAGLNKVGELKKQLDEARSAAERAQRDGDFETASRLMYGEIPRLEKELSEAS
FT                   KIAEAAETAPMVKEEVGPDEIAEVVSAWTGIPAGRLLEGESAKLLRMEDELGKRLIGQH
FT                   RAVQAVSDAVRRARAGISDPDRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMTRID
FT                   MSEYSEKHTVARLVGAPPGYVGYEEGGQLTEAVRRRPYTVVLLDEIEKAHPEVFDILLQ
FT                   VLDDGRLTDGQGRTVDFRNTILILTSNLGSQYLVDPQLDQAAKHEAVMNAVRAAFKPEF
FT                   LNRLDDIIIFDPLGTEELTKIVDLQVARLARRLSERRLTLTVTPAAREWLALTGYDPMY
FT                   GARPLRRLIQTAIGDQLAKELLAGNIRDGDEVIVDLDSARDALTIRPAR"
FT                   /protein_id="YP_003650868.1"
FT   gene            complement(288354..288701)
FT                   /db_xref="GeneID:9166720"
FT                   /locus_tag="Tbis_0244"
FT   CDS_pept        complement(288354..288701)
FT                   /locus_tag="Tbis_0244"
FT                   /gene_family="HOG000266081" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: nis:NIS_0956 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268237"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:9166720"
FT                   /translation="MDANPFELTDDTPVYVISVAAQLAGLHPQTLRQYDRLGLVSPGRS
FT                   AGRGRLYSARDILLLREVQRLSQEHGINLAGIKRILELETENMRLREEINRLRGEVAML
FT                   RALVRYELPPA"
FT                   /protein_id="YP_003650869.1"
FT   gene            complement(288706..289857)
FT                   /db_xref="GeneID:9166721"
FT                   /locus_tag="Tbis_0245"
FT   CDS_pept        complement(288706..289857)
FT                   /locus_tag="Tbis_0245"
FT                   /gene_family="HOG000226717" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /codon_start="1"
FT                   /product="chaperone protein DnaJ"
FT                   /transl_table="11"
FT                   /note="KEGG: gsu:GSU0034 chaperone protein DnaJ; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; DnaJ central domain protein; heat shock protein
FT                   DnaJ domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="GI:296268238"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="GeneID:9166721"
FT                   /translation="MSTKDYLEKDYYAVLGVPESASAEEIKKAYRKLARKYHPDANKGN
FT                   KEAEERFKEISEAYDVLSDPKRRKEYDEARSLFGSGLGGFAGAGGQRGGFTFDFGDLFS
FT                   GTVAGDRIGDLFGGLFGRSTRTTTRPRRGQDIETEVTLSFSEAVEGTTIPLRLTSSSAC
FT                   SACSGTGAKSGTTPRVCPMCEGTGTASRNLGSFAFSEPCRHCRGRGLIVDDPCVVCQGS
FT                   GRGRSTRTIHARIPAGVADGQRIRIKGKGAPGEHGGPAGDLYVLVHVKQHPVFGRSGEN
FT                   LTVTVPVTFAEAALGAEIKVPTLKGMPVTLRIPECTPNGRTFRVRGRGVPRKDGTRGDL
FT                   LVTIQVVVPQRLNDKARAALEEFRIATEGPDPREELIKQARSE"
FT                   /protein_id="YP_003650870.1"
FT   gene            complement(289936..290658)
FT                   /db_xref="GeneID:9166722"
FT                   /locus_tag="Tbis_0246"
FT   CDS_pept        complement(289936..290658)
FT                   /locus_tag="Tbis_0246"
FT                   /gene_family="HOG000252083" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /codon_start="1"
FT                   /product="GrpE protein"
FT                   /transl_table="11"
FT                   /note="PFAM: GrpE protein; KEGG: gme:Gmet_3533 GrpE
FT                   protein"
FT                   /db_xref="GI:296268239"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="GeneID:9166722"
FT                   /translation="MTSSENGSEQGPVIRDKRKIDPETGQARKTAAEQGQEKKDEQPGG
FT                   GAQAASAPADAQIADLLAERTADLQRVQAEFSNYRKRVERDKALVREQAVGGVLYELLP
FT                   VLDDIGRAREHGELVGGFAKVAELLESTLTKLGLSAYGKKGEPFDPTVHEALAHSYSPD
FT                   VTEPTCVEILQLGYRYGERILRPARVAVAEPPPEPAPEAPSGAPEGGEAGRPDAAEPGD
FT                   AAASPADTEPGAPSGEQN"
FT                   /protein_id="YP_003650871.1"
FT   gene            complement(290655..292520)
FT                   /db_xref="GeneID:9166723"
FT                   /locus_tag="Tbis_0247"
FT   CDS_pept        complement(290655..292520)
FT                   /locus_tag="Tbis_0247"
FT                   /gene_family="HOG000228137" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /codon_start="1"
FT                   /product="chaperone protein DnaK"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: bha:BH1346 class I heat-shock protein
FT                   (chaperonin)"
FT                   /db_xref="GI:296268240"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="GeneID:9166723"
FT                   /translation="MGRAVGIDLGTTNSVVAVLEGGEPTVIANAQGSRTTPSVVAFAKN
FT                   GEILVGEVAKRQAVTNVERTIRSVKRHMGTDWKIDIDGKKFTPQQISAFILQKLKQDAE
FT                   AYLGEKITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIINEPTSAALAYGLDKEKDQ
FT                   TILVFDLGGGTFDVSLLDVGQEDGHGFVEVKATSGDNHLGGDDWDQRIVDELVRRFKNA
FT                   HGIDLSKDKMALQRLREAAEKAKIELSGQTETTINLPYITASAEGPLHLEEKLTRAEFQ
FT                   RLTADLLERCKGPFFQVIKDAGIKVSDIDHVVLVGGSTRMPAVSDLVRELTGKEPNKGV
FT                   NPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKIIERNTTIPTKRSE
FT                   IFTTAEDNQPSVQIQVYQGEREIAAYNKKLATFELTGIPPAPRGIPQIEVTFDIDANGI
FT                   VNVSAKDLGTGKEQSMTITGGSALPKEEIERMMREAEQYAEEDRKRREEAETRNNADAL
FT                   AYQTEKFLRENEDKVPADVKNEVNAALSDLKKALEGSDVTAIRNAAEKLATVSQKMGSA
FT                   IYANAQSAGEQTAAASGGQTSGSQNKDEDVVEAEIVDEDREGGSK"
FT                   /protein_id="YP_003650872.1"
FT   gene            complement(292921..293373)
FT                   /db_xref="GeneID:9166724"
FT                   /locus_tag="Tbis_0248"
FT   CDS_pept        complement(292921..293373)
FT                   /locus_tag="Tbis_0248"
FT                   /gene_family="HOG000109999" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: smt:Smal_1609 hypothetical protein"
FT                   /db_xref="GI:296268241"
FT                   /db_xref="GeneID:9166724"
FT                   /translation="MIPLLSLAAACGQGSPDPSARSSAASPAPPDSVVVHTLSPLASPP
FT                   PEPSPSPVTPAGNTVAPRKVPWTEVTASPDGRTLTVVWWSGVEPCHVLDRVEVAESRDK
FT                   VTITLYEGADRRSPDAACIMLAVRKSTEVRLRAPLGGRQVADGARE"
FT                   /protein_id="YP_003650873.1"
FT   gene            293828..294622
FT                   /db_xref="GeneID:9166725"
FT                   /locus_tag="Tbis_0249"
FT   CDS_pept        293828..294622
FT                   /locus_tag="Tbis_0249"
FT                   /gene_family="HOG000230247" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /codon_start="1"
FT                   /EC_number="1.5.1.2"
FT                   /transl_table="11"
FT                   /note="KEGG: afw:Anae109_1387 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="GI:296268242"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="GeneID:9166725"
FT                   /translation="MIAILGTGKMGEALLSGLLRAGRSPDEIVATARRPERAEALRKRY
FT                   GVRMLGNAEAAREAETIILAVKPQDMDRLLSEIASCDLADKLVISVAAGITTAFIQARL
FT                   GEVPVVRVMSNTPVLVDEAMSVISPGAHATEEHLKRTEELLSPVGKVVRIPESLQDAAT
FT                   ALSGSGPAYFFYLVEAMVDAGILLGMPRAAALEMVTQAMVGAAIMLRDSGEHPVSLREA
FT                   VTSPGGTTIAAIAELERHRVRAAFLDAIEAACNRSRELASGR"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /protein_id="YP_003650874.1"
FT   gene            294997..296160
FT                   /db_xref="GeneID:9166726"
FT                   /locus_tag="Tbis_0250"
FT   CDS_pept        294997..296160
FT                   /locus_tag="Tbis_0250"
FT                   /gene_family="HOG000225181" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /codon_start="1"
FT                   /product="histone deacetylase superfamily"
FT                   /transl_table="11"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   bsu:BSU29710 acetoin dehydrogenase"
FT                   /db_xref="GI:296268243"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="GeneID:9166726"
FT                   /translation="MSKAVRIVWDDALTSYDFGPGHPMAPVRVALTMGLARELGLLSGV
FT                   DVAGCRPATDEELLMVHSRDYVAAVKEASATGRPALAHGIGTEDNPAFLGVHEASALIA
FT                   GASLAAARAVWSGEAEHAINVAGGLHHAMPGMASGFCIYNDVALAIQWLLDQGASRVAY
FT                   VDVDVHHGDGVQAMFYDDPRVLTISLHESPRTLFPGTGYPHETGADGTAVNVALPIGCG
FT                   DTGWLRAFHAIVPPLLREFRPDVLVSQHGCDTHALDPLAHLMLSLDGQRRTYAALHELA
FT                   HETAGGRWIATGGGGYEVVRVVPRAWTHLIAEVAGASLDPLTPTPDTWRVMVKELTGEV
FT                   PPLNMTDGRHPVWRDFADGYDPADPVDRAIMATRKAVFPYYALDPMP"
FT                   /protein_id="YP_003650875.1"
FT   gene            296634..296837
FT                   /db_xref="GeneID:9166727"
FT                   /locus_tag="Tbis_0251"
FT   CDS_pept        296634..296837
FT                   /locus_tag="Tbis_0251"
FT                   /gene_family="HOG000095546" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /codon_start="1"
FT                   /product="excisionase family DNA binding domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: bsu:BSU33370 hypothetical protein"
FT                   /db_xref="GI:296268244"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="GeneID:9166727"
FT                   /translation="MGAGERPLSEVKFLTVAEVAAVMRVSKMTVYRLVHSGELPAIRVG
FT                   RSFRVPEQAVHDYLRDAFIEAG"
FT                   /protein_id="YP_003650876.1"
FT   gene            297170..298183
FT                   /db_xref="GeneID:9166728"
FT                   /locus_tag="Tbis_0252"
FT   CDS_pept        297170..298183
FT                   /locus_tag="Tbis_0252"
FT                   /gene_family="HOG000053265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   dal:Dalk_1448 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="GI:296268245"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="GeneID:9166728"
FT                   /translation="MGRTVLVTGVSRHIGARVASALAADPDVHRVIGVDTAPPVSSTAP
FT                   PLGRVEFVRLDLRGLDLAQLIADSDIDTVVHLGLLSDPAGSRPAMREYNIIGTMQVLAA
FT                   CQRSRTVRRVVVRSTTAVYGSSPASPAVCTETTEPADSPHHGYERDAIEVEGYARGFAR
FT                   RRPDVATTILRFAPMLGPRVETPLTRYFSLPVLPTVLGFDPRLQFVHEDDVVDVLCRMA
FT                   REELRGVFNVAGDGVLLLSQCARRAGKPVLPLPSAAFHLLGTAVRSTGLIDFSPEQIAL
FT                   LSHGRVADTTALAAATGWRPKYGTAAAFDDFIRARGLGSDLPARVFDLAADLIRGR"
FT                   /protein_id="YP_003650877.1"
FT   gene            298189..299118
FT                   /db_xref="GeneID:9166729"
FT                   /locus_tag="Tbis_0253"
FT   CDS_pept        298189..299118
FT                   /locus_tag="Tbis_0253"
FT                   /gene_family="HOG000046680" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /codon_start="1"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: dal:Dalk_1813
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="GI:296268246"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="GeneID:9166729"
FT                   /translation="MGSAEPSGPPGTGGAGPWPPGEERLAELLGFLRRRLTGEYEVDEF
FT                   GFDPEFSDSVLLPLLRPLYRHWFRVEVLGAEHVPADSGALVVANHAGGMLPLDALMLQV
FT                   ALHDEAGRHVRLLGADLVYRLPLLNHLARKGGHTLACPEDAARLLAKGELVGVFPEGYK
FT                   GIGKPFSERYRLQRFGRGGFIVTAIRAQVPIIPCAIVGAEEIYPKLGEIPVLDRLLGLP
FT                   YVPVTPFFPWFGLLGLVPLPSKWAIEFGEPIRTDEYDVADAEDQFLVLDLTDRVRETIQ
FT                   HRLEALRAHRGPAFRFGPFAVEFGRFGC"
FT                   /protein_id="YP_003650878.1"
FT   gene            299220..300266
FT                   /db_xref="GeneID:9166730"
FT                   /locus_tag="Tbis_0254"
FT   CDS_pept        299220..300266
FT                   /locus_tag="Tbis_0254"
FT                   /gene_family="HOG000043952" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ade:Adeh_1736
FT                   alpha/beta hydrolase fold-1"
FT                   /db_xref="GI:296268247"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="GeneID:9166730"
FT                   /translation="MGKGRRAVLMGLTVGAAAGTLRRRAAARRARERERFFRTTGRKVT
FT                   VTTDDGARIAAEVDDHPAPRAAVVFTHGWLMSRHCWRYQRDALAGRALLVSYDHRGHGE
FT                   SSAAPLDAYTIDRLGDDLAAVIEATVPSDLPVILAGHSMGGMTIMALAQRHPGLIASRV
FT                   AGVALLSTSAGWRSGGLTYGLPGPVGRFAARATPRIFDALLARAEEIDRRPRLKELAML
FT                   PVTRLTAFGKKPHRADVRFVNAMATATATEPMVAFFHQIQVHDRLSALQALQDVETLII
FT                   VGERDRLTPPSDSRRIAKALPGARLIITPDAGHMIGIERPGLVNQELLGLLQRATERGA
FT                   AGRLGIAS"
FT                   /protein_id="YP_003650879.1"
FT   gene            complement(300282..301142)
FT                   /db_xref="GeneID:9166731"
FT                   /locus_tag="Tbis_0255"
FT   CDS_pept        complement(300282..301142)
FT                   /locus_tag="Tbis_0255"
FT                   /gene_family="HOG000250088" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /codon_start="1"
FT                   /product="HAD-superfamily hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sal:Sala_0193 HAD family hydrolase"
FT                   /db_xref="GI:296268248"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="GeneID:9166731"
FT                   /translation="MRRLLLRRNSPEVAGEVAAETTEAVATPDPTSAAFFDVDNTMMRG
FT                   ASIYHFARGLAARGLFTTRDLAKFAIGHAWFRIRGSENADHIAKAKEMALAFVAGLKVE
FT                   DVVRLGEEIYDEEMADRIWPQSLALARMHLAAGRRVWLVTATPVELARVIAQRLGLTGA
FT                   LGTVAETENGVYTGRLVGDLLHGPAKADAIRELARREGLDLSRCWAYSDSANDLPMLSL
FT                   VGHPHAINPDSELREHAAEHGWEISDFRTGRKITLIGLPIAATAGAIAGGIAAGIALRR
FT                   HYRAA"
FT                   /protein_id="YP_003650880.1"
FT   gene            complement(301197..301919)
FT                   /db_xref="GeneID:9166732"
FT                   /locus_tag="Tbis_0256"
FT   CDS_pept        complement(301197..301919)
FT                   /locus_tag="Tbis_0256"
FT                   /gene_family="HOG000110000" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268249"
FT                   /db_xref="GeneID:9166732"
FT                   /translation="MGGRFMGWWRFSRRRRGRWASRRSGQITARIAELGPWFGEGPRPE
FT                   FRAALRDELMRRFAEQAAARASRPAAPAPAGAPPVRRRPVLVRMLPSLVFSALLVLMFS
FT                   TGVRTYHSVPGEPLYPLKRMAECTVLSFAHDDDERAQREMTVARRRAAETASLVRRTPA
FT                   RDSQRLIGETLDDMEVTTRAALTHVARKGSAASTEVRRFAREQRNVVEPLLPKLDRENQ
FT                   ARARKYLIYIETFTSSGP"
FT                   /protein_id="YP_003650881.1"
FT   gene            complement(302069..302758)
FT                   /db_xref="GeneID:9166733"
FT                   /locus_tag="Tbis_0257"
FT                   /pseudo
FT   gene            302895..304352
FT                   /db_xref="GeneID:9166734"
FT                   /locus_tag="Tbis_0258"
FT   CDS_pept        302895..304352
FT                   /locus_tag="Tbis_0258"
FT                   /gene_family="HOG000159114" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ppw:PputW619_3587 DNA polymerase III, subunits
FT                   gamma and tau"
FT                   /db_xref="GI:296268250"
FT                   /db_xref="GeneID:9166734"
FT                   /translation="MDILVALLAFAGALLAGITTGVLVGRLRDEPNGWLIAWSVATGAL
FT                   ALSLAAIAVGHLTGFGALTFRAYQITGSLLAPLWLAAGTIQLLAERAATRFGVWLVGTA
FT                   ITVVGVVITMVDPISESFSKRLPVGSVHWDIWPEWLLRGVHGLVILTMLIALIVAVLRW
FT                   RDGDDYDADNMNASAVVAPAGMAIAGAMELALPGIVVVALMAGTAGGVWYVVARPLAPY
FT                   EDEEDEDYLDDEWEDPREGGRAAPAPEPARHPAAAAPPRRSGLGDLVAEYRAGEQGEAA
FT                   HHAGPGRPEPAGDDFSGPATGQIMIGDQMSRYAGMQPPPPAPVEEDESMPATGVVLSGG
FT                   ELPISEELAAALGVGFSGASREAGRAEQRQSGSVKPSPGIYGLLTVFTLMDGSGEAFDK
FT                   LAEETVEAVRQHEPDTLLFVCHSVKSAPLQRIIYELYRDEVGYAEHQRQPHIERFVTER
FT                   QPLVLAANTIELKVNAAKVVPLPTRFR"
FT                   /protein_id="YP_003650882.1"
FT   gene            complement(304805..305089)
FT                   /db_xref="GeneID:9166735"
FT                   /locus_tag="Tbis_0259"
FT   CDS_pept        complement(304805..305089)
FT                   /locus_tag="Tbis_0259"
FT                   /gene_family="HOG000250076" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05768"
FT                   /codon_start="1"
FT                   /product="glutaredoxin 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glutaredoxin 2; KEGG: bxe:Bxe_A1082
FT                   hypothetical protein"
FT                   /db_xref="GI:296268251"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="GeneID:9166735"
FT                   /translation="MAPSDHRITLLGKPGCHLCDDARAVVAKVAAEFGVPWEERDITLS
FT                   PEEQAEYWEMIPVVFLDGVQHGYWRIDEARLRAALTELLAADGSAGSGA"
FT                   /protein_id="YP_003650883.1"
FT   gene            305265..305993
FT                   /db_xref="GeneID:9166736"
FT                   /locus_tag="Tbis_0260"
FT   CDS_pept        305265..305993
FT                   /locus_tag="Tbis_0260"
FT                   /gene_family="HOG000250064" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /codon_start="1"
FT                   /product="CoA-binding domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sfu:Sfum_1603 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="GI:296268252"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="GeneID:9166736"
FT                   /translation="MIRRTHHARDRGIPDATVARLPLYLRALNALAERGTLTVSSEELA
FT                   AAAGVNSAKVRKDLSHLGSYGTRGVGYDVQYLIYQISRELGLTQDWAVAIVGVGNLGRA
FT                   LANYGGFVSRGFRIAALFDADPAVVGERIAGLVVEHVDALESVIKDRGISIVVIATPAS
FT                   AAQDVCDRVIAAGVTSILNFAPVVLAVPPEVNVRKVDLSIELQILAFHEQRKANGGPIM
FT                   ADQWPDEVGHVRERSMGAGS"
FT                   /protein_id="YP_003650884.1"
FT   gene            305990..307297
FT                   /db_xref="GeneID:9166737"
FT                   /locus_tag="Tbis_0261"
FT   CDS_pept        305990..307297
FT                   /locus_tag="Tbis_0261"
FT                   /gene_family="HOG000109649" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /codon_start="1"
FT                   /EC_number="1.2.1.70"
FT                   /transl_table="11"
FT                   /note="KEGG: gsu:GSU3284 glutamyl-tRNA reductase; TIGRFAM:
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="GI:296268253"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="GeneID:9166737"
FT                   /translation="MSILVVGLSHRTTPVSLLERATVSGDALVKLLHDVHRDEDVAEVL
FT                   VVSTCNRVEVYAHVARFHGGVTAITDVLGRHSGLPHEVLARHLYVHYQERAVQHLFTVA
FT                   CGLDSMVIGEQQILGQIRSALRLAQEEGTAGTALNELTQHALRVGKRARTETAIDRAGA
FT                   SLVGVGLSLAEQAIGQLPGKQALVVGAGSMSSLATATLARAGVTGIVVANRTLERAVRL
FT                   AESVGGRAVPLTGVAGEIGRADLVVSCVGAGTYSITEEMVEAAMRDRRSPLFVLDLAMP
FT                   RDVDPAIRRLPGVTLVDLESMQQDGLGSEIDGGRAKAIWEVKQIIAEEVDAYLDSQRAS
FT                   VVTPTVVALRSKAAEVVEAELARLWSRIPDADTRTRDEITNTVRRVVDKLLHAPTVRVK
FT                   QLATSPGGAQYAHALRELFDLDPQCPDAVTGLEVER"
FT                   /product="glutamyl-tRNA reductase"
FT                   /protein_id="YP_003650885.1"
FT   gene            307294..308205
FT                   /db_xref="GeneID:9166738"
FT                   /locus_tag="Tbis_0262"
FT   CDS_pept        307294..308205
FT                   /locus_tag="Tbis_0262"
FT                   /gene_family="HOG000228588" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.61"
FT                   /transl_table="11"
FT                   /note="KEGG: sat:SYN_02273 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="GI:296268254"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="GeneID:9166738"
FT                   /translation="MSAPLRLGTRKSLMATSQSRRVAERLAQATGRRSELVGITTFGDV
FT                   SRAHLTQLGGTGVFVSELRNALIAGEVDFAVHSLKDLPTKGDDRIVIAAIPPRDDPRDA
FT                   FVGRVPFSELPPGARVGTGSPRRIAQLRMLRPDLEYVPIRGNADTRLGKVTSGELDGIV
FT                   LAAAGLGRIGREEAIAQVFEVEQVLPAPGQGALAVECRADRADLIELLSAIDDRATRDA
FT                   VTAERSVLAALEAGCAAPVGAHASGDGNVLSLTAAVVSVDGRRSVRKSVSGPASAAMEL
FT                   GRDLAAAMLAEGAGTLMREQVQ"
FT                   /product="porphobilinogen deaminase"
FT                   /protein_id="YP_003650886.1"
FT   gene            308202..309782
FT                   /db_xref="GeneID:9166739"
FT                   /locus_tag="Tbis_0263"
FT   CDS_pept        308202..309782
FT                   /locus_tag="Tbis_0263"
FT                   /gene_family="HOG000290967" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /codon_start="1"
FT                   /product="uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4; KEGG: sfu:Sfum_3201 uroporphyrin-III C-
FT                   methyltransferase"
FT                   /db_xref="GI:296268255"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="GeneID:9166739"
FT                   /translation="MSSANHSLEAQSGFVAFVGAGPGDENLLTLRGADLLRRADVVIAD
FT                   RTLHGAMLRHCRDGAKIVDVGEDGSPAVDAIEEAKAGRTVVRLCPGDPSFFSSVADEIS
FT                   ACADAEVEFEIVPGVPPATAVPTYAGIPPASGVAEFRVVDATKVEDWTPHASCEGTLVI
FT                   YHGLAEAPAIAKALISGGKPDSTPVAVVREGTVTAQHTVVSTLGRLGPDLKRADVSEPA
FT                   MIVVGDAVGMRDRMSWFETKPLFGWRVLVPRTKEQAKELTEQLRAYGAVPEEVPTISVE
FT                   PPRTPQQMDRAIKGLINGRYEWVVFTSVNAVKALREKFEEYGLDARAFAGLKIAAVGDA
FT                   TARSLMDFGIRPDLVPTGEQSSEGLLAEWPPYDSLLDPINRVLLPRADIATDTLIAGLT
FT                   ELGWECDDVTAYRTVRAAPPPAPIREAIKSGGFDAVLFTSSSTVRNLIGIAGKPHNVTV
FT                   IAVIGPQTAKTAQEFGLRVDVMAEKPSVSLLAAALAEYGAKMRQAQLAAGETPRRPSQM
FT                   RRGARRRAK"
FT                   /protein_id="YP_003650887.1"
FT   gene            309895..310881
FT                   /db_xref="GeneID:9166740"
FT                   /locus_tag="Tbis_0264"
FT   CDS_pept        309895..310881
FT                   /locus_tag="Tbis_0264"
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.24"
FT                   /transl_table="11"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   sfu:Sfum_3057 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="GI:296268256"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="GeneID:9166740"
FT                   /translation="MSAQFPVARPRRLRRTPALRRLVAGTRLHPADLILPLFVKEGIAE
FT                   PQPVGSMPGVVQHTRDSLRKAVTEAAEAGVGGVILFGIPAHKDARGSAADDPEGIVQVA
FT                   VRDVVAEVGDALVVMTDTCLDEYTDHGHCGILTETGEVDNDATLERYASAAVSQAAAGS
FT                   QVIAPSGMMDGQVKAIREALDANGFAHVPILAYSAKYASGFYGPFREAAECAPRFGDRS
FT                   AYQQDPAGPIDEALREVRLDLAEGADAVMVKPALPYLDVIRRVRDAVDVPVAAYQVSGE
FT                   YAMIEAAAANGWLDRERIIMESLISIRRAGADLILTYWAAEVARLLS"
FT                   /product="Porphobilinogen synthase"
FT                   /protein_id="YP_003650888.1"
FT   gene            311031..311675
FT                   /db_xref="GeneID:9166741"
FT                   /locus_tag="Tbis_0265"
FT   CDS_pept        311031..311675
FT                   /locus_tag="Tbis_0265"
FT                   /gene_family="HOG000053407" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09250"
FT                   /codon_start="1"
FT                   /product="bifunctional DNA primase/polymerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase; KEGG:
FT                   dol:Dole_2704 bifunctional DNA primase/polymerase"
FT                   /db_xref="GI:296268257"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="GeneID:9166741"
FT                   /translation="MVGVPLARRVKRRGHRRPQKITAVLEYAQLGWAACPGAHPRGEGG
FT                   RACSCDRIGCPDPGAHPLSPAWRLQATTDPALLTRWWQQNPDANIILPTGRVFDVFDVP
FT                   ASMGLPALAAMDAAHVHGPVAENGDRVLFFVATRGAPEDEDEWWSCHLDADPETIESTP
FT                   GLRWHCRDSYVLAPPSTRVDGDQVRWIRPPDGRPLPDPLRVLDLLADFCDS"
FT                   /protein_id="YP_003650889.1"
FT   gene            311767..313065
FT                   /db_xref="GeneID:9166742"
FT                   /locus_tag="Tbis_0266"
FT   CDS_pept        311767..313065
FT                   /locus_tag="Tbis_0266"
FT                   /gene_family="HOG000020210" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /codon_start="1"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; aminotransferase class I
FT                   and II; KEGG: aeh:Mlg_0806 glutamate-1-semialdehyde 2,1-
FT                   aminomutase"
FT                   /db_xref="GI:296268258"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="GeneID:9166742"
FT                   /translation="MTRTQTSEALFDRAKKIVPGGVNSPVRAFGAVGGTPRFMASGEGP
FT                   YLVDVDGNRYVDLVCSWGPLILGHRHAAVVQAVEEALSRGLSYGTATEGEVLLAEEIVS
FT                   RMPPVEKIRLVSSGTEATMSAVRLARGFTGRSKVIKFAGCYHGHVDALLASAGSGVATF
FT                   GLPDSPGVTGAAAADTIVLPYNSVEAVEEAFRKFEIACVITEACPANMGVVPPAEGFNR
FT                   RLRELCSEHGALLIIDEVLTGFRVTAQGWYGVDPVDADLMTFGKVMGGGLPAAAFGGRA
FT                   DVMAHLAPEGPVYQAGTLSGNPLAVAAGLATLRACDQAVYDRLDRVAETIGRAASEALS
FT                   AAGVPHRLQRAGNLFSIFFTDRPVVDYESARAQDTAAYRAFFHSMLDQGVYLPPSAFEA
FT                   WFVSAAHDDEAVNRVLEALPAAARAAAQAARQG"
FT                   /protein_id="YP_003650890.1"
FT   gene            313409..314311
FT                   /db_xref="GeneID:9166743"
FT                   /locus_tag="Tbis_0267"
FT   CDS_pept        313409..314311
FT                   /locus_tag="Tbis_0267"
FT                   /gene_family="HOG000233518" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="LysR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pol:Bpro_4368 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="GI:296268259"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:9166743"
FT                   /translation="MLDLNRLRALHAVAVHGSVGAAAEALMVTPSAISQQLAKLERETG
FT                   TVLLERDGRGVRLTDAAGLLVEHAERILAMVEAAEAEFAALRGKVVGTLTLAAFPTAAR
FT                   GILPRALSILKRNHPGLGVLIYEREPERQLREVARGEIDVAVVQDWLTRPMPLPHGLSR
FT                   AVLLDDVADLVVPSGHPLAGRRAVSLHDLPEGDWISSGPGTVCHDFLLFLLRSVEREPR
FT                   IVCMAGEYPTQLALVAAGHGCALIPRLGRVALPEGVRVVPVEPPPTRRVYAVWRTRGGR
FT                   RPAIRAAVEALRGACAEDG"
FT                   /protein_id="YP_003650891.1"
FT   gene            314289..314981
FT                   /db_xref="GeneID:9166744"
FT                   /locus_tag="Tbis_0268"
FT   CDS_pept        314289..314981
FT                   /locus_tag="Tbis_0268"
FT                   /gene_family="HOG000250041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mex:Mext_0502
FT                   phosphoglycerate mutase"
FT                   /db_xref="GI:296268260"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:9166744"
FT                   /translation="MPVPRTGRLSGTMSELTIVHLLRHGEVHNPTGVLYGRLPGFHLSE
FT                   LGRRMAEVVAETLATRDIVEIRSSPMERAVETATPTAERLGLKIQIDDRLTEAFNVFEG
FT                   VRVGNGTALLRDIRRYRYFLNPFRPSWGEPYVEVVARMKAAIDEARERARGHEALLVSH
FT                   QLPIWVTRLAAEGRRLWHDPRRRQCALASLTSFTFEGNRLISVGYSEPAGALLKESAAG
FT                   EAGPSAGA"
FT                   /protein_id="YP_003650892.1"
FT   gene            315276..315842
FT                   /db_xref="GeneID:9166745"
FT                   /locus_tag="Tbis_0269"
FT   CDS_pept        315276..315842
FT                   /locus_tag="Tbis_0269"
FT                   /gene_family="HOG000097219" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /codon_start="1"
FT                   /product="Redoxin domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Thioredoxin domain; KEGG: bmj:BMULJ_00460 thiol-disulfide
FT                   isomerase"
FT                   /db_xref="GI:296268261"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR006662"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="GeneID:9166745"
FT                   /translation="MSVKRLTAIVALAAAALAGCAGSEAAQPGIGETRFVPGDGRVQVF
FT                   DPGERPKAPQISGRTLDGETVTLTPGTVYVLNFWASWCAPCRAEAPVLKDVAAITKSKG
FT                   VRFIGVNFKDQEASAKAYDRAVEPGYPSIFDNEGKLLLAFQGTVPPAAIPSTLIIDAQG
FT                   RIAARALGAVKYQDLLDAVTKVSDE"
FT                   /protein_id="YP_003650893.1"
FT   gene            315835..316566
FT                   /db_xref="GeneID:9166746"
FT                   /locus_tag="Tbis_0270"
FT   CDS_pept        315835..316566
FT                   /locus_tag="Tbis_0270"
FT                   /gene_family="HOG000097106" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /codon_start="1"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: rde:RD1_2269 cytochrome c-type biogenesis
FT                   protein CcdA"
FT                   /db_xref="GI:296268262"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="GeneID:9166746"
FT                   /translation="MSDLGTTVATGSLLLAVPIAVLAGVVSFISPCVLPLVPGYLSYVT
FT                   GMSGDPRRGRMVLGSALFVLGFAAVFVTGGAFFGGVGALLLEHSAVITRVLGGVTVLLG
FT                   LAFLGAIPGLQRDLRIHRLPSAGLAGAPLLGVVFGLGWTPCIGPTLAVVLTLSVDQGSA
FT                   GRGALLAFAYALGLGLPFVLAGLAYRRALYAIKALRRHTVLITRIGGAMLVTVGLLLVT
FT                   GWWGGLVAQLQGWVAGFEPVI"
FT                   /protein_id="YP_003650894.1"
FT   gene            316566..318182
FT                   /db_xref="GeneID:9166747"
FT                   /locus_tag="Tbis_0271"
FT   CDS_pept        316566..318182
FT                   /locus_tag="Tbis_0271"
FT                   /gene_family="HOG000099452" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /codon_start="1"
FT                   /product="ResB family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ResB family protein; KEGG: gur:Gura_3842 ResB
FT                   family protein"
FT                   /db_xref="GI:296268263"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="GeneID:9166747"
FT                   /translation="MTEPQETGTATAVESEPEAPHRPAGLGLIGWLRWGWRVLTSMRTA
FT                   LILLFLLALAAVPGSIYPQRGIDPDQVAQYFSSRPQEAEWLDRLWLFDVYSSPWFAAIY
FT                   LLLFISLLGCIVPRLARHAGELRRRPPAAPRNLLRLPYGEEFEGDLTVAEAAALLRKRR
FT                   FRVTTGPDWVAAEKGYLRETGNILFHFSLVVLLFAFAGGALYGYRGNVVVVEGESFANT
FT                   VAAYDRFMPGSRVTAESLHPFSFTLKDFQVTFIAAGERTGQALDYQAALTVRDAPDAPA
FT                   REAVLKVNQPLEVGGTQTYLISHGYAPTFKVTDGKGQVAWEGPVPCLISDRATYASECV
FT                   IKVPDARPEQLGFLIRFLPTGVQAGDAWVSAFPGTVNPVAQVFPFAGDLGLDSGVPQSV
FT                   FQLDTTKMRPLGKMTAQPKPLSVGETLELADGAGTIQFTGVKEWISLQVSRDPGRLPAL
FT                   LAATAAVLGLVLSLTVRRRRIWVRVNDRRITVGGLERTDGGAAAFAKEFTEIVTALRAD
FT                   RVGPTPPSPTAPPPAEHEEER"
FT                   /protein_id="YP_003650895.1"
FT   gene            318179..319150
FT                   /db_xref="GeneID:9166748"
FT                   /locus_tag="Tbis_0272"
FT   CDS_pept        318179..319150
FT                   /locus_tag="Tbis_0272"
FT                   /gene_family="HOG000099340" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /codon_start="1"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: pca:Pcar_2228
FT                   ABC-type transport system, permease component"
FT                   /db_xref="GI:296268264"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="GeneID:9166748"
FT                   /translation="MTPLVNEELATLSDQLTLVAVLLYLVAMICFALDLAFGRIHPASA
FT                   VKAREPVAVGAGGGGPSSGEPGEAAAAGGAATAEGAPWAAKAGLAGIALTWIGWAAHLA
FT                   AIVTRGLAVDRWPWGNMYEFVVGLCLAAVTAFLVLLFRHRIRFLGAFVTLAAALGLGFA
FT                   VLFLHVQAGPLMPALQSYWLAIHVSAAIVASGLFTVAGVSAILYLVRKDRPSVLPTREA
FT                   LDTVVHRAIVIGFPIWTFAVIAGALWADRAWGRYWGWDPKEVWSFITWVVYAAYLHARA
FT                   TAGWKGKAAIIISLVAFACLLFNLIGVNIFFPGLHSYSDIPR"
FT                   /protein_id="YP_003650896.1"
FT   gene            complement(319737..320063)
FT                   /db_xref="GeneID:9166749"
FT                   /locus_tag="Tbis_0273"
FT   CDS_pept        complement(319737..320063)
FT                   /locus_tag="Tbis_0273"
FT                   /gene_family="HOG000250020" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268265"
FT                   /db_xref="GeneID:9166749"
FT                   /translation="MAYLVGMPSVISGLVLLAFWLFCLFHVITTPWHEVRNLPKAAWVI
FT                   IVALLPGLGGLLWLLFGRPQAPAWHDPAAGAGWREQPQPGRPIGPDDDPEFLRSLDRRL
FT                   RGEE"
FT                   /protein_id="YP_003650897.1"
FT   gene            320396..321124
FT                   /db_xref="GeneID:9166750"
FT                   /locus_tag="Tbis_0274"
FT   CDS_pept        320396..321124
FT                   /locus_tag="Tbis_0274"
FT                   /gene_family="HOG000158950" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268266"
FT                   /db_xref="GeneID:9166750"
FT                   /translation="MERVHAATAPVVHDRPSYTWRDFELDDRPMRAEPHPPDAPDLRDG
FT                   RRHCGPLERILHRQWDAAEGPPSIDAVHAVDSLARLPDLIKVKLADGLAGIYIGAGGVP
FT                   DLDDMGYLRGAPLPSGQGTWDICAGAYGDRKIVVGDRPSPTPDVMLHEVGHALDDVDAT
FT                   PPWEWVSDSPEFAALYAECVPLLASSFHRQPGGLGRKEFFADAFAAIASRQRPALVDML
FT                   SGHTRAALNVMLFFNRRYGI"
FT                   /protein_id="YP_003650898.1"
FT   gene            321134..321370
FT                   /db_xref="GeneID:9166751"
FT                   /locus_tag="Tbis_0275"
FT   CDS_pept        321134..321370
FT                   /locus_tag="Tbis_0275"
FT                   /gene_family="HOG000106552" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268267"
FT                   /db_xref="GeneID:9166751"
FT                   /translation="MFVIRLGDGRLRVPRSLTSADGRLIGNAYVEIAPGEPDYERYLSE
FT                   AITEEEAAERRRRWREDNDELERVFQAFKAEQE"
FT                   /protein_id="YP_003650899.1"
FT   gene            complement(321598..321819)
FT                   /db_xref="GeneID:9166752"
FT                   /locus_tag="Tbis_0276"
FT   CDS_pept        complement(321598..321819)
FT                   /locus_tag="Tbis_0276"
FT                   /gene_family="HOG000019723" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /codon_start="1"
FT                   /product="excisionase family DNA binding domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; KEGG: cps:CPS_4926
FT                   MerR family DNA-binding response regulator"
FT                   /db_xref="GI:296268268"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="GeneID:9166752"
FT                   /translation="MESSSERLLTPGEVAALFRVDPKTVTRWAAAGRISSIRTPGGHRR
FT                   FRESEVHALLRGEDVMSAERQNGDSPRV"
FT                   /protein_id="YP_003650900.1"
FT   gene            322079..322285
FT                   /db_xref="GeneID:9166753"
FT                   /locus_tag="Tbis_0277"
FT   CDS_pept        322079..322285
FT                   /locus_tag="Tbis_0277"
FT                   /gene_family="HOG000223678" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268269"
FT                   /db_xref="GeneID:9166753"
FT                   /translation="MHPLVVYTLSRFGLFLVTLGVLYLVGMRGFWLLILAFLVSGLASY
FT                   VLLSRQRDAVSERIVRKRERRDG"
FT                   /protein_id="YP_003650901.1"
FT   gene            322684..323439
FT                   /db_xref="GeneID:9166754"
FT                   /locus_tag="Tbis_0278"
FT   CDS_pept        322684..323439
FT                   /locus_tag="Tbis_0278"
FT                   /gene_family="HOG000249464" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /codon_start="1"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methionine biosynthesis MetW
FT                   protein; Methyltransferase type 12; KEGG: mmw:Mmwyl1_0746
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="GI:296268270"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:9166754"
FT                   /translation="MTRASLDKQPREVAAMFDRTAKRYDLVNTVLSLGQDRTWRRATAA
FT                   AIDAGPGELVLDLAAGTGTSTDAFTMYGARAIACDFSLGMLRTGVARRGGSGLYGGGVR
FT                   GVTFIAGDALRLPFKSETFDAVTISFGLRNVADPAQALREMLRVTKPGGRLVICEFSRP
FT                   PARWFDLVYSQYLMRLLPLVARLLSSNPDSYEYLAESIRAWPDQAALAKLIHEAGWEKV
FT                   AWRNLTFGIVALHRAFKPGPGAARPGDAV"
FT                   /protein_id="YP_003650902.1"
FT   gene            323555..324829
FT                   /db_xref="GeneID:9166755"
FT                   /locus_tag="Tbis_0279"
FT   CDS_pept        323555..324829
FT                   /locus_tag="Tbis_0279"
FT                   /gene_family="HOG000249452" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /codon_start="1"
FT                   /product="geranylgeranyl reductase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; tryptophan halogenase; FAD
FT                   dependent oxidoreductase; Lycopene beta and epsilon
FT                   cyclase; KEGG: pna:Pnap_1343 geranylgeranyl reductase"
FT                   /db_xref="GI:296268271"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR008671"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:9166755"
FT                   /translation="MSEQTRAERSTADADVIVVGAGPAGSTAAFYLAKAGLDVLLLEKT
FT                   RFPREKVCGDGLTPRSVKELVAMGVDIDAPGWIRNRGLRVYGAGLRFELDWPQLTSYPD
FT                   FGLVRTRADFDEILARHAERAGARLLEETNVTGPVLDERSGRITGVTAKGADGAPQTFR
FT                   APLVIAADGNSSRLSIAMGLHKRADRPMGVAVRTYFRSPRHDDDYLETWLELWDGDRLL
FT                   PGYGWIFGVGDGTCNVGVGLLNTSAAFKNVDYRDLLRRWVKGMPAEWGFTEENMTAPIR
FT                   GAALPMAFNRQPAYRRGLLLVGDAAGAVNPFNGEGIAYAMATGRIAAETIVQALARPTP
FT                   AQRERVLLSYPRILKEEYGGYFTLGRLFLEAIGRPGVMKFATRHGLPRPTLMRFALKLL
FT                   ANLTDRRGDVSDRIINALSKVAPSA"
FT                   /protein_id="YP_003650903.1"
FT   gene            324826..324927
FT                   /db_xref="GeneID:9166756"
FT                   /locus_tag="Tbis_0280"
FT   CDS_pept        324826..324927
FT                   /locus_tag="Tbis_0280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268272"
FT                   /db_xref="GeneID:9166756"
FT                   /translation="MTEANCNPYATVKAAAEPGAIVNVRFHRVCEDM"
FT                   /protein_id="YP_003650904.1"
FT   gene            324930..325292
FT                   /db_xref="GeneID:9166757"
FT                   /locus_tag="Tbis_0281"
FT   CDS_pept        324930..325292
FT                   /locus_tag="Tbis_0281"
FT                   /gene_family="HOG000100120" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   subunit 3"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: glo:Glov_3138 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase chain 3"
FT                   /db_xref="GI:296268273"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="GeneID:9166757"
FT                   /translation="MELYVPILALAILAAGFALLSVSVIAPLTGPKRWNRAKLDSYECG
FT                   IDPTPQPVGGGRFPLKFMVTAMLFIVFDIEIIFLYPWAVAFDKLGVFGLVEMVLFIVTV
FT                   LAAYTYVWRRRGLDWD"
FT                   /protein_id="YP_003650905.1"
FT   gene            325296..325847
FT                   /db_xref="GeneID:9166758"
FT                   /locus_tag="Tbis_0282"
FT   CDS_pept        325296..325847
FT                   /locus_tag="Tbis_0282"
FT                   /gene_family="HOG000228249" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_2252 NADH-quinone oxidoreductase,
FT                   B subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="GI:296268274"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="GeneID:9166758"
FT                   /translation="MGLEEKLPSGFLLTTVEKAVGWARKNSVWPATFGLACCAIELMAT
FT                   GGPKHDLARFGMERASATPRQADLMIVAGRVSQKMAPVVRRIYDQMAEPKWVIAMGVCA
FT                   SSGGMFNNYAVVQGVDHIVPVDVYLPGCPPRPEMLIDAIVKLHDKIQNMKFGAHRAAQL
FT                   EELERRALRTLPLIEQGAGK"
FT                   /product="NADH-quinone oxidoreductase subunit B"
FT                   /protein_id="YP_003650906.1"
FT   gene            325844..326533
FT                   /db_xref="GeneID:9166759"
FT                   /locus_tag="Tbis_0283"
FT   CDS_pept        325844..326533
FT                   /locus_tag="Tbis_0283"
FT                   /gene_family="HOG000009798" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /codon_start="1"
FT                   /product="NADH (or F420H2) dehydrogenase subunit C"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   mno:Mnod_4128 NADH (or F420H2) dehydrogenase, subunit C"
FT                   /db_xref="GI:296268275"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="GeneID:9166759"
FT                   /translation="MSSKNLPEVPDGANADMANWPVVRTGMFGVKGSGDTSGYGRLVVR
FT                   RPPKSSTPRPYGSYFDEVADALEALCGDAIERVVVDRGEITFHVRRERLVEVMRHLRDD
FT                   PRLRFELSLGVSGVHYPDDAGAELHAVYHLCSITHNRRIRVEVSCPDSDPHIPSTVSVY
FT                   PTHNWHERETYDFFGIIFDGHPALTRIEMPDDWEGHPQRKDYPLGGIPVEYRGATTPPP
FT                   DQRRSYS"
FT                   /protein_id="YP_003650907.1"
FT   gene            326530..327846
FT                   /db_xref="GeneID:9166760"
FT                   /locus_tag="Tbis_0284"
FT   CDS_pept        326530..327846
FT                   /locus_tag="Tbis_0284"
FT                   /gene_family="HOG000228264" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01962"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_1313 NADH dehydrogenase I, D
FT                   subunit; TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="GI:296268276"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR010219"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="GeneID:9166760"
FT                   /translation="MSTMEAEGRVVDVAGQDWDEVVRTVGESGEERLVVNMGPQHPSTH
FT                   GVLRLVLTLDGETVTEVRPVIGYLHTGIEKNMEYRTWTQGVTFVTRMDYLSPIFNETAY
FT                   CMAVEKLLGITDRIPERAKTLRVLMMELNRISSHLVAVATYGMELGATSIMIYGFRERE
FT                   MVLDLFEYITGLRMNMAYVRPGGVSVDLPAGAVDKIGEFLKVMPGRIKDMRKLLDENPV
FT                   YTRRTKDVAYLDLTGCMALGVTGPVLRAAGLPWDLRKTQPYLGYETYEFDVPTANTCDV
FT                   YGRYLVRMAEMEESLKIIEQALDRLTGPLKGEPVMIEDKKIGWPSRLALGPDGLGNSPD
FT                   HIAHIMGTSMEALIHHFKLVTEGFRVPAGQAYAAVESPRGELGAHVVSDGGTRPYRVHF
FT                   RDPSFTNLQALPAMCEGGMVADVISAIASIDPVMGGVDR"
FT                   /product="NADH dehydrogenase I subunit D"
FT                   /protein_id="YP_003650908.1"
FT   gene            327843..328538
FT                   /db_xref="GeneID:9166761"
FT                   /locus_tag="Tbis_0285"
FT   CDS_pept        327843..328538
FT                   /locus_tag="Tbis_0285"
FT                   /gene_family="HOG000019734" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01958"
FT                   /codon_start="1"
FT                   /product="NADH-quinone oxidoreductase subunit E"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 24 kDa subunit; KEGG:
FT                   aba:Acid345_1312 NADH-quinone oxidoreductase, E subunit"
FT                   /db_xref="GI:296268277"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="GeneID:9166761"
FT                   /translation="MTYAPEVRERLEREAKEIIARYPKPRSALLPLLHLVQSEDGYISD
FT                   DGAEFCAEQLGLTKAEVLGVATFYTMYKREPAGEYNVGVCINTLCAVMGGDQIWETLTE
FT                   HLGIGHNETTPDGKITLERLECNAACDYAPVVVVNWEFFDNQTPESAKRLVDDLRAGKG
FT                   ATPTRGPKRLCTFKEASRILAGFPDGRAGEGPSAGEASLRGLRLAKANGWEAPRPGAEA
FT                   NEQKRGSEE"
FT                   /protein_id="YP_003650909.1"
FT   gene            328535..329821
FT                   /db_xref="GeneID:9166762"
FT                   /locus_tag="Tbis_0286"
FT   CDS_pept        328535..329821
FT                   /locus_tag="Tbis_0286"
FT                   /gene_family="HOG000251534" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01959"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: sme:SMa1525 NuoF2 NADH I chain F; TIGRFAM:
FT                   NADH-quinone oxidoreductase, F subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit"
FT                   /db_xref="GI:296268278"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="GeneID:9166762"
FT                   /translation="MTQLTPVLTRNWDRPDSFTLAGYGDYSAARKALSMDPDTIIQMVK
FT                   DSGLRGRGGAGFPTGMKWGFIPQNDGKPHYLVVNADESEPGTCKDIPLMMANPHALIEG
FT                   AIITSYAIRANHAFIYVRGEVLHVIRRLQAAVREAYEAGYLGRNIFGSGYDLELVVHCG
FT                   AGAYICGEETALLDSLEGRRGQPRLKPPFPAVAGLYACPTVINNVESVATVPSIVANGP
FT                   EWFASMGTEKSKGFGIFSLSGHVARPGQYEAPLGITLRELLEMAGGIRAGHRLKFWTPG
FT                   GSSTPIFTEEHLDVPLDFESVAANGSMLGTRAIQIFDETTCVVRAVLRWTEFYAHESCG
FT                   KCTPCREGTYWLKQVLYRLEKGQGTEEDLATITDIADNILGRSFCALGDGATSSIHSSV
FT                   KLFRDEYLKHFEIGGCPFDPAASTVWGVK"
FT                   /product="NADH-quinone oxidoreductase subunit F"
FT                   /protein_id="YP_003650910.1"
FT   gene            329818..332223
FT                   /db_xref="GeneID:9166763"
FT                   /locus_tag="Tbis_0287"
FT   CDS_pept        329818..332223
FT                   /locus_tag="Tbis_0287"
FT                   /gene_family="HOG000031440" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01973"
FT                   /codon_start="1"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   molybdopterin oxidoreductase; ferredoxin; molybdopterin
FT                   oxidoreductase Fe4S4 region; KEGG: smd:Smed_3617
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="GI:296268279"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="GeneID:9166763"
FT                   /translation="MTIETTSAGQIERPVDMVTLTIDGFRVSVPKGTLIIRAAELLGIE
FT                   IPRFCDHPLLDPAANCRQCLVEITDAGNGRGFPKPQPSCAIEVAEGMVVKTALTSPVAE
FT                   KAQRGVMEMLLLNHPLDCPVCDKGGECPLQNQAMSHGQGESRFQEKKRTFPKPVALSTQ
FT                   VLLDRERCIQCARCLRFSEQIAGDPLITFFERGAKEQVAAADGEPFHSYFSGNTIQICP
FT                   VGALTGAAYRFRARPFDLVSTPSACEHCASGCALRTDHRRGKVLRRLAADDPQVNEEWN
FT                   CDKGRWAFTYATQPDRLTTPLVRDEDGKLVPASWPEALAAAAEGLARARGRAGVLVGGR
FT                   LTLEDAYAYSKFARVALGTNDIDFRARPHSEEEARFLAYAVAGKGIEVSYADLERAPVV
FT                   LLVGFEPEEESPIVFLRLRKAVRKKGLKVYSIAPFTTPGLAKLNATLIRTVPGAEAEAL
FT                   GELIGGDLIPAEGIILVGERLATVPGAFSALVRLVQATGARVAWVPRRAGERGALEAGA
FT                   LPNLLPIGRPVDDETARSEVARVWNVGSLPSLPGRDTTGIIDAALNEEIDALLVAGVDP
FT                   YDLPDPSRALAALENTPFVVSLEIRASAVTDRADVVLPVAVVAEKSGSFVNWEGRGRQF
FT                   EAALQVPGVLSDLRVINAIADHMDVHLGLPDPAAARRELAAIGTWKGSRATPPTLTGRP
FT                   GKEPQAGEAVLATWHLLLDDGRLQDGEPYLAGTARPATALISAATAAEIGVSEGDKISI
FT                   GDGGVVMPVRIADLPDRVVWVPSNSNGISVTRDLGAVAGDVVKIGSVS"
FT                   /protein_id="YP_003650911.1"
FT   gene            332220..333578
FT                   /db_xref="GeneID:9166764"
FT                   /locus_tag="Tbis_0288"
FT   CDS_pept        332220..333578
FT                   /locus_tag="Tbis_0288"
FT                   /gene_family="HOG000228276" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: aba:Acid345_1308 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="GI:296268280"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="GeneID:9166764"
FT                   /translation="MNNAGPTLSDFGNDPLWLSFLKAVCIFVLLLLGVLFGVWGERKII
FT                   ARMQHRYGPNRAGKFGILQSLADGIKLALKEDLVPRKVDKVVYILAPALIAIPAFLAFS
FT                   VIPFGPTVSIFGVETPLQLTDLPVGVLLVLAMASIGVYGIVLAGWSSRSPYAILGGLRS
FT                   SAQVVSYEIAMALSFVAVFLQAGTLSTSEIVAAQAHAGSVTLFGVEIPTPSWYVVSLFP
FT                   SFAIYVITMFGETNRLPFDLPEGEGELVGGFHTEYSSSLKWGMFMIGEYVNMFTVSAIA
FT                   VTLFFGGWHAPWPISIWDAANTGWWPMLWFLGKVALAFWFFVWVRASLPRVRYDQLMAF
FT                   GWKVLIPVNLAWILIAATMKAMRISEGDRTVIYVLGAVIIIGAFAIWLRFDTVNQRRAE
FT                   AKAAQIEEEFKQLREEPAAGGFPVPPLDLPHYRGVVPAARHSTDAKEVTSGSN"
FT                   /product="NADH dehydrogenase"
FT                   /protein_id="YP_003650912.1"
FT   gene            333565..334080
FT                   /db_xref="GeneID:9166765"
FT                   /locus_tag="Tbis_0289"
FT   CDS_pept        333565..334080
FT                   /locus_tag="Tbis_0289"
FT                   /gene_family="HOG000228290" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01971"
FT                   /codon_start="1"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sus:Acid_3879 NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="GI:296268281"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:9166765"
FT                   /translation="MGATDWLNPVKGFGVTFHHMFKKPVTVQYPEEKRPTAPRFHGRHQ
FT                   LNRWPDGLEKCVGCELCAWACPADAIYVEGADNTETERYSPGERYGRVYQINYLRCIMC
FT                   GLCIEACPTRALTMTNEYELADTSREAMIYTKDMLLAPLGPGMEAPPHPMRLGETEEDY
FT                   YRLGRGNG"
FT                   /protein_id="YP_003650913.1"
FT   gene            334073..334963
FT                   /db_xref="GeneID:9166766"
FT                   /locus_tag="Tbis_0290"
FT   CDS_pept        334073..334963
FT                   /locus_tag="Tbis_0290"
FT                   /gene_family="HOG000019745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   subunit 6"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: afw:Anae109_4347 NADH-
FT                   ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="GI:296268282"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="GeneID:9166766"
FT                   /translation="MGESITFWVLAVVSVLAAFGLVLSRKAVYSALMLGVVMLSLAVLY
FT                   AVQDAPFLAAVQIIVYTGAVMMLFLFVLMLIGVDTSDSLVETIKGQRFWAIVAGLGFVA
FT                   LLGLAVGNVAVSAATGLGEEGKASNVLSLAELIFTRHVFAFEVTSALLITAALGAMVLA
FT                   HRERRTPKPTQKDLSRRRFLEYGRTGKDPAPLPGPGTYARHNAVDLPALLPDGTVSPLS
FT                   VNRYIARYEANEGDLDPELARLREQGRLLEGRAAAVDGEEPRDERAEGGEPAEDVLSAQ
FT                   AAGRGDGPRSEEEGK"
FT                   /protein_id="YP_003650914.1"
FT   gene            334960..335256
FT                   /db_xref="GeneID:9166767"
FT                   /locus_tag="Tbis_0291"
FT   CDS_pept        334960..335256
FT                   /locus_tag="Tbis_0291"
FT                   /gene_family="HOG000066429" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone oxidoreductase subunit 4L"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   glo:Glov_3128 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="GI:296268283"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="GeneID:9166767"
FT                   /translation="MTTHYLVLSALLFTIGAVGVLLRRNAIVVFMCIELMLNACNLAFV
FT                   TFARQHGNLDGQLIAFFVMVVAAAEVVVGLAIIVTIFRTRRSASVDDANLMKH"
FT                   /protein_id="YP_003650915.1"
FT   gene            335266..337194
FT                   /db_xref="GeneID:9166768"
FT                   /locus_tag="Tbis_0292"
FT   CDS_pept        335266..337194
FT                   /locus_tag="Tbis_0292"
FT                   /gene_family="HOG000100569" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: pla:Plav_3215 proton-translocating NADH-
FT                   quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="GI:296268284"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003916"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="GeneID:9166768"
FT                   /translation="MEPAVFQRDLTEIASIIQHDGGAIGASWLMIALPLVGAALLLVGG
FT                   RRTDKFGHLLGTVMALASFAVSVLAFIELLGFAPQERRRAVPLFEFIPGIADVGLLIDP
FT                   LSISFCLLITGVGSLIHIYSIGYMAHDPDRRRFFAYLNLFVAAMLLLVLADNYLLLFVG
FT                   WEGVGLASYLLIGFWQYKPSAATAAKKAFIINRVGDFGLLIGLFTIFATFHSLAFGEVF
FT                   SAASRASEVTLTAIGLLLLVGACGKSAQLPLQAWLLDAMEGPTPVSALIHAATMVTAGV
FT                   YLIVRSGPIYEGAPTAQLLVTIVGVATLLAGAIIGTAKDDIKKALAGSTMSQIGYMVLA
FT                   AGIGPAGYAFAIAHLITHGFFKADLFLGAGSIMHAMNDEVDMRKYGALRKVMPITFATF
FT                   LIGYLAIIGFPLLSGYFTKDGIIETAMEHSAVLGWLAVLGAGITGFYMSRVVFMTFFGT
FT                   KRWDANAHPHESPKVMTLPLIVLSIGSIGLGAYLILGNRFMLFLAPAVGAPEELPGFHP
FT                   FSVPGLATLGLVALGAAYAWLKYGAAEVPTVAPRGSFLVRFARRDLYGDALNEALFMRP
FT                   GQWLTRIAVFFDNRGVDGLVNGLAALIGGTSGRLRRVQTGFARSYALSMFIGATVLVGA
FT                   WFVVGNL"
FT                   /product="proton-translocating NADH-quinone oxidoreductase
FT                   subunit L"
FT                   /protein_id="YP_003650916.1"
FT   gene            337194..338702
FT                   /db_xref="GeneID:9166769"
FT                   /locus_tag="Tbis_0293"
FT   CDS_pept        337194..338702
FT                   /locus_tag="Tbis_0293"
FT                   /gene_family="HOG000100683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: proton-translocating NADH-quinone
FT                   oxidoreductase,   chain M; K00342 NADH dehydrogenase I
FT                   subunit M; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="GI:296268285"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="GeneID:9166769"
FT                   /translation="MHWLSTLMGVSVLGALGVPLFRNDKLAKQFTLVISLVVLALALAM
FT                   AREFDPNGDRFQFTETYAWIPSFGIHFSVGVDGIALVLILLSAVLVPVVVLASWNEAEG
FT                   GKRSVRTYFSLILLLEAMMIGVFAATDVFLFYVFFEAMLIPMYFMIGSYGGAQRSYAAV
FT                   KFLLYSLFGGLLMLVAVIALYVIAGKNTFLFGDLVGTVQDATTQKWLFLGFFIAFAIKA
FT                   PLWPFHTWLPDAAAQAPAGSAVLLVGVLDKVGTFGMLRYCLELFPDASKYFTPLVITLC
FT                   VIGVVYGAIVAIGQTDMKRLIAYTSVSHFGFIALGVFAMTSNASAGATLYMVNHGFSTG
FT                   ALFLIAGFLISRRGSQFIADYGGVQKVAPVLAGTFLIAGLSSLSLPGLSPFVSEFMVLL
FT                   GSYERFLWPTVIATTGVILAAIYILWMYQRMMNGPTAEPVKRMPDLNAREKWAIAPLIL
FT                   LLVVFGFYPKPLLDVINPAVKSTLASVSVTDPAPAVPVAAEEGQ"
FT                   /product="proton-translocating NADH-quinone oxidoreductase
FT                   subunit M"
FT                   /protein_id="YP_003650917.1"
FT   gene            338699..340249
FT                   /db_xref="GeneID:9166770"
FT                   /locus_tag="Tbis_0294"
FT   CDS_pept        338699..340249
FT                   /locus_tag="Tbis_0294"
FT                   /gene_family="HOG000100794" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /codon_start="1"
FT                   /product="proton-translocating NADH-quinone oxidoreductase
FT                   subunit N"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   gbm:Gbem_3913 proton-translocating NADH- quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="GI:296268286"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="GeneID:9166770"
FT                   /translation="MIFQAPNIEYGLLAPILIVFGAAVAGVLVEAFAPRYLRSAIHLPL
FT                   ALVSLLGAFALTIWQVAANGIPTKAAAEGALAVDGPALFIWGTILVLAIVSVLLINDEG
FT                   HFVASAVAVPGTAEEEQSLQDGAAHTEVFPLALFAVGGMMLFPVANDLLVAFVALEVMS
FT                   LPLYLLCGLARRRRLLSQEAAVKYFLLGAFSSAFFLYGVALVYGFAGSVDLAAISRALG
FT                   EVDGRDPLLFLGMALLGVGLLFKIGAAPFQAWKPDVYQGSPTPITALMASGTLVAAFGA
FT                   LLRVFWVGLGGMDWSWRPVMWAVAILTMLVGAVLAVTQTDIKRMLAYSSIAHAGFLLIG
FT                   VVATGGTQAENAAVVSAILFYLVAYGFSTVGAFAVVTMVRDPGGEAWHLSRWAGLGKRS
FT                   PLLAGVFAFFLLAFAGIPLTSGFLGKYAVFSAAVANDAVPLVIVGVIASAIAAFFYVRV
FT                   IVLMFFSDPAADAPAVVLPSVGTAAVVATAALATVVLGVYPEPVLDLAHSAAKSLFVR"
FT                   /protein_id="YP_003650918.1"
FT   gene            340262..341257
FT                   /db_xref="GeneID:9166771"
FT                   /locus_tag="Tbis_0295"
FT   CDS_pept        340262..341257
FT                   /locus_tag="Tbis_0295"
FT                   /gene_family="HOG000009104" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.5.1.30"
FT                   /codon_start="1"
FT                   /EC_number="2.5.1.30"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: xca:xccb100_1425
FT                   octaprenyl-diphosphate synthase, probable"
FT                   /db_xref="GI:296268287"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="GeneID:9166771"
FT                   /translation="MAAPPLVEIPRVDERLAEDLATGLAEVERMLRASVESEDAFITEA
FT                   ARHVMEAGGKRFRAMLVLLAAQFGDPKAPAVVPGAVVIELTHLATLYHDDVMDQAPMRR
FT                   GLPSANARFGDTVAILTGDYLFAQASEILADLGAEAIRVQARTFSRLVRGQIRETIGPP
FT                   EGMDPITHYLQVLADKTGSLIATSGRFGAMLSGAPREVEDRLAGACEAIGVAWQLGDDI
FT                   IDVVSDGSVSGKTPGTDLREGVRTLPVLYALASTDPADERLRMLLSGPVAEQDIEEALT
FT                   LLRAHPAMDMARKELVKWADQAKGALSGLPDIPARTALIRLCDWVVERTA"
FT                   /product="trans-hexaprenyltranstransferase"
FT                   /protein_id="YP_003650919.1"
FT   gene            341412..343097
FT                   /db_xref="GeneID:9166772"
FT                   /locus_tag="Tbis_0296"
FT   CDS_pept        341412..343097
FT                   /locus_tag="Tbis_0296"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /codon_start="1"
FT                   /product="NLP/P60 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NLP/P60 protein; KEGG: hypothetical protein
FT                   mgc108497"
FT                   /db_xref="GI:296268288"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="GeneID:9166772"
FT                   /translation="MLGAAVLTVASATPAQAAVALTCPATVPVYAIDGDGRLKWYGHRD
FT                   AGGGSWSWASGSGAQIGHGWHGFKRVFSGGNGVIYAVDGSGYLKWYRHTGASTGANTWA
FT                   SGSGKVIGHGWGGFVDVVADGTGVIYALDADGNLRWYRHLSPTTGGTGWASGSGTVIRT
FT                   GWKAITKLIPGRDGVIFGINTKGLVRWYKHLNPSGGGSTFGTGTGLVTGEEWDRYRTPS
FT                   GAGAGVFYAVDSGGRLWWERHADPQAGAPVWYERRQIGSGWGSFTSVFADVASCAPASS
FT                   TGYATGSGGRTLYYVNGRVAAVLTPGARTAVLYGTTVRKFSESTTTATVSTRAWVRLLP
FT                   GPWSTSASWASSWLSANVGSTSEDILEIASQYITGAPDRYKNGLRYAGDAHYGPVGEEG
FT                   RIEGSDFNDYLGIPWKYGDRVDEPEPDQKDSLDCSGFVRMVYGYRSGYPMEIGTPTGTA
FT                   LPRRAVQMHASAPGVMVVDGGTAKPTSYAALQPGDLLFWDASTDDGTAIDHVGIYLGVD
FT                   SNGKHRFVSSRKTVDGPTLGDVGGHSLLDNGTLYDRSWRAAKRL"
FT                   /protein_id="YP_003650920.1"
FT   gene            complement(343437..344342)
FT                   /db_xref="GeneID:9166773"
FT                   /locus_tag="Tbis_0297"
FT   CDS_pept        complement(343437..344342)
FT                   /locus_tag="Tbis_0297"
FT                   /gene_family="HOG000262547" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /codon_start="1"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   bph:Bphy_2413 transporter DMT superfamily protein"
FT                   /db_xref="GI:296268289"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="GeneID:9166773"
FT                   /translation="MPELRRGVAYGVAAYAIWGLTPLYWPLLEPSGAVEILAHRMVWSL
FT                   VVVAALLAVRRRWSWIRELTGRQVLLLAIAAIVVSVNWGVYIYAVNSGHVVDASLGYFI
FT                   NPLVNVLFGIMIFGERLRTGQWVAVGLGTLAVAVLTYGYGRPPWIALVLAFTFGIYGVV
FT                   KKKARVEGTESLAVETLVMLLPAVVYLGTLHASGEGTFGRYGLGHALLVAGAGVVTALP
FT                   LIFFTIAALSIPLSLVGLLQYIAPILQFLCGVLIAHETMPPSRWAGFCIVWLALAVFTW
FT                   DTLRAARNARLAREAEPATV"
FT                   /protein_id="YP_003650921.1"
FT   gene            344477..345139
FT                   /db_xref="GeneID:9166774"
FT                   /locus_tag="Tbis_0298"
FT   CDS_pept        344477..345139
FT                   /locus_tag="Tbis_0298"
FT                   /gene_family="HOG000263862" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /codon_start="1"
FT                   /EC_number="1.8.4.11"
FT                   /transl_table="11"
FT                   /note="KEGG: acr:Acry_0406 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="GI:296268290"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="GeneID:9166774"
FT                   /translation="MHWLLGKHKTTMVAPAEALPGRAEPMPVADRHAVLGTPLAPPYPE
FT                   GTEIAEFALGCFWGAERRFWQTPGVVTTAVGYAGGYTPNPTYEEVCTGLTGHAETVRVV
FT                   FDPKVISYERLLKVFWESHDPTQGMRQGNDVGTQYRSVIFTHGPEQERLAVASRDAYQK
FT                   VLTEHGYGRITTEIVPAGEFYFAEDYHQQYLHKVPDGYCGFGGTGVGCPVGLTSGEA"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /protein_id="YP_003650922.1"
FT   gene            complement(345288..345836)
FT                   /db_xref="GeneID:9166775"
FT                   /locus_tag="Tbis_0299"
FT   CDS_pept        complement(345288..345836)
FT                   /locus_tag="Tbis_0299"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce5012 hypothetical protein"
FT                   /db_xref="GI:296268291"
FT                   /db_xref="GeneID:9166775"
FT                   /translation="MSVAETIEPLPPLVADAMVLIHFAKADRLDVLGTCLSSLSTTRIV
FT                   AAEVDKYCAEYPSITSISDLEWLAILPQDTLEELLAFERWVQLLGSGEHDLGEASVFAA
FT                   AEVHELVAITDDRDATRVGSKHGLEIHGTVWLLTRLHQRGKMTLPQICTLVDALRETGM
FT                   RLPCTGGELPRWAEERRLL"
FT                   /protein_id="YP_003650923.1"
FT   gene            complement(345833..346945)
FT                   /db_xref="GeneID:9166776"
FT                   /locus_tag="Tbis_0300"
FT   CDS_pept        complement(345833..346945)
FT                   /locus_tag="Tbis_0300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; SMART: helix-turn-helix domain
FT                   protein; KEGG: sbp:Sbal223_3468 helix-turn-helix domain
FT                   protein"
FT                   /db_xref="GI:296268292"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="GeneID:9166776"
FT                   /translation="MCDYRTMSSLDWQEIGERVRQARLAKGLSQLQLAQKVDLDRTMIT
FT                   KIEAGSRRLDALELARLAQALDVPIGHFLHPAPEVLSHRTPLAEDTATDASQPYYRLDN
FT                   ALAAWIRDIRLLMDLGTLQPQPIMQYPGKADGPEAAAEAARWVRGELGLGTAPVQSMAE
FT                   LSERCGQYVLVTELPGDGASAVDGDMAAAVVSLNGDPGRRRSTAAHELGHMVLGDAYST
FT                   DIGVAASRTEREAMIDAFAGELLLPVAAIRAAADVAKASTRSVLVRLAAEYRTSWSMAL
FT                   RQARKAGVITSQEEKRLRSSLPTYAEFRDSLGWTPQPDLEDIRVPPGFAHAVMTAYRTG
FT                   QITRRRAFELMHGQLRSEEDLPPVDEDEAP"
FT                   /protein_id="YP_003650924.1"
FT   gene            347400..347900
FT                   /db_xref="GeneID:9166777"
FT                   /locus_tag="Tbis_0301"
FT   CDS_pept        347400..347900
FT                   /locus_tag="Tbis_0301"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_3374 tetratricopeptide repeat
FT                   protein"
FT                   /db_xref="GI:296268293"
FT                   /db_xref="GeneID:9166777"
FT                   /translation="MRRFWAASAVLTVICAAVGTAGLAALATGRGGPEPVQAPIAAERQ
FT                   AVRLPAGGVPEPSQGQVALQEEARSLPEGVAPQEVSRRQYRIMLRQCRYANTKALQEEC
FT                   LAEVQQRYTVGAFNPSLDCRTYSSITVCGELKLTPEERQCVREAVRQGMSYRRAEVECY
FT                   AFR"
FT                   /protein_id="YP_003650925.1"
FT   gene            347957..348352
FT                   /db_xref="GeneID:9166778"
FT                   /locus_tag="Tbis_0302"
FT   CDS_pept        347957..348352
FT                   /locus_tag="Tbis_0302"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268294"
FT                   /db_xref="GeneID:9166778"
FT                   /translation="MDPKSRGAADLLRALMGAAARFSETGGSLTREYFPHVGCEPISDL
FT                   AGPAVRLGMRVTLPGHELVAELAVRVTDAGFTIGGELMLDDAEPFLTLPPIETADVDKC
FT                   AALLHRYAEELTVPARLEVGRLLEHGC"
FT                   /protein_id="YP_003650926.1"
FT   gene            complement(348383..348736)
FT                   /db_xref="GeneID:9166779"
FT                   /locus_tag="Tbis_0303"
FT   CDS_pept        complement(348383..348736)
FT                   /locus_tag="Tbis_0303"
FT                   /gene_family="HOG000049105" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="GI:296268295"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="GeneID:9166779"
FT                   /translation="MTEQDNGPLLRPYMLTRGRTRPSGPEFDLLSVIRTAPSAHERTAG
FT                   LAPEHLRILRICRTPSTVADLASELGLSLNVLRILLSDLRDKGLISVRPQATVARLPDE
FT                   RILREVIQAFKAL"
FT                   /protein_id="YP_003650927.1"
FT   gene            complement(348733..350826)
FT                   /db_xref="GeneID:9166780"
FT                   /locus_tag="Tbis_0304"
FT   CDS_pept        complement(348733..350826)
FT                   /locus_tag="Tbis_0304"
FT                   /gene_family="HOG000253355" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08376"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Nitrate and nitrite sensing domain protein;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG: scl:sce8108
FT                   sensor histidine kinase"
FT                   /db_xref="GI:296268296"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="GeneID:9166780"
FT                   /translation="MAVRRRSIRFKLFAILLVPFTALGAIWAFTATLIAEEGFKLLQID
FT                   AVYNHVVVPTRGVIVQLQRERSLSVQALGSAYSLQTDLERQRRLTDEAARTLARESAQA
FT                   ADETPPAMRQRIQALIAQVERLDDLRTRVDERRLSRLDAIDEYSAVLETAFQAYDHLMI
FT                   SQDLELIGQTKAIILIARSHEVAAQEAALLSGVVASGRYTVEDRDAFASMVSRRRLLYQ
FT                   LGTGQLDAELIKRYTAFNDSPVHKTFLAVEEQLTRRGEVGRTLPVGALNWPAAAEQLVH
FT                   RLTELNAATSRDIADRAAPLARGVLLRIGVAGALGAGTAIAAVFISLRFARKLSGELTG
FT                   LERAVVELAERRLPSVLARLRRGEDVDVAAETRPLGTDHGTTEVASLSRAFGSVQRTAI
FT                   EAAVEQAKLRKGVNKVFLNLARRNQSLLTRQFALLDTLEKEITDPDLLEKVFGIDHLAA
FT                   RMRRHAEGLIILSGAAPARGWRNPVNLHDVVRAATEQVEDYQRVDVQVPHTHALVGRAA
FT                   TNVIHLLAELIENATAFSPPQSKVLVRGEAVARGYSLEIEDRGLGMTPEDMERFNQRLA
FT                   DPPEIDLADSDRLGLFVVGLLAKRHGIKVALRASPYGGTSAIVLLPQELVVEHAAEDLE
FT                   LTPLQPQEPSAPALAIARPDGAPKSTLPRRIRQANLAPQLRQPRGDLYSAMRPGSDPRG
FT                   EGS"
FT                   /protein_id="YP_003650928.1"
FT   gene            350965..352014
FT                   /db_xref="GeneID:9166781"
FT                   /locus_tag="Tbis_0305"
FT   CDS_pept        350965..352014
FT                   /locus_tag="Tbis_0305"
FT                   /gene_family="HOG000253119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gbm:Gbem_3934 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="GI:296268297"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:9166781"
FT                   /translation="MRSGPLAIFAAAALWGTAGTAGALTDAGSVPLAAARLVLGGAVLA
FT                   ALAARSLAAADPRHHGRGAGEPADQDGHLLGHAREAEKYRRGGPAPAPARSGIGAALAS
FT                   GLGLVRGRPALLLAAVAVAAYQLCFFAAVARTGVAIGTVVAIGSGPVFTGLLSWLLDRR
FT                   PPTLRWALATTTAVAGCAVLVTGGEASGAEPGGIALALVGGLLYAFYAVMASRAIQTGL
FT                   ESGVVMGLLFGGAAVLMLPVLVVTAPGSLTEPRALLVAVYLGCATTALSYLLYGKGLRT
FT                   TPVATAATLALAEPAVAALLGLAVLGERLSGPAWAGLGLLAVGLIIVALPERARTAPEP
FT                   AAQRTASGA"
FT                   /protein_id="YP_003650929.1"
FT   gene            complement(352182..352832)
FT                   /db_xref="GeneID:9166782"
FT                   /locus_tag="Tbis_0306"
FT   CDS_pept        complement(352182..352832)
FT                   /locus_tag="Tbis_0306"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vei:Veis_1972 ABC transporter related"
FT                   /db_xref="GI:296268298"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9166782"
FT                   /translation="MLEARDITVIYDRRRVLDGAGIAVPPGTTVGLMGPSGCGKSTLAR
FT                   VLALLQRPASGRVAIDGTPVHRWRHRAPRELRTSVALIFQQPRLAVDPRLTLAEIIAEP
FT                   LRATGRPIGRAAELAEEMGLTPDLLDRRPHEVSDGQLQRACVARALTLRPRYLICDEMT
FT                   TMLDVSTQAHLVARIEAYRGATGAGVLAISHDRELLTRWCQGPERVHTWPPSA"
FT                   /protein_id="YP_003650930.1"
FT   gene            complement(352825..353805)
FT                   /db_xref="GeneID:9166783"
FT                   /locus_tag="Tbis_0307"
FT   CDS_pept        complement(352825..353805)
FT                   /locus_tag="Tbis_0307"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /codon_start="1"
FT                   /product="oligopeptide/dipeptide ABC transporter ATPase
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: azc:AZC_1983 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:296268299"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="GeneID:9166783"
FT                   /translation="MTTGAAAALGHAVTAQAARLRVAGLTVRFHLPGATVHAVTEAAFE
FT                   VEQGRCLALIGESGCGKSVMAHTLLGLLPGNATVTGSAWLEQPGRPPLDLIAAPERVLA
FT                   REVRGRRIGLIPQSPAAHLTPVRTARAQLTEALRELGGRYTADELAERAGLRPHELDRY
FT                   PHQLSGGMAQRVANAIALAGDPWLVIADEPTTGLDRPLVDATMAELRRLCDDGHAVLLI
FT                   THDLRAAEQVADDVAVMYAGRIVEIAPAADFFRAPRHPYAAGLLDALPTRAFTPIPGQP
FT                   PELTRLAGGCAFRPRCARADDACAVRPQITPDTPVACHHPLERHA"
FT                   /protein_id="YP_003650931.1"
FT   gene            complement(353840..354736)
FT                   /db_xref="GeneID:9166784"
FT                   /locus_tag="Tbis_0308"
FT   CDS_pept        complement(353840..354736)
FT                   /locus_tag="Tbis_0308"
FT                   /gene_family="HOG000171367" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transporter inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gbm:Gbem_2642
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:296268300"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9166784"
FT                   /translation="MRPETTTPMETAAPDLIHTSAAAGRSGRRSVRIAAATLALLGLAV
FT                   IVVPLVARVDERLVDLGSALLPPSPAHPFGTDEMGRDVLLRSVYGLRVSLLVGLVAAAV
FT                   SVVIGGLVGVIAGAAGGIVDRLLMRVVDGVNSLPHLLLGIFIVALFAPSVWAVIISVGV
FT                   THWTTAARIVRSEVLSLRGRPYIDAAINGGSSRMRIIRRHFVPALIPHLGLAAVLMVPH
FT                   AIWHETALSFLGLGLPPHLASLGNMINDGQRSLLTGAWWPSVFPGLFILIPTLAVAVLA
FT                   QYWRDRTSPRWRSELNL"
FT                   /protein_id="YP_003650932.1"
FT   gene            complement(354736..355725)
FT                   /db_xref="GeneID:9166785"
FT                   /locus_tag="Tbis_0309"
FT   CDS_pept        complement(354736..355725)
FT                   /locus_tag="Tbis_0309"
FT                   /gene_family="HOG000170243" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transporter inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcb:BCB4264_A0946
FT                   oligopeptide ABC transporter, permease protein"
FT                   /db_xref="GI:296268301"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9166785"
FT                   /translation="MSVAGALARLVAWRLAFLVPLLLVVTAGMFALAKASPFDPVRQYL
FT                   GERALVTSQEIQDQIRANWGLDRPLAEQYLTWLGGLLTGDLGESRSFHRPVAEVIGERL
FT                   GWTMLVAGAAVVLMLAMGLVLGTIAAYRRGTWVDRLITGVAYANEAAPVFWIGLIAIWI
FT                   FSVTLGWLPAGGLTDAGSAVVSPGEVARHMILPVGVLAVSQSSWLVLFVRESVIATLRE
FT                   DFVIGARARGLRERTVLVRHALRSALLPFLTLFGARIPELVTGAILVESVFSWPGVAGT
FT                   AVRAALAVDFPLLAALTLLATVAVVAGNLIADAAYVIADPRVRVLGVS"
FT                   /protein_id="YP_003650933.1"
FT   gene            complement(355722..357251)
FT                   /db_xref="GeneID:9166786"
FT                   /locus_tag="Tbis_0310"
FT   CDS_pept        complement(355722..357251)
FT                   /locus_tag="Tbis_0310"
FT                   /gene_family="HOG000164960" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: glo:Glov_2097 4-phytase"
FT                   /db_xref="GI:296268302"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="GeneID:9166786"
FT                   /translation="MLAACSAPAGAPADGDRDTFVLGLRSEFDTLNPVLGYAPDGGSLL
FT                   FDGLVTRAADLTLRPALAREIPEVDGTTVTFRLREGVTFHDGTPLTSEDVAFTYNAVLD
FT                   PANNSTIRGDYAAIERVEAPDPQTVIFHLKHPYAPILQRATLGIVPKRLLEGQDLDKAP
FT                   FNTKPVGTGPYRFVSWTPGDKIVLEANEDYWGGAPSIKRLVLAFVPDDNARATRMAAGE
FT                   LDATELPPKAAARFDGQDGITVHRVPSADYRAVMFPMKQPVTGDPAIRKAISAAVDRAA
FT                   MVTTILAGAGDPAFGPIAPGTKWHDPAVTGSPTADRERAVRILEEAGWKPGPDGIRVKD
FT                   GTPARFTLMYPANDSLRKELALAVASDAKRIGIDVQVAGLDWDAIEPRMAKDALIMGYG
FT                   SPYDPDYVNYELFHSSFSGQGFFNPGHFSDPRVDELLEKGRATADEGERKRIYGEFQRR
FT                   IRDQEAWTYLVYLQHVYVIRGEWTGIEPSVEAHEHATGGLFRNIHEWKRAA"
FT                   /protein_id="YP_003650934.1"
FT   gene            357496..358104
FT                   /db_xref="GeneID:9166787"
FT                   /locus_tag="Tbis_0311"
FT   CDS_pept        357496..358104
FT                   /locus_tag="Tbis_0311"
FT                   /gene_family="HOG000273990" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   transcriptional regulator protein"
FT                   /db_xref="GI:296268303"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:9166787"
FT                   /translation="MFKPVSTVEALAAALRERVLSGDISPGTPLTEQELSTRYGVARPT
FT                   VREALAVLVHEGLLRRERNRSAYVPEITPEDFADLMYVRLPLEELMARALVGRRVAEAE
FT                   AALDRMDALRPDAPWAAVVAEHMALHQALIDAVGSPRLARLYGSLAAETRLALVRLRHA
FT                   YPDRRELVAEHRALLQVIADGPEEAALRAVRDHLTWRES"
FT                   /protein_id="YP_003650935.1"
FT   gene            358089..358517
FT                   /db_xref="GeneID:9166788"
FT                   /locus_tag="Tbis_0312"
FT   CDS_pept        358089..358517
FT                   /locus_tag="Tbis_0312"
FT                   /gene_family="HOG000108968" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: reu:Reut_A0491 hypothetical protein"
FT                   /db_xref="GI:296268304"
FT                   /db_xref="GeneID:9166788"
FT                   /translation="MAGILNASCTRWPELDRIAPMHGDPVPDTYVYVTEEGVARHYADG
FT                   SVEALAWDDVVEVRVGPSRSSGDEGDVVIVLLDRAGEECVVPQSAVDASFVARLRYLPD
FT                   FDMERLSKAVERAGNGYDGYQVVWRSPHPPSMVDLDYD"
FT                   /protein_id="YP_003650936.1"
FT   gene            complement(358869..359930)
FT                   /db_xref="GeneID:9166789"
FT                   /locus_tag="Tbis_0313"
FT   CDS_pept        complement(358869..359930)
FT                   /locus_tag="Tbis_0313"
FT                   /gene_family="HOG000007084" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate protein domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: eba:ebA3150 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="GI:296268305"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="GeneID:9166789"
FT                   /translation="MVTESPNGKGLALIPRADGKLSLKDFKSDQEVRWCPGCGDYAILA
FT                   AVQSFLPELGIRRENIVFVSGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLAASRPDLS
FT                   VWVVTGDGDALSIGGNHLIHALRRNINLTILLFNNRIYGLTKGQYSPTSEQGKITKSTP
FT                   YGSLDRPFNPISLALGAEATFVARTIDSDRKHLQQVLRAAAEHRGAALVEIYQNCPIFN
FT                   DGAFDPLKTPGLREEITIRLEHGKPIVFGPQGQEKAVRLTSTGGVEVVPRDQVADHEIL
FT                   VHDAHNPDPSLAFALSRLDEPAFAHVPIGIFRSVDRPSYEQLMADQIDQAVTAKGTGDL
FT                   MALLHSGDTWEIS"
FT                   /protein_id="YP_003650937.1"
FT   gene            complement(359920..361764)
FT                   /db_xref="GeneID:9166790"
FT                   /locus_tag="Tbis_0314"
FT   CDS_pept        complement(359920..361764)
FT                   /locus_tag="Tbis_0314"
FT                   /gene_family="HOG000007072" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /codon_start="1"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: afw:Anae109_1891 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein"
FT                   /db_xref="GI:296268306"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="GeneID:9166790"
FT                   /translation="MAKRVQQLDRVIIRFAGDSGDGMQLTGDRFTSETARFGNDLSTLP
FT                   NFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLVAMNPAALKANLADLPPGAEI
FT                   IVNTDEFTPRNLQKVGYTANPLEDDSLSSWRVHKVPLTSLTLRALEGFDISKKDAERAK
FT                   NMFALGLLSWLYNRPTEGTIRFLEQKFANRPEIAKANIAAFNAGWNYGETTESFSVSYE
FT                   VKPAKLAPGVYRNISGNQALAWGLIAASELSGLPLFLGSYPITPASDILHELSRHKNFR
FT                   VRTFQAEDEIAGVGAALGASFGGALGVTTTSGPGMVLKSETIGLAVAVELPLVIVDVQR
FT                   AGPSTGMPTKTEQTDLLMALYGRNGESPVPVVAPATPSECFAMAIEAARIALAYRTPVM
FT                   LLSDAYLANGSEPWRIPTREELPDISVPFATEPNGDGGRFLPFARDPETLARPWAIPGT
FT                   PGLEHRVGGLEKSDRTGEISYDPDNHDAMVRLRRAKIDGIKVPDLQVDDPDGSAKVLVL
FT                   GWGSTYGAISAAVRRVRATGRKVAQAHLRHLNPLPANTGQVLRSYEKVLLPEINLGQLA
FT                   MVLRARYLVDVIGYNRVRGLPFKAEELAGVIQDVIDGD"
FT                   /protein_id="YP_003650938.1"
FT   gene            362150..362521
FT                   /db_xref="GeneID:9166791"
FT                   /locus_tag="Tbis_0315"
FT   CDS_pept        362150..362521
FT                   /locus_tag="Tbis_0315"
FT                   /gene_family="HOG000100120" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   subunit 3"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: bca:BCE_5425 NADH dehydrogenase subunit A"
FT                   /db_xref="GI:296268307"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="GeneID:9166791"
FT                   /translation="MNGYFGSYAVVLVLLGIGVAIVAGAMTVNRLLRPSRPTPEKLTTY
FT                   ECGVDPVGEGWAQSQIRYYVYAYLYVVFAVDAVFLFPWATVFSAPGYGLTTLVEMFVFL
FT                   GFIALGILYAWRKRVLTWT"
FT                   /protein_id="YP_003650939.1"
FT   gene            362573..363085
FT                   /db_xref="GeneID:9166792"
FT                   /locus_tag="Tbis_0316"
FT   CDS_pept        362573..363085
FT                   /locus_tag="Tbis_0316"
FT                   /gene_family="HOG000228250" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: gbm:Gbem_3925 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="GI:296268308"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="GeneID:9166792"
FT                   /translation="MAVRDLPTIGPAARLAPRPMKFVLNWGRRYSLWVFNFGLACCAIE
FT                   FIATSMSRHDFIRFGVIPFANGPRQADLMIVSGTVTDKMAPAVKRLYEQMPDPKYVISF
FT                   GACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPEALLHGILKLQEKIAGESLADR
FT                   YGPGEDA"
FT                   /product="NADH-quinone oxidoreductase subunit B"
FT                   /protein_id="YP_003650940.1"
FT   gene            363082..363726
FT                   /db_xref="GeneID:9166793"
FT                   /locus_tag="Tbis_0317"
FT   CDS_pept        363082..363726
FT                   /locus_tag="Tbis_0317"
FT                   /gene_family="HOG000009797" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /codon_start="1"
FT                   /product="NADH (or F420H2) dehydrogenase subunit C"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   mlo:mll1369 NADH dehydrogenase subunit C"
FT                   /db_xref="GI:296268309"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="GeneID:9166793"
FT                   /translation="MTADIGAAIRERFGSRAEISDAFGQVVADVAPEDWVEALAFARSC
FT                   GFEFFDWLTGVDDPPEAIQVVAHVVNLTGVRHLLVRTRVPRDDPRLPSVTGVFRGADWH
FT                   ERETYEMFGVVFEGHPDLRPLLLPDGFEGHPLRKDFVLAARVAKAWPGAKEPGESGHEP
FT                   PSRRRMLPPGVPADWAKPAPEPREPAAERPGGPAAGRSGAGDPGAQGEGDG"
FT                   /protein_id="YP_003650941.1"
FT   gene            363719..364672
FT                   /db_xref="GeneID:9166794"
FT                   /locus_tag="Tbis_0318"
FT   CDS_pept        363719..364672
FT                   /locus_tag="Tbis_0318"
FT                   /gene_family="HOG000228276" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: bcb:BCB4264_A5417 NADH dehydrogenase (ubiquinone),
FT                   H subunit"
FT                   /db_xref="GI:296268310"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="GeneID:9166794"
FT                   /translation="MADLLDIAVRLAVIVAAFLLLPLVVGQMEHKAMAHMQSRLGPMYA
FT                   GGFHGWAQLIADGIKFIQKEDVIPAAADRRVFALAPAVTLVPYLVVMVVIPIGPGLIGV
FT                   DLDAGLFFVLAVMGVGVLGSIMAGWASGNKFSLLGGIRSAAQLMSYELPLVLAASSVAM
FT                   AAGTLSLPGIVERWEWWWLPWQAIGAVVFFIAGLAELRRPPFDMPIAESELVMGPMTEY
FT                   TGLRFALFMLAEYAGIVVLSALTTVLFLGGWHGPLLPGPVWTLIKVFALAFVVIWVRVS
FT                   FPRLREDQLQRFAWTCLVPLALLQLALTGVVKIALG"
FT                   /product="NADH dehydrogenase"
FT                   /protein_id="YP_003650942.1"
FT   gene            complement(364988..365854)
FT                   /db_xref="GeneID:9166795"
FT                   /locus_tag="Tbis_0319"
FT   CDS_pept        complement(364988..365854)
FT                   /locus_tag="Tbis_0319"
FT                   /gene_family="HOG000106637" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GA26446 gene product from transcript GA26446-
FT                   RA"
FT                   /db_xref="GI:296268311"
FT                   /db_xref="GeneID:9166795"
FT                   /translation="MLIRSTGHALGRPGAAGPSVRPRQATPLVRIVRGMHGYQGPPSYH
FT                   PHGREPYPPPPPWPPGPHPAVPYAAPPQRRARDTVLRIVWTLIPLFTCGVATPFMLAYA
FT                   AARLRSRALAAATAGYGAGLVIWITVAGHYPAIPFWADALAVTGWLATWLGGTVHAFAL
FT                   RRRLFGPRPNTGERANEEAVAKAMFRRMLREKARELAERDPSLARELRIGRPDLPREYD
FT                   DGGVVDVNHAPASVIATLPGMTPHLAEEVVRVRERLGRFVSAEDVAVAVNLSPHVVPEL
FT                   AEYTVYL"
FT                   /protein_id="YP_003650943.1"
FT   gene            365973..366677
FT                   /db_xref="GeneID:9166796"
FT                   /locus_tag="Tbis_0320"
FT   CDS_pept        365973..366677
FT                   /locus_tag="Tbis_0320"
FT                   /gene_family="HOG000228289" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ank:AnaeK_1272 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="GI:296268312"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:9166796"
FT                   /translation="MMVRVAHIPGEGLAKGLGVTLRHMLRKSDTQQYPEVKPDLPPRSR
FT                   GVIALVEENCTVCMLCARECPDWCIYIDSHKETLPAPEGGRPRVRNVLDRFAIDFSLCM
FT                   YCGICVEVCPFDALFWSPEFEYAEYDIRDLLHEKDRLREWAATVPPPPPLEAGAEPPKE
FT                   LAASRAPRPAARPAPAARPERRGEPGAAPGGARAAEAGTPPRRKPPMTMRDIRAIRPPG
FT                   SLPKREGPKEEP"
FT                   /protein_id="YP_003650944.1"
FT   gene            366674..367204
FT                   /db_xref="GeneID:9166797"
FT                   /locus_tag="Tbis_0321"
FT   CDS_pept        366674..367204
FT                   /locus_tag="Tbis_0321"
FT                   /gene_family="HOG000262591" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   subunit 6"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: aba:Acid345_1292 NADH-
FT                   ubiquinone/plastoquinone oxidoreductase, chain 6"
FT                   /db_xref="GI:296268313"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="GeneID:9166797"
FT                   /translation="MTPGLWPPSGPEIVFLLLGLVALGSGVLVVTTKRLVHAALWLVVC
FT                   FGALAGCYLVLTAEFVAWVQVLIYVGAVVVLLLFGIMLTRAPTGRSEELDSGNRWAAAL
FT                   VALATAGVLVTVVISGFRDAYAPLEPGRGSAGEIGAGIFRTWVLPFEVLSLLLLAALIG
FT                   AIVISRTDITGRR"
FT                   /protein_id="YP_003650945.1"
FT   gene            367291..367632
FT                   /db_xref="GeneID:9166798"
FT                   /locus_tag="Tbis_0322"
FT   CDS_pept        367291..367632
FT                   /locus_tag="Tbis_0322"
FT                   /gene_family="HOG000066429" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone oxidoreductase subunit 4L"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   ank:AnaeK_4329 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="GI:296268314"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="GeneID:9166798"
FT                   /translation="MHVVYPVVLSALLFSIGVYGVLARRNAILVMLSIELMLNAVNLNL
FT                   VAFDIWAGDRLHSGQALALFVIVIAAAEVGLGLAIVLAVFRTRKTIDVDRLRALSERER
FT                   ADDDAEART"
FT                   /protein_id="YP_003650946.1"
FT   gene            367629..369509
FT                   /db_xref="GeneID:9166799"
FT                   /locus_tag="Tbis_0323"
FT   CDS_pept        367629..369509
FT                   /locus_tag="Tbis_0323"
FT                   /gene_family="HOG000100569" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: mca:MCA1349 NADH dehydrogenase I, L subunit;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="GI:296268315"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003916"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="GeneID:9166799"
FT                   /translation="MTAVLALIPGLPFAAAVAGLLGSRWPRGRAGRPDPAARRRAAWFA
FT                   IAPLTGSAVLTLWLAGALSRGTRTSEGFWAALLPGRVAGAYPVIDTGSLPITLSLQADG
FT                   LSVLTGGLVVVIALAVQVYSVGYMRDDPRYPSYTAFISLFTSAMLLVVYAGDLILLYVG
FT                   WEVMGLCSYLLIGHWWEDRANSRAAIKAFLVTRLGDVGFLFGIFTLGTAAGSFRIDDVL
FT                   RAGIPEGTLILGTLLLLAGVAGKSAQVPLQTWLPDAMAGPTPISALIHAATMVAAGIFV
FT                   IARLYPLFLGAGPTLDALAVIAALGMLGAALAALAQDDLKRVLAYSTISQLAVMAAALA
FT                   AGSDQAAIFHLLTHGGFKALLFLCAGVVIHHAGSNLLGRMGGLRTALPITFVTMTIGFA
FT                   ALAGLPPASGFFSKDAVLTAIADGRGALRPVLFASALLTAGVTGAYATRAWLRAFFGPA
FT                   RAEPGAGHPPESGGEAPGSMLWPLVALAVPSLLFGFALPAFGGAVHGETAALGQAAALL
FT                   GIGAVWWAWRRDPEQDPARLLGPLRGVCERGFHVDAVYAALVTRPVLRLAGGVGRADVR
FT                   VIDRAVRGAGGTVTAVSRLVRLAQTGNAQLYLTGLLAGALLIAVAAVMSG"
FT                   /product="proton-translocating NADH-quinone oxidoreductase
FT                   subunit L"
FT                   /protein_id="YP_003650947.1"
FT   gene            369506..371113
FT                   /db_xref="GeneID:9166800"
FT                   /locus_tag="Tbis_0324"
FT   CDS_pept        369506..371113
FT                   /locus_tag="Tbis_0324"
FT                   /gene_family="HOG000100683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /codon_start="1"
FT                   /EC_number="1.6.99.5"
FT                   /transl_table="11"
FT                   /note="KEGG: sme:SMa1536 NuoM2 NADH-
FT                   ubiquinone/plastoquinone (complex I) oxidoreductase;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="GI:296268316"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="GeneID:9166800"
FT                   /translation="MNWLLILLPALPLAGAAALATPAFRGRTGIGWGTGVSGLVLAGAV
FT                   AVAAAFDHRDAGRVQFEVDLPWVPALGVRFHLGVDGISLPLVVLTALLTFLCFVHLARH
FT                   RPEAGRPRALAFALLVLEVGMMGTFLALDLLLFFVFFEVVLVPMYFVIAIWGGDGRRAA
FT                   AVKFILYTLLGSALLLIGLLVVALQAGTLDMTALAERRGAGIPRAAQVVAFLAIGLGLA
FT                   VKTPMWPLHTWLPDAHTEAPTVGSVLLAGVLLKMGSYGFARIAIPALPEGAAAWAPWLG
FT                   AFAAIGIVYGALACLAQRDLKRLIAFSSVGHMGFVLLGLATLTPVGMNAALFGNIAHGL
FT                   ITGLLFFLAGAVKERYGTSDIARIGGGLLGRLPYLGSLLTFAGIASLGLPGLAGFWGEM
FT                   LALLGAFRPADALPRPLFLVFMVAGGVGAVLTAAYFLRMLSFVTHGRAIETVPVGPQLA
FT                   AVEERAGAAPPGEPPGAAAGPAGGRAFRRGRPADVTGHELAAWTPLVVLIVLLGLVPAI
FT                   LLSVTTPAVLAALTGVVP"
FT                   /product="proton-translocating NADH-quinone oxidoreductase
FT                   subunit M"
FT                   /protein_id="YP_003650948.1"
FT   gene            371110..372675
FT                   /db_xref="GeneID:9166801"
FT                   /locus_tag="Tbis_0325"
FT   CDS_pept        371110..372675
FT                   /locus_tag="Tbis_0325"
FT                   /gene_family="HOG000100794" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /codon_start="1"
FT                   /product="NADH/Ubiquinone/plastoquinone complex I"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: gbm:Gbem_3913 proton-translocating NADH- quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="GI:296268317"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="GeneID:9166801"
FT                   /translation="MILTLAVPPFASGPGGVIQSIDFAAIAVPLILACAAGLVLLLDAF
FT                   LPDRPGSGRAVGLVALGGVLAALAATAVQGAQGVERRTFCVPASLAADGAPPPCSFVAD
FT                   RFTLVFAAVVLAAGVVVVLLSMAELATGRVPVGEWYFLLLATLTGAVLLPASRDLITLV
FT                   VALEVVSLPVFALTALRRYDGRATEAALKLFLFSVVATAVTLFGASLLYGVTGSVFLDR
FT                   IALAQAGPGSPVTTVAIMLMLAGFAFKAAAVPFHSWAGDVYRGAPIPVAALLSVVSKAA
FT                   GFAGLILLLTTALGGRAATWAPVIAVVAALTMTVGNVLALRQRDAIRLLAWSSVAQSGY
FT                   ILAPLAAVPGPGGATAPGEPASAGSPVIGPAAGASIAYLIFYAAMNLIAFAVVMTVARR
FT                   EDGAELDGYRGLVRRSPVLGLGLAFSLISLAGLPPGLAGLFAKIVVFRAVLDGGLGWLA
FT                   VVVAVNTVIGLAYYLAWTARLFAPAAPEPGRTGPVPALVAVGLTVAVTLAFSVVPQAVL
FT                   ALAG"
FT                   /protein_id="YP_003650949.1"
FT   gene            372745..373593
FT                   /db_xref="GeneID:9166802"
FT                   /locus_tag="Tbis_0326"
FT   CDS_pept        372745..373593
FT                   /locus_tag="Tbis_0326"
FT                   /gene_family="HOG000227301" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /codon_start="1"
FT                   /product="peptidase M48 Ste24p"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: gbm:Gbem_3280
FT                   peptidase M48 Ste24p"
FT                   /db_xref="GI:296268318"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="GeneID:9166802"
FT                   /translation="MHHNGLRTAVLLGALSALLLAVGGWIGGGAGVRIAFVAALAVNGF
FT                   AYFFSDRIALSAMRARPVSEVEQPVLYRIVRSLSTEARRPMPRLYLSPTMQPNAFATGR
FT                   NPRNAAVCVTYGLLALLDERELRAVIGHELAHVYNRDILLSSVAGALATMITYVAQLGV
FT                   FFGSDDDETPGFFGTLLVMILGPVAATMIQLAISRSREFAADDLGARLTGDPLALASAL
FT                   RKIELGVRRIPLPENGRLASASHMMIANPFRGDGLGRLFSTHPPTAERIARLERMAGYR
FT                   R"
FT                   /protein_id="YP_003650950.1"
FT   gene            complement(373937..374677)
FT                   /db_xref="GeneID:9166803"
FT                   /locus_tag="Tbis_0327"
FT   CDS_pept        complement(373937..374677)
FT                   /locus_tag="Tbis_0327"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acr:Acry_0685 ABC transporter related"
FT                   /db_xref="GI:296268319"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9166803"
FT                   /translation="MSTVEIRNVHKSFGDLEVLRGIDFSVESGQVVCIIGPSGSGKSTL
FT                   LRCVNLLEQPTSGQVFVDGIELTDPDVDIDAARRRIGMVFQQFNLFPHLTVMRNITIAQ
FT                   ERVLKRSRAEAERIATENLKKVGLLEKAKAYPAQLSGGQQQRVAIARALAMNPSLMLFD
FT                   EPTSALDPELVGEVLSVMRQLAQDGMTMLVVTHEMSFAREVADRVVFMDHGVIVEDGPP
FT                   EQVIGNPKHERTREFLRRVLNPVG"
FT                   /protein_id="YP_003650951.1"
FT   gene            complement(374674..375507)
FT                   /db_xref="GeneID:9166804"
FT                   /locus_tag="Tbis_0328"
FT   CDS_pept        complement(374674..375507)
FT                   /locus_tag="Tbis_0328"
FT                   /gene_family="HOG000267552" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /codon_start="1"
FT                   /product="polar amino acid ABC transporter inner membrane
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: acr:Acry_0684 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="GI:296268320"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="GeneID:9166804"
FT                   /translation="MSSVTEQQQALRPRGGLSPRKKQRISRGIQYAVLVIVVVVLAAIA
FT                   DWPAISQSFLNMDVAREGLPELFTVALKNTVIYTITGYAFGFVLGLVLALMRLSSVGPY
FT                   RWIAATYIEIFRGLPALVIFLMIINLPLAFPGFRLPGDVYGQAALGLGLVSAAYMAETF
FT                   RAGLQAVPKGQMEAARSLGMPYMRAMVSIIIPQAVRIVIPPLTNELVLLFKDSSLVLFL
FT                   GVTASQAELAKFGNDEAATFANPTPIFVAGVTYLLITVPLGYLARRLEARQGGGR"
FT                   /protein_id="YP_003650952.1"
FT   gene            complement(375504..376352)
FT                   /db_xref="GeneID:9166805"
FT                   /locus_tag="Tbis_0329"
FT   CDS_pept        complement(375504..376352)
FT                   /locus_tag="Tbis_0329"
FT                   /gene_family="HOG000031895" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: acr:Acry_0683
FT                   extracellular solute-binding protein"
FT                   /db_xref="GI:296268321"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:9166805"
FT                   /translation="MAPWSTYRRVAGIGATALITALMVAACGGGGDTTASSPSEAASAA
FT                   GGVKLVNPGKLTTCTNIPYEPFQFQQGDKIVGFDVDIVDLVANKLGVQQEIVDIDFAAI
FT                   KSGAALNAGKCDVAAAGMTITEERKQNLDFSVPYFDASQALMAKKGSGVTSLDDVKAKG
FT                   LKLGAQASTTGLDYVKSQGFEPIEFADSQKQLNGLQAGRVDVIVQDLPVVLTWLKKPEI
FT                   SAEYEMVGSLDTGEQYGIGLKKGNTELLNVVNEVINQAKADGTYATIYKKWFGTEPPSN
FT                   S"
FT                   /protein_id="YP_003650953.1"
FT   gene            complement(376714..377235)
FT                   /db_xref="GeneID:9166806"
FT                   /locus_tag="Tbis_0330"
FT   CDS_pept        complement(376714..377235)
FT                   /locus_tag="Tbis_0330"
FT                   /gene_family="HOG000221455" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="MarR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: scl:sce6390 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:296268322"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="GeneID:9166806"
FT                   /translation="MPEHDTGDYAAFCAVEHQLGILFRRAQALSARMRSKVHPELEPGA
FT                   YGLLSSIDRNAPIRPSDLAACLGVGKATISRQVKVLEELGLVGREPDPLDRRAHRLVLT
FT                   PQGRQLLDRVRTARQQQLYSLLSSWPTEDVWLLARMLERFNALTERALLAEPAPGQEHA
FT                   EPDQARISPG"
FT                   /protein_id="YP_003650954.1"
FT   gene            complement(377448..379163)
FT                   /db_xref="GeneID:9166807"
FT                   /locus_tag="Tbis_0331"
FT   CDS_pept        complement(377448..379163)
FT                   /locus_tag="Tbis_0331"
FT                   /gene_family="HOG000239126" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /codon_start="1"
FT                   /product="EmrB/QacA subfamily drug resistance transporter"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_2480 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="GI:296268323"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:9166807"
FT                   /translation="MSHRQVLEALSGLLVAMFVAILSGTIVANALPTIAAELHADETVY
FT                   TWIITTTLLAVTVSTPLWGKLADLFNKKLLIQLSLVIFICGSMFAALTQNVGMLITARA
FT                   VQGIGVGGLTALSQVIMAAMIPPRERGRYSGYLGAVFAVGTVGGPLIGGVIVDTPWLGW
FT                   RWCFCVGVPFSLIAMLVLQRTLRLPTTKRAVKVDWLGALLITAAVSLLLIWVSFAGHDY
FT                   DWLSWQTAAMVGGSLVLGALFVLAERTAKEPILPLRLFAVRTISLSSFASLFIGAAMFG
FT                   SSTFLVQYFQLARGETPTVAGLLTLPMIIGLALSSTISGRIITRTGRWKGFLVAGAITL
FT                   AAGMGLMGTMRYDTAYWVLALFMFCTGVGVGMTQQNLVLAVQNQVRLADLGAASSLVAF
FT                   LRSMGGAVGVSVLGAVLSHRVGGYLREGLAALGVKAGATAMDGSIPDLSALPAPIRTVV
FT                   QSAFGHAIADLFLFSAPAVLVALLAIFLIKEVPLRTTIAHTAEREPAPSTNGFRPGNGA
FT                   QATAQPASADGIGPADGARPADGSRPANGTRPGSADGTGPGHHGEVTQGERRGR"
FT                   /protein_id="YP_003650955.1"
FT   gene            complement(380147..380638)
FT                   /db_xref="GeneID:9166808"
FT                   /locus_tag="Tbis_0332"
FT   CDS_pept        complement(380147..380638)
FT                   /locus_tag="Tbis_0332"
FT                   /gene_family="HOG000249184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04461"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   bha:BH2387 nucleotide-binding protein"
FT                   /db_xref="GI:296268324"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="GeneID:9166808"
FT                   /translation="MAEHSFDIVSKIDRQEVDNALNQAAKEIAHRFDFRGTGASVSWSG
FT                   KKEIEIKANSEERVKAALEVLKEKLIKRGQSLKILDAGEPKLSGKEYRLMVGLKEGIDQ
FT                   EHAKKISKIIRDEGPKGVKAQIQGDELRVSSKKKDDLQAVIALLKGKDLDIALQFTNYR
FT                   "
FT                   /protein_id="YP_003650956.1"
FT   gene            381051..381135
FT                   /note="tRNA-Tyr1"
FT                   /db_xref="GeneID:9166809"
FT                   /locus_tag="Tbis_R0008"
FT   tRNA            381051..381135
FT                   /db_xref="GeneID:9166809"
FT                   /locus_tag="Tbis_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            382067..382399
FT                   /db_xref="GeneID:9166810"
FT                   /locus_tag="Tbis_0333"
FT   CDS_pept        382067..382399
FT                   /locus_tag="Tbis_0333"
FT                   /gene_family="HOG000222826" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /codon_start="1"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   dvu:DVU0989 periplasmic divalent cation tolerance protein
FT                   CutA, putative"
FT                   /db_xref="GI:296268325"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="GeneID:9166810"
FT                   /translation="MGNEIEVRVTTSKRQEADQIVTAVVARRLAASAQVVAQVSSTYWW
FT                   EGEVQQAEEWLLLMKTTADRFDDLAACVRELHSYQVPQIVAVPIVRGTPDYLEWIRRET
FT                   DPGRGE"
FT                   /protein_id="YP_003650957.1"
FT   gene            complement(382365..383792)
FT                   /db_xref="GeneID:9166811"
FT                   /locus_tag="Tbis_0334"
FT   CDS_pept        complement(382365..383792)
FT                   /locus_tag="Tbis_0334"
FT                   /gene_family="HOG000159211" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="GI:296268326"
FT                   /db_xref="GeneID:9166811"
FT                   /translation="MLDALQKRNIGQVFRLIRQYAGVSQTRIGIAVNLSQGKVSEIMRG
FT                   SAQVTALDVFERIADGLRMPDSARLALGLAPRSPGRGQIIEAVLSRRAISSRDGAPAGQ
FT                   LLSVEGVLFGSRPSDDLWDVDLLTLAWVVGRLDSQMDRRTMLLLAAGMTVDTAASMADP
FT                   WKRLSRALRGPQMLDEETIERLEARTIGFHRLESVLPARAIYQGLTTHINELSTLLQSG
FT                   PPERYRRRLAATAGEAATLASWIAWDLKQPTQSAAFERVAALAAKESGHHIIQACTYAY
FT                   RSYAVTGPEAVEHIRRAQQFLPAEGDDATRAWLLAREAEELAALGDGQAVELLQRAEEA
FT                   HNQARPHRERAWTRFLDSGRMAAFQLSTYVRLGDEQRVTEASQAALAALGPDQDRKRVS
FT                   VVYADIAQAQLQLGDITEGVAYARRALEAAQRTESSWGMRHLAKIEKALAARPDQAARE
FT                   LLGDLRATRRALGQSPA"
FT                   /protein_id="YP_003650958.1"
FT   gene            384254..384499
FT                   /db_xref="GeneID:9166812"
FT                   /locus_tag="Tbis_0335"
FT   CDS_pept        384254..384499
FT                   /locus_tag="Tbis_0335"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268327"
FT                   /db_xref="GeneID:9166812"
FT                   /translation="MAADVHEGFGLALVSVWVDLVVWTDGRWFRWRSGRTSTSGRPVYA
FT                   FAPASDVVTAARRVAHRYGQLRQQYPPPPWLAGGSS"
FT                   /protein_id="YP_003650959.1"
FT   gene            384496..384789
FT                   /db_xref="GeneID:9166813"
FT                   /locus_tag="Tbis_0336"
FT   CDS_pept        384496..384789
FT                   /locus_tag="Tbis_0336"
FT                   /gene_family="HOG000109990" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268328"
FT                   /db_xref="GeneID:9166813"
FT                   /translation="MNVLDEPDRLHGAHVPIRRGSVRQLQWWEPTPAERVRVLAWTCDC
FT                   QARFYELCQSGGMVYIRRTVQKDPEPEISETHRWPVQEGWRVWFDLLTGEVR"
FT                   /protein_id="YP_003650960.1"
FT   gene            complement(384873..385190)
FT                   /db_xref="GeneID:9166814"
FT                   /locus_tag="Tbis_0337"
FT   CDS_pept        complement(384873..385190)
FT                   /locus_tag="Tbis_0337"
FT                   /gene_family="HOG000259573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="GntR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: acr:Acry_1750 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268329"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="GeneID:9166814"
FT                   /translation="MDFAPPKYARVIAAIQQRIRDGEYAPGDMLPSETQLVREFGVGRT
FT                   TVVRALQTLAMQGWIEREHGRGSFVKGRPPEPPADRARPLGVLGRSVLKRHQGPAINML
FT                   V"
FT                   /protein_id="YP_003650961.1"
FT   gene            complement(385288..385632)
FT                   /db_xref="GeneID:9166815"
FT                   /locus_tag="Tbis_0338"
FT   CDS_pept        complement(385288..385632)
FT                   /locus_tag="Tbis_0338"
FT                   /gene_family="HOG000109990" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268330"
FT                   /db_xref="GeneID:9166815"
FT                   /translation="MSGTTTTAAQTTGTTKSSKSAVPRVPCPAVHLPWREGAEELAWHE
FT                   SRRFARVRVVAWTCHEHRTTWYELCEAGGLAFIRRHDGRQAKPRVRESHAWPLAEARTM
FT                   WVALLSGQVR"
FT                   /protein_id="YP_003650962.1"
FT   gene            complement(385629..385985)
FT                   /db_xref="GeneID:9166816"
FT                   /locus_tag="Tbis_0339"
FT   CDS_pept        complement(385629..385985)
FT                   /locus_tag="Tbis_0339"
FT                   /gene_family="HOG000159118" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268331"
FT                   /db_xref="GeneID:9166816"
FT                   /translation="MTRRGHVAAALGLATSSREECLYCEGGELLAEMFDWEIFIPVDGV
FT                   DQLGPCGTSAWQATSMDALRAALRRMDPAAKPWGRIIHRFYDFGVLPDEWSRRVIFHAT
FT                   LDPAGSVRFERVGP"
FT                   /protein_id="YP_003650963.1"
FT   gene            386122..387378
FT                   /db_xref="GeneID:9166817"
FT                   /locus_tag="Tbis_0340"
FT   CDS_pept        386122..387378
FT                   /locus_tag="Tbis_0340"
FT                   /gene_family="HOG000109981" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /codon_start="1"
FT                   /product="tetratricopeptide domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: acr:Acry_1350
FT                   methyltransferase type 12"
FT                   /db_xref="GI:296268332"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="GeneID:9166817"
FT                   /translation="MHDHLKAKRRSEGMHGNAFEPIHIPIWVWGREETRQILKKRDMAG
FT                   LFNIALKYAGASQVRISAATGIAQGRISQIMRGQRQVTDLEVLERIATGLGLPDHARML
FT                   LGLAPLDLAFPTDDHDEEHRQQAEELRTRIEAAATVDATTVQILATDTNNLRLLDRRLG
FT                   GLAIADKMRAQISQIERVHRHAVRPGIRAQLAHVLSETAALAGWQALDRCALADAWDYH
FT                   ETAISAAREADDPALLAYARGQQAYVLIDLGRPAEAAELLHHVRHTYDRRVPGHLRTWL
FT                   AAAEAEAAAILGDEATTRTALDQAATLLPKEDADPSLPYVALNAHHLARWRGNCLVRFG
FT                   DPETIEDLRSALAGMDGTFNRAEAGLRCDLAHALLARGEAEAAQPHLYRAEHLAMMIGS
FT                   RRHGRRIAELKRAVTRALR"
FT                   /protein_id="YP_003650964.1"
FT   gene            complement(387359..387919)
FT                   /db_xref="GeneID:9166818"
FT                   /locus_tag="Tbis_0341"
FT   CDS_pept        complement(387359..387919)
FT                   /locus_tag="Tbis_0341"
FT                   /gene_family="HOG000045854" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: kpe:KPK_0067 putative
FT                   ADP-ribose pyrophosphatase"
FT                   /db_xref="GI:296268333"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="GeneID:9166818"
FT                   /translation="MATNEERSRWVVHGERLIYDNRWIRLGLVDVEIPGGERFEHHAVH
FT                   LGRAAMTVLVDDRDRVLMLWRHRFLFDRWGWELPGGLVEVGEDPMETAVREVVEETGYR
FT                   PVEIEHLITFQPMVGMVDSEHIVFLGRGAELIGEPTGEVEADLIEWIPLKALPDMIARG
FT                   DIWNSGSLVGLLYARERLNGARG"
FT                   /protein_id="YP_003650965.1"
FT   gene            388137..390849
FT                   /db_xref="GeneID:9166819"
FT                   /locus_tag="Tbis_0342"
FT                   /pseudo
FT   gene            391689..393137
FT                   /db_xref="GeneID:9166820"
FT                   /locus_tag="Tbis_0343"
FT   CDS_pept        391689..393137
FT                   /locus_tag="Tbis_0343"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /codon_start="1"
FT                   /product="beta-lactamase"
FT                   /transl_table="11"
FT                   /note="PFAM: beta-lactamase; KEGG: sus:Acid_2490
FT                   beta-lactamase"
FT                   /db_xref="GI:296268334"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="GeneID:9166820"
FT                   /translation="MPKCPKIVGLLMLGTALSSGTMPVGTPAAASTGGAAVTGLGSAHR
FT                   AARAGGHDDPRDGQWQSVRARERQQQNLLRDVTLALTPMQQSETDSRALPYNRQKTDAM
FT                   TESYSDQRGLSDITSRASGDQKNSPDTNPPVTAWAPSDNAAGAAMLAYLRDLAARNRFT
FT                   GSALVVRRGRVLARFAAGWADEEKRIPNRPDTVYRVMSITKQFTSMLVLKLRDRGLLEL
FT                   DDPICPYLVPKYLKTCPAAWRPITIRMTLTHTSGIPNIETLPGYLANVTRPTTVRKLIR
FT                   QFVNLPLDFKPGTSWKYTNSGYVLAGAIIQAVTHKPYGVVLRKLITKPLKLRHTGYSRT
FT                   YPPRGYAKGYVKPGSPAPLLNGSELFSATGLYTTVDDIVRWDRAFGSYTVAPPATVKQA
FT                   FTPQAKCPPNGCLNLPSSAYAFGWLVDRLQGHRLRYHPGLFMGYTAMNMYLPDDDIQVV
FT                   VLSNVQDTDTAGIARHLATLALDL"
FT                   /protein_id="YP_003650966.1"
FT   gene            complement(393268..393801)
FT                   /db_xref="GeneID:9166821"
FT                   /locus_tag="Tbis_0344"
FT   CDS_pept        complement(393268..393801)
FT                   /locus_tag="Tbis_0344"
FT                   /gene_family="HOG000078516" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sus:Acid_4614 GCN5-related N- acetyltransferase"
FT                   /db_xref="GI:296268335"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:9166821"
FT                   /translation="MSDSSDEPGAPSGILIRPMRETDAAQVLAIYQAGLDGGNAGFETT
FT                   APTWEAFDAAKLPRHRYVAADTASGQVVGWVAASAVSDRCVYAGVVEDSVYVHPDHGGR
FT                   GIGLALLNALIRSTEAEGIWTIQAGVFPENTASLRLHEKAGFRVVGTRHRIGRHHGRWR
FT                   DVILLERRSTVTGL"
FT                   /protein_id="YP_003650967.1"
FT   gene            complement(393843..394226)
FT                   /db_xref="GeneID:9166822"
FT                   /locus_tag="Tbis_0345"
FT   CDS_pept        complement(393843..394226)
FT                   /locus_tag="Tbis_0345"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: maq:Maqu_3638 regulatory protein, ArsR"
FT                   /db_xref="GI:296268336"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:9166822"
FT                   /translation="MSNQALSATDAYGDTPTTACCTPLACKPLSESEAAELAPLFKALA
FT                   DPVRLRLLSLIACHEAGETCVCDLTAAFDLTPPTISHHLRVLKQAGLIDSERRGTWVFY
FT                   WIKPEVLARMASLLSPAAPARTA"
FT                   /protein_id="YP_003650968.1"
FT   gene            394345..394782
FT                   /db_xref="GeneID:9166823"
FT                   /locus_tag="Tbis_0346"
FT   CDS_pept        394345..394782
FT                   /locus_tag="Tbis_0346"
FT                   /gene_family="HOG000050259" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: scl:sce5616 lactoylglutathione
FT                   lyase"
FT                   /db_xref="GI:296268337"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9166823"
FT                   /translation="MPRVQLALRVPDLEGSIEFYSKLFGVEPAKRRPGYVNFAIAEPPL
FT                   KLVLIQGEEGEPTRMDHLGVEVEDVAQVTAATERLKAAGLATLEEKDVACCYAVQDKVW
FT                   VRGPGNEPWEVYVVKADADTLTKQGGSACCAGDAGQETVSG"
FT                   /protein_id="YP_003650969.1"
FT   gene            complement(394945..395580)
FT                   /db_xref="GeneID:9166824"
FT                   /locus_tag="Tbis_0347"
FT   CDS_pept        complement(394945..395580)
FT                   /locus_tag="Tbis_0347"
FT                   /gene_family="HOG000099674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03596"
FT                   /codon_start="1"
FT                   /product="cadmium resistance transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: cadmium resistance transporter; KEGG:
FT                   quaternary amine transporter"
FT                   /db_xref="GI:296268338"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="GeneID:9166824"
FT                   /translation="MDGILGTVGTAGAVFAGTNVDDIVILTVLFLSARAHGLPRPWQII
FT                   AGQYTGIAVTVVVSVIAALGLAILPDPWVGLVGSLPLAMGVRGLIEAVRAKDPADGSPP
FT                   AVASGLLSVASITVANGADNISVYTPVFRTIGVSASLITIAVFAVLVAVWCLIGSWLGS
FT                   HKKIIEFVERYGRWLVPLVFIAIGLVIVLESGVISLLADLVRHLLEPV"
FT                   /protein_id="YP_003650970.1"
FT   gene            complement(395740..395871)
FT                   /db_xref="GeneID:9166825"
FT                   /locus_tag="Tbis_0348"
FT   CDS_pept        complement(395740..395871)
FT                   /locus_tag="Tbis_0348"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268339"
FT                   /db_xref="GeneID:9166825"
FT                   /translation="MPKASGGAVLEGVASARLPGEHANSGSLIGLRYARERLVGAGG"
FT                   /protein_id="YP_003650971.1"
FT   gene            396100..396936
FT                   /db_xref="GeneID:9166826"
FT                   /locus_tag="Tbis_0349"
FT   CDS_pept        396100..396936
FT                   /locus_tag="Tbis_0349"
FT                   /gene_family="HOG000253241" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pap:PSPA7_0575 hypothetical protein"
FT                   /db_xref="GI:296268340"
FT                   /db_xref="GeneID:9166826"
FT                   /translation="MRVTFASEPATPAHPNEDFVGATADAAVLLDGASAPAGVTSGCSH
FT                   GVRWYSHTLGALLLAELTESTEPLPEILARGIERVTSLHQDTCDLSRGDSPSATVVMLR
FT                   RTGDRVDWLVLCDSVLLLDTGAAEPTVVCDDRLNHLLKPSRDRVRALEPGTPEHAEAMR
FT                   EHVALVNECRNRDGGFWVASTDPRAAEEALTGSVPAEKVRAVALLSDGASRLVDRFHLA
FT                   TWREVVGMVDRYGPAELIRRVRRAERSDPDGKRWPRGKPSDDASAVYCTHLNGHRP"
FT                   /protein_id="YP_003650972.1"
FT   gene            397308..400376
FT                   /db_xref="GeneID:9166827"
FT                   /locus_tag="Tbis_0350"
FT   CDS_pept        397308..400376
FT                   /locus_tag="Tbis_0350"
FT                   /gene_family="HOG000180457" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce6752"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce6752 hypothetical protein"
FT                   /db_xref="GI:296268341"
FT                   /db_xref="GeneID:9166827"
FT                   /translation="MVTVTHSSGSDLQRIGSYIAAEPGPGRFPLVAGGKAAPLVVASAD
FT                   HRGVLRVVNDLQADIERVTGVRPAVVHDRVPDADEVVLIGTIGASPLIDRLIAEGRLDV
FT                   TGIAGRWETSLEQVIEDPLPGVRRAFVIAGSDQRGTIFGAYDVSREIGVSPWYWWADVP
FT                   VPHRDELYVLPGRHTQGTPKVKYRGFFINDENPALGTWAPAYFGPGYAPGHPGGFTSRF
FT                   YAKVYELMLRLKANYLWPAVWGRAFAEDDPDNHRVAAEYGVVIGTSHEAPMMRGIEEWN
FT                   RHAVPAQRDEAGYIVVPGHDPYDGTGEWSFRRNGEAIKRYWADGIRRMREEGFEGVVTL
FT                   GMRGNGDLSLPDGDGIDLMESILAAQREILARESGRDVTTIPQVFTLYKEVQRYWDKGL
FT                   RPPDDVTVIFCDDNWGNLRKVPDPKFPARSGGYGLYYHFDYVGDGRNYKWVDTVNLANT
FT                   WEQLHLAYRYGIDRLWVVNVGDLKGEELPLQFFLDYAWDPDRWPLERLGEWRRRYAAQN
FT                   FGPEHADEIAEILDRYGRLQSRRKPELTNRRITVDPAKDLATDPGAVVYDDEASPFRLT
FT                   AYREMDRVTAEWRRLAERAERVRAALPKEYDDAYYELVYYQVKATANLYELRRAQFLNR
FT                   HYAEQGRAAANDLADLAEERFAEDQAMSDYYNNELAGGKWRGFQTQPKIGYGDVARYGP
FT                   DAGWQQPERDNEALPDAIYPPLRRIELPEKAELGVAVDGSDSWWPHETSPATLPVFSPY
FT                   QTQPPQYIEVFNRGTVPFEYTIEPAVPWVTVTPAAGRVEKEVRAVVEVDWSRAPVGRTE
FT                   VPITISGAGTTVEVLAIVDNPALPRREFRGHVEANGYVAIEADHYTRAVNTDGITWTLI
FT                   PGIGRTGNGMTPFPVTAGRRTPGGDGPRLEYTVTLFTAGEVRVTAYLSPRNNVFATDGL
FT                   AYAISIDDAEPQIVNITKATGADDTAMNRQWQRNTSDNINVTTTVHTVGAPGVHTLKFW
FT                   MVDPTVVVQRLVVDTGGLLDSYLGPPESLRVAS"
FT                   /protein_id="YP_003650973.1"
FT   gene            complement(400337..400441)
FT                   /db_xref="GeneID:9166828"
FT                   /locus_tag="Tbis_0351"
FT   CDS_pept        complement(400337..400441)
FT                   /locus_tag="Tbis_0351"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268342"
FT                   /db_xref="GeneID:9166828"
FT                   /translation="MEAAAGDRLPREEAVTVAAVAGYDATRRLSGGPR"
FT                   /protein_id="YP_003650974.1"
FT   gene            complement(400569..401750)
FT                   /db_xref="GeneID:9166829"
FT                   /locus_tag="Tbis_0352"
FT   CDS_pept        complement(400569..401750)
FT                   /locus_tag="Tbis_0352"
FT                   /gene_family="HOG000020391" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01670"
FT                   /codon_start="1"
FT                   /product="family 12 glycoside hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 12; cellulose-
FT                   binding family II; SMART: cellulose-binding family II;
FT                   KEGG: endoglucanase, putative"
FT                   /db_xref="GI:296268343"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="GeneID:9166829"
FT                   /translation="MRPAAAPVMVHAMSMRRFLAGLTVLGSVAASLVIATSAAQADTVI
FT                   CEKWGTTTIQGGKYVVQNNNWGSDIQQCITVTDTGFTVSQANHNKPTNGAPGAYPSVFA
FT                   GCHYGTCSSGSRLPMQATDSLFDTIRTSVRMTYPSSGVYNASYDLWFDPTPRTDGQNTG
FT                   AEIMVWLNRVGSIQPIGSRVDTVNLAGATWEVWYGNTGWNVISYVRTTPVDSISFAVRE
FT                   FFDDAVRRGYAQRSWYLTSVQAGFEPWVGGTGLTVNEFSYSVGGSDPTEPSPPVTTSPP
FT                   ASPPPGGAACRVAYRKNEWLGGFTADVTVTNTGSSAINGWNLTFTFPSGQRVTNGWNAT
FT                   ISQSGATVTAQNMSYNASIPPGGSVSFGFQGTWTGSNGDPADFTLNGTRCQTA"
FT                   /protein_id="YP_003650975.1"
FT   gene            complement(401994..402341)
FT                   /db_xref="GeneID:9166830"
FT                   /locus_tag="Tbis_0353"
FT   CDS_pept        complement(401994..402341)
FT                   /locus_tag="Tbis_0353"
FT                   /gene_family="HOG000270156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /codon_start="1"
FT                   /product="anti-sigma-factor antagonist"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   swp:swp_1613 anti-anti-sigma factor family protein"
FT                   /db_xref="GI:296268344"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="GeneID:9166830"
FT                   /translation="MVTWTIHTPGSTQWTVLSLRGELDLYAVDELRRPVLTAIAAHGPW
FT                   LAVDLTAVNFIDTTGLGMLVRLLNKLREKNGDLALIGPRGQVKRILQWTNLNRLFPVFD
FT                   SAAAIPEPARN"
FT                   /protein_id="YP_003650976.1"
FT   gene            402853..403062
FT                   /db_xref="GeneID:9166831"
FT                   /locus_tag="Tbis_0354"
FT   CDS_pept        402853..403062
FT                   /locus_tag="Tbis_0354"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268345"
FT                   /db_xref="GeneID:9166831"
FT                   /translation="MRSRWIGPDGYEIVPARIGGRQVLRVQRYGDFVADCLSVEEVAQY
FT                   VDLADLCEVIPLPVRRDDTQTAVR"
FT                   /protein_id="YP_003650977.1"
FT   gene            403125..403571
FT                   /db_xref="GeneID:9166832"
FT                   /locus_tag="Tbis_0355"
FT   CDS_pept        403125..403571
FT                   /locus_tag="Tbis_0355"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268346"
FT                   /db_xref="GeneID:9166832"
FT                   /translation="MRLPLTACLMYRATLAVSMLGLGLTACASHRETPTTARPQVYVLN
FT                   FYGAEEGRAEQRPRDLVLSEFTTINAVTWQSWGPTRAVGRGKLSGMWCLPECGDAPYDA
FT                   TVTLGAVVPVRGKGYFSRYAVTARLPDDQRKRADLTGRLPIPGE"
FT                   /protein_id="YP_003650978.1"
FT   gene            403658..403730
FT                   /note="tRNA-Thr1"
FT                   /db_xref="GeneID:9166833"
FT                   /locus_tag="Tbis_R0009"
FT   tRNA            403658..403730
FT                   /db_xref="GeneID:9166833"
FT                   /locus_tag="Tbis_R0009"
FT                   /product="tRNA-Thr"
FT   gene            403886..403961
FT                   /note="tRNA-Met1"
FT                   /db_xref="GeneID:9166834"
FT                   /locus_tag="Tbis_R0010"
FT   tRNA            403886..403961
FT                   /db_xref="GeneID:9166834"
FT                   /locus_tag="Tbis_R0010"
FT                   /product="tRNA-Met"
FT   gene            404041..404205
FT                   /db_xref="GeneID:9166835"
FT                   /locus_tag="Tbis_0356"
FT   CDS_pept        404041..404205
FT                   /locus_tag="Tbis_0356"
FT                   /gene_family="HOG000004838" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L33"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: bcy:Bcer98_3067 50S ribosomal protein
FT                   L33"
FT                   /db_xref="GI:296268347"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="GeneID:9166835"
FT                   /translation="MASTDVRPKITLACQECKHRNYITRKNRRNDPDRLELKKYCPNCK
FT                   THRVHRETR"
FT                   /protein_id="YP_003650979.1"
FT   gene            404593..405042
FT                   /db_xref="GeneID:9166836"
FT                   /locus_tag="Tbis_0357"
FT   CDS_pept        404593..405042
FT                   /locus_tag="Tbis_0357"
FT                   /gene_family="HOG000249016" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="MaoC domain-containing protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mxa:MXAN_4673 MaoC domain protein"
FT                   /db_xref="GI:296268348"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:9166836"
FT                   /translation="MALNRDFIGRSGKSSAPYEVSRVKIKEFAEAIGDMNPIYHDREAA
FT                   IAAGHPDVVAPPTFPIVFSLAEAGKVLSDPELGLNYAMVVHGEQRFEYDRPIYAGDRLL
FT                   TTTTITEIRSVGRNEFVTLRSDITTVDGEPVCRAYCMLVEREGAA"
FT                   /protein_id="YP_003650980.1"
FT   gene            405045..405473
FT                   /db_xref="GeneID:9166837"
FT                   /locus_tag="Tbis_0358"
FT   CDS_pept        405045..405473
FT                   /locus_tag="Tbis_0358"
FT                   /gene_family="HOG000242266" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="MaoC domain-containing protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mxa:MXAN_4672 MaoC domain protein"
FT                   /db_xref="GI:296268349"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="GeneID:9166837"
FT                   /translation="MTAKVKYDEVEVGQEIPAAGYRVRRLDLVKYAGASGDFNPIHWNE
FT                   RYAKSVGLPDVIAHGMYTMAQGGRFLTDWAGDPAAVVEYGVRFSSMVVVPDDEEGATVT
FT                   VSGRIEEKLPDNRVVVALTATSNGSRVLSKARAVVRLA"
FT                   /protein_id="YP_003650981.1"
FT   gene            405548..406597
FT                   /db_xref="GeneID:9166838"
FT                   /locus_tag="Tbis_0359"
FT   CDS_pept        405548..406597
FT                   /locus_tag="Tbis_0359"
FT                   /gene_family="HOG000284356" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.158"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce7823 UDP-N-acetylmuramate
FT                   dehydrogenase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase domain protein; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="GI:296268350"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="GeneID:9166838"
FT                   /translation="MTDRLAGVRLAPYTTLRVGGPARAFAEAGSAEELIGLVAGADRDG
FT                   EPVLVLGGGSNLVVADEGFAGLVVRVRSRGVAVSAEGERVVVTAEAGEDWDALVARCVA
FT                   EGLAGIECLSGIPGLAGATPIQNVGAYGQEVAQTITSVRVYDRRAGATTVLTPEECRFG
FT                   YRHSLFKEDPGRYVVLSVSYALTRSRLSTPIAYRELAAALGVEQGERAPLAEVRAAVLE
FT                   LRRRKGMVLDPGDPDTRSAGSFFTNPILTREQAAELELRAPGFPRWDMPDGTVKVPAAW
FT                   LIENAGFPKGYARGRARISTKHTLAITNPSGEATAREVLALAREIRAGVQEKFGVELVN
FT                   EPVMVGISL"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /protein_id="YP_003650982.1"
FT   gene            406843..407400
FT                   /db_xref="GeneID:9166839"
FT                   /locus_tag="Tbis_0360"
FT   CDS_pept        406843..407400
FT                   /locus_tag="Tbis_0360"
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   sat:SYN_01349 hypothetical protein"
FT                   /db_xref="GI:296268351"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="GeneID:9166839"
FT                   /translation="MQAFWTSLAVIFVAELGDKSQLMAMTFATRFRALTVLTGITLATL
FT                   LVHLVSVVFGRAVGDALPEGLISVIAGLAFLGFALWTLRGDELSEEEKSKAATVTRNAL
FT                   IAVTVAFFLSELGDKTMLATITLATQHGWFGTWIGSTLGMVAADAVAILVGRYLGTALP
FT                   EKWIKYGAAAAFAVFGVLLLIG"
FT                   /protein_id="YP_003650983.1"
FT   gene            complement(407496..410417)
FT                   /db_xref="GeneID:9166840"
FT                   /locus_tag="Tbis_0361"
FT   CDS_pept        complement(407496..410417)
FT                   /locus_tag="Tbis_0361"
FT                   /gene_family="HOG000224039" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /codon_start="1"
FT                   /product="LuxR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein LuxR; TPR repeat-
FT                   containing protein; Tetratricopeptide TPR_4; Bacterio-
FT                   opsin activator HTH domain protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: regulatory protein LuxR;
FT                   Tetratricopeptide domain protein; KEGG: rle:pRL120769
FT                   putative transcriptional regulator"
FT                   /db_xref="GI:296268352"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="GeneID:9166840"
FT                   /translation="MLVPMTRRPVSPAFVGRDAELESLRDAFDQARKRATTTVLIGGEA
FT                   GVGKTRLLARFAEEAGLDGAHVLIGGCVELSAEGLAYAPFIAVLRQLVRELSAAEVTAL
FT                   LPDGAARDLARLLPEFGEPNADGDTESARIRLFELILILVERLAERRPVLLAIEDVHWA
FT                   DRSSRDLIAFLSRNLTAAPVLMVLTYRSDELHRTHPLRPVLAELGRLGSVVRIELPRFT
FT                   RHEVALQVAGILGTTPEYDRVTTIFERSGGIPLFVEALLEAGEDCAVPESLHDLILRPV
FT                   DRLPERTQQVLRIAAAGGVRVGHDLLAAVSGLSDAELEDALRPAIAANVLQVADGRAYA
FT                   FRHALIREAVHDELLPGEHARLHARYAEEIGNDHALVPPGRAAFEIAHHWYAARNDLWA
FT                   LISAWEAAEAAHRSFAYTEQAQFLDRVLALWDKVPDAAERIGADHVGVLERAAEAAFVS
FT                   GDMERGLRYVKAALAELDEKTAPERVAELLVRRANINFQRGRPGALDDLRRAERLVPEP
FT                   SDTRTTVLLRLGYVLLLNGQVTEGTKATQEALEIARRKGDERNEADLVLNLSLGHWLAG
FT                   DLEQARVLDDRAISLGKRLNFPLVVLRALANKIDTLDNLGRSEEAVALADEGERLARQY
FT                   GRYRHQGVFIANNRAEALVSLGRWDEAVEVVERALAMDPAPRVRAHCLRVRTDIAIARG
FT                   EQDVARAGLAELRALTDVQAEGVQELANNTRLLICWHLLMGEPLRAIEVAERLFDAPLR
FT                   NKPLLAWRLSATIRYACEAAAAVAPERAAALRARVAELSYGDRPVEGHGPVCEAYRHVA
FT                   RGSFDTAAEMWRRLNRPYERALALVHAAQTVVASGDREGVAVRLREAHPIATQLGAAPL
FT                   AARIETLARRHQIPLGRPGTARAGSAGPGTAGAGSAGGVALTPREREVLRLVAAGRTNR
FT                   EIAAELFISAKTVSVHVSNILAKLGAATRGEAAAAAHRLSLLD"
FT                   /protein_id="YP_003650984.1"
FT   gene            complement(410570..410755)
FT                   /db_xref="GeneID:9166841"
FT                   /locus_tag="Tbis_0362"
FT   CDS_pept        complement(410570..410755)
FT                   /locus_tag="Tbis_0362"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268353"
FT                   /db_xref="GeneID:9166841"
FT                   /translation="MFPELQYQLVLMHMDELRDEALGEARARKARRSRKRNEDEEAEPV
FT                   GRRRAPRIALRGRQWS"
FT                   /protein_id="YP_003650985.1"
FT   gene            411275..412216
FT                   /db_xref="GeneID:9166842"
FT                   /locus_tag="Tbis_0363"
FT   CDS_pept        411275..412216
FT                   /locus_tag="Tbis_0363"
FT                   /gene_family="HOG000241644" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /codon_start="1"
FT                   /EC_number="4.1.2.4"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce5008 putative deoxyribose-phosphate
FT                   aldolase; TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="GI:296268354"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="GeneID:9166842"
FT                   /translation="MTAPLAEVAASNASLRAFLHGLPGVDRVGAEARAAMLGTRSIKTT
FT                   AKKHAIDLAIRMLDLTTLEGADTPGKVRAMCAKAVRPDPSDPDAPSVAAVCVYPDLVPV
FT                   AVAALQGTGVKVASVATAFPSGRSSLNVKVAETEYAVAAGASEVDMVIDRGAFLAGDYL
FT                   KVYEEIAAVKAACAGRAHLKVILETGELATYDNVRRASWLAMLAGADFIKTSTGKVSPA
FT                   ATPAVTLIMLEAVRGYLKATGRRVGVKPAGGIRTTKDAIKYLVLVNETAGPDWLDPEWF
FT                   RLGASSLLNDLLMQRQKLATGRYAGPDYFTLD"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /protein_id="YP_003650986.1"
FT   gene            412221..413657
FT                   /db_xref="GeneID:9166843"
FT                   /locus_tag="Tbis_0364"
FT   CDS_pept        412221..413657
FT                   /locus_tag="Tbis_0364"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="1.2.1.8"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: scl:sce5007
FT                   putative aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="GI:296268355"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="GeneID:9166843"
FT                   /translation="MFEYAPAPESRDIVDIQPSYGLFINGEWVEPHSEERHPTVNPATE
FT                   EPLSEIAWADEADVDRAVETARKAFVTWSAMRGAERAKYLFRIARIIQERARELAVLET
FT                   LDNGKPIRESRDVDLPLVAAHFFYYAGWADKLAYAGLGRPGREPRPIGVAGQVIPWNFP
FT                   LLMLAWKVAPALACGNTVVLKPAETTPLTALAFADICRQADLPPGVVNIVTGAGETGAA
FT                   LVRHPGVDKVAFTGSTEVGKLIAKAVAGTGKRLTLELGGKAANIVFDDAPIDQAVEGIV
FT                   NGIFFNQGHVCCAGSRLLVQESIADELIEALKRRIALLRVGDPLDKNTDIGAINSAEQL
FT                   AKIRELAESGEAEGAERWSPPCTLPDRGYWFPPTVFTNVAQSHRIAREEIFGPVLSVLT
FT                   FRTPAEAVEKANNTPYGLSAGVWTEKGSLMLWMASRLRAGVVWSNTYNRFDPASPFGGY
FT                   KESGYGREGGRHGLEEYLAL"
FT                   /product="betaine-aldehyde dehydrogenase"
FT                   /protein_id="YP_003650987.1"
FT   gene            413828..414694
FT                   /db_xref="GeneID:9166844"
FT                   /locus_tag="Tbis_0365"
FT   CDS_pept        413828..414694
FT                   /locus_tag="Tbis_0365"
FT                   /gene_family="HOG000223969" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /codon_start="1"
FT                   /product="aldehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: scl:sce5006
FT                   putative aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="GI:296268356"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="GeneID:9166844"
FT                   /translation="MTERLAVRKTYKLFIGGAFPRSESGRSYVVHSSSGEFLANAAKAS
FT                   RKDARDAVVAARKAFPGWWGATPYNRGQIIYRAAEMLEGRRAQFAAETAALEGIDLERA
FT                   GELVDAAVDRLVWYAGWSDKIAAVLGSANPVAGPYFNLSSPEPAGVVAVIAPQTASLLA
FT                   LVSVIAPVIVTGNTCVVVAAERAPLPAITFAEVLATSDLPGGVVNILTGSTEELAPWLA
FT                   GHMDVNAIDLTGAGPELAVRCEELAAENLKRVLRPPAMPIDWSADPGIERMAAFLEIKT
FT                   VWHPMGA"
FT                   /protein_id="YP_003650988.1"
FT   gene            complement(414906..415484)
FT                   /db_xref="GeneID:9166845"
FT                   /locus_tag="Tbis_0366"
FT   CDS_pept        complement(414906..415484)
FT                   /locus_tag="Tbis_0366"
FT                   /gene_family="HOG000253643" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_6981 hypothetical protein"
FT                   /db_xref="GI:296268357"
FT                   /db_xref="GeneID:9166845"
FT                   /translation="MELAALQEQTRLLLRQKITVMVNQYTVHLAEPDGTPGPVVAFAEQ
FT                   KRLALKEQVTVYTDESRSRVLTGFKARTVVDFAGEYDVVDEAGKPIGKFWKRGMRSLLR
FT                   STWHLQQPGLPTLTGQERNPVVAVLRRFVDALSWLPYHFDFSIGASIAFSVDSRWGIRD
FT                   TYLINVRDPRLDRRLVIAMAIALDALEGR"
FT                   /protein_id="YP_003650989.1"
FT   gene            415692..415904
FT                   /db_xref="GeneID:9166846"
FT                   /locus_tag="Tbis_0367"
FT   CDS_pept        415692..415904
FT                   /locus_tag="Tbis_0367"
FT                   /gene_family="HOG000073247" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /codon_start="1"
FT                   /product="phage shock protein C"
FT                   /transl_table="11"
FT                   /note="PFAM: PspC domain protein; KEGG: hne:HNE_3296 phage
FT                   shock protein C"
FT                   /db_xref="GI:296268358"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="GeneID:9166846"
FT                   /translation="MVYRSREHKIIAGVCGGIAERFGMRPTTVRLLFLLSCILPGPQFV
FT                   IYLLLWILLPKAPPTYAPPYHGRHW"
FT                   /protein_id="YP_003650990.1"
FT   gene            416018..416656
FT                   /db_xref="GeneID:9166847"
FT                   /locus_tag="Tbis_0368"
FT   CDS_pept        416018..416656
FT                   /locus_tag="Tbis_0368"
FT                   /gene_family="HOG000194322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.181"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_4305 lipoate-protein ligase B;
FT                   TIGRFAM: lipoate-protein ligase B; PFAM: biotin/lipoate A/B
FT                   protein ligase"
FT                   /db_xref="GI:296268359"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="GeneID:9166847"
FT                   /translation="MFQPRPLALIQDDLVEYEKAMERMAAMVEERQKDERPDTLWLLSH
FT                   PPVFTVGKRTRAEHLPDPSFGIPVVPTNRGGQLTYHGPGQLVGYLIVRLRPGEGIVDYI
FT                   REVELRLVEALRRLGVPAERRDTPPGSELLTGVWTTNTNRKIVSIGMRSSRSVTSHGFA
FT                   LNVDGDLTPWTLAVPCGMPDVEMTSILRELGHASMEETRRVVAEVFEAS"
FT                   /product="lipoate-protein ligase B"
FT                   /protein_id="YP_003650991.1"
FT   gene            416753..417523
FT                   /db_xref="GeneID:9166848"
FT                   /locus_tag="Tbis_0369"
FT   CDS_pept        416753..417523
FT                   /locus_tag="Tbis_0369"
FT                   /gene_family="HOG000068665" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ade:Adeh_0783 hypothetical protein"
FT                   /db_xref="GI:296268360"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="GeneID:9166848"
FT                   /translation="MPILVGTSGWQYDSWSGLLYPGVPRRLWLERYAEAFATVENNNAF
FT                   YRLPKRETFEAWRERTPADFVMAVKASRFLTHIKRLKDPEEPVDRLMGVAAGLGGKLGP
FT                   ILLQLPPTLEAEPERLRRCLARFPDGVRIAVEPRHASWWSGEVRDLLTGYGAALCWADR
FT                   LGRPVGPLWRTTDWVYLRFHEGAGRDWPHYGERALRSWVDRLGGVADAYVYFNNDPGGA
FT                   AVRNAIDFAGYARAAGYAVTRARLPERPPAASPV"
FT                   /protein_id="YP_003650992.1"
FT   gene            417875..418804
FT                   /db_xref="GeneID:9166849"
FT                   /locus_tag="Tbis_0370"
FT   CDS_pept        417875..418804
FT                   /locus_tag="Tbis_0370"
FT                   /gene_family="HOG000180308" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   mpo:Mpop_2998 periplasmic solute binding protein"
FT                   /db_xref="GI:296268361"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="GeneID:9166849"
FT                   /translation="MLSLISRSLCIALLVLTAVACGGASGPPSADGSRLNVVATTTQVA
FT                   DFAANIGGDKVRVHGLLKPNVDPHDYEPTPLDMRMLAEADVVVKNGVGFEKWLDQAIEA
FT                   SGFRGTLVDASQGVRLRTGEGASADPHIWHDPRNAKTMAANIARAFAAADAANAAVYEQ
FT                   NLAAYQARLDELDAEIEKKIQSIPEDRRKLVTDHDTFGYYADRYGLTVVGSVIPSFDTS
FT                   AELSAKQITDLVARIKAAGVTAIFSEASLPPKTAEAIGREAGVRVVAGEDALYGDSLGP
FT                   EGSAGATYLQMMRHNTDTIVAALGGAAT"
FT                   /protein_id="YP_003650993.1"
FT   gene            418801..419571
FT                   /db_xref="GeneID:9166850"
FT                   /locus_tag="Tbis_0371"
FT   CDS_pept        418801..419571
FT                   /locus_tag="Tbis_0371"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mes:Meso_2852 ABC transporter related"
FT                   /db_xref="GI:296268362"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9166850"
FT                   /translation="MTERPPSTPALILDRVSVAYGDVPVLEDVTGTVNPGESVALIGPN
FT                   GAGKSTLIKAVLGMVPVVRGRIEVLGGPPAQARRHVAYVPQADTLDPDFPISVEQVVLM
FT                   GRYRWMGRFRRASRADREEVAAALEAVGLADRARDRFGTLSGGQRQRVLLARAIAARPR
FT                   LLLLDEPFNGVDAVSQHALLEALAGLKAQGTAVVVSTHDLAIAHLACEEVCLINRHQFG
FT                   FGPTGEVLTPERLRATYGGRALELRGDRVIVGQT"
FT                   /protein_id="YP_003650994.1"
FT   gene            419568..420440
FT                   /db_xref="GeneID:9166851"
FT                   /locus_tag="Tbis_0372"
FT   CDS_pept        419568..420440
FT                   /locus_tag="Tbis_0372"
FT                   /gene_family="HOG000181428" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /codon_start="1"
FT                   /product="ABC transporter protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: bha:BH1390 hypothetical protein"
FT                   /db_xref="GI:296268363"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:9166851"
FT                   /translation="MSLIEPFQTPFMARALAELIILGVLGGTVGVVVLLRRLAFLSDAL
FT                   SHTIFPGVVAGYLLAGEDGVFWGALAAGIATAALLTLLTRRVAQDAALALLLTTLFAAG
FT                   VVLVSRRSGYASDLTAFLFGRVLTVTPEQLWQTAAVAAVVIALLAALRRPLLLRAFDPV
FT                   GAEAAGVRVGLLDLVVNVAVALTVVAAVRAVGMVLVIALLIVPAAAARVLSDRLTVIVP
FT                   LACLIGAAGGWLGLVVSWEASIGYGLRLASGGTVVLVLVAMYGLAQAAGLVRRRVRLGR
FT                   ARTGLEAVQ"
FT                   /protein_id="YP_003650995.1"
FT   gene            420437..421267
FT                   /db_xref="GeneID:9166852"
FT                   /locus_tag="Tbis_0373"
FT   CDS_pept        420437..421267
FT                   /locus_tag="Tbis_0373"
FT                   /gene_family="HOG000181428" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /codon_start="1"
FT                   /product="ABC transporter protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: bha:BH1390 hypothetical protein"
FT                   /db_xref="GI:296268364"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:9166852"
FT                   /translation="MTWFDSSVHRALAEAVLVGALGGVVGVHVLIRRLPFFTMALTHAT
FT                   FPGIVIAALLGADLYLGGGVFGLLITLAVVLFSRVRGQDFTAATGIALAGGFALGVVLV
FT                   SAQDGFAKDLTAYTVGDILAVSARDLAITAGIAAAVTLLLVVFRRELLITAFDPVGAAA
FT                   LGLRTALIDFILLAAVVVTVVATVPALGVILTVALLVGPAATARLLTDRYALLFPISAA
FT                   IGVSCGVAGVWLSTVWNVAAGASIALLVGVVFGLVFLGSHGAALVRRRAAARPL"
FT                   /protein_id="YP_003650996.1"
FT   gene            complement(421308..422108)
FT                   /db_xref="GeneID:9166853"
FT                   /locus_tag="Tbis_0374"
FT   CDS_pept        complement(421308..422108)
FT                   /locus_tag="Tbis_0374"
FT                   /gene_family="HOG000253172" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   mxa:MXAN_2293 hypothetical protein"
FT                   /db_xref="GI:296268365"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="GeneID:9166853"
FT                   /translation="MEKIPPGIDPSVPSPARIYDYLLGGKDNFASDREAAAKLIQAAPN
FT                   AQEEVRANRRFLIRAVEYLADQGIRQFLDIGTGLPTQENVHEVALRKAPDSRIVYVDND
FT                   PIVLAHARALLGRNPQVAVAQGDLREPESILDNPEVTEHLDFNEPVGLLLVAILHFLPD
FT                   EAAYPAVAKLRDRLAPGSHLVISHGSAGRLDDKGVAAIRRVYARSSAGEAVARTREEIL
FT                   RFFEGCELVEPGVVTVDEWRPREGEPVRTRTEGAVVYGGVGVVG"
FT                   /protein_id="YP_003650997.1"
FT   gene            complement(422407..423207)
FT                   /db_xref="GeneID:9166854"
FT                   /locus_tag="Tbis_0375"
FT   CDS_pept        complement(422407..423207)
FT                   /locus_tag="Tbis_0375"
FT                   /gene_family="HOG000253172" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="GI:296268366"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="GeneID:9166854"
FT                   /translation="MEQVPPGIDPDVPSAARIYDFFLGGKENFAVDRAVAQKLLELSPN
FT                   IKESARANRRFLVRAVEYLADQGIRQFLDIGAGLPTQENVHEVALRKAPDSRIVYVDND
FT                   PIVLAHARALLACNAQTIAVAGDLREPESILDNPEVTAHLDFNEPVGLLLVSILHFIPD
FT                   EAAYPAVAKLRDRLAPGSHLVISHVSAGDLDERTLEKGRRIYTQSQAGVAVPRSREDIA
FT                   RFFDGFELVEPGLVRIREWRPRKDEVIMPGLPGVGGFAGVGVLR"
FT                   /protein_id="YP_003650998.1"
FT   gene            complement(423504..424304)
FT                   /db_xref="GeneID:9166855"
FT                   /locus_tag="Tbis_0376"
FT   CDS_pept        complement(423504..424304)
FT                   /locus_tag="Tbis_0376"
FT                   /gene_family="HOG000253172" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="GI:296268367"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="GeneID:9166855"
FT                   /translation="MDKFPQGVDPNVPSPARIYDYLLGGKDNFAVDRAAAEKILEHAPN
FT                   AKEAAQANRRFLIRAVEYLADQGIRQFLDIGAGLPTQENVHEVALRKAPGSRIVYVDND
FT                   PIVLAHARALLACDAQTIAVAGDLREPESILDNPEVTAHLDFNEPVGLILVAILHFIPD
FT                   EAAYPAVAKLRDRLAPGSHLVISHASMGQIDEKGLAEVKQIYARSSAGSAIPRTREEIE
FT                   RFFDGFEVVEPGLVWVEDWRPRDDEVKLPRLPGVDGYAGVGILR"
FT                   /protein_id="YP_003650999.1"
FT   gene            complement(424625..425425)
FT                   /db_xref="GeneID:9166856"
FT                   /locus_tag="Tbis_0377"
FT   CDS_pept        complement(424625..425425)
FT                   /locus_tag="Tbis_0377"
FT                   /gene_family="HOG000253172" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="GI:296268368"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="GeneID:9166856"
FT                   /translation="MDKVPPKIDPTVPSPARIYDYLLGGKDNFASDRAAAEKVLQLSPN
FT                   AREVARANRRFLIRAVEYMTQQGIRQFLDIGTGLPTQENVHQVALRHAPDSRVVYVDND
FT                   PIVLVHARALLADEKRVVAVEGDLRRPESILDNPQVTKHIDLGQPVGLLLVAVLHFIPD
FT                   EAAYPAVAKLRDRLAPGSHLAISHISAEDLDEKTVQEGKQVYAKSSAGALVPRSRGDIQ
FT                   RFFGEYGLVEPGLVWPDDWRRTEGEDRIPRMQGSDCYAGVAIVR"
FT                   /protein_id="YP_003651000.1"
FT   gene            complement(425934..426749)
FT                   /db_xref="GeneID:9166857"
FT                   /locus_tag="Tbis_0378"
FT   CDS_pept        complement(425934..426749)
FT                   /locus_tag="Tbis_0378"
FT                   /gene_family="HOG000253172" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   mxa:MXAN_2293 hypothetical protein"
FT                   /db_xref="GI:296268369"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="GeneID:9166857"
FT                   /translation="MGCRMENAPQIDPTVPSPARIYDYLLGGKDNFPADREAAENLLRL
FT                   SPNLKEGAQANRRFLIRAVEYMTQQGIRQFLDIGAGLPTQENVHQVALRHAPDSRVVYV
FT                   DNDPIVLTHARALLADEKRVVAVEGDLRRPESILDNPEVTQHIDFGQPVGLLLVAVLHF
FT                   IPDEAAYPAVAKLRDRLAPGSHLVISHGSVSRDLNEDVIEKGKEIYARSSAGMAIPRSR
FT                   EEILRFFDGFELVEPGLVPWPDDWRPREDEVRLPRLPGVDSYAGVGILR"
FT                   /protein_id="YP_003651001.1"
FT   gene            426902..427018
FT                   /db_xref="GeneID:9166858"
FT                   /locus_tag="Tbis_0379"
FT                   /pseudo
FT   gene            complement(427270..427617)
FT                   /db_xref="GeneID:9166859"
FT                   /locus_tag="Tbis_0380"
FT   CDS_pept        complement(427270..427617)
FT                   /locus_tag="Tbis_0380"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00418"
FT                   /codon_start="1"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="SMART: regulatory protein ArsR; KEGG:
FT                   transcriptional regulator ArsR family"
FT                   /db_xref="GI:296268370"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:9166859"
FT                   /translation="MPSAAPGRVLEHPKPEEIRLEAVLHALADPVRLQVVRRLAELGTE
FT                   APCSAIELAVSKSTSTYHFRVLREAGVITQVYRGTAKMNALRRDDLDRLFPGLLDAVLA
FT                   ADAAQRRRTGA"
FT                   /protein_id="YP_003651002.1"
FT   gene            427747..428835
FT                   /db_xref="GeneID:9166860"
FT                   /locus_tag="Tbis_0381"
FT   CDS_pept        427747..428835
FT                   /locus_tag="Tbis_0381"
FT                   /gene_family="HOG000116232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /codon_start="1"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gme:Gmet_2577 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="GI:296268371"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="GeneID:9166860"
FT                   /translation="MSVLFEPLRLRGLTIPNRVWMSPMCQYSAAETGPDQGVPNDWHFV
FT                   HLGTRAIGGAGLIMVEATAVTPEGRISPYDLGLWNERQQEAFARITRFLREHGAVPAIQ
FT                   LAHAGRKASTDRPWLGGRPVGPEHHGWRPVAPSPVPFADGHPVPAELSVEQIKGLVEAF
FT                   AAAARRALAAGFQVVEIHGAHGYLINEFLSPHSNHRTDAYGGSFENRIRFALEVADAVR
FT                   AVWPDDLPVFFRVSATDWLAENGRAGWTVDDTVRLAKELLAHGVDLLDVSSGGITGGVT
FT                   IPAGPGYQVPFAARVKAETDLAVSAVGLITEPRQAEEIVASGKADAVMLGRELLRNPYW
FT                   PRYAARELGAEPGWPNQYHRAV"
FT                   /protein_id="YP_003651003.1"
FT   gene            429081..430043
FT                   /db_xref="GeneID:9166861"
FT                   /locus_tag="Tbis_0382"
FT   CDS_pept        429081..430043
FT                   /locus_tag="Tbis_0382"
FT                   /gene_family="HOG000253049" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /codon_start="1"
FT                   /product="luciferase-like monooxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   mno:Mnod_7147 luciferase-like monooxygenase"
FT                   /db_xref="GI:296268372"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="GeneID:9166861"
FT                   /translation="MAEIGYTLLCEQAPPRQLVDDAVTAERIGFGFAVISDHYFPWLEE
FT                   MGHSPYAWSVLGAVAQATERIPLMTFVTCPIMRYHPAVVAQKAATMGVLSGGRFTLGLG
FT                   SGENLNEHVVGLGWPAVSARHEMFREAVEIIKDLFEGGYRSYRGAYFDLESAKLYDRPD
FT                   PPVPIAIAASGERSVNLAVEYGDALVCADPDGDLVRRYRSIGGEGRPVYGQVALCYDRD
FT                   RDAAVERAHRLWRWSVTGWKVMSELPAPVNFAAATTTVRPEDVARQVPCGPDVDAVVAA
FT                   VQRYVDAGFTHVALLQIGHAEHQREFFDWAEKELLPALR"
FT                   /protein_id="YP_003651004.1"
FT   gene            complement(430305..431047)
FT                   /db_xref="GeneID:9166862"
FT                   /locus_tag="Tbis_0383"
FT                   /pseudo
FT   gene            431573..432025
FT                   /db_xref="GeneID:9166863"
FT                   /locus_tag="Tbis_0384"
FT   CDS_pept        431573..432025
FT                   /locus_tag="Tbis_0384"
FT                   /gene_family="HOG000198397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /codon_start="1"
FT                   /product="DoxX family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: DoxX family protein; KEGG: gur:Gura_3338 DoxX
FT                   family protein"
FT                   /db_xref="GI:296268373"
FT                   /db_xref="InterPro:IPR011637"
FT                   /db_xref="GeneID:9166863"
FT                   /translation="MRLDRFHGGVLSLFRMVVGLLFLTHGAASLFNVFGGHMGTGQAIP
FT                   AGAWPGWWAALIQLVCGGLVLVGLFTRVSALLCSGSMAYAYFVVHQPKALLPLQNGGEL
FT                   AALFCWGFFLIAVLGPGPWAVERLIPRRAKGGREGSRASLATPAGA"
FT                   /protein_id="YP_003651005.1"
FT   gene            432237..432569
FT                   /db_xref="GeneID:9166864"
FT                   /locus_tag="Tbis_0385"
FT   CDS_pept        432237..432569
FT                   /locus_tag="Tbis_0385"
FT                   /gene_family="HOG000222826" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /codon_start="1"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   rce:RC1_1321 divalent cation tolerance protein, putative"
FT                   /db_xref="GI:296268374"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="GeneID:9166864"
FT                   /translation="MECIEVRVTAGSREEAERICTEAVSRRLAACAQVVAPITSTYRWQ
FT                   GEIERSEEWLLLLKTTAGRFEELARCVTELHSYEVPEIIAVPITHGSAAYLDWVRRETA
FT                   PESAAE"
FT                   /protein_id="YP_003651006.1"
FT   gene            432763..433569
FT                   /db_xref="GeneID:9166865"
FT                   /locus_tag="Tbis_0386"
FT   CDS_pept        432763..433569
FT                   /locus_tag="Tbis_0386"
FT                   /gene_family="HOG000233295" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /codon_start="1"
FT                   /product="SARP family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain protein; KEGG:
FT                   afw:Anae109_1735 SARP family transcriptional regulator"
FT                   /db_xref="GI:296268375"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="GeneID:9166865"
FT                   /translation="MGFDFRFLGPLQVWRGGRFIEIRAPKQRALLAVLAIRAGQVVSID
FT                   RLIEELWGGAPPPSARTTLYSLVFRLRRRLHAGVEVMGTRSPGYLLRVAPGALDFRRFE
FT                   AGLVRGRAELAAQDHARAARTFRDALALWRGQAFADVPEIPLVQAEARRLEELRLTALE
FT                   DRIEADLALGRHALVAAELYALVEEYPLRERLWEMLMLALYRSARQVDALRAFEQAQQA
FT                   LAGHWGLTPGPGLKRMYERILAADPGLMPMERSEPPPTALGDPRDR"
FT                   /protein_id="YP_003651007.1"
FT   gene            433919..435037
FT                   /db_xref="GeneID:9166866"
FT                   /locus_tag="Tbis_0387"
FT   CDS_pept        433919..435037
FT                   /locus_tag="Tbis_0387"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /codon_start="1"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: dps:DP1685 thiamin
FT                   biosynthesis protein (ThiF)"
FT                   /db_xref="GI:296268376"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="GeneID:9166866"
FT                   /translation="MESRLDVPTWRPRLRDSVIVQRDGDELLFICTGDRTVKRFSADER
FT                   AMRLLPLLTGRKTVAELAEAVGAASVEEIRPVLQVLEEERLLSKASDFDGDFLTLGSRR
FT                   AYYYDRQLRLFQDFCDEELLADLSGVDVQRRLDGATVVICGVGGLGGWIAHLLGLAGVG
FT                   TLRLCDFDRVELTDLARQPLFTVEDVGRSKVDAAAARIGDLNPHVTVEQFMRKMSGPDD
FT                   LGDLVAGADLVIAAADEPSPVDVATWISEACREGIPHIIGGGYAYHLGVVGTTVIPGRS
FT                   ACWECVRSVTLAEHGRAQAITLIPRRQRTGGLGVLNGLVASVLAWEAIRVVVGLPPALT
FT                   DRWLEIDLWSLTKRVRSIERRPDCPACGDAGA"
FT                   /protein_id="YP_003651008.1"
FT   gene            complement(435192..436520)
FT                   /db_xref="GeneID:9166867"
FT                   /locus_tag="Tbis_0388"
FT   CDS_pept        complement(435192..436520)
FT                   /locus_tag="Tbis_0388"
FT                   /gene_family="HOG000171266" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01840"
FT                   /codon_start="1"
FT                   /product="PHB depolymerase family esterase"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: esterase, PHB
FT                   depolymerase family; PFAM: cellulose-binding family II;
FT                   SMART: cellulose-binding family II"
FT                   /db_xref="GI:296268377"
FT                   /db_xref="InterPro:IPR000480"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="GeneID:9166867"
FT                   /translation="MRSTAGRLVAVVIAALLAVAGAILALPASAASLVEVTDFGPNPTN
FT                   LRMHLYVPDRVQQRPPVLVAVHYCTGSGPAFYAGTEFASLADRYGFIVIYPSATRSGQC
FT                   FDVSSPETLRHNGGSDSLAIVSMVRYVLQRYNADPDRVYVTGASSGAMMTNVLLGAYPD
FT                   VFKAGAAFMGVPFGCFATTDGSSWNSACANGQLIRTPQQWGDLVRAAYPGYQGPWPRIQ
FT                   IWHGTEDNILRYPNFQEQIKQWTNVHGLSQTPSYTDRPQWNWTRTRYGGTGVQVPVEAI
FT                   SIQGAGHDLPQAGMAQMAIAFFGLDQTGPGPSPSPSTPASPSPSPSTPASPSPQPSGTC
FT                   RVQYDMNAWNTGFTTSVTITNTGSSPINGWELTFTLPSGQSVVSAWNATISPSSGQVTA
FT                   RNVSYNALIPPGGSTSFGFQGVHTGNTGKPASFSLNGVSCAVS"
FT                   /protein_id="YP_003651009.1"
FT   gene            436938..438119
FT                   /db_xref="GeneID:9166868"
FT                   /locus_tag="Tbis_0389"
FT   CDS_pept        436938..438119
FT                   /locus_tag="Tbis_0389"
FT                   /gene_family="HOG000014016" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF955; helix-
FT                   turn-helix domain protein; SMART: helix-turn-helix domain
FT                   protein; KEGG: protein of unknown function DUF955"
FT                   /db_xref="GI:296268378"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="GeneID:9166868"
FT                   /translation="MAGDITAARVRQLIKESGLTQAEFAGRVGLDASKMSKSLSGVRRF
FT                   TSLDLARIADLCGVTVDWLLGVDSLTPSLATRTAPLSSSADAAIKEAERLARMRADLAF
FT                   LGYRREVPAFELTGGSLIDQGTDLARKAAEHAARERINFWETRDLADAVEKAFGVDVRI
FT                   YECPNAFDGLVWSDEHSPLIVVSTSRLSAQRLPTRQRFTIAHALGHLLARDDRRLIVDE
FT                   NIHDREHKSTKQEMLANAFAAELLLPARLLRDEAARTRWTREDFAALACRLWVAPNTLA
FT                   WRLFNLGLIDRNRCEDFGRLTAWDAASIAGVAGTFGEWLQSASRARMPFMLVRDAFQAY
FT                   ADGKSTLRPLANLLGVDTDLLRQVMHGKKEDSPLASWPITGSPTPLCSATSPP"
FT                   /protein_id="YP_003651010.1"
FT   gene            438116..438373
FT                   /db_xref="GeneID:9166869"
FT                   /locus_tag="Tbis_0390"
FT   CDS_pept        438116..438373
FT                   /locus_tag="Tbis_0390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268379"
FT                   /db_xref="GeneID:9166869"
FT                   /translation="MSELTLLARILRGRGRWTEAIAYEVSRSAKVYPELNTIASDGWLG
FT                   EPIEIDNDDEIEQIERVRRAVFGGTVHEPLKHLGEARPAT"
FT                   /protein_id="YP_003651011.1"
FT   gene            438370..438597
FT                   /db_xref="GeneID:9166870"
FT                   /locus_tag="Tbis_0391"
FT   CDS_pept        438370..438597
FT                   /locus_tag="Tbis_0391"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268380"
FT                   /db_xref="GeneID:9166870"
FT                   /translation="MILNRPEFRGSYWITDDRDAREYAQFQGITTLDTADLLAEGVIEN
FT                   CCGTSEALRLLRRMQQEGRNVRIPRDLGQR"
FT                   /protein_id="YP_003651012.1"
FT   gene            438900..439349
FT                   /db_xref="GeneID:9166871"
FT                   /locus_tag="Tbis_0392"
FT   CDS_pept        438900..439349
FT                   /locus_tag="Tbis_0392"
FT                   /gene_family="HOG000224536" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BRADO1780"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bra:BRADO1780 hypothetical protein"
FT                   /db_xref="GI:296268381"
FT                   /db_xref="GeneID:9166871"
FT                   /translation="MTTSVAHVHSIEHTIHTTNRWLNHLSEAIGTSDREFVHGLLRTWL
FT                   HAVRDALTVQASAHFAAQLPDLIRGIYYNGWNASAVPIRRDRQEFIDHFATSGRIAHSD
FT                   VPKLAPLVTEFLCRELSEPVVKQALAQLPQDVRALLRPKAMAGTG"
FT                   /protein_id="YP_003651013.1"
FT   gene            complement(439394..439975)
FT                   /db_xref="GeneID:9166872"
FT                   /locus_tag="Tbis_0393"
FT   CDS_pept        complement(439394..439975)
FT                   /locus_tag="Tbis_0393"
FT                   /gene_family="HOG000223723" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /codon_start="1"
FT                   /product="CBS domain-containing membrane protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: bph:Bphy_1094
FT                   signal-transduction protein"
FT                   /db_xref="GI:296268382"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:9166872"
FT                   /translation="MFVYEVMRTPVITLRPDDTVRQAIRVLYGNHITAAPVVGERGELA
FT                   GMVSEIDLLTAELRAANTLDRNFPETSLRVANVMSRTVVTVTEDTEVSALLDLMINMRV
FT                   KTVPVIRGFELVGIVTRRDLMAMLATPDETLRDVIVELLRRECPAAASCDVVVRDGEVE
FT                   LRGGLGEWDSREAEELIRTVPGVVRVTRAG"
FT                   /protein_id="YP_003651014.1"
FT   gene            440338..440943
FT                   /db_xref="GeneID:9166873"
FT                   /locus_tag="Tbis_0394"
FT   CDS_pept        440338..440943
FT                   /locus_tag="Tbis_0394"
FT                   /gene_family="HOG000223723" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /codon_start="1"
FT                   /product="CBS domain-containing membrane protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: smd:Smed_2997 putative
FT                   signal-transduction protein with CBS domains"
FT                   /db_xref="GI:296268383"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="GeneID:9166873"
FT                   /translation="MLVREVMTSPVVTVPVSWSVRQAIRLLYDKDITAAPVVDEQGRMV
FT                   GIISEMDLLRGEFDTDRRVFLRPSAPVDLAPSPGIEEVMTPNVRTVQEDDDVMAAVDLM
FT                   ITMGVKSVPVLRGEQLTGIVSRRDLMGMVAYGDARIRDDVLAALRDSDETSAWRVAVHD
FT                   GVVELYGDAADASAARKAEMIARSVPEVVDVVLRGGGW"
FT                   /protein_id="YP_003651015.1"
FT   gene            complement(440970..441344)
FT                   /db_xref="GeneID:9166874"
FT                   /locus_tag="Tbis_0395"
FT   CDS_pept        complement(440970..441344)
FT                   /locus_tag="Tbis_0395"
FT                   /gene_family="HOG000052573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /codon_start="1"
FT                   /product="CrcB protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: nha:Nham_0217 CrcB protein"
FT                   /db_xref="GI:296268384"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="GeneID:9166874"
FT                   /translation="MTTILLVFAGGAIGAPARYLTDRFVQRRLGGVFPWGTLTVNVTGS
FT                   FLLGCLLGLQFARGLPDGVTTLLGTGFCGAFTTFSTFGYETVRLLEEGSTWAAGVNAFA
FT                   GLLLGVPAAVTGLLLAGVLG"
FT                   /protein_id="YP_003651016.1"
FT   gene            complement(441341..441688)
FT                   /db_xref="GeneID:9166875"
FT                   /locus_tag="Tbis_0396"
FT   CDS_pept        complement(441341..441688)
FT                   /locus_tag="Tbis_0396"
FT                   /gene_family="HOG000257373" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02641"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   noc:Noc_2284 hypothetical protein"
FT                   /db_xref="GI:296268385"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="GeneID:9166875"
FT                   /translation="MRQQARRLMIFINENDQYHHRPLYAEIVDRAHRMGLAGATVLRGI
FT                   EGYGHSSQIHTSRLLSLSEAQPVTIIIVDDAERIEAFRLVLDELITEGLVVCDPVEVRR
FT                   YPAAGQAEERA"
FT                   /protein_id="YP_003651017.1"
FT   gene            complement(441685..442185)
FT                   /db_xref="GeneID:9166876"
FT                   /locus_tag="Tbis_0397"
FT   CDS_pept        complement(441685..442185)
FT                   /locus_tag="Tbis_0397"
FT                   /gene_family="HOG000052573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /codon_start="1"
FT                   /product="CrcB protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: pde:Pden_0789 CrcB protein"
FT                   /db_xref="GI:296268386"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="GeneID:9166876"
FT                   /translation="MRRRAHRSGGRIRRAVPSPRRAAGTAPARTWDVLAVIGLGGGIGS
FT                   VARHLAGAAIPAHPYGFPWATFLVNVTGCLAIGGLMAVVDALPGRRYLRPFTGVGLLGG
FT                   YTTFSTYANELVTLVHHGAWAVAGGYALGSILAGLAAVRLGKDAAGAAIRRAAHRRRRG
FT                   GAP"
FT                   /protein_id="YP_003651018.1"
FT   gene            442458..443306
FT                   /db_xref="GeneID:9166877"
FT                   /locus_tag="Tbis_0398"
FT   CDS_pept        442458..443306
FT                   /locus_tag="Tbis_0398"
FT                   /gene_family="HOG000019983" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268387"
FT                   /db_xref="GeneID:9166877"
FT                   /translation="MDAAYVGDIYAEHLTEADLQLLAEAAGHQGGAAELRRDPAIIPDL
FT                   LDHPRVFAVLFGRSGSASRDLTAISPFLLFAAAVHRAAAELAVRGAVPYPRVPAADVRQ
FT                   MSGFLESPSRRLFLAELLSSFVRVTGGRYWVRTEEGERLRELTELDLPRLAEILDAVPE
FT                   TDRPGVLRRLGDVALFLAGVLPGYAIRHVFGGVDATALWFTVRGAAEPWAGEPAGTAAE
FT                   EPAVEMLEYLGSHWYRRAWELAPVRSARLAVLPEVAEGFRPARRVLNYVAGRYLFAASG
FT                   R"
FT                   /protein_id="YP_003651019.1"
FT   gene            443556..445080
FT                   /db_xref="GeneID:9166878"
FT                   /locus_tag="Tbis_R0011"
FT   rRNA            443556..445080
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT                   /db_xref="GeneID:9166878"
FT                   /locus_tag="Tbis_R0011"
FT                   /product="16S ribosomal RNA"
FT   gene            445261..448299
FT                   /db_xref="GeneID:9166879"
FT                   /locus_tag="Tbis_R0012"
FT   rRNA            445261..448299
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT                   /db_xref="GeneID:9166879"
FT                   /locus_tag="Tbis_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            449013..449312
FT                   /db_xref="GeneID:9166880"
FT                   /locus_tag="Tbis_0399"
FT   CDS_pept        449013..449312
FT                   /locus_tag="Tbis_0399"
FT                   /gene_family="HOG000162911" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268388"
FT                   /db_xref="GeneID:9166880"
FT                   /translation="MTTESPPDVNVTALAINVEIPEPLRWTDSRRDVEYVLTTLNVRLL
FT                   PDGRLAAKAYGRPVAGGPGAYTSFRVPGRPELADLIKRAADRAAQLWAAHRGFD"
FT                   /protein_id="YP_003651020.1"
FT   gene            449864..450583
FT                   /db_xref="GeneID:9166881"
FT                   /locus_tag="Tbis_0400"
FT   CDS_pept        449864..450583
FT                   /locus_tag="Tbis_0400"
FT                   /gene_family="HOG000094100" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BAS3116"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bat:BAS3116 hypothetical protein"
FT                   /db_xref="GI:296268389"
FT                   /db_xref="GeneID:9166881"
FT                   /translation="MAGRRLRRFVPPQHGAWAMLAVPYLAGLLTAGFHWPAVPLLGAWI
FT                   AGYLLSYFVFQALKSRRPRRYRDQLLGYGLIAAPLLLVVVVAAPRVLWYAPAYAVLFAI
FT                   NAWYAWRRRERDLANDLASIAESCLMVFVVATIADTPPSAVLVPFLLCAAYFAGTVPYV
FT                   KTMIRERGNVAYYRWSIGYHVVALAVAAYLSPWAGVLFAWFLARAVLFPRHGLTAKQIG
FT                   VTEVVNSVLLLTCIALI"
FT                   /protein_id="YP_003651021.1"
FT   gene            450815..451495
FT                   /db_xref="GeneID:9166882"
FT                   /locus_tag="Tbis_0401"
FT   CDS_pept        450815..451495
FT                   /locus_tag="Tbis_0401"
FT                   /gene_family="HOG000159124" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bch:Bcen2424_1209 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="GI:296268390"
FT                   /db_xref="GeneID:9166882"
FT                   /translation="MIKSQRADRLQGSSRAVRILGSLAGALAIGAGFGAATAFMNALSL
FT                   SHADLESRAYTESGWSYAEIISVLLDSGWAWAGCGVVVGWAVTRGDGGRRSGLALGATA
FT                   AALALIAATIAYGIGEAIADGGQTPWFGADELVWGTAAIVLGAPLGAIGACARWPGALG
FT                   LLARLTVPVGAAVQMIVLPPGRNEVVQAIGKTIVWTAAAVSIALIVAHFVVTRRRSRPA
FT                   AETP"
FT                   /protein_id="YP_003651022.1"
FT   gene            complement(451848..453374)
FT                   /db_xref="GeneID:9166883"
FT                   /locus_tag="Tbis_0402"
FT   CDS_pept        complement(451848..453374)
FT                   /locus_tag="Tbis_0402"
FT                   /gene_family="HOG000239128" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily protein"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0279 major facilitator superfamily MFS_1"
FT                   /db_xref="GI:296268391"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:9166883"
FT                   /translation="MSSAGLPAGQEREQLRYAWRALSVVCMASVLATIGGNALNVALPK
FT                   LVDQTKASAAAASWILLAFQLTTTVLTVIFGRLADMFGRRTMYLCGLGVYTLASLLAGM
FT                   APDPWLIVGMRVVQAAGMAMLLTNSAALISDAFPRHRLGEGMGVYTASFSISQLAGPTL
FT                   GGLLVEHLGWRWLFWYNVPLGMACLIWGAIVLRRPAPGEDGQRLDLPGSFMILLSLGGL
FT                   LLALSEVTRLGWAHPVILAGLAFFVVLLPVFIAWELRSPHPVVDIRMFRDPTFGLGTLA
FT                   SFLSSIARMGVVILIALFFQAVHGDTAVEASLKLLPLSIAAMIASVTSGFLQRRFSPRS
FT                   LAMFGSSLSTAGLGTLLLVIGADAPALAIMAGLLVLGFGSGTFLPSNATVLLSELPSNR
FT                   LGIMNAMRLMLQSVGIVVGTALSLSIITAPLPPAMHDHVFAGTLSHVSDAAVQRLVTGY
FT                   RWALACLVGISALATLTCLWRGHLGEPGGDRRGHRGGGHADPAARRPVAG"
FT                   /protein_id="YP_003651023.1"
FT   gene            complement(453667..454281)
FT                   /db_xref="GeneID:9166884"
FT                   /locus_tag="Tbis_0403"
FT   CDS_pept        complement(453667..454281)
FT                   /locus_tag="Tbis_0403"
FT                   /gene_family="HOG000041767" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hne:HNE_0651
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:296268392"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9166884"
FT                   /translation="MARKSGSWEWSRTAETRKNMLRAAREVFCEQGFAETSVADIVSRA
FT                   GSSVGSLYHHFGGKSELFLALWEEHQAAHEKAAASAVAEARASGVTDPVELFITGARAV
FT                   LEGSWERRDLVRMFMDGDGPPGFELMRRTRGREWVRQNAVLLGAGTGPLDRMTVSVLTT
FT                   VIGEAGREVATCETREEADEVIEAAVTLIRRLAAPWPGETK"
FT                   /protein_id="YP_003651024.1"
FT   gene            455233..456462
FT                   /db_xref="GeneID:9166885"
FT                   /locus_tag="Tbis_0404"
FT   CDS_pept        455233..456462
FT                   /locus_tag="Tbis_0404"
FT                   /gene_family="HOG000130989" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dal:Dalk_3948 extracellular ligand-binding receptor"
FT                   /db_xref="GI:296268393"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:9166885"
FT                   /translation="MQWHGHEQTKAHFAMEYHKMVKVRKVAIFSLAVAVTMLSAGCSQG
FT                   LLGSGGDSGSAAEQGPIVLGMLIPQSGSEAAVGPYMQNAAQMAVDEINEQGGVLGRKLE
FT                   LKVADDACDPQTAVAGANKLVTEGIAVSVGGYCSGATLPTLPVFGKANIPMIIPAANSQ
FT                   ELVDQRLKHVFLINGTGAQQAAAAVKWITKRGAKNVALVHDNTSYSKDIAVRTQQILDE
FT                   PGGPETAIVEAVTPKESDYSANVTNILAKKPDFVYWTGYFQEGGLLTRQLRQAGYKGDI
FT                   MVADGAVSEKLVEIAGGEHAEGVYATMTYTPDTIEGAEGWIENYKKKFGTAPGPYSNQA
FT                   YDAVRLAAEAIKRAGSTDGDKIIAALEGIDGFPMFSGPLKFTPEHTLATGGFQILVVKS
FT                   GTFVLQDSLQ"
FT                   /protein_id="YP_003651025.1"
FT   gene            456581..457474
FT                   /db_xref="GeneID:9166886"
FT                   /locus_tag="Tbis_0405"
FT   CDS_pept        456581..457474
FT                   /locus_tag="Tbis_0405"
FT                   /gene_family="HOG000202530" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvl:Dvul_2253 inner-membrane translocator"
FT                   /db_xref="GI:296268394"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9166886"
FT                   /translation="MTQLIWNGLFVGSFYALVALGYSMVYGIIKLLNFAHGDIYMLGAF
FT                   AGFAILGATGGVSPDMQLPLLLGVLVVTMGFTGMCGVLLERIAYRRLRSAPRLSLLITA
FT                   VGASFSLEYGVRVIAGPDPQVYPVRLGGTTIHVLGASITVQQIVLMVVAVALMVALNLL
FT                   VTRSREGRAMRAIALDPRTSALMGINVNAVIARTFFLGSALAGAAGVMAGAYYGKIDFM
FT                   MGFLIGLKAFTAAVIGGIGNIPGTMLGGLLLGMLESFGTYWLGGEWRDVFAFGVLILFL
FT                   TVRPTGLLGERVTERV"
FT                   /protein_id="YP_003651026.1"
FT   gene            457471..458454
FT                   /db_xref="GeneID:9166887"
FT                   /locus_tag="Tbis_0406"
FT   CDS_pept        457471..458454
FT                   /locus_tag="Tbis_0406"
FT                   /gene_family="HOG000202415" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvl:Dvul_2395 inner-membrane translocator"
FT                   /db_xref="GI:296268395"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9166887"
FT                   /translation="MSVQTPTSTPTRRRRKGTALGRAITRTFDNRWAGLAALAIALLAP
FT                   FVIATPYALSVMTSAAIFVMLAAGLNIVVGYCGLLDLGYAAFFAVGAYTSGVLSTRFDL
FT                   PLLATLPAVIVVTIIAGIVIGAPTLRLRSDYLAIVTLGFGEIIRITANNLEITGGPSGI
FT                   YGIPGLTDNAVVFYYLTVVVVAVAVAGAARLGRSRLGRAWRFIREDEDAAEAMGVHTYR
FT                   VKLAAYIAGAIWGGLAGVLFAAHLSAISPGSFTFLQSALVLMAVVLGGMGSTPGVVLGA
FT                   IVISLLPEVLRDFADYRYFAFGVLLIIFMLVRPQGLWPHRSREASA"
FT                   /protein_id="YP_003651027.1"
FT   gene            458451..459272
FT                   /db_xref="GeneID:9166888"
FT                   /locus_tag="Tbis_0407"
FT   CDS_pept        458451..459272
FT                   /locus_tag="Tbis_0407"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acr:Acry_0357 ABC transporter related"
FT                   /db_xref="GI:296268396"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9166888"
FT                   /translation="MTLLSVENLRLSFGGLLAIDDLSFSVGEAEIVSVIGPNGAGKTSA
FT                   FNCVTGFYKPTAGRILFRGRDITGLRPSKIAGLGVARTFQNLRLFGEMSVLDNVRAGAH
FT                   LWLKQSVFDALLHTPRYRRSERECTEQAHHWLDFVGLRGDRYGPARALPYGEQRRVEIA
FT                   RALARKPDLLLLDEPGAGLNHGEKAEMRDLIRRIRHDLGIAIVLIEHDMGLVMEVSERV
FT                   VVLNFGRKIADGRPEEVRRDPAVIEAYLGKDEDETPAGEQMEVGGGHDAGA"
FT                   /protein_id="YP_003651028.1"
FT   gene            459259..459972
FT                   /db_xref="GeneID:9166889"
FT                   /locus_tag="Tbis_0408"
FT   CDS_pept        459259..459972
FT                   /locus_tag="Tbis_0408"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_0262 ATPase"
FT                   /db_xref="GI:296268397"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9166889"
FT                   /translation="MPALEIDSLHVHYGGVHALRGLSLTVEEGEIVALLGNNGAGKTTT
FT                   LSAVSGLVRPSAGRIVFQGRDVTRARPEEIVKAGLVHVPEGRRVFSTLTVHENLQLGGY
FT                   LVRDHAELRRRIDRVYTLLPRLAERRDQQAGTLSGGEQQMLAIGRALVTGPRLLLLDEP
FT                   SMGLAPLVVASVMELVREVNSQGVSVLLVEQNAKAALKIAHRGYVIENGECVLGGSAAE
FT                   LRGDQRVVAAYLGGA"
FT                   /protein_id="YP_003651029.1"
FT   gene            460278..461285
FT                   /db_xref="GeneID:9166890"
FT                   /locus_tag="Tbis_0409"
FT   CDS_pept        460278..461285
FT                   /locus_tag="Tbis_0409"
FT                   /gene_family="HOG000294417" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /codon_start="1"
FT                   /product="SpoOM family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SpoOM family protein; KEGG: bsu:BSU08760
FT                   sporulation-control gene"
FT                   /db_xref="GI:296268398"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="GeneID:9166890"
FT                   /translation="MVFKRMLGALGVGAPSVDTVLANPRVQPGGTLTGEVRLKGGDFDA
FT                   EIEHITLSLVAQVEIEHGDRERRGVGEFYRYQVSGPTVLRKGENRVLPFQMSVPWETPI
FT                   TEVDGQHLTGMAVGVRTELAIAKAVDKGDLDPIAVMPLPSQRAVLDAFPRLGFAFKGAD
FT                   LEAGHIYGVQQMLPFYQEIEFYAPPQYAGVVSEVELTFVTNPGGMDVVLEVDGRRLGDA
FT                   IGRFTVSHDEALRTDWVAEIDRWVASLGQYGAPAPGYGAYGDPHGYGPYGHPDPHAYGP
FT                   HGHPYPPHHSSGPGWGTVAAAGAAGLIGGMIAGEVVEEIVEEIFEDDGGDGGDW"
FT                   /protein_id="YP_003651030.1"
FT   gene            461355..461729
FT                   /db_xref="GeneID:9166891"
FT                   /locus_tag="Tbis_0410"
FT   CDS_pept        461355..461729
FT                   /locus_tag="Tbis_0410"
FT                   /gene_family="HOG000187907" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /codon_start="1"
FT                   /product="putative CBS domain-containing signal
FT                   transduction protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: pmy:Pmen_4121
FT                   signal-transduction protein"
FT                   /db_xref="GI:296268399"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="GeneID:9166891"
FT                   /translation="MRIGNVYRPDVFGCWVDERLPDVARRMAEKDVGALAVLDGNEVVG
FT                   VITERDLVRALAESPDVYSARVSEFATTDVETADVEDDSREVAERMLEAGFRHMPVTQN
FT                   GEMVGMVSMRDLLALETWSG"
FT                   /protein_id="YP_003651031.1"
FT   gene            complement(461856..462080)
FT                   /db_xref="GeneID:9166892"
FT                   /locus_tag="Tbis_0411"
FT   CDS_pept        complement(461856..462080)
FT                   /locus_tag="Tbis_0411"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bpm:BURPS1710b_A1472 putative permease"
FT                   /db_xref="GI:296268400"
FT                   /db_xref="GeneID:9166892"
FT                   /translation="MNPFLGSLVLTLALQLTDSAHAGNRARADQRLEHRTGICPAARRR
FT                   ERPRRGAERRARRRGDAFSLARHGRSAVM"
FT                   /protein_id="YP_003651032.1"
FT   gene            complement(462336..462974)
FT                   /db_xref="GeneID:9166893"
FT                   /locus_tag="Tbis_0412"
FT   CDS_pept        complement(462336..462974)
FT                   /locus_tag="Tbis_0412"
FT                   /gene_family="HOG000088153" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="TetR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_0214
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:296268401"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9166893"
FT                   /translation="MTATPEAEVPTNARGAPLSKRGERTRRKLLDAAEQVFAELGYYEA
FT                   SIVKITEAAGVSQGTFYIYFESKQQIFDELVADLNRRVRHAMSEAAKKGRTRAERERLG
FT                   FAGYFRFTAEHPALYRIIRQAEFVSPDAMRRHYAKIAEGYMEGLRQAMDDGEIVRADPE
FT                   VLAYALMGIGELIGMRWILWDDKQPPRQVPEDVFEEMHRFITRGLGATA"
FT                   /protein_id="YP_003651033.1"
FT   gene            463114..463869
FT                   /db_xref="GeneID:9166894"
FT                   /locus_tag="Tbis_0413"
FT   CDS_pept        463114..463869
FT                   /locus_tag="Tbis_0413"
FT                   /gene_family="HOG000027949" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A2258 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="GI:296268402"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:9166894"
FT                   /translation="MQGLILTQVDGPVATIVLNRPERHNSLVPELLRDLLTALEKVADA
FT                   RAVVLAAEGRSFSTGGDVRAFAERDGDALRDYANELVGLLGETMLAIMRLPAPVIAAVH
FT                   GMVTGGSLGLLLASDIVLIHPSVTIAPWYTTVGFAPDGGWTALLPYRIGASRAAVVQYT
FT                   NTPIDAETAVAWGLATRVESDVRRAAAELARTIAGQRPGAVRATKRLINGDLDAIAARL
FT                   DAEREAFVRQITTPEAREGMTAFLSRAAR"
FT                   /protein_id="YP_003651034.1"
FT   gene            463890..466301
FT                   /db_xref="GeneID:9166895"
FT                   /locus_tag="Tbis_0414"
FT   CDS_pept        463890..466301
FT                   /locus_tag="Tbis_0414"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /codon_start="1"
FT                   /product="NHL repeat containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   sfu:Sfum_2158 NHL repeat containing protein"
FT                   /db_xref="GI:296268403"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="GeneID:9166895"
FT                   /translation="MRKRPAAAFAAALLLAVAAGLVRPAAEAGAATVLTFADEDRSSEL
FT                   TGHVVHQRYQFNTPTTVTYDRDTITGNPAAARVYVADMGNHVIRVFDLNGKQIGRLDDA
FT                   DTQLAPDSPASSVPQITAPLGIYFLSKSEAVDDRLAGLYINDVGVHKLHFFRTDPSNPD
FT                   RFYYVTSFGQEGHGGGADLKLPRNMTVTPDGLLYVSDEFNHRIKGFRIDPDTWTATLVT
FT                   TVGSQGGPIIPGTDKDYGTDSTHYDDYAGEPLKRDGFRIPQGMTYWRTPDGSRTYLYVA
FT                   DNGNNRVKIFEVAASGTLTLVDILGRFTRNGTADHLKRPRGVRVDVNGNLYVADTYGGR
FT                   IIRFPNLGTNTAKYRTSLSADAAASWVYGRLGIHQVEMRTPATALTEDEAFQLPNDVVP
FT                   VETPSGARYTENIWSWGVYYPGARVLLVSDTGNHRIKKCWEHPTQNTILRCSVSAGVGG
FT                   VTAHEFWGHPRTLAGQLHAVGGMDLLPGQGSDPDTLLVSDTPNTVIYRYGLDGSYKGKF
FT                   TGGSISYGVTGLSVYPVSGSHHVGVLVAADATLPYPYTGDSSLRIYNRAGGSVNVFNLT
FT                   TRTSGASKISYTGGNFPVAIDIVPEGGSYGVFISTSGNRLYRFTLSGSSLTLNWVTGGP
FT                   DPSKGSDSGSTWNLGPNFYGEGAAGTFDQIQDVTAGGGRVYAVDRRNQRIQVFNASTGA
FT                   YIAKIGKGGGTYDHPASITPDEFFLPHGVRLDGGLLVGDGFNMIVRDYDDPTGLTPDSS
FT                   GRLPVTMRGYWVDPHLGTRKGGLFATQHVLRAGPYVFVDSLISNRITRIS"
FT                   /protein_id="YP_003651035.1"
FT   gene            466314..468176
FT                   /db_xref="GeneID:9166896"
FT                   /locus_tag="Tbis_0415"
FT   CDS_pept        466314..468176
FT                   /locus_tag="Tbis_0415"
FT                   /gene_family="HOG000230005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; MaoC
FT                   domain protein dehydratase; KEGG: rce:RC1_3527 acyl-CoA
FT                   synthetase, putative"
FT                   /db_xref="GI:296268404"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="GeneID:9166896"
FT                   /translation="MKVPDLLGKGAELSPDSTALVDTLSGREFDYATASERAGRAARYL
FT                   SEGLGVRPGDRVAVLSGNRVELMELLFACGRLGALLVPLNWRLSADELAGIMADCTPTV
FT                   LISDDTHAEKALRLDGNAVRFGADYERALAEADPIWGPTEWPDEKDPWYLLYTSGTTGR
FT                   PKGVIQTYGMAVVNHLNIGVAIGLTSVDTTLNVLPMFHTGGINLYTMPTLIVRGTAIIQ
FT                   HEFDAALALRLLSERATVFFGVPTVYQMLYDHPDFATTDLSRVRSWSSGGASMPVPLLH
FT                   KLAEKGVVVRQGMGMTETGPTIFLIDEAHALSKAGSVGKPQAFTEVKLVDRNGDPADEG
FT                   EMLVRGPGVTPGYWNQPEATRAAFTEDGWLRTGDVARRDEDGYYTIVDRVKDMYISGGE
FT                   NVYPAEVEKVLLTHPAVAEAAVVGVPDDRWGEVGKAYLVVRAGMTVDADEIRAFCKERL
FT                   AGYKVPKHVEVIEALPRNATGKVLKDRLRVVTWSEEFTVTQKDFDRFAALSGDDNPIHV
FT                   DPEYAKTTRFGGTVAHGMLIFTLIRAAVRRHHPGAELTEQFLKFPAPTPAGERVTITAR
FT                   ESAAGPDRITCDITVTRTDGTTVCEAVTTIRRPAAGGDREQEDA"
FT                   /protein_id="YP_003651036.1"
FT   gene            468173..468562
FT                   /db_xref="GeneID:9166897"
FT                   /locus_tag="Tbis_0416"
FT   CDS_pept        468173..468562
FT                   /locus_tag="Tbis_0416"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /codon_start="1"
FT                   /product="MaoC domain-containing protein dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmr:Mmar10_0309 MaoC-like dehydratase"
FT                   /db_xref="GI:296268405"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:9166897"
FT                   /translation="MSDWWEQAVGRSATLERTFTAEDLAEYRSLSGDTTEDPAGGESVP
FT                   EPLIAGLFSTLLGTDLPGNGTMYLKQEMRFLGRAKPGETVRAEVTVTAVRPEKALVDLD
FT                   TVAKVGDRVVCEGKALVMAPQYGHR"
FT                   /protein_id="YP_003651037.1"
FT   gene            468752..469933
FT                   /db_xref="GeneID:9166898"
FT                   /locus_tag="Tbis_0417"
FT   CDS_pept        468752..469933
FT                   /locus_tag="Tbis_0417"
FT                   /gene_family="HOG000088185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bja:bll0887 ABC transporter substrate-binding protein"
FT                   /db_xref="GI:296268406"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:9166898"
FT                   /translation="MKRYGVALSALLALTLTACGSSGGEDTSASGSSGGGSPVKVGVLT
FT                   STSGLVAGYGKQFIEGFKAGLDHATKGTGEVAGRKIEVTYHDDAGDPAKATAEATDLIG
FT                   KGYKILTGTVSSGVAMQLAPLAGQNKVLYIAGAAAADGVTGSNAYTFRSGRQTWQDVKA
FT                   AEGLAGGVQGKKVMVFAQDYAFGQANVDAVKAVLGEAGGATVTPVLVPLKTTDFTPFAR
FT                   QIVDAKPDLVFVAWAGDTAPNMWRTLAQQGVFDVTKVVTTLADRATFGSFGPAGDKIDF
FT                   VAHYFAEATDNEPAKALASALGTTADIFHTDGFTAAQMVVRAIEQGGDDVEKMITALEG
FT                   WTFTSPKGEMTIRAEDHALLQPMFHATLEGEKPRAVATLGPEQVAPPANPIKR"
FT                   /protein_id="YP_003651038.1"
FT   gene            469930..470682
FT                   /db_xref="GeneID:9166899"
FT                   /locus_tag="Tbis_0418"
FT   CDS_pept        469930..470682
FT                   /locus_tag="Tbis_0418"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcr:BCAH187_A2032 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="GI:296268407"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9166899"
FT                   /translation="MSAILETHGLGVAIGGVRILSDVSLSVRRGEIMAVLGPNGAGKTT
FT                   LFNLLTGLRRPSAGRIVLNGTDITGAPVFRRARLGLVRSFQITSLFPSLTVLENARLAA
FT                   QVHLGGSLALWRRVRPTDAAVAMARAALETVGIAEYADEPAGSLSHGAKRKLEVALAIV
FT                   GKPAVLLLDEPTAGMSAEDVPELTEVIRRVRDRHGTTILLVEHRMDVAIGLADRMAVMH
FT                   HGTLLACDTPDAVMADPLVQSAYLGEAL"
FT                   /protein_id="YP_003651039.1"
FT   gene            470679..471401
FT                   /db_xref="GeneID:9166900"
FT                   /locus_tag="Tbis_0419"
FT   CDS_pept        470679..471401
FT                   /locus_tag="Tbis_0419"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dac:Daci_6027 ABC transporter related"
FT                   /db_xref="GI:296268408"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9166900"
FT                   /translation="MTKATEGTMLSVRGLHVHLGESHVLQGVSFDVRAGGVTALLGRNG
FT                   AGKTTTMRGLLGLVPRRGEVILDGEDISRLPTHEVVRRGIGYVPENREVFAGLTVQENL
FT                   LLAERPGSPHHYDLVYELFPRLKERLKQRAGTMSGGEQQMLALARALLNDNRLLLIDEP
FT                   SQGLAPYLVAELTEALARAAELVTIVLVEQNLRMVQRLARDAVVLDQGRVVWSGGAADL
FT                   LGDGELTRQYLGVGVAKA"
FT                   /protein_id="YP_003651040.1"
FT   gene            471398..472264
FT                   /db_xref="GeneID:9166901"
FT                   /locus_tag="Tbis_0420"
FT   CDS_pept        471398..472264
FT                   /locus_tag="Tbis_0420"
FT                   /gene_family="HOG000202531" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ABC-transporter ; K01997 branched-chain amino acid
FT                   transport system permease protein"
FT                   /db_xref="GI:296268409"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9166901"
FT                   /translation="MSTFILLTVTGLGLAALYFLVASGLSLIYGLMDVLNFAHGAFLTL
FT                   GAYTAWVVVDATGSLLLGVAVAIAVGAVLAVLMETALLRRMYGSHVPQVLLTVGLLLAI
FT                   TALIRSIFGTDALQLATPEWMNEVTEILGAPIPNNRFVLIVTAVLVYLAMSAFLAKTRY
FT                   GLIIRAGVENRAMVTALGIDVRRAFTLVFAIGGALAALAGALAGVINNAVSPEQGMSLL
FT                   IFAFIVVIIGGLGSFRGSALAAVLVGLLQQYANFYGAVGAGDLIVVLMLAAILLVRPQG
FT                   LLGRAAS"
FT                   /protein_id="YP_003651041.1"
FT   gene            472261..473319
FT                   /db_xref="GeneID:9166902"
FT                   /locus_tag="Tbis_0421"
FT   CDS_pept        472261..473319
FT                   /locus_tag="Tbis_0421"
FT                   /gene_family="HOG000202418" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   aav:Aave_3172 inner-membrane translocator"
FT                   /db_xref="GI:296268410"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9166902"
FT                   /translation="MTDQMIRTRPAVEPRTRRGPRAWAKPVVLAALPLLAAALPYLDVQ
FT                   VPLLFDGPLGSPGVLHVLSLMCVMAAVAVTYDLLFGFTGLLSFGHGLYVALGMYTTGIV
FT                   LTHTDLGFAGAVAWVAVLGLVVPLVLGAICLRVGGIAFAMATLAFGQAGAIFVVRDPLR
FT                   ITGGELGLALPYEKLPEPLVGVINAGNRYWLALALLVVTYAVVRWALASRPGRVWRAIR
FT                   DNETRVLVLGLRPYAFKLMAFVLSSFLASLAGLVYALIAGGAHAEVTEATFTLGLLVMV
FT                   VLGGSGHPYGALIGGLVYTYLNHRLGQLSTTLGGPLSEPLFILGVLFVVLILFLPGGIV
FT                   SLVRRTESKGGA"
FT                   /protein_id="YP_003651042.1"
FT   gene            473316..474332
FT                   /db_xref="GeneID:9166903"
FT                   /locus_tag="Tbis_0422"
FT   CDS_pept        473316..474332
FT                   /locus_tag="Tbis_0422"
FT                   /gene_family="HOG000088164" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.1.41"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.41"
FT                   /transl_table="11"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III; KEGG: bcz:BCZK1748
FT                   hypothetical protein"
FT                   /db_xref="GI:296268411"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:9166903"
FT                   /translation="MTVCIAGTSSYLPSRWMTAAEISAASGVPEDVIIERFGLRGKHIA
FT                   APDEHVTDMAARVGAQVLAETGTDPADVDAVVYFGSTWKEHPVWHAAPKIAHMLGTHRA
FT                   FALELDYVSCGTPVAMRVCRDMMLAEPHLNRVLAVAASRESYLLDYTNVRSRFAFNFGD
FT                   GAAGVLFTRDQGVAEVYETEMITDGSFAHQVRVPAGGSVEPASEETVRKGRHKLDVYDP
FT                   ASMKEGLDRVSLPNFVRAAEGALKRSGLGLGDVDHLCVLHMKRSMHLGLLDALGIPADR
FT                   ALYLDDTGHMSGVDPLLALDRAARAGRLSEGDIVLLLAAGTGYTWAATALRWIGPRS"
FT                   /product="beta-ketoacyl-acyl-carrier-protein synthase I"
FT                   /protein_id="YP_003651043.1"
FT   gene            474859..475287
FT                   /db_xref="GeneID:9166904"
FT                   /locus_tag="Tbis_0423"
FT   CDS_pept        474859..475287
FT                   /locus_tag="Tbis_0423"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01951"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF101"
FT                   /db_xref="GI:296268412"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="GeneID:9166904"
FT                   /translation="MVSSGYRAIPRAAGLVVEAWGDSREECLAEAVRAVVDSFAEIGDA
FT                   VPDGSVEFALAVRDDDALLLTVLDEVIDQIQVEERVPVDVSIDEGTGIAMGEFEIRLAT
FT                   VPLEAVREVGALPEAVQPAGSWFRRESGVWRAHALIEV"
FT                   /protein_id="YP_003651044.1"
FT   gene            475457..475948
FT                   /db_xref="GeneID:9166905"
FT                   /locus_tag="Tbis_0424"
FT   CDS_pept        475457..475948
FT                   /locus_tag="Tbis_0424"
FT                   /gene_family="HOG000110012" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /codon_start="1"
FT                   /product="Hsp90 ATPase activator family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: pde:Pden_4582 hypothetical protein"
FT                   /db_xref="GI:296268413"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="GeneID:9166905"
FT                   /translation="MAVTLFHRGPSLAALHDEYAARGRIDHEAPVRSSSGTVVAAPAER
FT                   VWAIMADVASWPSWASNLQVLELGEVRPGETFRWRLGPVTIRSRFARVDPGRELTWTGT
FT                   FFWYRAVDRHVLEPPGDGTTRVTIEESLAMPLLPLLYGEARLRANHERWLAELKAVAEA
FT                   "
FT                   /protein_id="YP_003651045.1"
FT   gene            476071..476469
FT                   /db_xref="GeneID:9166906"
FT                   /locus_tag="Tbis_0425"
FT   CDS_pept        476071..476469
FT                   /locus_tag="Tbis_0425"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: bcy:Bcer98_1820 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268414"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:9166906"
FT                   /translation="MFNIGEFARLGRVSVRMLRHYDALGLLRPARVDPVTGYRYYEARQ
FT                   LSRLNRLLALKDLGLAGRRGTADERGRPGTTAHPDAGDHPIRGTLTSGVPGVSGCRSGW
FT                   ISRTRPRHAVANGIPSGRRCAGRSRCPR"
FT                   /protein_id="YP_003651046.1"
FT   gene            476917..478263
FT                   /db_xref="GeneID:9166907"
FT                   /locus_tag="Tbis_0426"
FT   CDS_pept        476917..478263
FT                   /locus_tag="Tbis_0426"
FT                   /gene_family="HOG000219166" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /codon_start="1"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /transl_table="11"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: scl:sce2618 putative cytosine permease"
FT                   /db_xref="GI:296268415"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="GeneID:9166907"
FT                   /translation="MASALGNDDYAISRVPLQARYSWWSVAVQRFGQLSALSQFLLGAT
FT                   LGFGMTFWESFWAITFGAVILEVVAIALGVIGMREGMSTSMLARWCGFGQAGSALIGLA
FT                   IGISLVGWFGIQSGVSAEGLYQLLPVMPVWAWSLVFGLAVTAIVVKGFHSMAWTAYLTV
FT                   PAFMLLVAWSIGSELANHSLADLVASAPAGPRLSLLEGTTLVAGGFIVGAVITPDMTRY
FT                   NRSVGDVIKQTLVGITLGEYVIGLAGVLLAHAVKSANIVTIVTSTVGLIGVLVIVTGTL
FT                   KINDWNLYSSGLGVVNFIGTVFGRQANRAVVTLCVGVVGSVLAAAGILERFTDFLTLLG
FT                   VTFPPIAGIMIAEYFVVRTWRRQLTATNKAGTMPAEAPRWVPATLVIWLIASAIGKFVT
FT                   WGLPSINSLVAAFALYVIAGWLGLIRGYGTAHTESVESGAAQTSAPSAS"
FT                   /protein_id="YP_003651047.1"
FT   gene            478290..479849
FT                   /db_xref="GeneID:9166908"
FT                   /locus_tag="Tbis_0427"
FT   CDS_pept        478290..479849
FT                   /locus_tag="Tbis_0427"
FT                   /gene_family="HOG000168685" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /codon_start="1"
FT                   /product="hydantoinase/oxoprolinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: mlo:mll9131
FT                   hydantoinase"
FT                   /db_xref="GI:296268416"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="GeneID:9166908"
FT                   /translation="MRIGIDVGGTNTDAVLMDGQRVLAAVKTATTRDVTSGINTALAEL
FT                   KRQRAFDPVAIQAVMIGTTHFINALVEAERLAPTAAIRLGLPATASLPPMVDWPERLVR
FT                   AISGRYYLCHGGHEFDGRHISELREDEIRRVAEDLRRHGIRSLAISSVFSPVNAEFEQR
FT                   AAEILSEELPDVAISLSSEIGRMGLLERENATIINASLRELASQIVDGLAGSLEKAGIT
FT                   APLYLSQNDGTLMDVEFARRYPVATFASGPTNSMRGAAFLSGVETCAVVDVGGTTSDIG
FT                   VLRHGFPREATTEVSVAGIRTNFRMPDVLSLGIGGGSRVRSGDDGVTVGPDSVGYRLTE
FT                   EALVFGGSTLTATDVAVAAGRAEIGDPSLVRGLDRSLVEAALRRIAKDVEDAIERIRTS
FT                   PEPLPVIAVGGGSIVLPDEIGDSGPIHRPDHFAVANAIGAAIAQIGGEVDRIYPVEPGR
FT                   RQAVLDEAKQEAVDRAIASGARPGSVRIVEVDEVPLAYLPGNATRIRVKAVGELQLEAA
FT                   DA"
FT                   /protein_id="YP_003651048.1"
FT   gene            479842..480930
FT                   /db_xref="GeneID:9166909"
FT                   /locus_tag="Tbis_0428"
FT   CDS_pept        479842..480930
FT                   /locus_tag="Tbis_0428"
FT                   /gene_family="HOG000223282" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   mlo:mll9130 hypothetical protein"
FT                   /db_xref="GI:296268417"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="GeneID:9166909"
FT                   /translation="MPERLITEADLDDIAVGAAILGTGGGGDPHIGRLLAHAAVRAHGP
FT                   VRLVGLDTVPDDAVTMVVAMMGAPTVMLEKVPSAEQASRAVEALAAYLGRTPTHLACAE
FT                   AGGVNALVPVVAAAQLGLPLIDADGMGRAFPELQMVMPTLYGIGATPMSIADEKGNSGV
FT                   FATIDNHWAERLARSATIDMGCSAMISLFPMNGEQARKALVPGTLSLCAELGRLVREER
FT                   AAHRDPVAAVTERLGGVELFHGKVVDVSRRTEGGFARGEAVLDGLGGCTGERMELRFQN
FT                   ENLVAERDGTVVASVPDLICVLDAEAGTAITTETLRYGQRVRVIAAPCDPRWHTPEGIE
FT                   LVGPRYFGYDHDPVRVGMGVGA"
FT                   /protein_id="YP_003651049.1"
FT   gene            480927..482030
FT                   /db_xref="GeneID:9166910"
FT                   /locus_tag="Tbis_0429"
FT   CDS_pept        480927..482030
FT                   /locus_tag="Tbis_0429"
FT                   /gene_family="HOG000223282" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   scl:sce2619 hypothetical protein"
FT                   /db_xref="GI:296268418"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="GeneID:9166910"
FT                   /translation="MSYTLEREDLADLARGAALLGTGGGGDPYIGRLLVEQALREGDGK
FT                   ITVLDPSDLRDDDLVIPTAQMGAPTVVVEKIPHGDEPVAALRALEERLGRRADATMPIE
FT                   CGGINSMIPLLVAARTGLPVVDADGMGRAFPELQMETFSVYGVPGSPLAIGGENGETVI
FT                   IDTGADNKRMEWLARGVTIRLGGVAHIAEYAMSGAEVRRTAVPNTLTLGLRIGRALRTA
FT                   RERHGDFIEALAGALEGSGYDNIRVLFRGKVVDVERRTVGGFARGHATFAAFDGPERLE
FT                   LTFQNENLVARVDGEVRCVVPDLICVLEAETGEPITTEGLRYGQRAVVVGISTPELMRT
FT                   PEALAVFGPRAFGLDVEFEPVERLVSP"
FT                   /protein_id="YP_003651050.1"
FT   gene            482035..483099
FT                   /db_xref="GeneID:9166911"
FT                   /locus_tag="Tbis_0430"
FT   CDS_pept        482035..483099
FT                   /locus_tag="Tbis_0430"
FT                   /gene_family="HOG000223282" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   scl:sce2619 hypothetical protein"
FT                   /db_xref="GI:296268419"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="GeneID:9166911"
FT                   /translation="MPYHLGERDVDHLARGVTLLGSGGGGQTDTAGRLLRRTLAGDRVA
FT                   LLRRDELPGGDIVPVGIVGAVSAFTERLPAGGEWGPVVAAVTERTGVRPAGLMSIEAGG
FT                   VNGILVFVAARELGLPVIDADLMGRALPRLDQTSTAAAGEPLTPLAIGDATGRLLILDG
FT                   LSPTAAERIVRSALSEFGGWAAVALRPLPAGRLDRVAIPGSFARALRLGACHAAWHRAA
FT                   DPYAMAAALGARVLVLGRVVEVVRHRAGTGFGRGSVIIRATGGRTLVRLEMENEYLLAL
FT                   ADGRPVASTPDILCVLDRATGVAISCDSVRGGAEVVVLHLPGPAFWWRPEAVGAVAPRA
FT                   FGLDIDPVGPEDRR"
FT                   /protein_id="YP_003651051.1"
FT   gene            483096..484640
FT                   /db_xref="GeneID:9166912"
FT                   /locus_tag="Tbis_0431"
FT   CDS_pept        483096..484640
FT                   /locus_tag="Tbis_0431"
FT                   /gene_family="HOG000223645" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG2508"
FT                   /codon_start="1"
FT                   /product="putative PucR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCV4471 sugar diacid utilization
FT                   regulator"
FT                   /db_xref="GI:296268420"
FT                   /db_xref="GeneID:9166912"
FT                   /translation="MRRGAPTLRELLGHPRLAAAVPLAGEDDLDRPVTGVTLIDPADTS
FT                   PVQAGDIALCPAVPPGFLSGWRLDATLRRLHDQRAAALAVPVGENGALLDSTRQLARHL
FT                   HLPVLGLRTAPLRWAGEAIALVHAPEVDAAEVLRRAHRALTREPMSPQEVARALSGILD
FT                   RPVGVFSPDGTPTGVTPEPSPRFNPRATVAQIVTEHGRTTVAVPVPGTTVGAVDLWLAA
FT                   ALGQAPAYWAAAVRDVLQAGALAVQRWQAVRRVVLERDARLRAGLFSDLLEGRLGTGDV
FT                   PRERASEIGWRLDGWHVAFHIAALGQVDLLRHTDAVSAAIAAEGIDAAVVERGDGWSGW
FT                   TTTRDEPDQDADRELLAALRRVRRRLATRFDCAIGVGRAYLGPAGLTRSLAEAWDAARL
FT                   ARGRPQAGRLAHIDRLGLAQLLVAWASTETFAPTAARLLKPLESQPGDLIATLTAYLDA
FT                   GGSVAETAAVLGVHRNTVTARLRRIEELLTVDLANPDDRLALHLACRVTQGRQSGG"
FT                   /protein_id="YP_003651052.1"
FT   gene            484977..485990
FT                   /db_xref="GeneID:9166913"
FT                   /locus_tag="Tbis_0432"
FT   CDS_pept        484977..485990
FT                   /locus_tag="Tbis_0432"
FT                   /gene_family="HOG000105698" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /codon_start="1"
FT                   /product="type 12 methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: cps:CPS_2928 hypothetical protein"
FT                   /db_xref="GI:296268421"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:9166913"
FT                   /translation="MTRTPYVARHRSRLGYRLAYALRHPGKVWPYLRRLTRDARLRLTT
FT                   RDHISYYRAVMRADIKEMGPDAAIGSHSRRSWLRVGKMQFDYLIAHGLSPQDRVLDIGC
FT                   GNLRLGWRLIHYLEPGHYYGIDISPEILLAAADTVAWYGLQAKLPYLALVDDLTFAALP
FT                   DAYFTVVHAHSVFSHSPIEVIDECLRHVGRILHPDGFFDFTFDRTEKEEHHVLREDFYY
FT                   RTETLVELAARYGLRAEFMADWERYRHKQSRIRVRHARRRAVGRGEGGRRPGGRAVRSP
FT                   VSRPAVTGRAREAAVGGRGRPPSRSRSAALPGIPRRRVIRPAGRGRRGPGRRRCTW"
FT                   /protein_id="YP_003651053.1"
FT   gene            complement(485935..487116)
FT                   /db_xref="GeneID:9166914"
FT                   /locus_tag="Tbis_0433"
FT   CDS_pept        complement(485935..487116)
FT                   /locus_tag="Tbis_0433"
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: rpi:Rpic_1910 acetyl-CoA acetyltransferase"
FT                   /db_xref="GI:296268422"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:9166914"
FT                   /translation="MESGEKILVIDGARTPVGSFGGALKDVPAHELGAIAVREALRRAG
FT                   VDGSDVGEVVMGCIGQVGPDAYNARRVAVAAGLPVGTPAYTVNRLCGSGLQAVWSAAMQ
FT                   LRWGDIDFAVAGGDESMSRMPFYDFGARSGYKLGDRTLYDGTVMMLTDPFHNIHMGRTA
FT                   EAVARKYGVSRQEQDEFALRSQRRAASPEAKAAFAEEITPVEVKGRKPYTVEADEHPRP
FT                   DTTLEALARLKPVFEENGTVTAGNASGINDGAAALVLTRESVAAERGLRALVSLEAVVT
FT                   AAMEPELMGYAPVLALRKLFERTGTGPKDIDVFEVNEAFAAQAVAVIRDAGLDPEKTNP
FT                   YGGAIALGHPVGATGAILTLRVAKHLVRHDKELGVVTMCIGGGQALAALFRRV"
FT                   /protein_id="YP_003651054.1"
FT   gene            complement(487232..487423)
FT                   /db_xref="GeneID:9166915"
FT                   /locus_tag="Tbis_0434"
FT   CDS_pept        complement(487232..487423)
FT                   /locus_tag="Tbis_0434"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268423"
FT                   /db_xref="GeneID:9166915"
FT                   /translation="MGNRMAARGVATGQGNTSARETEPRSIPAGTGGGYCRGAPCYRHR
FT                   GWEAGAGMALALFTLTSY"
FT                   /protein_id="YP_003651055.1"
FT   gene            complement(487854..488225)
FT                   /db_xref="GeneID:9166916"
FT                   /locus_tag="Tbis_0435"
FT   CDS_pept        complement(487854..488225)
FT                   /locus_tag="Tbis_0435"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: tgr:Tgr7_1925 putative transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="GI:296268424"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:9166916"
FT                   /translation="MSIQDRLAAGAATWCAPLTCKPLSEDEAAEIAPLFKALADPVRLR
FT                   LLSLIASHEGGEVCVCDLTVAFDVTPPTISHHLKVLRQAGLIEGDRRGTWVYYRANPEV
FT                   LAKLAAVIGPAPAVQAGTA"
FT                   /protein_id="YP_003651056.1"
FT   gene            488619..489872
FT                   /db_xref="GeneID:9166917"
FT                   /locus_tag="Tbis_0436"
FT   CDS_pept        488619..489872
FT                   /locus_tag="Tbis_0436"
FT                   /gene_family="HOG000148525" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /codon_start="1"
FT                   /product="amidohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   pst:PSPTO_2801 prolidase, putative"
FT                   /db_xref="GI:296268425"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="GeneID:9166917"
FT                   /translation="MSAFVLENANLLDLESGEFRPATSVRVEGDRIVEVSEPGATLTAP
FT                   DDVPRLAAGGRTLLPGLIDAHVHAAITTMDFAALGRRAYTRIGIEAKAILERMLRRGFT
FT                   TVRDAGGLDAGLKEALQLGLISGPRVFRSGRVLSQTGGHGDTIPPNPAAEPHLCACSIH
FT                   STGFAHIADGPDAVRRAVREELKGGADQIKVMAGGGVASPSDPIDMVQYSEEEIRVAVE
FT                   EAARRRTYAFAHAYVPDAIVQAVRAGVRSIEHGNLIDAEAARVMAEHGCYLVPTLVTYD
FT                   QLVELGRQLSLPPESMAKLDAVVNAGKSAIETALAAGVRIGFGTDLLGETHDAQSKEFL
FT                   LRAEVQPPLDVLRSATLVNAELLGKTGELGVIAPGAYADLLLVDGDPLADISVLTGQGE
FT                   RLDLIVRGGEIVVNRLPG"
FT                   /protein_id="YP_003651057.1"
FT   gene            complement(490130..491134)
FT                   /db_xref="GeneID:9166918"
FT                   /locus_tag="Tbis_0437"
FT   CDS_pept        complement(490130..491134)
FT                   /locus_tag="Tbis_0437"
FT                   /gene_family="HOG000179135" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.8"
FT                   /transl_table="11"
FT                   /note="KEGG: sde:Sde_3061 xylanase/chitin deacetylase-like;
FT                   PFAM: glycoside hydrolase family 11; SMART:
FT                   cellulose-binding family II"
FT                   /db_xref="GI:296268426"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="GeneID:9166918"
FT                   /translation="MFRSPRGHGRGRRFIGRICALAVAVITGLTMSVGTAHAQTISSNQ
FT                   TGYHDGYFYSFWTDAPGTVSMTLGSGGNYSTSWWNTGNFVAGKGWATGGRRTVTYSASF
FT                   NPSGNAYLALYGWTRNPLVEYYIVESWGTYRPTGTYKGTVTTDGGTYDIYETTRYNAPS
FT                   IEGTRTFKQFWSVRQSKRTSGTITTGNHFDAWARAGMQLGSFDYMIMATEGYQSSGNSN
FT                   VTLGTGGGGGTTPPPGGGGGGGGGGCQATIIPGQVWADRFNLSVQVTGTDNWVVTVTVT
FT                   PPQKIIATWNGNPTWDYTGNVMTMRPNGSGNTFGFTIMHNGNWSWPSVTCRVA"
FT                   /product="endo-1,4-beta-xylanase"
FT                   /protein_id="YP_003651058.1"
FT   gene            complement(491711..492013)
FT                   /db_xref="GeneID:9166919"
FT                   /locus_tag="Tbis_0438"
FT   CDS_pept        complement(491711..492013)
FT                   /locus_tag="Tbis_0438"
FT                   /gene_family="HOG000223392" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Sama_2843"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: saz:Sama_2843 hypothetical protein"
FT                   /db_xref="GI:296268427"
FT                   /db_xref="GeneID:9166919"
FT                   /translation="MREHCCAEMTRRVAWRCAEHDDPFDCPDAVVIFDARFQEYGLIVR
FT                   DGGRSFIEIHYCPWCGSRLPESRRDRWFAELEQRGIDPWTDEIPPEYQDDRWLHS"
FT                   /protein_id="YP_003651059.1"
FT   gene            complement(492179..492865)
FT                   /db_xref="GeneID:9166920"
FT                   /locus_tag="Tbis_0439"
FT   CDS_pept        complement(492179..492865)
FT                   /locus_tag="Tbis_0439"
FT                   /gene_family="HOG000253635" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="MerR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: rso:RS05447 transcription regulator
FT                   protein"
FT                   /db_xref="GI:296268428"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="GeneID:9166920"
FT                   /translation="MRPVDLAREHGLSTQAVRNYESAGILPPAGRTAAGYRVYTPVHAA
FT                   ALRAFLSLVAGHGHAMATAIMQAVNRGAVDEALRLIDESHARLLEDRRTLEAVEAALRD
FT                   LAPAPPPEPGGVHIGALARRLGVRPATLRKWEKAGLVRPRRDPRTGYRVYGAADVRDAR
FT                   LVHQLRRGGYLLAQIAPLIAQVRAAGGVEPLESAIRSWRERLAARGRAMLTGAADLEAF
FT                   LRARQG"
FT                   /protein_id="YP_003651060.1"
FT   gene            492956..494131
FT                   /db_xref="GeneID:9166921"
FT                   /locus_tag="Tbis_0440"
FT   CDS_pept        492956..494131
FT                   /locus_tag="Tbis_0440"
FT                   /gene_family="HOG000268871" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05139"
FT                   /codon_start="1"
FT                   /product="erythromycin esterase"
FT                   /transl_table="11"
FT                   /note="PFAM: Erythromycin esterase; KEGG: swi:Swit_1817
FT                   erythromycin esterase"
FT                   /db_xref="GI:296268429"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="GeneID:9166921"
FT                   /translation="MEIRDAARPLDGAAVSAFLRSLPARPDLLGLGEAMHFVTELGEAR
FT                   NAIFRHLVEHEGFRAFAIESDCLKALLVDEYVTTGAGDLDEVMERGFSHGFGAFPANRE
FT                   LVRWMREHNERHGDRLRFFGIDGPLEYWAASPREALAGLYALVDGPPCSWETIDELLGP
FT                   DARWSDEATVLDPSRSIGQSDDARRLRLITDDLITLLETQAPRLSPADRERAELYARTA
FT                   VGLLRYHHWMADTSPARVSRLSAVRDALMAANLRAIAAHGPVLVFSHNLHLQRSGSTMT
FT                   FGDQELAWWSAGALVSAHLGDRYAFIASALGALGDDGPPPGTLEGALATLPWERALADA
FT                   RALAAAVPGAAPRTSPHYAYFPLDPAQIGTADGVLFLGRVRVPDWPRGPRE"
FT                   /protein_id="YP_003651061.1"
FT   gene            494320..494907
FT                   /db_xref="GeneID:9166922"
FT                   /locus_tag="Tbis_0441"
FT   CDS_pept        494320..494907
FT                   /locus_tag="Tbis_0441"
FT                   /gene_family="HOG000108931" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hch:HCH_02830 hypothetical protein"
FT                   /db_xref="GI:296268430"
FT                   /db_xref="GeneID:9166922"
FT                   /translation="MVDTALATDPAAIERAVRDEPVGTTWPWNSGPKAIEAFLHRVVDA
FT                   MNGMRELCVVEAEFGHYGSGYASFVDVFLTKRDGSLRETFADGWTRFTGWTLALCRLAP
FT                   FAVLFGNSRVWYGPRPGTRSSSIPHRDRLPEDTVPASRTELWELAELLEGYGFAFLDPE
FT                   ILMLPIDPTLEIDTTLGERPYRVWDAWFHWAD"
FT                   /protein_id="YP_003651062.1"
FT   gene            complement(494938..495252)
FT                   /db_xref="GeneID:9166923"
FT                   /locus_tag="Tbis_0442"
FT   CDS_pept        complement(494938..495252)
FT                   /locus_tag="Tbis_0442"
FT                   /gene_family="HOG000268007" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00893"
FT                   /codon_start="1"
FT                   /product="small multidrug resistance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   rce:RC1_2954 multidrug resistance protein SugE, putative"
FT                   /db_xref="GI:296268431"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="GeneID:9166923"
FT                   /translation="MAWVVLIVSGMLETAWAVALAESKGLTRPLPTALFVLSLAASMLG
FT                   LGYALRSIPVGTAYAVWVGIGAVGTAVYGMVVLGEPATAGRLICLALIISGVVGLKLLH
FT                   "
FT                   /protein_id="YP_003651063.1"
FT   gene            495336..495815
FT                   /db_xref="GeneID:9166924"
FT                   /locus_tag="Tbis_0443"
FT   CDS_pept        495336..495815
FT                   /locus_tag="Tbis_0443"
FT                   /gene_family="HOG000251567" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG4994"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xcv:XCV1106 hypothetical protein"
FT                   /db_xref="GI:296268432"
FT                   /db_xref="GeneID:9166924"
FT                   /translation="MNDRVLSVVSGSGLTVMVREPPGNRLIDMGGEHDDPVQAAITGEM
FT                   RLLEWEVRSSAVLLGELLDPEFTEIGASGRLWDRHSLINALTQESDAPPYRITVSEMKG
FT                   RLLAPGIVHLTYVSDENGRRARRSSIWRRSEQGWRLYFHQGTLLPPQEPMPADLG"
FT                   /protein_id="YP_003651064.1"
FT   gene            496054..496434
FT                   /db_xref="GeneID:9166925"
FT                   /locus_tag="Tbis_0444"
FT   CDS_pept        496054..496434
FT                   /locus_tag="Tbis_0444"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="ArsR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: dsh:Dshi_3967 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268433"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:9166925"
FT                   /translation="MISREALAPAAALFRSLADPVRLSIVQRLARGEARVVDLTRELAL
FT                   PQSTVSKHLACLRDCRLVDYRAEGRQSFYFIATPELLDLLRSAEALLAATDQAVALCPT
FT                   YGTACAGSRPAEAPAVGEGTAG"
FT                   /protein_id="YP_003651065.1"
FT   gene            496431..497153
FT                   /db_xref="GeneID:9166926"
FT                   /locus_tag="Tbis_0445"
FT   CDS_pept        496431..497153
FT                   /locus_tag="Tbis_0445"
FT                   /gene_family="HOG000108489" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01545"
FT                   /codon_start="1"
FT                   /product="cation efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cation efflux protein; KEGG: sus:Acid_3868
FT                   integral membrane protein"
FT                   /db_xref="GI:296268434"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="GeneID:9166926"
FT                   /translation="MTALTVGPSPERRAVLMRRVRLLVAATISYNVIEAVVAIAAGSVA
FT                   SSGALVAFGLDSVIEVASAAAVAWQFSARDPEVVERRERRALRMIALSFFALALYVSVD
FT                   SVAALLGGGEAEHSTPGLILAALSLVIMPVLSYAQRRAGRELGSASAVADSKQTLLCTY
FT                   LSAVLLAGLAVNSLFGWAWADPVAALVIAGVAVKEGLEAWRGDACCQPPLHPAAALSGR
FT                   ADGEPGCSACGPGCACCS"
FT                   /protein_id="YP_003651066.1"
FT   gene            497188..497814
FT                   /db_xref="GeneID:9166927"
FT                   /locus_tag="Tbis_0446"
FT   CDS_pept        497188..497814
FT                   /locus_tag="Tbis_0446"
FT                   /gene_family="HOG000138432" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce8712"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce8712 hypothetical protein"
FT                   /db_xref="GI:296268435"
FT                   /db_xref="GeneID:9166927"
FT                   /translation="MALTALAVYLVSLALAFGVRTWVQWRRTGDTGFRGGGLRPGSVQW
FT                   WARLLFIAALVAVAAGPVAELAGLAAVPALDVPVVRVSGLILALLGTAAVLAAQASMGA
FT                   SWRIGVDESERTDLVTTGAFAMVRNPIFTAMMITAAGLAAMVPNVVSLAALALTVVSIE
FT                   VQVRAVEEPYLLRVHGEAYARYAARVGRFLPGLGRLRRSGAPAGR"
FT                   /protein_id="YP_003651067.1"
FT   gene            complement(498036..499166)
FT                   /db_xref="GeneID:9166928"
FT                   /locus_tag="Tbis_0447"
FT   CDS_pept        complement(498036..499166)
FT                   /locus_tag="Tbis_0447"
FT                   /gene_family="HOG000217409" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.1.1.11"
FT                   /codon_start="1"
FT                   /EC_number="3.1.1.11"
FT                   /transl_table="11"
FT                   /note="PFAM: Pectinesterase; KEGG: cja:CJA_0181 pectin
FT                   methylesterase, putative, pme8C"
FT                   /db_xref="GI:296268436"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:9166928"
FT                   /translation="MSHTPLIGRRQVLAGAAGILGLALASPARAAHVPPFGRYGSPRHR
FT                   LNDRTLYVDSQGRGDYTTVQAAVDATPDSPAEGWTLVIAAGTYRETVLVPQAKTGLCFL
FT                   GATGDARDVVIVYDNAAGTPKPDGGTYGTSGSATATIQADGFTAAHVTFANDWLRADHP
FT                   EITDTQAVAAKVMGDRSYFERCRFLGHQDTLYADTRNVATFARQYYRECYIEGDVDFVF
FT                   GRATAVFERCELTTLARDVTFRPYGFVFAPSTAAANPHGFLAVHCVINGPAADASFGLA
FT                   RPWRPSSDPTAVPSLVVRETWMGPSIDAATPYVDMSSGYHWRDARFGEFHNKGPGAAIP
FT                   VPENRPQLTPQQAAEHTPRKYLGDWHPRPALLPRPH"
FT                   /product="pectinesterase"
FT                   /protein_id="YP_003651068.1"
FT   gene            complement(499421..499494)
FT                   /note="tRNA-Gly5"
FT                   /db_xref="GeneID:9166929"
FT                   /locus_tag="Tbis_R0013"
FT   tRNA            complement(499421..499494)
FT                   /db_xref="GeneID:9166929"
FT                   /locus_tag="Tbis_R0013"
FT                   /product="tRNA-Gly"
FT   gene            499776..500351
FT                   /db_xref="GeneID:9166930"
FT                   /locus_tag="Tbis_0448"
FT   CDS_pept        499776..500351
FT                   /locus_tag="Tbis_0448"
FT                   /gene_family="HOG000228601" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /codon_start="1"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: amc:MADE_01987
FT                   deoxycytidine triphosphate deaminase"
FT                   /db_xref="GI:296268437"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="GeneID:9166930"
FT                   /translation="MLLSDRDLRAEIESGRIKIDPWDPEMLQPSSIDVRLDRYFRVFEN
FT                   HRYPHIDPAVEQPDLTRLVEPVGDEPFILHPGEFVLASTYEVISLPDDVAARLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFEGHVTLELSNVATLPIKLWPGMKIGQLCMFRLSSPAEYPYG
FT                   SPRYGSRYQGQRGPTPSRSYLNFHRTKV"
FT                   /protein_id="YP_003651069.1"
FT   gene            500497..501114
FT                   /db_xref="GeneID:9166931"
FT                   /locus_tag="Tbis_0449"
FT   CDS_pept        500497..501114
FT                   /locus_tag="Tbis_0449"
FT                   /gene_family="HOG000062967" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   aba:Acid345_3130 protein of unknown function DUF47"
FT                   /db_xref="GI:296268438"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="GeneID:9166931"
FT                   /translation="MRLRLTPREDSYYDLFAHAANNIVTASRVLVEIISDGSDREALAE
FT                   KMRACEHAGDEHTHAIMNRLNESFITPFDREDIYRLASNLDDVMDFMEAAADLIVLYQI
FT                   DRLPRDVIQQVEVLERAAELTADAMPRLRSMQHLNGYWIEINRLENQADQIYRRLLAKL
FT                   FSGEYDALTVMKMREVIEQLELAADAFEHVANTIESIAVKES"
FT                   /protein_id="YP_003651070.1"
FT   gene            501115..502116
FT                   /db_xref="GeneID:9166932"
FT                   /locus_tag="Tbis_0450"
FT   CDS_pept        501115..502116
FT                   /locus_tag="Tbis_0450"
FT                   /gene_family="HOG000231894" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /codon_start="1"
FT                   /product="phosphate transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphate transporter; KEGG: sfu:Sfum_2275
FT                   phosphate transporter"
FT                   /db_xref="GI:296268439"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="GeneID:9166932"
FT                   /translation="MELALVIGVIVIALIFDYTNGFHDAANAIATSVSTRALTPRTALI
FT                   MAAVMNFIGAHLGTSVAQTVGKGIIAPPDGQQGLLIVGGALIGAILWNLITWYFGLPSS
FT                   SSHALIGGLVGSALAAGAGVSWSGVVEKVVIPMILSPVIGFTLGALIMIAILWIFRRSN
FT                   PHRTGKGFRYAQTVSAAAMALGHGLQDAQKTMGVIFLALVVGGYVAPTDPIPEWVITIA
FT                   AAAISLGTYAGGWRIMRTLGRRIIHLNAPAGFAAEMAAASVLYGAAMGFGAPISTTHTI
FT                   TTAIMGVGATRRLSAVRWGVAGNIVTAWVLTIPAAAVVAALSYGLLHLIFRV"
FT                   /protein_id="YP_003651071.1"
FT   gene            complement(502118..503005)
FT                   /db_xref="GeneID:9166933"
FT                   /locus_tag="Tbis_0451"
FT   CDS_pept        complement(502118..503005)
FT                   /locus_tag="Tbis_0451"
FT                   /gene_family="HOG000248937" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03448"
FT                   /codon_start="1"
FT                   /product="mycothiol biosynthesis acetyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: mycothiol biosynthesis acetyltransferase;
FT                   PFAM: GCN5-related N-acetyltransferase; KEGG: predicted
FT                   protein"
FT                   /db_xref="GI:296268440"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="GeneID:9166933"
FT                   /translation="MTVRVEIRETPGDQEAVLALAEAAAEADGVRPLNEQTLLALRYGG
FT                   PSGARFLLLYDGDELAGFAYLEPSDPPSGELVVHPGFRGRGLGGRLLAAVLDTGGKGVR
FT                   LWAHGDLPAAARLAAGFGMTRARALWRMRRPLTTPLPAPELPEGVRLRTFEPGRDEEAW
FT                   LALNARAFADHPEQGSWTLEDLKRRQQEPWFDPAGFFLAERAGTLVGFHWTKVHAQAEG
FT                   ADGPIGEVYVVGVDPEERGTGLGRALTLAGLAHLRSRGLDQVMLYVDEANTAAVRLYES
FT                   LGFTRWTVDVMYRR"
FT                   /protein_id="YP_003651072.1"
FT   gene            503136..504872
FT                   /db_xref="GeneID:9166934"
FT                   /locus_tag="Tbis_0452"
FT   CDS_pept        503136..504872
FT                   /locus_tag="Tbis_0452"
FT                   /gene_family="HOG000247215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /codon_start="1"
FT                   /product="5'-nucleotidase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: scl:sce7039 putative
FT                   5'-nucleotidase family protein"
FT                   /db_xref="GI:296268441"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="GeneID:9166934"
FT                   /translation="MTKAFLTRLAVAGTAVAGVLALAALPAGADPAPQSASKGRGNGGS
FT                   KPDHSVPVRLLTINDLHGNLEPPTGSSGRIVDETGQTVDAGGAAYLAAHLKRLRDRNTL
FT                   VVAAGDLIGASPLISAAYHDEPTVSLLDKLGLATSAAGNHEFDEGYAELKRIMDGGCHP
FT                   TDGCSPAGKWKGARFDYLAANVVREKNGAEALPPYVIKQVNGVKIGFIGLVTQTTPSIV
FT                   TSSGIQGLEFTDEVEAANRVSRLLAAKGVKAQVVLVHEGDQVATPQSPDTCPVVPGPGS
FT                   RIAAGLDPEIDLVISGHSHQAYICKIKDPAGQDRYHTQGSSFGRIITQIDFRVDRKTRD
FT                   VIRSSVSADNHVVTRTITPDPEVEAYVQTWKERVSVVANRPVGNITATIARDPSGAGES
FT                   PLGNLIADAQLEAAREGGAEIALMNPGGVRADLTYPASGSEGDGVVTYGEAFTVQPFNN
FT                   LVQVVTLTGEQLRRLLEQQWTESYTRVLQPSASLTYTADLTKPIGSRVSDIKINGIPVT
FT                   DTQRIRVAANNFLIGGGDGFTVFTEGTELWSGPLDIDAFVAYLSAHSPVDPPATDRITF
FT                   IR"
FT                   /protein_id="YP_003651073.1"
FT   gene            complement(505014..505769)
FT                   /db_xref="GeneID:9166935"
FT                   /locus_tag="Tbis_0453"
FT   CDS_pept        complement(505014..505769)
FT                   /locus_tag="Tbis_0453"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /codon_start="1"
FT                   /product="putative winged helix family two component
FT                   transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: bcb:BCB4264_A1351 DNA-binding response regulator"
FT                   /db_xref="GI:296268442"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:9166935"
FT                   /translation="MSNLLLLTNALEPSTEILPALGLLLHPVRVAPAEASALIDAPPAD
FT                   AILVDARRELIHAKSLCRLLRTTGLTAPLIAIVTEGSLAAINAEWGVDDVVLESAGPAE
FT                   VEARLRLAIGKLSTSEAEKAPGEIRSGDLSIDEATYTARIRGRVLDLTFKEFELLKYLA
FT                   QHPGRVFTRAQLLQEVWGYDYFGGTRTVDVHVRRLRAKLGSEYESLIGTVRNVGYRFVP
FT                   DRGGDQQNKVAREKAREAAREKNPEEQHA"
FT                   /protein_id="YP_003651074.1"
FT   gene            505996..506244
FT                   /db_xref="GeneID:9166936"
FT                   /locus_tag="Tbis_0454"
FT   CDS_pept        505996..506244
FT                   /locus_tag="Tbis_0454"
FT                   /gene_family="HOG000280991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /codon_start="1"
FT                   /product="thiamineS protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamineS protein; KEGG: ade:Adeh_1120
FT                   molybdopterin synthase subunit MoaE / molybdopterin
FT                   synthase subunit MoaD"
FT                   /db_xref="GI:296268443"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="GeneID:9166936"
FT                   /translation="MASGTVRYWAAAKDAAGVAEEPFEAETLGELIRRISGNPELERVL
FT                   RRSSFLVNGAPAGTRDPGTIRLPEGAVVEVLPPFAGG"
FT                   /protein_id="YP_003651075.1"
FT   gene            506376..507056
FT                   /db_xref="GeneID:9166937"
FT                   /locus_tag="Tbis_0455"
FT   CDS_pept        506376..507056
FT                   /locus_tag="Tbis_0455"
FT                   /gene_family="HOG000105530" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory transducer
FT                   with   cache sensor"
FT                   /db_xref="GI:296268444"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="GeneID:9166937"
FT                   /translation="MRKLLVSVFVLAALLVGLDRVAVVGAEREIARRVQAVFDLPDPVS
FT                   VDITGFPFLTQALSGRLEEISLSAGEVTKAGITLSRIDATLEGVTAPLGELIEDSANAD
FT                   VRAERITGTAVISMKTIAEFAPPGIRVTGTGGDTVKVSGRVTAFGQRVPVDAEMKIHVG
FT                   RGEIRLTPVSVNVGGGMQVPNAERLLTFTVPIPNLPLGLKVTRVTSTSDGLALTGTATD
FT                   VRFR"
FT                   /protein_id="YP_003651076.1"
FT   gene            507040..507618
FT                   /db_xref="GeneID:9166938"
FT                   /locus_tag="Tbis_0456"
FT   CDS_pept        507040..507618
FT                   /locus_tag="Tbis_0456"
FT                   /gene_family="HOG000094755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="ECF subfamily RNA polymerase sigma-24"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   rpa:RPA0550 RNA polymerase sigma factor RpoE"
FT                   /db_xref="GI:296268445"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:9166938"
FT                   /translation="MSDSAEPGRAGEPPGPAVRDKGVGTGAGTGEELVRALFAHHAGPL
FT                   YGYALRLTGDPGKAEDVVQETLLRAWRHPAVLEGRPVRAWLFTVARNLVVDQHRARQAR
FT                   PQETGDEALARVPADDELERAVESWEIAEAIASLRPEHRDVLLEVYYRGKSVKEAAEAL
FT                   GIPPGTVKSRTYYALRALKLALEERGLAP"
FT                   /protein_id="YP_003651077.1"
FT   gene            507636..508391
FT                   /db_xref="GeneID:9166939"
FT                   /locus_tag="Tbis_0457"
FT   CDS_pept        507636..508391
FT                   /locus_tag="Tbis_0457"
FT                   /gene_family="HOG000110161" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /transl_table="11"
FT                   /note="KEGG: ank:AnaeK_0242 Fe-S oxidoreductase"
FT                   /db_xref="GI:296268446"
FT                   /db_xref="GeneID:9166939"
FT                   /translation="MSLGVYVLGALDADEEAAVRAHLEACAACRAEAEELSGLTPLLAR
FT                   VTERDIEQVGEPPRAVLDRLITTAARRGRRRRLLLALAASVSVVALAGTAWLTVAQGAR
FT                   NGAAESAADTSTAQTADISAADRPEIALDRASTPGDGRTTMATEARGANGDMRVAVRLI
FT                   PREGGTEVVARVAGVPAGTLCTLRAIGTDGTVAPVGSWSVAPGLYREDNVVFEGRTGLQ
FT                   LPYIQRLELTGSDGDVLVTVPVRHRPGPG"
FT                   /protein_id="YP_003651078.1"
FT   gene            508576..509103
FT                   /db_xref="GeneID:9166940"
FT                   /locus_tag="Tbis_0458"
FT   CDS_pept        508576..509103
FT                   /locus_tag="Tbis_0458"
FT                   /gene_family="HOG000045722" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: afw:Anae109_4125 cytochrome c biogenesis
FT                   protein transmembrane region"
FT                   /db_xref="GI:296268447"
FT                   /db_xref="GeneID:9166940"
FT                   /translation="MVGVIVLAVTLAVGVVIGLFLRHRDGRMRTVSAPASDQAPQERSP
FT                   GEPSAGATVLTSEDIGAELGERATLVQFSTAFCQPCRATRVVLGEVARIVPGVRHVEID
FT                   AESRLDLVRRLGIMRTPTVLVLDRSGNVVKRASGRPRKVDVIAALGAVVDDDAPRPAAE
FT                   TSHEPSQHSDKV"
FT                   /protein_id="YP_003651079.1"
FT   gene            509296..509706
FT                   /db_xref="GeneID:9166941"
FT                   /locus_tag="Tbis_0459"
FT   CDS_pept        509296..509706
FT                   /locus_tag="Tbis_0459"
FT                   /gene_family="HOG000042676" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tdn:Suden_0151 CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="GI:296268448"
FT                   /db_xref="GeneID:9166941"
FT                   /translation="MQIDPRGPRFSAVITTLVLAAVLVTGSAWLLAFQALVFVLGIFDA
FT                   SPYGLIYKRLVRPRLGPPSELEDAAPPRFAQGVGSVFAIAGLIGFATGITPLAYGATAA
FT                   ALLAAFLNAAFGLCLGCQMYLIIRRLQPGRVQ"
FT                   /protein_id="YP_003651080.1"
FT   gene            509703..510542
FT                   /db_xref="GeneID:9166942"
FT                   /locus_tag="Tbis_0460"
FT   CDS_pept        509703..510542
FT                   /locus_tag="Tbis_0460"
FT                   /gene_family="HOG000157236" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.8.1.1"
FT                   /codon_start="1"
FT                   /EC_number="2.8.1.1"
FT                   /transl_table="11"
FT                   /note="KEGG: cja:CJA_2345 rhodanese-like domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="GI:296268449"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9166942"
FT                   /translation="MSRSAVLVDADWVEANLDTPGVVIVEVDEDTTAYDKGHIRGAIKL
FT                   DWKKDLQDPVRRDFIDKAGFEALLSERGIANDDTVVLYGGNNNWFAAYAYWYFKLYGHE
FT                   KVKLLDGGRKKWELESRELVTEVPQRPRTNYKAKDQDLSIRAFRDDVINAIGKLNLVDV
FT                   RSPDEFVGKLLAPAHLPQEQAQRPGHVPTARNIPWSKAVNDDGTFKSDEELRKIYSDAG
FT                   VDFSKDTIAYCRIGERSAHTWFVLHELLDLPNVKNYDGSWTEYGSLVGVPIELGEAR"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /protein_id="YP_003651081.1"
FT   gene            510542..510841
FT                   /db_xref="GeneID:9166943"
FT                   /locus_tag="Tbis_0461"
FT   CDS_pept        510542..510841
FT                   /locus_tag="Tbis_0461"
FT                   /gene_family="HOG000019364" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268450"
FT                   /db_xref="GeneID:9166943"
FT                   /translation="MSQGCGAPAQTVTLPVGVDLSSQAIIQGVVTGTGGTAYARLLDRT
FT                   GEFAGEVVVSDEGVFRFFAAPGRWTVRIIAAGGVTRDVEVEAKLGEVTQVSIDL"
FT                   /protein_id="YP_003651082.1"
FT   gene            511331..512695
FT                   /db_xref="GeneID:9166944"
FT                   /locus_tag="Tbis_0462"
FT   CDS_pept        511331..512695
FT                   /locus_tag="Tbis_0462"
FT                   /gene_family="HOG000110162" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbr:BB1601 hypothetical protein"
FT                   /db_xref="GI:296268451"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="GeneID:9166944"
FT                   /translation="MRQVSGTSAHAVADQPAVRRRPAWLLSPYALPLHALRIAGACALP
FT                   LIIWFSLGRVIRWGLLLLAATISHGEWYQARLVVVMFLFTLVVMASLVTTIGMLYILRG
FT                   ALMETQARRAAGEAHESLLNALNRTALVFCGIYLTWGFLAEDARDFMNIDLLRQPDRIF
FT                   IDAFAGEESTVMRGLIGLDLIVSAVTMAVAWVVKTLFARRHEAGRGRFSGVIATCGELA
FT                   FVLYGLNAVTTVLGARSDWVGSRVVIVAWQEWMEKARESIPGWKSVTDFIGEVWPYVVD
FT                   ALVLPLTWLTVGILVYGAYAEDTRTTIRGTPLERAAAPLERRTHALTRRALDRLTEGWT
FT                   SRWIPLLHSLRLTMRGGAPLFGMFALCYVGLHIGGIYLERAGRYLLDTGEPYFWIFTSV
FT                   PIEFVSELIVTTLSMCLIAATFDLAATRDRLARAQVSAGSAARDRSSPETSPLPS"
FT                   /protein_id="YP_003651083.1"
FT   gene            complement(512634..514322)
FT                   /db_xref="GeneID:9166945"
FT                   /locus_tag="Tbis_0463"
FT   CDS_pept        complement(512634..514322)
FT                   /locus_tag="Tbis_0463"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: SL44-1; basic proline-rich protein"
FT                   /db_xref="GI:296268452"
FT                   /db_xref="GeneID:9166945"
FT                   /translation="MSQPPRNGTPSGNTPEGQEWYVLPPDRPSDADPSAGTSGAFGMPA
FT                   QPPGGGAPAHGPYPQGGPADLPYGPHPGGHRGDLGYHFPVQPHGPRPGEGPHSAPASPP
FT                   PAAQPGPSLAAQPGEGGFPAPSPSHGQRPGEGGYPTPAPSHGQQPGEGGYSTPAPSSGT
FT                   QPADITYGAAPPPQGSHPGGEPQPGDITYGAALPPQPGDPAYEPAPPVPGAQPGEGAHG
FT                   TPPPPDITYSAALPPQGGRPGGEPRPDDVTYGAPLPAQGPQPGGEPQPGDITYSGPLPS
FT                   QGSPDITYSGRLPAQEPRPASSRVRPPQDKRVWPPEDDEDRSTQPFPALRGTRTLPPQP
FT                   PQQAEGPGRPEPPATAESGAAAQEGAAPGTGKGTSRARRTILLGGAAVLSVALAVGVPG
FT                   WFHYSVYRYGRPADHVHIVPKGESMVWQHVEWRATLFEIPPPDSSPGSTDRKWLKAVIT
FT                   RTALDQEGAIRHGTPEVMLTDRAGRTWRMEELSNETPPSTEQNRIGVTYRMEFIGVAPP
FT                   EVADEVELLVRPSTYRDVPGQSTEDFMKAAAKSQERNDHVLRFRR"
FT                   /protein_id="YP_003651084.1"
FT   gene            complement(514322..514999)
FT                   /db_xref="GeneID:9166946"
FT                   /locus_tag="Tbis_0464"
FT   CDS_pept        complement(514322..514999)
FT                   /locus_tag="Tbis_0464"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sme:SMc02592 hypothetical protein"
FT                   /db_xref="GI:296268453"
FT                   /db_xref="GeneID:9166946"
FT                   /translation="MTVTQPQLPSVEGPAAEARPAKAGAGRRIARGLIGLALAAAAVYA
FT                   QTFEPSYEEQLSNLTVHGRIGEVVHTSRYSVKVNWIKAALSVDTKNFGVGDTIQVRTSN
FT                   LFLVVNISARGVREPFRLSQGSPPVLRTRDDRVYWPTDKVDSSLTLFSKWIQPGLWSSG
FT                   VLVYEVPKDAVPGARLVFAPPAGLLVVDLYQPETEIDLGLTGGAAARLIDEAEEYHTLV
FT                   NKK"
FT                   /protein_id="YP_003651085.1"
FT   gene            complement(514996..515655)
FT                   /db_xref="GeneID:9166947"
FT                   /locus_tag="Tbis_0465"
FT   CDS_pept        complement(514996..515655)
FT                   /locus_tag="Tbis_0465"
FT                   /gene_family="HOG000110139" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268454"
FT                   /db_xref="GeneID:9166947"
FT                   /translation="MTSSRGGKRRRRPILIPAAIAIAAAGLGVTALLGGLQEAPEKPPP
FT                   EVAPGKIIDQGRFSTQFIKAIDTTEQDRYGTPKRSLQLVLKVKNVSNETAPVGGIPKPD
FT                   AKPSMGFGEFASSLLRIAPEIKSEYGPSVYVLSYGVQSRQLHPGITTTVVVKYDLKPTD
FT                   PAPSEITIDVGSFVYEEIGLRDKTRQWRLAGELDDEEFTPTVAARITLPVRQEQGQ"
FT                   /protein_id="YP_003651086.1"
FT   gene            515800..517716
FT                   /db_xref="GeneID:9166948"
FT                   /locus_tag="Tbis_0466"
FT   CDS_pept        515800..517716
FT                   /locus_tag="Tbis_0466"
FT                   /gene_family="HOG000110140" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268455"
FT                   /db_xref="GeneID:9166948"
FT                   /translation="MGDPHPDHAQLQADRIYLGWQYAQLYPDPGPPPKRPPREEIPEEP
FT                   LDDEWLRRQRFQEDLFNRPVRLLRTSAAMIAALILLLGVTGVLMWPLVLLGLAAAGGVA
FT                   LICSYAIYKGRRTVDARIEERRERLQRERERRKRELLAAEEEHAAKYREWAERKRRYEE
FT                   QVTWYAVTVPDDIDRIDVAGGTLAGWSALITLVGATRLHSGGDLTVLDLSEGAIATDLI
FT                   ELARRGGDKPLVWVLPADLPRLDLGARLGPEAFADVLAHVVSVSEETGRDIGFDNAILE
FT                   RVLQVLGEDATISQVTAALRALAQVGDPRDDMRRGLLTAAQLERIGTLFGRGVADRVVI
FT                   ERAWAMESQLRKLEPLGSEAVPLPPARLRVISMDRQAGVFGNRVLGTYVATALTHLLRR
FT                   SPANRRPWDHTIIVAGADKLRGDVLDRLMDACETSRTGLVFTYRTLTPTVRERLGRGHA
FT                   AVAFMRLGNAEDARVASEHIGTGHRLELARLTERLSASAGGMAGRYTSTVGPQQASAGE
FT                   RSEGDLREDITRSTEWGRRATEVAHGAPHLSREFLVEPHQLQQLPTTSVIVTHATAEGR
FT                   RVRLADANPAILTFPKSTLRDIDEVLRALPDGGEEEASPAGADAPPPNLGPPPPRLDWR
FT                   KRP"
FT                   /protein_id="YP_003651087.1"
FT   gene            517813..520917
FT                   /db_xref="GeneID:9166949"
FT                   /locus_tag="Tbis_0467"
FT   CDS_pept        517813..520917
FT                   /locus_tag="Tbis_0467"
FT                   /gene_family="HOG000013581" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG0433"
FT                   /codon_start="1"
FT                   /product="ATPase-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bca:BCE_1138 hypothetical protein"
FT                   /db_xref="GI:296268456"
FT                   /db_xref="GeneID:9166949"
FT                   /translation="MHPFPLSGPWYRIQAITAPARSPSAEWDFVTVLPAVLSAAQRNRP
FT                   FVIGWLSRGAGAPLELITNAGPLEPPRQPKRAATTGDPPPAGPQPLLFPGGARGVEIGD
FT                   DWLADLADLVWTPCPGRQAPPLQGRAGTDAESGRPTLFESTLVTLMSRPFAWLVIAEPT
FT                   DLLDAEIAHLRTQLNVLRQYGDASERSRFDVERAERRMQELDAFREAGLWNVRVLAGAA
FT                   NAEELRQIAPVLVGSVEMSHHPYRLRTALSGAGLAGKDSGPGAGPVYAFTEALSLDLRD
FT                   PTDGAATPFAATAGALAALAGLPHREVPGVRVLDAGFFDVTSEAEVDGSSEVIDLGTIV
FT                   DGQDRPVGTFRVPLSTINRHVFVTGATGSGKSQTVRHLLEQLTEAGIPWLAIEPAKSEY
FT                   AAMAGRIEHLAPLTVINPSAPDNVPISVNPLAPEPGYPVQAHIDMVRALFMAAFDAEEP
FT                   FPQIMSLALQRVYEANGWDVVTGAGIPGAAVQPAVPTLEQLQQHALEVIQEIGYGNEVQ
FT                   ADVEGFISLRLRSLRVGSAGRFFEGGHPADIGGLLQRNVVLAIEDVANDEDKAFLMGTL
FT                   IIRIVEHLRMRARQEPREELAGGLRHVIVIEEAHRLLRNRGAGRASTHAVELLAGMLAE
FT                   IRAYGEGIIVAEQIPTKLVSDVVKNTALKIVHRLPAEDDRRLVGAAMNLSEDQSRQVVS
FT                   LRPGYAAVFADGMDRPLRVKIPLGEDRERPMLSPVPPIRGRRSAACGRECRTGKACTLV
FT                   ELREADLLAAAPEWAWLRIWTDTVILAFVTNRPLPGVPRVLADIWAELPPRRRECLLAT
FT                   LIERSVSRRAWSLRTWFDPALLTERAAEVAAGLLDPESVEGELPPMRPGDRPGPSWVIP
FT                   QVRWLHEVERLFPYGRPAPDLRDPAPPMEYPLFGTDPAGRPYPHPGVNGSVQPEGKGEG
FT                   AVAVGARVELLGHRAKALRHHPLSMEVDRNRALAWRVILGDDEHEGIQRDITIVAIGVE
FT                   PHERLRFVAQTMGASWLETVLSWPRRFVLPFDGDAPTELSFPDAG"
FT                   /protein_id="YP_003651088.1"
FT   gene            520950..522224
FT                   /db_xref="GeneID:9166950"
FT                   /locus_tag="Tbis_0468"
FT   CDS_pept        520950..522224
FT                   /locus_tag="Tbis_0468"
FT                   /gene_family="HOG000245927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: aeh:Mlg_2195
FT                   UDP-N-acetylmuramoylalanine--D- glutamate ligase"
FT                   /db_xref="GI:296268457"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="GeneID:9166950"
FT                   /translation="MSQLPLRAQLATALGRTAATLSRATGRGDGSVIGGRIGLMLDPDL
FT                   LRKLAAHRKLALVSATNGKTTTTRLIAAALQELGEVATNAFGANMPAGHVTALASAKNA
FT                   PYGVLEVDEKYLPEVLDTTGAQVVCLMNLSRDQMDRAAEIWLLAQKWRRALSGKPAHAI
FT                   ANCDDPLVAWAASTAARVTWVAAGQRWREDSWCCPECGGPLDRPEPGTIGQGIGVSSAA
FT                   GAMWACRECTFHRPEPNWVLDGEEVIDPRGTRWRLDLQLPGQANRSNAAMALAVAAAFG
FT                   LEPARALPRLRTVTSVAGRYTTVERDGRVLRLLLAKNPAGWLEAFDVTDPALPVILSVN
FT                   AQVPDGRDTSWLWDVDYGVLKGRPVVVTGERRLDLALRLHVAGVPFQLCDSFGEAVSAV
FT                   PAGRVDVIANYTAFQQIRAEFGRAV"
FT                   /protein_id="YP_003651089.1"
FT   gene            522214..522921
FT                   /db_xref="GeneID:9166951"
FT                   /locus_tag="Tbis_0469"
FT   CDS_pept        522214..522921
FT                   /locus_tag="Tbis_0469"
FT                   /gene_family="HOG000245938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07685"
FT                   /codon_start="1"
FT                   /product="CobB/CobQ domain-containing protein glutamine
FT                   amidotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: adenosylcobyric acid synthase ;
FT                   K02232 adenosylcobyric acid synthase"
FT                   /db_xref="GI:296268458"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="GeneID:9166951"
FT                   /translation="MQSDLCLVWIYPDLLSTYGDQGNVLVLEHRARARGIPARTIHVRS
FT                   SDPVPQQGHIYLIGGGEDRPQILATERLRRDGGLHAAVANGAVVFAVCAGYQLIGRVYA
FT                   GDEGQPVEGVGLLDISSGRGQRRAVGELAAEPDPALGLPTLTGFENHMGVTTLGPGVRP
FT                   LARTVAGVGNGDGTEGCYAGRVVGTYMHGPALARNPALADLLLSWVVGALPPMDDTWYE
FT                   RLRQERLAAVLSK"
FT                   /protein_id="YP_003651090.1"
FT   gene            complement(523295..523657)
FT                   /db_xref="GeneID:9166952"
FT                   /locus_tag="Tbis_0470"
FT   CDS_pept        complement(523295..523657)
FT                   /locus_tag="Tbis_0470"
FT                   /gene_family="HOG000229182" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:MCA0352"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mca:MCA0352 hypothetical protein"
FT                   /db_xref="GI:296268459"
FT                   /db_xref="GeneID:9166952"
FT                   /translation="MARSLVIKVTAGMDAPERCNQAFTVAAAAVASGVPVSLWLTGESA
FT                   WFALPGRAKEFRLPEATPLEDLLDAVLTGGKVTLCTQCAARRGITVDDVIEGIRIAGAP
FT                   TFVEEVLAEGAQALVY"
FT                   /protein_id="YP_003651091.1"
FT   gene            524048..524545
FT                   /db_xref="GeneID:9166953"
FT                   /locus_tag="Tbis_0471"
FT   CDS_pept        524048..524545
FT                   /locus_tag="Tbis_0471"
FT                   /gene_family="HOG000220947" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08768"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1794; KEGG:
FT                   Os01g0679600; hypothetical protein"
FT                   /db_xref="GI:296268460"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="GeneID:9166953"
FT                   /translation="MDVHPELEPIAFLLGRWEGAGVIGYPTIESANFGQEVVFGHNGKP
FT                   FLTYQSRTWLLDRDGNRVRPLAMESGFWRMLPDRQVEVCLSHPTGIVEIYVGEVVFHKI
FT                   ELHTDVVARTVTAKEYNAGRRLYGLVNGNLMYAFDMAAMGQSLQAHASAELKKVADFVP
FT                   GE"
FT                   /protein_id="YP_003651092.1"
FT   gene            524574..524735
FT                   /db_xref="GeneID:9166954"
FT                   /locus_tag="Tbis_0472"
FT   CDS_pept        524574..524735
FT                   /locus_tag="Tbis_0472"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268461"
FT                   /db_xref="GeneID:9166954"
FT                   /translation="MGLRVEKREEPRARFRRRRAGWTWAESVLGHRLPGVRCLLWIRRD
FT                   VTDIQAEA"
FT                   /protein_id="YP_003651093.1"
FT   gene            524911..525321
FT                   /db_xref="GeneID:9166955"
FT                   /locus_tag="Tbis_0473"
FT   CDS_pept        524911..525321
FT                   /locus_tag="Tbis_0473"
FT                   /gene_family="HOG000014143" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /codon_start="1"
FT                   /product="Fur family ferric uptake regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: scl:sce0007
FT                   ferric uptake regulation protein"
FT                   /db_xref="GI:296268462"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="GeneID:9166955"
FT                   /translation="MAKAWHEELRARGYRITPQRQLVLEAVAKLGHATPEDICAEVRET
FT                   ARGINISTVYRTLELLEKLGLVTHTHLNRNAPTYHLASEADHVHLVCRGCGEVTEVSPD
FT                   MAAGLVSSLEEKLGFETDISHLTVYGHCRNCR"
FT                   /protein_id="YP_003651094.1"
FT   gene            525419..526258
FT                   /db_xref="GeneID:9166956"
FT                   /locus_tag="Tbis_0474"
FT   CDS_pept        525419..526258
FT                   /locus_tag="Tbis_0474"
FT                   /gene_family="HOG000225359" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /codon_start="1"
FT                   /product="anti-sigma-factor antagonist"
FT                   /transl_table="11"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sus:Acid_0527 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="GI:296268463"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="GeneID:9166956"
FT                   /translation="MTVQAEAAIRRTKELFLEQDGRLLDQWSEKANISADELRELYRAL
FT                   RTALSGKEEDFTDVRGLLAEFSRTRVRQGYTPSETARTVFALKDAMYEIVEADGSPEAL
FT                   RGFAWFSRLVDDLGLFTFETFSNAREKIILDQTEQLLELSTPVVKLWEGIVAVPLVGTL
FT                   DSARTQVVMEKLLQTLMETGSQHAVIDITGVPAVDTQVAHHLLKTVMAARLMGAECVIS
FT                   GIRPQIAHTIVTLGIEFGDIVTKASLADALAHALRRSGAEIKVNGRRPDEEETESSP"
FT                   /protein_id="YP_003651095.1"
FT   gene            526255..526617
FT                   /db_xref="GeneID:9166957"
FT                   /locus_tag="Tbis_0475"
FT   CDS_pept        526255..526617
FT                   /locus_tag="Tbis_0475"
FT                   /gene_family="HOG000269818" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /codon_start="1"
FT                   /product="anti-sigma-factor antagonist"
FT                   /transl_table="11"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: dac:Daci_4410 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="GI:296268464"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="GeneID:9166957"
FT                   /translation="MTRPPILKLGDILIVSIQTDLDDQEAVALQDDLAEAAVASGARGV
FT                   IIDITAVDVVDSFIGRTFATIAAITRILDAETVVVGMQPAVAITMVELGLSMGGVRTAL
FT                   NLTQAIEMLNHARSPG"
FT                   /protein_id="YP_003651096.1"
FT   gene            526614..527018
FT                   /db_xref="GeneID:9166958"
FT                   /locus_tag="Tbis_0476"
FT   CDS_pept        526614..527018
FT                   /locus_tag="Tbis_0476"
FT                   /gene_family="HOG000269930" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mrd:Mrad2831_5231 putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="GI:296268465"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="GeneID:9166958"
FT                   /translation="MSTEPQELTIATNGDIVQARRQVRIAAAELGLSLVDQTKVVTVAS
FT                   ELARNALVHAGGGHMRVEVVHNGPRRGLRLTVVDEGPGIEDIEQALTEGFSTANGLGLG
FT                   LSGSRRLVDEFDLVSAPQQGTRVTVIKWAR"
FT                   /protein_id="YP_003651097.1"
FT   gene            527018..528010
FT                   /db_xref="GeneID:9166959"
FT                   /locus_tag="Tbis_0477"
FT   CDS_pept        527018..528010
FT                   /locus_tag="Tbis_0477"
FT                   /gene_family="HOG000225360" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /codon_start="1"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: sus:Acid_0530
FT                   putative anti-sigma regulatory factor, serine/threonine
FT                   protein kinase"
FT                   /db_xref="GI:296268466"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="GeneID:9166959"
FT                   /translation="MDGRADVWIRTEDPSAVGAVRRAAAELAREAGFDATRTGEVGVAV
FT                   TEAVSNLVKHAVDGVVLLRPHPEMARAVELVAIDSGPGIADLGQALRDGYSTTGTLGIG
FT                   LGAIRRLASRLDAYSLPGRGSVLVAVFTPHGMPAPPQRCSGLCRPIGEEVVCGDAFAFV
FT                   ATEDSVIVTVCDGLGHGGAAAQASQQAVRIFLKQPHMSPAEILERVHRGLGQTRGGAVA
FT                   VGLVRPGSVSFAGLGNVSGLIVTAEGKVAMTSQPGIAGHPGGLTHQYEYPLPQHAVVVF
FT                   HSDGLSDRWEPTTFPGLLTHSPAVICATLLRDVGTRRDDACVVAVRARP"
FT                   /protein_id="YP_003651098.1"
FT   gene            528007..529689
FT                   /db_xref="GeneID:9166960"
FT                   /locus_tag="Tbis_0478"
FT   CDS_pept        528007..529689
FT                   /locus_tag="Tbis_0478"
FT                   /gene_family="HOG000002809" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: sus:Acid_0531 histidine kinase"
FT                   /db_xref="GI:296268467"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:9166960"
FT                   /translation="MTGEEITRVGFGDDQDAFAIRRLAREIAERVGLEAQDRIRMATAL
FT                   SEIVREVLALGGEGVVIISLTEESLIMTVDYRVGEDLRQSEGMALAGRLVDEVVHAEPG
FT                   SITLVKRVPAHVARRSPAEVRAGLSPVVRVTAMDELREQNRELAGTLEEGQRLNVELTE
FT                   TNKGILALYNQLSAELEETNRGVVALYAELEEKSARLRELAEARQRFWVSVSHELRTPL
FT                   NSIIGLVRLLLGPGGEPLSEEQEHQIRLIGSSAETLLAMVSELLDMAKAESGRIQPQPV
FT                   AVDVAALAEEVCTALRPAAPHRVALIVDVAADVGEMFADKAILARILHNLLYNALKFTY
FT                   EGEVRLSVRLDPDAGDVVFTVADTGIGIPAKYLERVFEEFFQVPGPVAVKAEGSGLGLP
FT                   YARRLAEALGGTLTLTSREGEGTTATLRVPRRMARPEVNRVLIADGDAGFRAAARRLLT
FT                   GFATHVMEAADGITALQLMTAHPPDVVLIDEFLPRMDGATLLQRMAEAARLRDVPVVVV
FT                   GYPSQQADRGFPVLSRQELDRDRLLATIRAVRAARTGGGPEHG"
FT                   /protein_id="YP_003651099.1"
FT   gene            529682..531271
FT                   /db_xref="GeneID:9166961"
FT                   /locus_tag="Tbis_0479"
FT   CDS_pept        529682..531271
FT                   /locus_tag="Tbis_0479"
FT                   /gene_family="HOG000054046" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /codon_start="1"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Stage II sporulation E family protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; protein phosphatase 2C domain protein; KEGG:
FT                   aba:Acid345_2411 PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="GI:296268468"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="GeneID:9166961"
FT                   /translation="MGDTRATVLVVDDTPTKRYILSSWLRRAGHRVVEATGGGEALFLV
FT                   GEVKPDLVVLDIRMPDISGFEVCERIKGDPATAAIPVIQVSAAAIAASDRTEGLERGAD
FT                   AYLTEPIEPDEFTATVEATLRYYWARRRAERMAARLAQLVEITLRINEAETFDEVLRVA
FT                   AGGAAQMLERPAGLLALAPNGKTRAYIARPGRETTAMSATPGSLDRLTGRSLGEAAGVR
FT                   LLETGVDEWTRIVPGCGITSGVRGVVCRTKTGRPPVYLGVASRPPMDEGDTNLLRQLGQ
FT                   ALALAVDALRAYTEEHTIALTLQRSLLPRRVPDIPGLRISVRYQPAAKEVGGDFYEVLP
FT                   LGERVLVALGDVQGHSLHAATVMAELRHALRASLLDKVDPAHSMGLLNTVLRRYHPLIT
FT                   ATVCLLLIAPATGEVELVNAGHIPPLLAGKDARYHPFGDLMLGVTDETYRVERLILPED
FT                   GTILLFTDGLIEDRGRMLDDGLETARRLAEDVGDDLDAFCDRLIGAFGAREDDFALVAV
FT                   RRTGERKPYPSE"
FT                   /protein_id="YP_003651100.1"
FT   gene            531282..532340
FT                   /db_xref="GeneID:9166962"
FT                   /locus_tag="Tbis_0480"
FT   CDS_pept        531282..532340
FT                   /locus_tag="Tbis_0480"
FT                   /gene_family="HOG000248903" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03317"
FT                   /codon_start="1"
FT                   /product="folate-binding protein YgfZ"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: folate-binding protein YgfZ; PFAM: glycine
FT                   cleavage T protein (aminomethyl transferase); KEGG:
FT                   mxa:MXAN_6341 glycine cleavage system T protein"
FT                   /db_xref="GI:296268469"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="GeneID:9166962"
FT                   /translation="MRSPLLDALGAVPGERPDETVAAHYGDPYAEQRALVRGEALTDRS
FT                   NRGVVRVSGPDRLSWLNSLSSQKLDTLRPGVPTQTLILDPHGRIEHHLTLVDDGTAVWA
FT                   HVEPGTAADLIAFLEKMRFMLRVEIEDRTAEYAVVSVGAPGTEPAPRTLPEGIIAIGGD
FT                   LLVPRDRLAGIADELGLRLAGLWAYEALRIAAHIPRLGFETDHKTIPHEVGWIEKAVHL
FT                   NKGCYRGQETVARVHNLGHPPRRLVFLHLDGSVDILPPHGAPVTLAGPAAAAGEPGAEP
FT                   DAGDRGQVGFVGSSARHYELGPIALALVKRTVPVDAPLLAGGVAASQEVIVPPDAGRNV
FT                   KIDPALARRRLR"
FT                   /protein_id="YP_003651101.1"
FT   gene            complement(532538..532978)
FT                   /db_xref="GeneID:9166963"
FT                   /locus_tag="Tbis_0481"
FT   CDS_pept        complement(532538..532978)
FT                   /locus_tag="Tbis_0481"
FT                   /gene_family="HOG000113982" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /codon_start="1"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: bcy:Bcer98_3122
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="GI:296268470"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="GeneID:9166963"
FT                   /translation="MRAVVQRVTSASVTVDGKVVGAIDEPGLLVLVGVTHTDGRAEAAR
FT                   LAAKLWGLRILHGEKSCSDLNAPLLVISQFTLYGDARRGRRPTWQAAAPAPVAEPLVDA
FT                   VVEELRALGARVETGVFGADMKVTLTNDGPVTLVLHVDAPSA"
FT                   /protein_id="YP_003651102.1"
FT   gene            533204..534142
FT                   /db_xref="GeneID:9166964"
FT                   /locus_tag="Tbis_0482"
FT   CDS_pept        533204..534142
FT                   /locus_tag="Tbis_0482"
FT                   /gene_family="HOG000167872" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06089"
FT                   /codon_start="1"
FT                   /product="L-asparaginase II"
FT                   /transl_table="11"
FT                   /note="PFAM: L-asparaginase II; KEGG: mlo:mlr7616
FT                   hypothetical protein"
FT                   /db_xref="GI:296268471"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="GeneID:9166964"
FT                   /translation="MPELVVEVVRSGFVECVHRVRVHVVDAQGEPVMVRGDTAALASPR
FT                   SAMKPLQALAMLRHGLPLTGELLALACSSHCGEAFHVDGVRKILASAGLDESALRCPPD
FT                   LPYDEESRLRVIRSGGTAERIYMNCSGKHAAMLATCAVNGWPLDSYLHPGHPLQRAIRA
FT                   AVEEFTGERIAATGVDGCGAPLLFVSMTGVVRAYRRLVLAEGGPERRIADAMRAHPEWT
FT                   TGTARPETVLMRAIPGLLVKSGAEGFVVWAHSDGRAGAVKVEDGGERARMPATVAALRA
FT                   AGLDAPELAGLATAPLFGGGEPVGEVRVRPA"
FT                   /protein_id="YP_003651103.1"
FT   gene            534287..535165
FT                   /db_xref="GeneID:9166965"
FT                   /locus_tag="Tbis_0483"
FT   CDS_pept        534287..535165
FT                   /locus_tag="Tbis_0483"
FT                   /gene_family="HOG000205102" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /codon_start="1"
FT                   /product="methyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: cak:Caul_1717
FT                   methyltransferase"
FT                   /db_xref="GI:296268472"
FT                   /db_xref="InterPro:IPR003455"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="GeneID:9166965"
FT                   /translation="MRNDGEPSMTALMAAAARAAHLIVDEEPHIFRDTLAYRLLGERAE
FT                   TLVGFHRAHGTEPVLAGARTAAVTRSRYTEDRLTEAIGRGIGQYVILGAGLDSFAYRSP
FT                   YAGKIRVFEVDHPDTQGWKRALLTASGIPTPPSLRFVPADLEEQFDRLAYGGLDPSRPA
FT                   FVSWLGVTMYLTRGAVERTLAWLGRLAPGTELVVEYLLPEALWDAAGREYAEHVRAAAA
FT                   GFGEPWVTFFAPEEMSALLERHGFEVIEQARQREAIDAALWHRSDSLSACDLSVFAHAR
FT                   VRRDPAAGGGA"
FT                   /protein_id="YP_003651104.1"
FT   gene            complement(535414..536910)
FT                   /db_xref="GeneID:9166966"
FT                   /locus_tag="Tbis_0484"
FT   CDS_pept        complement(535414..536910)
FT                   /locus_tag="Tbis_0484"
FT                   /gene_family="HOG000253219" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: swi:Swit_4521 membrane-like protein"
FT                   /db_xref="GI:296268473"
FT                   /db_xref="GeneID:9166966"
FT                   /translation="MELRTDGVLHVKESVTLAGGPVQRKLITRTRYDDTRDRLYRISNV
FT                   KGASFDGQTLTMAKSGTVEYDVTGAVTPLPGSVELRWFPVAGPAESATVTVTGPQPIHH
FT                   LSCFAGPPSSVIGCTSASMDHTGASATFEQQNLRAGELLTVAVGFPQGAAKAQPILERR
FT                   FELSTAFTLNAVTGTALAALLVVLLGGVGLLYWTRGRDARVISTESGPLSGHRNGVFTP
FT                   PDGVRPGQIGTLIDEQADVVDVTATILDLAVRGYLRIDEQPRQAYDAPDWRLVKLPGAR
FT                   VDELLPYERALYDALFDGRDSVLLSELHGSFAERLDAVRDALYEDVVRQGWFARRPDSV
FT                   RSRWTTLGIITIVIGVLGTVLLAWFTTYGLLGLAVIIAGAALAYGGQFMPAKTAKGSAA
FT                   LAHTLGFRRYLAEGGIDDVPPERRIELFSRYLPYAVIFDNVDPWARVVSSFTGNGERAD
FT                   HLYWYQGPAEWDLSKFADSMRTFTVTTSGAISASRRFRSL"
FT                   /protein_id="YP_003651105.1"
FT   gene            537088..538056
FT                   /db_xref="GeneID:9166967"
FT                   /locus_tag="Tbis_0485"
FT   CDS_pept        537088..538056
FT                   /locus_tag="Tbis_0485"
FT                   /gene_family="HOG000226537" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /codon_start="1"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mlo:mlr5644 metal-transport protein"
FT                   /db_xref="GI:296268474"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="GeneID:9166967"
FT                   /translation="MARSRLYRNGALAAEGFPAAEVAGLIRDPSAVVWLDLCAPGREEL
FT                   EALGAELGVHELAVEDAVKRRQRPKLDAYDGHLFLSVHAARFDAGSGGLRVAEAAAFVA
FT                   RNVLVTVREPDFPIDEVVRRWDEQAGLAAHGVMFLLYGLLDYVVDTHFDAVERIDDEVE
FT                   ALEETVFGDGPVTPADQRRAYRIRKSLVRLRRIVVPMREVVNGLMRREEELGDGRMRPY
FT                   LLDVYDHVLRATEWTESLRELLADIREAHLTMQGNRMNMIMKRVTSWAAIIAVPTLITG
FT                   FYGQNLPFPGFGQVWGFWVSNALIVIASVTLYLTFRSRDWL"
FT                   /protein_id="YP_003651106.1"
FT   gene            complement(538072..538413)
FT                   /db_xref="GeneID:9166968"
FT                   /locus_tag="Tbis_0486"
FT   CDS_pept        complement(538072..538413)
FT                   /locus_tag="Tbis_0486"
FT                   /gene_family="HOG000239122" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RPD_4397"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpd:RPD_4397 hypothetical protein"
FT                   /db_xref="GI:296268475"
FT                   /db_xref="GeneID:9166968"
FT                   /translation="MFGPVNSILSLIFWLISVTAFVMSVWALVHAVRIPARAFAAAGKQ
FT                   TKQLWLIILGFATLFTFAAAVNYGGIGTGLPNIFTIAAIIASGIYLADVKPAVTMYRSG
FT                   GSEGPYGPW"
FT                   /protein_id="YP_003651107.1"
FT   gene            complement(538667..539050)
FT                   /db_xref="GeneID:9166969"
FT                   /locus_tag="Tbis_0487"
FT   CDS_pept        complement(538667..539050)
FT                   /locus_tag="Tbis_0487"
FT                   /gene_family="HOG000110121" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ecs:ECs0774 cell envelope integrity inner
FT                   membrane protein TolA"
FT                   /db_xref="GI:296268476"
FT                   /db_xref="GeneID:9166969"
FT                   /translation="MTLATEVKKITRSKPFYALTGAGDLALEKARSYALTVQGKAETVA
FT                   RDMPEKARKYADSAAQRLTRLYDELAARGQRVVGRVSGETARELTKVAQSAAREFSAAA
FT                   KEAERGAAEQSKKSTRAKAGSRR"
FT                   /protein_id="YP_003651108.1"
FT   gene            complement(539054..539491)
FT                   /db_xref="GeneID:9166970"
FT                   /locus_tag="Tbis_0488"
FT   CDS_pept        complement(539054..539491)
FT                   /locus_tag="Tbis_0488"
FT                   /gene_family="HOG000053152" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="XRE family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bbr:BB0746 putative
FT                   transcriptional regulator"
FT                   /db_xref="GI:296268477"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:9166970"
FT                   /translation="MELPKVGSLGEFIRQQRQQAKISLRQLAAQASVSTPYLSQVERGL
FT                   RKPSAEILNQIAKALSISAQALYERAGLIENGDGTSDVLTAIRADMTLTPRQRQVLIDI
FT                   YESFRKENRAASAQPRPSAEPLGDGDPASSRDGVTPESQEG"
FT                   /protein_id="YP_003651109.1"
FT   gene            complement(539559..540473)
FT                   /db_xref="GeneID:9166971"
FT                   /locus_tag="Tbis_0489"
FT   CDS_pept        complement(539559..540473)
FT                   /locus_tag="Tbis_0489"
FT                   /gene_family="HOG000243187" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /codon_start="1"
FT                   /product="peptidase M48 Ste24p"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M48 Ste24p; peptidase M56 BlaR1;
FT                   KEGG: afw:Anae109_4097 peptidase M56 BlaR1"
FT                   /db_xref="GI:296268478"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="GeneID:9166971"
FT                   /translation="MIAAAVLAALAMGCVLAAKRLTAAKWTHRAPHIGILLWQAIGVAW
FT                   GLATIGALLAFALEPYGKGVFYGMAAMVTAPEYGGVESPHDVARLTALVLGLALLAVLI
FT                   AVPIVAAVQTLRARRRHRDLLALIAREDPSVPGVRVVDFPAAAAYCVPGLKSQVVISDG
FT                   TLSLLSPGELDAVLAHEAAHVRERHDLVLLPFGALRRALPWSGLVRDAQASVELLVEMA
FT                   ADDRARQRCCPKRLASALLRFGTAAVPVPQGALGASAAESVMARVERLLRPQSALPPAQ
FT                   RFLLLAASVALAASAPALWFLPG"
FT                   /protein_id="YP_003651110.1"
FT   gene            complement(540470..540793)
FT                   /db_xref="GeneID:9166972"
FT                   /locus_tag="Tbis_0490"
FT   CDS_pept        complement(540470..540793)
FT                   /locus_tag="Tbis_0490"
FT                   /gene_family="HOG000219495" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03965"
FT                   /codon_start="1"
FT                   /product="CopY family transcriptional repressor"
FT                   /transl_table="11"
FT                   /note="PFAM: Penicillinase repressor; KEGG: sus:Acid_7418
FT                   CopY family transcriptional regulator"
FT                   /db_xref="GI:296268479"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="GeneID:9166972"
FT                   /translation="MNILWAAETPLTAREVGRRIEDRELAPTTVMTVLDRLVRKGFLNR
FT                   TRDGRAWRYQPAASRDAYVAELMLEALDLTGDRHAALTHFARSVSGAEAEVLRKALMEL
FT                   EKR"
FT                   /protein_id="YP_003651111.1"
FT   gene            540878..541393
FT                   /db_xref="GeneID:9166973"
FT                   /locus_tag="Tbis_0491"
FT   CDS_pept        540878..541393
FT                   /locus_tag="Tbis_0491"
FT                   /gene_family="HOG000086960" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /codon_start="1"
FT                   /product="Appr-1-p processing domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: sun:SUN_1457
FT                   hypothetical protein"
FT                   /db_xref="GI:296268480"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="GeneID:9166973"
FT                   /translation="MALILVQGDITQQRVDAIVNAANSSLLGGGGVDGAIHRRGGPQIL
FT                   EECRIWRATQYPDGLPTGKAVATTAGRLPARWVIHTVGPVYSRSEDRSHLLASCYRESL
FT                   RIADALGARTVAFPAISTGAFGWPMEDAARIALTTVRRADPGIDEVRFVLFDAEAYSVF
FT                   ERVLKEIK"
FT                   /protein_id="YP_003651112.1"
FT   gene            complement(541461..542327)
FT                   /db_xref="GeneID:9166974"
FT                   /locus_tag="Tbis_0492"
FT   CDS_pept        complement(541461..542327)
FT                   /locus_tag="Tbis_0492"
FT                   /gene_family="HOG000239141" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mxa:MXAN_2356 hypothetical protein"
FT                   /db_xref="GI:296268481"
FT                   /db_xref="GeneID:9166974"
FT                   /translation="MSLTAPADRRAGRGAHVLDPRSRAGARARPIGMITRGTTGQNRLR
FT                   RCDRWIAAVYGPLLRSAAPPLVVDLGFGASHVTTLELFTRLRRVCPSVEVVGVEIDPAR
FT                   VAAAKPYEREGLSFTLGGFELPVGRPPLLVRAFNVLRQYEEEAAWAHWDLLRSGIHPDG
FT                   VIVEGTCSEVGHRATWVALGAEGPRTLTFAARFTGFERPSDLAERLPKTLIHRNVPGER
FT                   IHAFLTDWDRAWAACAPFGAFGMRQRWIKTAELLARDWPVATAPPLGGRSRWRLGELTL
FT                   PWSAVAP"
FT                   /protein_id="YP_003651113.1"
FT   gene            complement(542324..543076)
FT                   /db_xref="GeneID:9166975"
FT                   /locus_tag="Tbis_0493"
FT   CDS_pept        complement(542324..543076)
FT                   /locus_tag="Tbis_0493"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bmv:BMASAVP1_A0832 short chain dehydrogenase/reductase
FT                   family oxidoreductase"
FT                   /db_xref="GI:296268482"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:9166975"
FT                   /translation="MTKKTAVVTGASSGIGAATARRLAAEGYQVVAGARRRDRLEKLAA
FT                   EVDGIIPVTLDVTSQESVDALAASLDRCDVLVNNAGGAIGLEPVAEGSVEDWQRMYDVN
FT                   VLGTFRMTRALLPKLIESGDGVLVLVTSVAGHVSYEGGGGYCAAKHAQASMAATLRLEL
FT                   CGRPVRVIEVAPGMVKTEEFSLTRFRGDAERAAKVYEGVPDPLTADDIADVIAFAVTRP
FT                   PHVNIDQIVVRPRAQAAQHKVHRVTQDA"
FT                   /protein_id="YP_003651114.1"
FT   gene            543210..544496
FT                   /db_xref="GeneID:9166976"
FT                   /locus_tag="Tbis_0494"
FT   CDS_pept        543210..544496
FT                   /locus_tag="Tbis_0494"
FT                   /gene_family="HOG000077288" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03449"
FT                   /codon_start="1"
FT                   /product="UDP-N-acetylglucosamine"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine; PFAM: glycosyl
FT                   transferase group 1; KEGG: bmn:BMA10247_A2262 glycosyl
FT                   transferase, group 1 family protein"
FT                   /db_xref="GI:296268483"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="GeneID:9166976"
FT                   /translation="MAARRRRVNRVATISVHTSPLDQPGTGDAGGMNVYIVEVARRLAD
FT                   LGIEVEIFTRRTARDLPPAVELHPGVLVRHVTAGPYEELDRADLPGQLCSFLSGVLRTE
FT                   AMYEPGRYDVIHSHYWLSGQVGWLAKERWGVPLVHTMHTMAKVKNLRLAEGDKPEPAIR
FT                   VLGEEQVVDVADRLVANTVTEARELIELYHAPPERVTVVNPGVNLNIFRPAPKAAARRR
FT                   LGLPADARVLLFVGRIQPLKAPDVMLRAAAIMIAERPELRSRLIVACVGGPSGNGLARP
FT                   SLLADLAAELGIADVVRLEPPAPQPELADWYRAADLTVVPSHNESFGLVALESQACGTP
FT                   VAAASVGGLRTAVRHGVSGVLVDGHDPRQWAASLAELLDDPDRLAALSAGAVRHAARFG
FT                   WSATAARLAEVYTEALERVHRTVPVGANS"
FT                   /protein_id="YP_003651115.1"
FT   gene            544527..545048
FT                   /db_xref="GeneID:9166977"
FT                   /locus_tag="Tbis_0495"
FT   CDS_pept        544527..545048
FT                   /locus_tag="Tbis_0495"
FT                   /gene_family="HOG000053228" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268484"
FT                   /db_xref="GeneID:9166977"
FT                   /translation="MRSDLEGVIESALAAAVLSYERPRPGAFLVKLPGQHKLATMTWLI
FT                   LGDQALNIEAFFCRKPDENHAEFYRWLLRKNGSMYGVHFALDEIGDVYLVGRIPIDAVT
FT                   PEEIDRLLGCVLTYADESFERAIELGFASSIRREWEWRVKRGRVFGQPPAVRPGRRGRL
FT                   GELTPGRSIR"
FT                   /protein_id="YP_003651116.1"
FT   gene            545108..545851
FT                   /db_xref="GeneID:9166978"
FT                   /locus_tag="Tbis_0496"
FT   CDS_pept        545108..545851
FT                   /locus_tag="Tbis_0496"
FT                   /gene_family="HOG000221682" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /codon_start="1"
FT                   /EC_number="5.4.2.4"
FT                   /transl_table="11"
FT                   /note="KEGG: YALI0B02728p ; K01834 phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="GI:296268485"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:9166978"
FT                   /translation="MATLVLLRHGESEWNLKGLFTGWVDVTLSPAGEEEARRGGRLLVE
FT                   KGIYPDVVHTSVLTRAIKTANLALEAAGLLWLPVKRSWRLNERHYGALQGKDKAQTRAQ
FT                   FGDEQFMLWRRSYDVPPPPIADDDEFSQRGDRRYANLPPELIPRTECLKDVVARLLPYW
FT                   YDEIVPDLAAGKTVLVVAHGNSLRALVKHLEGISDQDIVGLNIPTGIPLRYELDENFRP
FT                   KGPGEYLDPEAAKAAIEAVANQGKK"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /protein_id="YP_003651117.1"
FT   gene            complement(546443..547099)
FT                   /db_xref="GeneID:9166979"
FT                   /locus_tag="Tbis_0497"
FT   CDS_pept        complement(546443..547099)
FT                   /locus_tag="Tbis_0497"
FT                   /gene_family="HOG000074027" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /codon_start="1"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   bmc:BAbS19_I20060 PhoU"
FT                   /db_xref="GI:296268486"
FT                   /db_xref="InterPro:IPR008170"
FT                   /db_xref="GeneID:9166979"
FT                   /translation="MRDAYHEELNALTARLLEMCRFVRSAMSRGTTALLGADLALAESV
FT                   IADDAEIDRRYAEVDSSIQLLLATQQPVAVDLRTVITALRISADLERMGDHAERIAKIA
FT                   RMRHPEPAVPAEVRDTIAEMGAIAEDLISKTASVIESRDVDLARRLVKEDDEMDRLHRR
FT                   LFRVLLSADWPHGVEAAIDVTLIGRYYERYADHAVRIAQDVIYLATGDRDADGAG"
FT                   /protein_id="YP_003651118.1"
FT   gene            547213..548388
FT                   /db_xref="GeneID:9166980"
FT                   /locus_tag="Tbis_0498"
FT   CDS_pept        547213..548388
FT                   /locus_tag="Tbis_0498"
FT                   /gene_family="HOG000223176" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: gbm:Gbem_2951 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="GI:296268487"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:9166980"
FT                   /translation="MLRVNELLASLAAMGGFLVGAFVMLAIVRTLEFSMRQRDRGDDLA
FT                   PGVASVLAVLPSSAVVLDRDDRVLRASPAARAFGLVRGDTLMAAELLAMARKVRRDGEI
FT                   RESEIETRGGRFGQDTTTFAVRVAPLGTDGQVLVLAEDQTERQRVEAVRRDFVANVSHE
FT                   LKTPVGALSLLAETVMAAADDPEAVRRFAGRMQHEAARLTNLIQDLITLSRIQGGEPIP
FT                   SPAPVLVDDVIREAIDRCNTKASAKGIQLVTAGAQGLQVWGDDDLLVTALRNLIDNAIA
FT                   YSPEKTRVVVSSRSAHGHVEVSVADQGIGIPEEAQQRIFERFFRVDAARSRATGGTGLG
FT                   LAIVKHVAVAHGGEVTVWSKEGSGSTFTLRLPAYAGEPASSRTDTPVEAAQ"
FT                   /protein_id="YP_003651119.1"
FT   gene            548385..549074
FT                   /db_xref="GeneID:9166981"
FT                   /locus_tag="Tbis_0499"
FT   CDS_pept        548385..549074
FT                   /locus_tag="Tbis_0499"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="winged helix family two component transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bcb:BCB4264_A5589 DNA-binding response
FT                   regulator YycF"
FT                   /db_xref="GI:296268488"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="GeneID:9166981"
FT                   /translation="MTRVLVVEDEESFSDALSYMLRKEGFEVAVAASGPEALEVFDREG
FT                   ADLVLLDLMLPGLPGTEVCRSLRQRSKVPVIMLTAKDSEIDKIVGLELGADDYVTKPFS
FT                   SRELVARIRAVLRRRGDAEEPSSSVLAAGPVRMDVDRHVVTVRGEKVQLPLKEFELLEV
FT                   LLRNAGRVLTRGQLIDRVWGADYVGDTKTLDVHIKRLRAKIEPDPSKPRYILTVRGLGY
FT                   KFETAEN"
FT                   /protein_id="YP_003651120.1"
FT   gene            complement(549171..549818)
FT                   /db_xref="GeneID:9166982"
FT                   /locus_tag="Tbis_0500"
FT   CDS_pept        complement(549171..549818)
FT                   /locus_tag="Tbis_0500"
FT                   /gene_family="HOG000106586" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GI15809 gene product from transcript GI15809-
FT                   RA"
FT                   /db_xref="GI:296268489"
FT                   /db_xref="GeneID:9166982"
FT                   /translation="MLPIYVRTKETCTVTSSRRRAIAAGALLAAVIPALAACGAGFTAN
FT                   TNKPYAPTEAGVLISAESDGPFSNPYEVKGIQVPQAFILGPDSGAQIAAGGSAPLYLTL
FT                   TTSGGTDTLTAVTPDEQKATQVTLPGPVQVTSEGLARTTGALLQGLKQPLRGGEYIQLR
FT                   LQFQNAGEIPLTVPVVTRSREFATLPPAPQPTETAATPTETPEPSPSPTTEP"
FT                   /protein_id="YP_003651121.1"
FT   gene            550052..550543
FT                   /db_xref="GeneID:9166983"
FT                   /locus_tag="Tbis_0501"
FT   CDS_pept        550052..550543
FT                   /locus_tag="Tbis_0501"
FT                   /gene_family="HOG000239163" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /codon_start="1"
FT                   /product="CarD family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: transcription factor CarD; KEGG:
FT                   bcb:BCB4264_A4827 transcriptional regulator, CarD family"
FT                   /db_xref="GI:296268490"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="GeneID:9166983"
FT                   /translation="MTFKVGDTVVYPHHGAARIEAITTRTINGQEKTYLVLKVDKGDLT
FT                   VQVPAENAELVGVRDVVGQEGLERVFDVLRMPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLYRRDKERGLSAGEKRMLAKARQILVSELALAENTNEDKAEALLDEVLNSARC
FT                   "
FT                   /protein_id="YP_003651122.1"
FT   gene            550569..551030
FT                   /db_xref="GeneID:9166984"
FT                   /locus_tag="Tbis_0502"
FT   CDS_pept        550569..551030
FT                   /locus_tag="Tbis_0502"
FT                   /gene_family="HOG000239175" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /codon_start="1"
FT                   /EC_number="4.6.1.12"
FT                   /transl_table="11"
FT                   /note="KEGG: afw:Anae109_2497 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4- cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="GI:296268491"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="GeneID:9166984"
FT                   /translation="MGIGVDVHPFSPGRELYLAGLHWPGEPGLAGHSDGDAAAHACCDA
FT                   LLSAAGLGDLGGLFGTADPRWAGASGAVLLEETARRVRAAGFEIGNLAVQIIGNRPKVA
FT                   PRRAEAEKALGAAAGAPVSVAATTTDGLGLTGRGEGIAAIATAIVFPRS"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /protein_id="YP_003651123.1"
FT   gene            551230..551505
FT                   /db_xref="GeneID:9166985"
FT                   /locus_tag="Tbis_0503"
FT   CDS_pept        551230..551505
FT                   /locus_tag="Tbis_0503"
FT                   /gene_family="HOG000281220" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:PsycPRwf_0043"
FT                   /codon_start="1"
FT                   /product="transglycosylase-associated protein"
FT                   /transl_table="11"
FT                   /note="KEGG: prw:PsycPRwf_0043 transglycosylase-associated
FT                   protein"
FT                   /db_xref="GI:296268492"
FT                   /db_xref="GeneID:9166985"
FT                   /translation="MTAIIGAIIIGAIVGVIARLLLPGKQQITWVWTIAIGIVAALIGT
FT                   ALAQVMGVATTPGIDWIELFMQILLAVVGVALFSGIRGRSRGRSRV"
FT                   /protein_id="YP_003651124.1"
FT   gene            complement(551882..553465)
FT                   /db_xref="GeneID:9166986"
FT                   /locus_tag="Tbis_0504"
FT   CDS_pept        complement(551882..553465)
FT                   /locus_tag="Tbis_0504"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: PT repeat family protein"
FT                   /db_xref="GI:296268493"
FT                   /db_xref="GeneID:9166986"
FT                   /translation="MDAIPPARPGVAEPPARRPSAFATVLRRLAIGAASLALAALTVAA
FT                   CALSFDDLRAFALAGGAPAELAALYPAAFDVLLAVALLTLPLVRGGSRLLLFQAGFVLC
FT                   VLLVAAAATTSTMAAGLTLDPHTASIVIALLPWVMLAIGLWLLLLLLAHARANRVEPDG
FT                   TAGADDLLPFEPARPEPAEPPAEVRQAGPQARDAGDAQGPAGDRTADAETAEVRPAAQA
FT                   DEPTASGTALAASEPSGDEHAAAEPPDRPAGGPDATEPPSHEPSGAESPAPADPAAETG
FT                   TASPGRQEPHDAATPGAEPAPATAPVADAGTPSPEPEAAEPAESAARTAPQPESPQAPE
FT                   AEAQPAGGDRREDGSDTGSARARSARARRSAAAAEAPEAAAEAPEPDPAQAPGRTRPLR
FT                   WGDLRRPPKGDVLVYPKRSQEAAEQATADASPSAPASSTEPAASPSARAETASGSAADP
FT                   ETGGAPAQPEAEDTQPVRRPRRGRAAKAEQAAQPATEEPGAQPEDSSAEPTVPLQPPSG
FT                   RMRSTPRPPR"
FT                   /protein_id="YP_003651125.1"
FT   gene            553598..553975
FT                   /db_xref="GeneID:9166987"
FT                   /locus_tag="Tbis_0505"
FT   CDS_pept        553598..553975
FT                   /locus_tag="Tbis_0505"
FT                   /gene_family="HOG000022434" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /codon_start="1"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: cak:Caul_2456 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="GI:296268494"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="GeneID:9166987"
FT                   /translation="MLPDSARELFDGVNHATVACLNPDGSPHTSVVWVKTDGGDILFST
FT                   VKGRRKHRNILRDPRVSILVMDSGNPYRYAEVRGIATMIDDPEADLIQELSRKYTGRPW
FT                   DVHPDGERVIVRITPKKVFVR"
FT                   /protein_id="YP_003651126.1"
FT   gene            554099..555493
FT                   /db_xref="GeneID:9166988"
FT                   /locus_tag="Tbis_0506"
FT   CDS_pept        554099..555493
FT                   /locus_tag="Tbis_0506"
FT                   /gene_family="HOG000245250" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.16"
FT                   /transl_table="11"
FT                   /note="KEGG: gme:Gmet_0057 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia ; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="GI:296268495"
FT                   /db_xref="InterPro:IPR002308"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="GeneID:9166988"
FT                   /translation="MSLHLYDTSTRTVREFVPINPGRVSIYLCGATVQAPPHIGHIRCG
FT                   VAFDVLRRWLMRLGYDVTFCRNVTDLDDKIIKVAAEEGVPWFVVAERNQRLFTWAYDQL
FT                   GCLPPTVEPRAMGHIPEMIELIKRLLDKGHAYVAGNDVYFDVRSFADRYGRLSNQRLEH
FT                   MRPAGDTENESLKRDPRDFALWKGAKPGEPSWPTPWGRGRPGWHLECSAMATKYLGETF
FT                   DIHGGGVDLIFPHHENEIAQSQAAGDGFARYWVHNGLLKVGGEKMSKSLGNSLLISEIL
FT                   RKVRPIELRYYLVAAHYRSELDYSEEALKEAAAAFRRIEGFVNRAAEMIHDVDAAAPLP
FT                   QPFVDAMNDDLNVPQALAVVHEVVREGNIAISQVNKEQVARLLAETQNMLDVLGLDPRA
FT                   EPWRSRNGSAMREVVDALVSIALEQRQAARARKDYATADAIRDRLAAAGIVVEDTPQGT
FT                   RWELAR"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /protein_id="YP_003651127.1"
FT   gene            555516..556484
FT                   /db_xref="GeneID:9166989"
FT                   /locus_tag="Tbis_0507"
FT   CDS_pept        555516..556484
FT                   /locus_tag="Tbis_0507"
FT                   /gene_family="HOG000218798" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /codon_start="1"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: bsu:BSU00960
FT                   hypothetical protein"
FT                   /db_xref="GI:296268496"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="GeneID:9166989"
FT                   /translation="MARKTSGKPAKKQKGSGGKIRGSLEGRGPTPPAHMRHWYKERVRA
FT                   AERQRKAAAAAQAPALARTPSRPFLEEGAEIIAGRNPVVEALRADIPARVLYVAYRIDT
FT                   DDRVREAIKIAADRDIPMVEVSRDRLDQLTGGAVHQGIGLEIPPYEYAHPDDLVEAAHQ
FT                   AGEVPLIVALDGVTDPRNLGAIARSAAAFGAHGIVVPSRRSVGVTSGAWKTSAGTLATL
FT                   PVARASNLTQTLKAYRKEGLFVVGLDGDAKEEIADNTLLTEPLVLVVGSEGKGLSRLVR
FT                   ETCDMLARIPMGERVESLNAGVAAGIALYEIARRRRQAVTQ"
FT                   /protein_id="YP_003651128.1"
FT   gene            556524..556596
FT                   /note="tRNA-Thr2"
FT                   /db_xref="GeneID:9166990"
FT                   /locus_tag="Tbis_R0014"
FT   tRNA            556524..556596
FT                   /db_xref="GeneID:9166990"
FT                   /locus_tag="Tbis_R0014"
FT                   /product="tRNA-Thr"
FT   gene            557647..557991
FT                   /db_xref="GeneID:9166991"
FT                   /locus_tag="Tbis_0508"
FT                   /pseudo
FT   gene            complement(558031..558915)
FT                   /db_xref="GeneID:9166992"
FT                   /locus_tag="Tbis_0509"
FT   CDS_pept        complement(558031..558915)
FT                   /locus_tag="Tbis_0509"
FT                   /gene_family="HOG000085953" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /codon_start="1"
FT                   /product="Silent information regulator protein Sir2"
FT                   /transl_table="11"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: bra:BRADO7087 NAD-dependent deacetylase"
FT                   /db_xref="GI:296268497"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="GeneID:9166992"
FT                   /translation="MADGLAAGGVGTAHARPCTVDPMGLLADLVADGEVVVLSGAGLST
FT                   ESGIPDYRGVNGRLRRSQPMTYQTFIGSAAARRRYWARSHLGWRHMAEARPNAGHHAVA
FT                   ELQRRGLVAGIITQNVDGLHQAAGARDVIELHGSLSRVRCLGCGERTPREVLDRRLREA
FT                   NPGWTARAGAVNPDGDVELSDEEIAGFRVVDCASCGGVLKPDVVFFGENVPRDRVAACL
FT                   ELAERAGLLLVLGSSLAVMSGYRLVRHAADHGIPIAIINQGPTRGDAHALVTIDARLGS
FT                   ALPRLLARLDAAW"
FT                   /protein_id="YP_003651129.1"
FT   gene            559070..559576
FT                   /db_xref="GeneID:9166993"
FT                   /locus_tag="Tbis_0510"
FT   CDS_pept        559070..559576
FT                   /locus_tag="Tbis_0510"
FT                   /gene_family="HOG000293548" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /codon_start="1"
FT                   /product="HxlR family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   dac:Daci_5358 HxlR family transcriptional regulator"
FT                   /db_xref="GI:296268498"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="GeneID:9166993"
FT                   /translation="MGLKRREWFSRVIKLRNVPREARPRECSIADTLDLVGERWSLLVI
FT                   REISYGVRRFDGIVRHTGAPRDILTTRLRKLEAAGVIRREQYRDHPVRYEYHLTPAGAE
FT                   LFDVLLMLMKWGDRHLNSGDPPVRWHHSCGEVLDPVVVCRHCGGEARTGAHSPIGRGVA
FT                   TPERI"
FT                   /protein_id="YP_003651130.1"
FT   gene            559932..561692
FT                   /db_xref="GeneID:9166994"
FT                   /locus_tag="Tbis_0511"
FT   CDS_pept        559932..561692
FT                   /locus_tag="Tbis_0511"
FT                   /gene_family="HOG000110165" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="family 2 glycosyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: exoO;
FT                   beta-D-1,6 glucosyl transferase"
FT                   /db_xref="GI:296268499"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:9166994"
FT                   /translation="MEAEGVGAVDVSVVVPAYGSRTSLDRCLTSLLVQRVRKEIIVVDD
FT                   GASEEVRRLLRLYAVYHPGVVRVIQEPGPGLPGRMRNRGLDAARGRFVYFGDPEEELGP
FT                   EVLGRMLAVADGQGADIVLRAAEGRAFPRAAAREALADGSVYDDLTCAKLFRRSMLERH
FT                   RIRFDETLRIGEDMVFAVHAYCHAEVISAVAVGERGGPPSRREEPSGDPLAWLQMIRVP
FT                   LAVLGRHVPPGPLRDRLLARHFRLDVLSQLGAPFLAAREEDREKIVAETADICAQWLTR
FT                   GVLDLLSLTDRARVEALDDITHLVRLAEVEQARLTHRLTGLEWQGDRLLICGRVALDGI
FT                   PGRPGLILRERASGREWRPGVTSVADLICAVIPARSLPAGVWDVHAVVECHGTRRTAPF
FT                   GQVRDANVTVPRLRFAGRRVVGPFFTPDGRLGVDVGGHVIRVPGSVRLTRTEWVGRRLR
FT                   VDGRVRVAKAPAAPAVRQLVWRERTSGLEVREPAAVTGPGTFSAQTCGFWPGVWDAYLE
FT                   LDVGGPPLRFPVKVDCPENLGRSLRWWRGPVRWTARPYATAVNRRLSTSVVVSSPRVVF
FT                   RRLVRRIRRT"
FT                   /protein_id="YP_003651131.1"
FT   gene            561765..562796
FT                   /db_xref="GeneID:9166995"
FT                   /locus_tag="Tbis_0512"
FT   CDS_pept        561765..562796
FT                   /locus_tag="Tbis_0512"
FT                   /gene_family="HOG000291302" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /codon_start="1"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: sus:Acid_6714 cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein"
FT                   /db_xref="GI:296268500"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="GeneID:9166995"
FT                   /translation="MHVPDGFFNLPVSVGTGLVAAAGVAVSLRGARRELDDRTAPMAGL
FT                   VAAFIFAAQMLNFPVAAGTSGHLLGGALAAILAGPYTAVLCLAVVLLVQAVFFADGGLT
FT                   ALGVNITLMAIVGSAVGWGVFRLVTRGRPRSRAVAVAGSFLAALVSVPVVALAFTLLFW
FT                   LGGTAPIDVAAVAAAMGGVHVLIGIGEGLITALVVSAVLAVRPDLVYGARGLAGPLVLR
FT                   TSEGEKVVTPEQPDAQPARTGLRPFLLGGGLVALLLAGVVSLFASSAPDGLERVAEDKG
FT                   FDTVAQPHPLEDGPMADYAVKGVENEMLATGAAGVIGVGITVVAGGLIFTAARRRNRDK
FT                   AAA"
FT                   /protein_id="YP_003651132.1"
FT   gene            562793..562984
FT                   /db_xref="GeneID:9166996"
FT                   /locus_tag="Tbis_0513"
FT   CDS_pept        562793..562984
FT                   /locus_tag="Tbis_0513"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268501"
FT                   /db_xref="GeneID:9166996"
FT                   /translation="MTPPMGGATPWTRGTPPGVAGAAVNGTAGPAHAGRDDTPSAAVRP
FT                   GAVSPVRVVRPSPSGRRG"
FT                   /protein_id="YP_003651133.1"
FT   gene            563054..563812
FT                   /db_xref="GeneID:9166997"
FT                   /locus_tag="Tbis_0514"
FT   CDS_pept        563054..563812
FT                   /locus_tag="Tbis_0514"
FT                   /gene_family="HOG000009137" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /codon_start="1"
FT                   /product="cobalt ABC transporter inner membrane subunit
FT                   CbiQ"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   gsu:GSU1280 cobalt ABC transporter, permease protein"
FT                   /db_xref="GI:296268502"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="GeneID:9166997"
FT                   /translation="MSAGHRLHLPGDTPVHRLPPQCKLAATLAFAVAVVATPRERFWAF
FT                   GVYALLLAGVALAARVPAAFLLRRMTIEVPFVLFAVAIPIIGMGERVEVLGVPLSVEGL
FT                   WASWNILAKATLGVAASILLAATTEPRMLLYGAERLRLPQLMVQIAMFMLRYLDVILDE
FT                   MRRMRIARESRGFVARDLRQAPVLAKSLGALFIRAYERGERVHIAMLSRGYTGRMPVID
FT                   ELPASGRQWAAAASVPVLAAVTAVLAWTLP"
FT                   /protein_id="YP_003651134.1"
FT   gene            564192..565007
FT                   /db_xref="GeneID:9166998"
FT                   /locus_tag="Tbis_0515"
FT   CDS_pept        564192..565007
FT                   /locus_tag="Tbis_0515"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /codon_start="1"
FT                   /product="cobalt ABC transporter ATPase subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: gme:Gmet_2439 cobalt transport protein ATP-
FT                   binding subunit; TIGRFAM: cobalt ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:296268503"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9166998"
FT                   /translation="MSGPAGERHAEGAERAAGAPPSLVVRDLAYAYPDGTQALFGVNFT
FT                   IRRGERVALLGPNGAGKTTLVLHLNGILTPGHGTVEVAGIPVRKDTLREVRRRVGLVFQ
FT                   DPDDQLFMPTVREDVAFGPANLGVRGAELERRVRDALARVGMLDAIDRPPHHLSFGQRR
FT                   RVAVATVLAMEPEILVLDEPSSNLDPASRRELAEILKSLDVTVLMVTHDLPYALELCER
FT                   SLILSGGVIVADGPTAELLADADLLAAHRLELPYGFSVPAAQRSFTHPA"
FT                   /protein_id="YP_003651135.1"
FT   gene            565040..565819
FT                   /db_xref="GeneID:9166999"
FT                   /locus_tag="Tbis_0516"
FT   CDS_pept        565040..565819
FT                   /locus_tag="Tbis_0516"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pna:Pnap_0798 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="GI:296268504"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="GeneID:9166999"
FT                   /translation="MDLNGAAAIVTGGASGLGEATARELARIGATVLVADINAERGKKI
FT                   ADEIGGVFAQTDVADEASVQAAVDAAVATGKPLRAVINCAGIGWAERTVNRDGSPHSLA
FT                   SYRKVIDVNLIGTFNFMRIGAAAMAKTDPVDSDNSRGVIINTSSVAGIEGQTGQVAYSA
FT                   SKGGIIGMTLPAARDLSVIGVRVLTICPGIIDTPIYGTIGSKDVEEFKARLLAPVAFPK
FT                   RMGRPEEFAHLVRSLIENDYMNGEVIRFDAGIRFQPK"
FT                   /protein_id="YP_003651136.1"
FT   gene            565831..566595
FT                   /db_xref="GeneID:9167000"
FT                   /locus_tag="Tbis_0517"
FT   CDS_pept        565831..566595
FT                   /locus_tag="Tbis_0517"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cti:RALTA_A1582 crotonobetainyl-CoA hydratase"
FT                   /db_xref="GI:296268505"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:9167000"
FT                   /translation="MADEVLVSVDGGVGVITINRPQAKNAVNAAVARGIADAIDDLDAR
FT                   KDVSVLVLTGAGGTFSAGMDLKAFLAGELPMIEGRGFGGITEAPPKKPIIAAVEGYALA
FT                   GGFELVLSCDLIVASEEAKFGLPEPKRGLVAAAGGVMRLPRRIPYHIAMEIALTGDFYP
FT                   ATRLHELGLVNRITPAGKALEEATELAKKIAANAPLALAATKKIMVESIDWSLDEMFAK
FT                   QDEITGPVFTSKDAMEGAAAFAEKRAPVWKGE"
FT                   /protein_id="YP_003651137.1"
FT   gene            566695..567327
FT                   /db_xref="GeneID:9167001"
FT                   /locus_tag="Tbis_0518"
FT   CDS_pept        566695..567327
FT                   /locus_tag="Tbis_0518"
FT                   /gene_family="HOG000241134" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /codon_start="1"
FT                   /product="rhomboid family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhomboid family protein; KEGG: lpp:lpp0886
FT                   hypothetical protein"
FT                   /db_xref="GI:296268506"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="GeneID:9167001"
FT                   /translation="MGDYWPSVPPPPRNPGNRLAHGLGGALGGISLVVLLVAAMWVIEI
FT                   VDTLLLGQLDQLGIIAQEPYGLPGILFAPFLHAGFGHLMANSVPLLILGSLAAIRGVGK
FT                   FVTASFLITMVSGIGVWLTSPPNTLTLGASGLVFGYFGYVVARGLFDRRPLDIVLSVIV
FT                   VLLYSSLLLGVLPVQPGVSWQGHLFGLIGGVLAAWLLRRRRYRPLYY"
FT                   /protein_id="YP_003651138.1"
FT   gene            complement(567826..568938)
FT                   /db_xref="GeneID:9167002"
FT                   /locus_tag="Tbis_0519"
FT   CDS_pept        complement(567826..568938)
FT                   /locus_tag="Tbis_0519"
FT                   /gene_family="HOG000239573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /codon_start="1"
FT                   /product="phosphoserine aminotransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V; KEGG: zmo:ZMO1684 phosphoserine
FT                   aminotransferase"
FT                   /db_xref="GI:296268507"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="GeneID:9167002"
FT                   /translation="MADIVIPADIKPADGRFGSGPSKVRPEQLAALAASGASVLGTSHR
FT                   QKPVKSLIARIKAGLTELFSLPDGYRVVLGNGGTTAFWEIAAFGLIRQKSQHLKFGEFS
FT                   SKFTKVAQKAPWLSEPTVIESEPGSHPTPVAEEGVDVYALTHNETSTGVAMPIKRVADD
FT                   DSLVLVDATSAAGGLPVSAEEFDVYYFAPQKCFASDGGLWIALMSPKALERAAEIAGSG
FT                   RYIPEFFSLPTAIDNSQKDQTYNTPSVATLFLLAEQIDWMNSQGGLAWTTARCADSASR
FT                   LYTWAEKTSYTTPFVADPAQRSNVVGTIDFVDGVDAATVAKVLRANGIVDTEPYRKLGR
FT                   NQLRIAMFPAIDPADIEALTACIDYVVERL"
FT                   /protein_id="YP_003651139.1"
FT   gene            complement(569228..570334)
FT                   /db_xref="GeneID:9167003"
FT                   /locus_tag="Tbis_0520"
FT   CDS_pept        complement(569228..570334)
FT                   /locus_tag="Tbis_0520"
FT                   /gene_family="HOG000021225" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /codon_start="1"
FT                   /EC_number="2.3.3.1"
FT                   /transl_table="11"
FT                   /note="PFAM: Citrate synthase; KEGG: mlo:mll3842 citrate
FT                   synthase 2"
FT                   /db_xref="GI:296268508"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="GeneID:9167003"
FT                   /translation="MSDFKPGLEGVVAFETEIAEPDKEGGALRYRGVDIEELVGKVSYG
FT                   HVWGLLVDNSFLPGLPAMEAFPLPVRSGDVRVDVQSALALLGPAFGFQPLLDIDDQQAR
FT                   DDLARASMLALSFVAQSARGLGKPMVPQRLVDEGKTIVEQFMIMWRGEPDPRHVKAIDA
FT                   YWTSAAEHGMNASTFTARVIASTGADVAAALSGAVGAMSGPLHGGAPARVLHMIEAVER
FT                   IGDAKKYVQSELDKGNRLMGFGHRVYRAEDPRARVLRRTAQELGAPRYEVAAALEKAAL
FT                   EELQARKPDRVLATNVEYWAAVVLDFAEVPANMFTSMFTCARTAGWAAHILEQKRTGRL
FT                   VRPSARYVGPSQRSINEVPGAAEVIGKL"
FT                   /product="citrate (Si)-synthase"
FT                   /protein_id="YP_003651140.1"
FT   gene            570508..571152
FT                   /db_xref="GeneID:9167004"
FT                   /locus_tag="Tbis_0521"
FT   CDS_pept        570508..571152
FT                   /locus_tag="Tbis_0521"
FT                   /gene_family="HOG000242755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /codon_start="1"
FT                   /EC_number="1.4.3.5"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_0514 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="GI:296268509"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="GeneID:9167004"
FT                   /translation="MDSASHLPGLRSAYDGEPLIESDMADDPLDQFTEWFADAVDARLP
FT                   EPNAMVLATSSAGGRPSARLVLLKGYDERGFVFFTNYESRKGRDLAENPRACLLFPWHA
FT                   IRRQVRIEGTVVRLPREESESYFHSRPYRSRIAAWASRQSAVLESRAVLEERFRRLAER
FT                   WPENPPMPDFWGGFRVIPQEIEFWQGGADRMHDRIRYRRGRDAWIRERLAP"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /protein_id="YP_003651141.1"
FT   gene            complement(571171..571797)
FT                   /db_xref="GeneID:9167005"
FT                   /locus_tag="Tbis_0522"
FT   CDS_pept        complement(571171..571797)
FT                   /locus_tag="Tbis_0522"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /codon_start="1"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ank:AnaeK_2690 phage SPO1 DNA polymerase- related protein"
FT                   /db_xref="GI:296268510"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="GeneID:9167005"
FT                   /translation="MGNSGDKRFLPDGEPSLPALREAARRCQGCSLYRNATQTVFGTGP
FT                   PDATFMFVGEQPGDQEDRQGAPFVGPAGRVLARAIEEAGIDRDRVYLTNAVKHFKFQTR
FT                   GKRRIHERPSAAEIAACRPWLTAELRVVDPVVTVVLGATAARALLGPAFRVTRRRGEPI
FT                   PRGVGSYYVATIHPSAVLRAPSGQRGPAYEGFLADVRVAARLGGR"
FT                   /protein_id="YP_003651142.1"
FT   gene            571875..572579
FT                   /db_xref="GeneID:9167006"
FT                   /locus_tag="Tbis_0523"
FT   CDS_pept        571875..572579
FT                   /locus_tag="Tbis_0523"
FT                   /gene_family="HOG000096101" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /codon_start="1"
FT                   /product="DtxR family iron (metal) dependent repressor"
FT                   /transl_table="11"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   SMART: iron dependent repressor; KEGG: sus:Acid_2178 DtxR
FT                   family iron dependent repressor"
FT                   /db_xref="GI:296268511"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="GeneID:9167006"
FT                   /translation="MTSNGLIDTTEMYLRTIFELEEEGIVPLRARIAERLQQSGPTVSQ
FT                   TVARMQRDGLVIVHDDRHLSMTETGRLLATRVMRKHRLAECLLTQVIGLPWEEIHIEAC
FT                   RWEHVMSEQVERRLVDLLNAPRYCPHGNPIPGLAELGVPEAEPAGEEKISTMASVATQE
FT                   PTKVVIRRISEQVQSDPALMLKLKQVGIQPGREVTLATSDDGVRVTGDDQAGGTDMDLP
FT                   RGVAAHLFVASA"
FT                   /protein_id="YP_003651143.1"
FT   gene            572703..574937
FT                   /db_xref="GeneID:9167007"
FT                   /locus_tag="Tbis_0524"
FT   CDS_pept        572703..574937
FT                   /locus_tag="Tbis_0524"
FT                   /gene_family="HOG000101486" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /transl_table="11"
FT                   /note="KEGG: protein serine phosphatase with GAF(s)
FT                   sensor(s); TIGRFAM: PAS sensor protein; PFAM: Stage II
FT                   sporulation E family protein; GAF domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART:
FT                   protein phosphatase 2C domain protein; GAF domain protein"
FT                   /db_xref="GI:296268512"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:9167007"
FT                   /translation="MRSWGDLPQDITERMTAEAILEQTDMAVVVADRFSNILYWNPFAE
FT                   RLFGKSGKPTAKDSLANLGMADKDRPVAGELARHVLRGGVWEGTFDVIRGDGTMVYVRA
FT                   QAVPMRHPSGSVSGIVLTAREAMRSNEREKDRIGLLERIGERLAGSLYLEETLDRVADV
FT                   LVPQFADHCFIELFEGNRLIRKVSRHAHGWQPPADAWKGVGDEINYPPGHYAESALRYQ
FT                   ETVLVEDFSQVSFPATSEAAARVCAEVGITSAIAAPLCARGEVLGLLYLALSNLSDRSS
FT                   HHYDSFDRDLVGAIATRVALAVDNALLFEEERHTAESFQKHLLPRDFPEFDGLQVAAWY
FT                   YPAAPLPSRGQGIQTQVGGDWYDVIPLSAGRVGIVIGDVEGRGAKAAAIMGQLRAALRA
FT                   FATDDKPPADILTKLDEWTRIVVEPERDEYGADVSSPPIVTCLYMVYDAWSRQLSYANA
FT                   GHAPPLLIVDGTVQELDISEVGHPLGVRAKGMHADLVYKEETRTLPPGATLLLYTDGLV
FT                   DRRPPRDADGTPMSDDDALRTLCDTLAKVANEPVERIAEAASRAIPGEIDDDMAILVVR
FT                   SVDDDLEFEERTFPAQPIMVGEARRMAAEAFASWQVPEERAELACLLVSEVVTNVVLHA
FT                   ANSNVPRRALVLDGPPLPFDESWDTWDFPGADDEVVGDKEFTLRLRRGKKSIWVEVFDQ
FT                   DLRLPRIRSAGENDEGGRGLYLVDQLAARWGSRPTRDGKAVWFEINISGH"
FT                   /protein_id="YP_003651144.1"
FT   repeat_region   575392..575835
FT                   /note="CRISPRs"
FT                   /rpt_unit_range="575392..575422"
FT   gene            576138..576302
FT                   /db_xref="GeneID:9167008"
FT                   /locus_tag="Tbis_0525"
FT   CDS_pept        576138..576302
FT                   /locus_tag="Tbis_0525"
FT                   /gene_family="HOG000110176" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296268513"
FT                   /db_xref="GeneID:9167008"
FT                   /translation="MDSGLILLVFLAFLFAWALNRVRRFFKLTPLRYAGVMVVFIVVML
FT                   LLWGQEQIR"
FT                   /protein_id="YP_003651145.1"
FT   gene            complement(576492..577637)
FT                   /db_xref="GeneID:9167009"
FT                   /locus_tag="Tbis_0526"
FT   CDS_pept        complement(576492..577637)
FT                   /locus_tag="Tbis_0526"
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: pag:PLES_48141
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="GI:296268514"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:9167009"
FT                   /translation="MQRDLFEEEHLLFRDTVREFLAREVVPHHAQWEKDGIVPRDVWKK
FT                   AGELGLFALSVPEQYGGSGIRDFRYNAVLDEEIIRAGASGLGFSLHNDVVAPYLLDLTN
FT                   DEQKERWLPGFVSGELITAIAMTEPGAGSDLQGIRTTAIRDGDHYVLNGQKTFITNGIN
FT                   ADLVIVVAKTDPSAGARGITLLVVERGMEGFTRGRNLEKIGLHAQDTAELFFDNVRVPV
FT                   ANRLGPEEGQGFIQLMQNLPQERLSIAVAAVAASERVLEMTIEYCRNRKAFGRSIGSFQ
FT                   NTRFVLAELATEVEIARHYVDKCIRALNAGELTAVDAAKAKWWTTDLQNKVIDRCLQLH
FT                   GGYGYMLEYPVAKAWLDGRVQSIYGGTNEIMKEIIGRSFGF"
FT                   /protein_id="YP_003651146.1"
FT   gene            577861..579303
FT                   /db_xref="GeneID:9167010"
FT                   /locus_tag="Tbis_0527"
FT   CDS_pept        577861..579303
FT                   /locus_tag="Tbis_0527"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296268515"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="GeneID:9167010"
FT                   /translation="MSQWTARRRRGLAAAVASVVGGMLLATPATPAQAQTAEIDLTYRC
FT                   RGGLVSSTPVQLKATLTVQTALTVGQPLDIRWDIKYADTSRFVSPDYFAAGGRLSATGA
FT                   VKVTGQQWSGELHSSGAQEQEQLRKGDALTLPSLISGAVSTTQPGTFEIVPERLTLGFI
FT                   PPASERIVNDDDPAVTYHGDHWRDDNDRPAHFNDIHNDVHATDKAWHRVEFKFTGTGVD
FT                   FITEQDHRAGRLEFKIDGRPGVPQHADASKDENGNPVTVVNRGNHTLWSVRGLPYGEHT
FT                   LEITNTEDKWAIVDGFRVVTEELLDPPSQFRVTCTAVNKPTAIRVVISEGGAGSPSNGP
FT                   GNGGPSSTPSVSPSNGNGGNGDGGGNGNESPSPGPSDGGQSPSPGTSGSPTPSGSPRPT
FT                   VTTTVTATATPTVAQVLVTPRGGVQTGEAPAGNAAGAAMLLGSGGLLLALAAGSGVALA
FT                   RRRAAHATGPAAGEGGDEHHTG"
FT                   /protein_id="YP_003651147.1"
FT   gene            579284..580390
FT                   /db_xref="GeneID:9167011"
FT                   /locus_tag="Tbis_0528"
FT   CDS_pept        579284..580390
FT                   /locus_tag="Tbis_0528"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /codon_start="1"
FT                   /product="peptidase C60 sortase A and B"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   bja:blr0521 hypothetical protein"
FT                   /db_xref="GI:296268516"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="GeneID:9167011"
FT                   /translation="MSTTPGDAPTPEEQPAASGEGVTPGAASGESASAGPTGHPAHRPA
FT                   DPAPAGPYGTAEGSPGAPQTPAPPQSPAAPQMPSSPHVPAVQHVPAAQAMPAAQPVPAA
FT                   QPVPGAAPGRRSLPQPVLAGMLIAGSLGGIVAVMAGTLALLSPSAEEADPVNAQRAGVS
FT                   GAALAPTVGPGGTDQPLTAAAATAPPPDPAARPRRPLTLTPKNASAARMTLARTKGRPV
FT                   RIRIPAIGVSAPVEPVGVDAKGEMQVPPLSKPNLVGWYRLGPAPGEQGPAILLGHVNTR
FT                   AGAAVFYRLRELKRGNKIAIRRADGKTAIFTVDGIEQVSKLTFPTKRVYGNTATASLRL
FT                   ITCGGLYDAKTHHYTDNVIVYATLTSVV"
FT                   /protein_id="YP_003651148.1"
FT   gene            580629..581528
FT                   /db_xref="GeneID:9167012"
FT                   /locus_tag="Tbis_0529"
FT   CDS_pept        580629..581528
FT                   /locus_tag="Tbis_0529"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="GI:296268517"
FT                   /db_xref="GeneID:9167012"
FT                   /translation="MGARSVRESKATGRIAARAALAGAIGASVLLGGGFLIEADAAPVT
FT                   VAYTCTAAQSRATHAPELTVSLAGPASAAPSQPVTVVWANTQPTEPGKFLPAPGPIPAT
FT                   QPITLTGQLVVAGPSATTTAQAAGSSTPGLEVPSGVPVPLPPMTATVTPAAAGAMTITA
FT                   QAFTLQLSTGDTPVTYSCTPAPGATPASHVVTVAAGPVTSPTPSGSASPSLPTSPSPTP
FT                   SPTTPRPTRTVYKTVTMQPTQGVQVTRTPKGGANTGGGGEAGPDGRVLILTGGALVLAS
FT                   AAGGLALRARTRGVRQRS"
FT                   /protein_id="YP_003651149.1"
FT   gene            581542..582438
FT                   /db_xref="GeneID:9167013"
FT                   /locus_tag="Tbis_0530"
FT   CDS_pept        581542..582438
FT                   /locus_tag="Tbis_0530"
FT                   /gene_family="HOG000019512" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /codon_start="1"
FT                   /product="peptidase C60 sortase A and B"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="GI:296268518"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="GeneID:9167013"
FT                   /translation="MTMPPAGQYPPGPPHGAPIDPNLPAGPPPVLQPVVLPPVVPQAPV
FT                   PPEPEPVAGSASLALRGVLLFAAVAGIITVIIGVISVVSSPEEYAAPDRSTIRLQREEP
FT                   GGLAPSVGPGGPGEPLTQAAATAPPPVPAEPPAAPLQPATPKRLIIPKLGVDAPIISVG
FT                   TDRNGELESPPMDEPNLVGWYRGGPTPGQAGPAVLLGHKDTRTRSAVFSRLHELRYGDR
FT                   IEVVRMDGTVAVFTVGGVEQASKDTFPTERVYGRTEYAELRLITCGGVYNRVSGHYLDN
FT                   VIVYARMTATERVDRAS"
FT                   /protein_id="YP_003651150.1"
FT   gene            582579..583724
FT                   /db_xref="GeneID:9167014"
FT                   /locus_tag="Tbis_0531"
FT   CDS_pept        582579..583724
FT                   /locus_tag="Tbis_0531"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: swi:Swit_3630 acetyl-CoA acetyltransferase"
FT                   /db_xref="GI:296268519"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="GeneID:9167014"
FT                   /translation="MAEAYIVGAVRTPVGKRNGGLSTIHPTDLAAHTLAALIERTGVDP
FT                   AAVDDVIMGCVSQIGPQSLDIARNAWLSAGLPESVPGVTIDRQCGSSQQAIHFAAQAVM
FT                   SGTQDLVVAAGVESMSMVPIGSNVTIPLEKGMPFPYGEKWVERYGNQEISQFRGAELMC
FT                   EKWGFSREDLEKYALESHQRASKAIANGYFAEQIVPINGVEHDEGPRPDTSLEKMAALP
FT                   TLRPDGKITAATSSQVSDGAGAVLIASERAVREHNLTPRARIHTLALAGDDPVYMLTAP
FT                   IPATKKALQRAGLSIDDIDVIEINEAFAPVPLAWLREIGADPAKTNPNGGAIALGHPLG
FT                   GTGAILMTKLLHELERIGGRYGLQTMCEGGGQANVTIIERL"
FT                   /protein_id="YP_003651151.1"
FT   gene            complement(584160..586031)
FT                   /db_xref="GeneID:9167015"
FT                   /locus_tag="Tbis_0532"
FT   CDS_pept        complement(584160..586031)
FT                   /locus_tag="Tbis_0532"
FT                   /gene_family="HOG000131667" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: ade:Adeh_1417
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="GI:296268520"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="GeneID:9167015"
FT                   /translation="MTDYAKAREVAEEAREQWIRPSFGKQLFLGDFRLDLVYPAPPEPE
FT                   AAVAKGEEFLRVLTEFLRERVDPMAIERNAMIPDEVVKGLAEIGAFGMTIGEEYGGLGL
FT                   SHYHYCKALALTASYSPALCALLSAHQSIGVPKPIQLFGTEEQKRRFLPRCARGEISAF
FT                   LLTEPDVGSDPARLSTTAVRDGDSYVIDGVKLWTTNGVVADLLVVMARTGEKISAFVVE
FT                   ADSPGITVENRNSFMGLRGIENGVTRFHQVRVPAENLIGREGQGLKIALTTLNTGRLSL
FT                   PATCAGAVKWALKIAREWGDQRVQWGKRIGGHEAIAKKIAFIAATAYAIDAIVDLTCRL
FT                   ADDERNDIRIEAALAKLYATEMAWLAMDELVQMRGGRGYETAESLHARGERGVPAEQFL
FT                   RDLRINRIFEGSTEIMHLLIAREAVDTHLSVAGALIDPKADLKTKGRAAAKAGGFYAKW
FT                   LPSLLAGSGQLPSAYAAFGPVARHLRFVERTSRKLARNTFYGMSRWQGRLEHRQAFLAR
FT                   LVDIGAELYAMTAVCVRAKEDAAKAGPGAYAIADVFCRQARLRVKDLFRRLWVNTDAED
FT                   TGLARRVLEGDYLFVEEGILDPSIEGPWVAPARPGPSERPDVHRHIG"
FT                   /protein_id="YP_003651152.1"
FT   gene            complement(586872..587654)
FT                   /db_xref="GeneID:9167016"
FT                   /locus_tag="Tbis_0533"
FT   CDS_pept        complement(586872..587654)
FT                   /locus_tag="Tbis_0533"
FT                   /gene_family="HOG000269178" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /codon_start="1"
FT                   /product="type 12 methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: mxa:MXAN_1023 putative pristinamycin I
FT                   synthase 3"
FT                   /db_xref="GI:296268521"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:9167016"
FT                   /translation="MIANYTCHDRQRVNEDLMSGYDRVVQPAAGDDALENHLGGDEAKN
FT                   YRRYEFDMVAPHVGRSMLEIGSGLGHFAEQFLPRVDRLVVSDFDPYCVERLRERFAGHG
FT                   NVSVLQFALPAEVPLDEPVESVVMMNVLEHIAEDVDALRSVAKVTVPGGRIVIWVPGYM
FT                   QLYGDFDRKVGHVTRYTPTTLRRTVTAAGLDIEVLKPINFLGGIAWWAAVKRGGVGYPD
FT                   PRLVKIYDRTVVPLTRFIERFIRPPFGQTVFCVARVPG"
FT                   /protein_id="YP_003651153.1"
FT   gene            complement(587959..589155)
FT                   /db_xref="GeneID:9167017"
FT                   /locus_tag="Tbis_0534"
FT   CDS_pept        complement(587959..589155)
FT                   /locus_tag="Tbis_0534"
FT                   /gene_family="HOG000218814" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /codon_start="1"
FT                   /EC_number="3.5.4.4"
FT                   /transl_table="11"
FT                   /note="KEGG: aba:Acid345_0045 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="GI:296268522"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="GeneID:9167017"
FT                   /translation="MRHDKRMARPLDRLPKAHLHLHFTGSMRHATLIELAEKHGVHLPD
FT                   ALVREWPPRLRATDERGWFRFQRLYDIARSVLRRPEDVQRLLREAAEDEAREGSRWLEI
FT                   QVDPSGYAQWFGGLTSTLELILDAADRASKDTGVGIAVIVAANRTRHPLDARTLARLAA
FT                   QYVGKGVVGFGLSNDERRGRARDFDHAFRIAKRAGLLAVPHGGELLGPSSVRECVEDLQ
FT                   ADRVGHGVRAAESPWLMERLAERQIACEVCPLSNVSLGVAQRPEDVPLRRLFDAGVPIA
FT                   LGADDPLLFGARLLPQYELARQVYGFSDAELAEMARQSIRASAAPDSVKKELLAEVDAW
FT                   LASPPEPVSPPEPVSPAEAVPAAPSQAEPVPAEPAAAGPAPGGSPVPAPAPGLMAQPA"
FT                   /product="adenosine deaminase"
FT                   /protein_id="YP_003651154.1"
FT   gene            complement(589475..590680)
FT                   /db_xref="GeneID:9167018"
FT                   /locus_tag="Tbis_0535"
FT   CDS_pept        complement(589475..590680)
FT                   /locus_tag="Tbis_0535"
FT                   /gene_family="HOG000223062" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /codon_start="1"
FT                   /product="aminotransferase class I and II"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   ppd:Ppro_2189 aminotransferase, class I and II"
FT                   /db_xref="GI:296268523"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="GeneID:9167018"
FT                   /translation="MTRPRISARISAISESATLAVDAKAKAMKAAGRPVIGFGAGEPDF
FT                   PTPDYIVEAAVEACRNPRFHKYTPAGGLPELKEAIAAKTKRDSGFEVEPSQVLVTNGGK
FT                   QAVYEAFATLLDPGDEVLVPAPYWTTYPEAIKLAGGVQVDVVTDESTGYLASVDQLEER
FT                   LTERTKALLFVSPSNPTGAVYSPDQVAEIGRWAAEKGLWVVTDEIYEHLVYGDAKFSSI
FT                   ATLVPELRDRVVVLNGVAKTYAMTGWRVGWLIGPKDVVKAATNLQSHATSNVCNVAQAA
FT                   ALAAVSGDLSAVERMREAFDRRRRTMVRMLNEIPGVVCPEPKGAFYAYPSVKALLGKEI
FT                   RGRRPQTTTELAELILEEAEVALVPGEAFGTPGYFRLSYALGDEDLVEGVSRVAKLLAE
FT                   AR"
FT                   /protein_id="