(data stored in ACNUC8465 zone)

HOGENOMDNA: THEPD_1

ID   THEPD_1; SV 1; empty ; DNA; empty ; PRO; 31504 BP.
XX
AC   NC_008696;
XX
PR   Project: 58563;
XX
DE   Thermofilum pendens Hrk 5 plasmid pTPEN01, complete sequence.
XX
OS   Thermofilum pendens Hrk 5
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermofilaceae;
OC   Thermofilum.
XX
RN   [1]
RP   1-31504
RX   PUBMED; 18263724.
RA   Anderson,I., Rodriguez,J., Susanti,D., Porat,I., Reich,C., Ulrich,L.E.,
RA   Elkins,J.G., Mavromatis,K., Lykidis,A., Kim,E., Thompson,L.S., Nolan,M.,
RA   Land,M., Copeland,A., Lapidus,A., Lucas,S., Detter,C., Zhulin,I.B.,
RA   Olsen,G.J., Whitman,W., Mukhopadhyay,B., Bristow,J. and Kyrpides,N.;
RT   "Genome sequence of Thermofilum pendens reveals an exceptional loss of
RT   biosynthetic pathways without genome reduction";
RL   J. Bacteriol. 190 (8), 2957-2965 (2008)
XX
RN   [2]
RP   1-31504
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-DEC-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-31504
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Dalin,E., Tice,H., Pitluck,S., Thompson,L.S., Brettin,T.,
RA   Bruce,D., Han,C., Tapia,R., Schmutz,J., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Kim,E., Anderson,I., Olsen,G., Reich,C., Woese,C. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (14-DEC-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000506.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001423
CC   Source DNA and archaea available from Carl Woese
CC   (carl@phylo.life.uiuc.edu)
CC   Contacts: Carl Woese (carl@phylo.life.uiuc.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..31504
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:368408"
FT                   /note="type strain of Thermofilum pendens Hrk 5"
FT                   /strain="Hrk 5"
FT                   /plasmid="pTPEN01"
FT                   /organism="Thermofilum pendens Hrk 5"
FT   gene            complement(47..1714)
FT                   /db_xref="GeneID:4600341"
FT                   /locus_tag="Tpen_1840"
FT   CDS_pept        complement(47..1714)
FT                   /locus_tag="Tpen_1840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pfa:PF11_0207 hypothetical protein"
FT                   /db_xref="GI:119709758"
FT                   /db_xref="GeneID:4600341"
FT                   /translation="MAEERKKPVEVKEYEASEYLKQLGYSEEELRRMGVLPAEEVPEPV
FT                   EVEIEEIPEAEIEEAPEVEVEIEEYPGEEEVAKAKEEHERQVAEVMDKIRDAVRGMMKT
FT                   RAWVMVHGKPLETLPPLKKEDIAAVAKTPEGDVSIITKEGKEYVVVAGEKVYEVELPQE
FT                   DKLAVQRLTAELSKRYGAAAVTEAVDRMLKEYAPRLYPALKEKAPAAVAAVGKAKEAVS
FT                   GATKGWKLALYRALYPGVLSTYDYFSRMTEATLNMVAALGLTGLLAYLITWARGFAASG
FT                   AGGLWGLMEEKDVVVALFNFLLDLASYTLIPALLAVFVFLLVYLGGAITGAVRLIRVGG
FT                   ESRSVVVPLFSFVSAVLNAMFRQMLVGYLVGAVAEYVAIVIVALLSSVVLLWLGLLAVS
FT                   ALTGLFLGGIQGALVFALLVFLPVASVLAGALTLVLLGRSSRAMLRLTDLPTLLLATVV
FT                   AVSYKFAFIQPLLWLVLAAVVVILGIIAASRPVERLMVLLRGVAVIAGAIFAVHLGYSG
FT                   IEDFVVPAFRLYCQILGLPEGVVNTAVDWARKILYVIP"
FT                   /protein_id="YP_919098.1"
FT   gene            complement(1778..2074)
FT                   /db_xref="GeneID:4600312"
FT                   /locus_tag="Tpen_1841"
FT   CDS_pept        complement(1778..2074)
FT                   /locus_tag="Tpen_1841"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709759"
FT                   /db_xref="GeneID:4600312"
FT                   /translation="MRPDEAVRTAKAIRLLFALLNTLLLVLLIPSAFRMALGGIELPMM
FT                   LGSIAGVALSRRYPQVSGIILLINVLALVVSAGVPAIIKPLAPPVSPVNLTKP"
FT                   /protein_id="YP_919099.1"
FT   sig_peptide     complement(1964..2074)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.680) with cleavage site probability 0.600 at
FT                   residue 37"
FT                   /locus_tag="Tpen_1841"
FT                   /product="hypothetical protein"
FT   gene            complement(2071..3015)
FT                   /db_xref="GeneID:4600318"
FT                   /locus_tag="Tpen_1842"
FT   CDS_pept        complement(2071..3015)
FT                   /locus_tag="Tpen_1842"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="abortive infection protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Abortive infection protein"
FT                   /db_xref="GI:119709760"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="GeneID:4600318"
FT                   /translation="MRAGSYKVALVHYTAIAVAGILLAYVALRAFLLLGILYVIGAVGG
FT                   LIVSLVVGALAGAIPGRGEAKPNNPWTLVMPVALNAAILFSLVSYGYSNLALMGTSMVV
FT                   LFLANRGFKPPEPDMARGVIGGFAAFIVVLVLSLLTNLFLQGRLEPLGGYNGTLLYTGI
FT                   APAASSGGLEAQFWAFIMLFVVAVSEEMWRAATYYNVLANSSHRLATVIATTWFLFMHV
FT                   PSRMQYGLQAPVIIALIGIATLTMWFFARGDIWAMVVAHGIYNTALAGIAYGMLPVELL
FT                   LLAIFVYAVWYSGSGVTVEIPEKVAEKVKGVVA"
FT                   /protein_id="YP_919100.1"
FT   gene            complement(3012..3572)
FT                   /db_xref="GeneID:4600299"
FT                   /locus_tag="Tpen_1843"
FT   CDS_pept        complement(3012..3572)
FT                   /locus_tag="Tpen_1843"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709761"
FT                   /db_xref="GeneID:4600299"
FT                   /translation="MDLDRAIKTVGLVNAVLTTVLITLWVIAAFRSVVVTAEVAGIPLV
FT                   PPLAATQPSPETVGKAIISLLYTVFKYVIYAVIVITGIYVALGLVANFVTAFLPITVPR
FT                   ATLNTLIKNILALFIIKLVVDASLSYFGYSADVAENMAVLEGVGGAPSLLLIAAMVTGV
FT                   AVAVYLVYRALKKRLGEVEVVLE"
FT                   /protein_id="YP_919101.1"
FT   gene            complement(3585..3803)
FT                   /db_xref="GeneID:4600317"
FT                   /locus_tag="Tpen_1844"
FT   CDS_pept        complement(3585..3803)
FT                   /locus_tag="Tpen_1844"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709762"
FT                   /db_xref="GeneID:4600317"
FT                   /translation="MPRKKGIAKAVSRVLKSDAFAVAVFVLFMVGAIIVGWNPFGYTLG
FT                   LPNLLLEGVFVLGMYFIYATKLRHRLI"
FT                   /protein_id="YP_919102.1"
FT   gene            complement(3846..4214)
FT                   /db_xref="GeneID:4600335"
FT                   /locus_tag="Tpen_1845"
FT   CDS_pept        complement(3846..4214)
FT                   /locus_tag="Tpen_1845"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709763"
FT                   /db_xref="GeneID:4600335"
FT                   /translation="MPFEYAGCKVERQGNAYILVCPAGRAIVKKDEVVLYTPEGAVRVF
FT                   SPDVHAIRGKISAVEPVKRGLPELLSEIGSEASAESPEELYNDIRLYEETEAAPERLWR
FT                   EYAETERRLRSLRSWLYE"
FT                   /protein_id="YP_919103.1"
FT   gene            complement(4306..4677)
FT                   /db_xref="GeneID:4600330"
FT                   /locus_tag="Tpen_1846"
FT   CDS_pept        complement(4306..4677)
FT                   /locus_tag="Tpen_1846"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709764"
FT                   /db_xref="GeneID:4600330"
FT                   /translation="MNRKASVPMLGGCIVVHQVYPPSKSVGGKGEAVYFLKCPGGFVEV
FT                   HEHVTVIRPKGEEEFGYVFRSETEGWYGPGARVLSWVPLWHYLDDITDGKFKKKVHTPE
FT                   ELYSLVEEAYAQWEAEVGV"
FT                   /protein_id="YP_919104.1"
FT   gene            complement(4677..5063)
FT                   /db_xref="GeneID:4600323"
FT                   /locus_tag="Tpen_1847"
FT   CDS_pept        complement(4677..5063)
FT                   /locus_tag="Tpen_1847"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709765"
FT                   /db_xref="GeneID:4600323"
FT                   /translation="MKCPRGEAYVEPEHVSVTVRRDNTVTEQAFFRSEDGWLLKVAGDR
FT                   LFNADTSLSDVLSSIGLYDEPREALESMGFDVDEVEPVVTRVESVESPEELYGMARRAY
FT                   NKWRSSKAYVESGELAFTLPRGEV"
FT                   /protein_id="YP_919105.1"
FT   misc_feature    complement(<4821..4910)
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:176609"
FT                   /locus_tag="Tpen_1847"
FT   gene            complement(5211..5609)
FT                   /db_xref="GeneID:4600344"
FT                   /locus_tag="Tpen_1848"
FT   CDS_pept        complement(5211..5609)
FT                   /locus_tag="Tpen_1848"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709766"
FT                   /db_xref="GeneID:4600344"
FT                   /translation="MYGSTVSMEEYRRLRQYLLRKPTLGGCRVERVPGGYRVVCRRGNA
FT                   VVSEEGAVFLFEDNRMAFYKGDVSVEGRDLRYPARPFSEALASIGFQEEAESPEELYGM
FT                   AESVYTAWEEDIEEVKRRLRERYGEVYE"
FT                   /protein_id="YP_919106.1"
FT   gene            complement(5762..5995)
FT                   /db_xref="GeneID:4600348"
FT                   /locus_tag="Tpen_1849"
FT   CDS_pept        complement(5762..5995)
FT                   /locus_tag="Tpen_1849"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709767"
FT                   /db_xref="GeneID:4600348"
FT                   /translation="MARYKSARVGERGEPKPRCCVCGSEDVCAKIEGKFYCYKCGSRII
FT                   VEHSRRIVEELVAKYLGEKLLTQDDPFNWGGG"
FT                   /protein_id="YP_919107.1"
FT   gene            complement(6000..6356)
FT                   /db_xref="GeneID:4600310"
FT                   /locus_tag="Tpen_1850"
FT   CDS_pept        complement(6000..6356)
FT                   /locus_tag="Tpen_1850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709768"
FT                   /db_xref="GeneID:4600310"
FT                   /translation="MHRLTEEQINRVNATRKLLVVDSSKLPRGLLRYLTEKWRGDASQL
FT                   LANAASFLPCRCRDCICTDEPRNNPGGDVVIVAGFLEWQLFLQVTEKYGVCFETVEQAL
FT                   TFAWEVMPSSFRRL"
FT                   /protein_id="YP_919108.1"
FT   gene            complement(6500..6697)
FT                   /db_xref="GeneID:4600304"
FT                   /locus_tag="Tpen_1851"
FT   CDS_pept        complement(6500..6697)
FT                   /locus_tag="Tpen_1851"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709769"
FT                   /db_xref="GeneID:4600304"
FT                   /translation="MGLRDWLRRGGLEVEFEDEEELVEAPPGLEEEEEPWEEWESEEEY
FT                   WEQPPRVRKWWWEESEEEEE"
FT                   /protein_id="YP_919109.1"
FT   gene            complement(6813..7586)
FT                   /db_xref="GeneID:4600329"
FT                   /locus_tag="Tpen_1852"
FT   CDS_pept        complement(6813..7586)
FT                   /locus_tag="Tpen_1852"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709770"
FT                   /db_xref="GeneID:4600329"
FT                   /translation="MPRPKKLRNAKVVPLVLEGELYEQAKRIAAQLGVSVSEYVRQALK
FT                   EKIEADSVRLGLSNVFEEKAVAQARDGSLTAEVAGVPPLAVAQFNDFARSWEELRPALA
FT                   KAVDEVKMLWGEWQGLDEEARHYAEKEVPPHLHDKWVKVEGRGEMWGRQAFQAFVEEYK
FT                   AKRMKELAGRLREVDAVISRYWKLYYVWMKLRKEVFRDDNKDKEMLSRAAKIEAELARM
FT                   YERIAEVRKEREELRRALYGSQKKGRRGFSTARRQ"
FT                   /protein_id="YP_919110.1"
FT   gene            complement(8070..8768)
FT                   /db_xref="GeneID:4600315"
FT                   /locus_tag="Tpen_1853"
FT   CDS_pept        complement(8070..8768)
FT                   /locus_tag="Tpen_1853"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709771"
FT                   /db_xref="GeneID:4600315"
FT                   /translation="MWLLVFDPVEAKALYARIEEMGFLETELVMVAKVVFSTFDKMDDG
FT                   VKRAKRAASKWWNIPAKIAIRLFPSWYYMHMAPSYLFHAPQSLAASVDTGKGALHLLWA
FT                   DVVEVNKAEYQLVSLFKNVEDVKSFLEGEKVFKRALALATARKHDEIAEMSKAVAEIIT
FT                   VSARILKTIVDNIPGSYDIIEQVLSKYNVKGETVVEFATSEAVARQLLAKLKEMAGAPA
FT                   PAGAPAPTPA"
FT                   /protein_id="YP_919111.1"
FT   gene            8952..9350
FT                   /db_xref="GeneID:4600313"
FT                   /locus_tag="Tpen_1854"
FT   CDS_pept        8952..9350
FT                   /locus_tag="Tpen_1854"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709772"
FT                   /db_xref="GeneID:4600313"
FT                   /translation="MPRDKNYLFKVKVKRYKRGGHVVEIVARGQGLKSAYYLIDKLLNN
FT                   ELIHYQPTSVVRRLKKRQRLEGGGKRFVIESKPVKPREKKPPENEKPQNFEANPPPSPP
FT                   APAEDSEEELPSFVKGNPWVGILSQGRR"
FT                   /protein_id="YP_919112.1"
FT   gene            9482..9862
FT                   /db_xref="GeneID:4600326"
FT                   /locus_tag="Tpen_1855"
FT   CDS_pept        9482..9862
FT                   /locus_tag="Tpen_1855"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709773"
FT                   /db_xref="GeneID:4600326"
FT                   /translation="MVCGRLTVAREKNLEMRKAILQLWNQGFRTPRAVAERLGVPTGKV
FT                   RWYMWQMRREGLLPKKDTEGDLLDKSLTLLKGALFHISSTRIDIYASNPKLADSLARAE
FT                   NYVREAMELIQVYRRMKWVVNR"
FT                   /protein_id="YP_919113.1"
FT   gene            9859..10311
FT                   /db_xref="GeneID:4600342"
FT                   /locus_tag="Tpen_1856"
FT   CDS_pept        9859..10311
FT                   /locus_tag="Tpen_1856"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709774"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="GeneID:4600342"
FT                   /translation="MKREDWEVIEEDEEIVEEEEEPVEEEVVEEDEERVNEPDEVVIAK
FT                   PEPSLESYMTRTELFLMHVYETKRYFNMSQEAKRRGMKQLASRFLRESRQHLRVAFHMC
FT                   PYRPHMCPLYDVWTGKCPVGLEDRCRPLAWSKARPKKIRGWFRKKK"
FT                   /protein_id="YP_919114.1"
FT   gene            10818..12032
FT                   /db_xref="GeneID:4600320"
FT                   /locus_tag="Tpen_1857"
FT   CDS_pept        10818..12032
FT                   /locus_tag="Tpen_1857"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709775"
FT                   /db_xref="GeneID:4600320"
FT                   /translation="MVMYASNTVSTAALNKPLNRPLNTSKAMRMDKKKLLVVALLLAVV
FT                   AGAVYLAHLDADKREVPSETIDTGKYIDAYVSVYVNGRLAATQRMHSFTSAFSYLAPIA
FT                   FTPTSSFTQTSTFTGVVEPVSAYGAALTPGSYSWILQKGRFYGCPASAASPWQVAITQT
FT                   PLPRLVAVFYNTSGSKIGEAVFSGTSVDLANKVVNATGTVLYLTASFTYTGATATNIKE
FT                   VHLARPTGQVYSLAPGASCGGMRITNDSFATAITVNPNDVVTVVYTFYFKKPLTTNFAY
FT                   MFLAFLYNAKDQVVPLNATDGSTFTFNVAVAVPINTTISVFTSSGTVSVKEPTVTVGPG
FT                   VWALSQAFKFTSNDYVTRIQLRVRFENGKDVVIVDYVPSQPIPVKPDRPYIFSVSFSYP
FT                   FVNKP"
FT                   /protein_id="YP_919115.1"
FT   sig_peptide     10818..10976
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.433 at
FT                   residue 53"
FT                   /locus_tag="Tpen_1857"
FT                   /product="hypothetical protein"
FT   gene            12044..12730
FT                   /db_xref="GeneID:4600325"
FT                   /locus_tag="Tpen_1858"
FT   CDS_pept        12044..12730
FT                   /locus_tag="Tpen_1858"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709776"
FT                   /db_xref="GeneID:4600325"
FT                   /translation="MRRSVVALPLLLLALLTVNAVPVNPPAYTLGVSVTLGGEEVPEPV
FT                   AVVLRVAFNKTLTVRFIGESNGEKVGLTVAYKVNGTERTATAGVDALNVTAAYITPIIY
FT                   VFTVPQNVTVGGTTYKLSNSSTATVDPVSTDTVLFVYTAPSTAPPSGGGGNQPTAPTMP
FT                   SQPSINTPSEKSRINLGELLVWVQGVLAWLMEHPEYLLLIVLALLVVLVAYYLKKRREE
FT                   LVIEIG"
FT                   /protein_id="YP_919116.1"
FT   sig_peptide     12044..12106
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT                   /locus_tag="Tpen_1858"
FT                   /product="hypothetical protein"
FT   gene            12776..13279
FT                   /db_xref="GeneID:4600337"
FT                   /locus_tag="Tpen_1859"
FT   CDS_pept        12776..13279
FT                   /locus_tag="Tpen_1859"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709777"
FT                   /db_xref="GeneID:4600337"
FT                   /translation="MRRLIELVKVLRKHKRVLKAGTAFAASVVALGVLWVTSPLHFLFA
FT                   LYVVTGLLFLAVLHGLDKTFAFLPFALMVFLITGLTGLSALLLTGSYGLHRYDLQLQIV
FT                   AGSIAAVTAYLSVYWLVPRGKFEVIEGYGEQFLDEVRRVFERPPDERKVLEAKKALKAG
FT                   ASPL"
FT                   /protein_id="YP_919117.1"
FT   sig_peptide     12776..12874
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.350 at
FT                   residue 33"
FT                   /locus_tag="Tpen_1859"
FT                   /product="hypothetical protein"
FT   gene            13276..13575
FT                   /db_xref="GeneID:4600301"
FT                   /locus_tag="Tpen_1860"
FT   CDS_pept        13276..13575
FT                   /locus_tag="Tpen_1860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709778"
FT                   /db_xref="GeneID:4600301"
FT                   /translation="MSEKKCEVMSFGEWVQLYGGGVREYFEYLVLEMVRQRGEVSLTAI
FT                   MDELRRQADGDKRVRAWYTPQRVVTLLAIMAKQGKIRLKLVGSKRVVEDGRRGA"
FT                   /protein_id="YP_919118.1"
FT   gene            13556..13774
FT                   /db_xref="GeneID:4600338"
FT                   /locus_tag="Tpen_1861"
FT   CDS_pept        13556..13774
FT                   /locus_tag="Tpen_1861"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709779"
FT                   /db_xref="GeneID:4600338"
FT                   /translation="MGEEVPRCFCGEVAVIRVGDVLLCKNHWRKVLGALAKIGDSRGEA
FT                   TLEDVKVEGGELVLRVSGRIIKVREKR"
FT                   /protein_id="YP_919119.1"
FT   gene            13806..14255
FT                   /db_xref="GeneID:4600334"
FT                   /locus_tag="Tpen_1862"
FT   CDS_pept        13806..14255
FT                   /locus_tag="Tpen_1862"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709780"
FT                   /db_xref="GeneID:4600334"
FT                   /translation="MARKPRSQIVCPRCGAPGSIERFYSNGRAYLRVRHSLGGGKRSYC
FT                   YIGPADSYVHVELLHALTLTNLVNTDPAQVAERALEELISSARFVHGKKDLEGWVARAK
FT                   LAVDAVEIALEKLKRVLEEKEAELEALRREEERELLRQNGLLVYK"
FT                   /protein_id="YP_919120.1"
FT   gene            14305..14574
FT                   /db_xref="GeneID:4600328"
FT                   /locus_tag="Tpen_1863"
FT   CDS_pept        14305..14574
FT                   /locus_tag="Tpen_1863"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709781"
FT                   /db_xref="GeneID:4600328"
FT                   /translation="MSIRENVVIKVRRLKDFVEHTSRADRVFYYSRGTYYVAIAGSMIW
FT                   AGDIGVEPEDVRKEFLKVLNVKGVEVEDILKPYEVPDYLKSLME"
FT                   /protein_id="YP_919121.1"
FT   gene            14580..14876
FT                   /db_xref="GeneID:4600340"
FT                   /locus_tag="Tpen_1864"
FT   CDS_pept        14580..14876
FT                   /locus_tag="Tpen_1864"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709782"
FT                   /db_xref="GeneID:4600340"
FT                   /translation="MRAKDFLVEEVREWLAEYLARHQGGIATVLARYAARDLRRYHPVA
FT                   VSLAITQVKMVTDKLGRVWVLDDKLTRYAKVRKYVYRRENGGVGEVVREYYAN"
FT                   /protein_id="YP_919122.1"
FT   gene            14866..15402
FT                   /db_xref="GeneID:4600300"
FT                   /locus_tag="Tpen_1865"
FT   CDS_pept        14866..15402
FT                   /locus_tag="Tpen_1865"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709783"
FT                   /db_xref="GeneID:4600300"
FT                   /translation="MRIDRRLGFRLSRALRPSVVRLHGEAGGQAQPFIPLRIRRLRLLP
FT                   PLLPSPAPSGARGGEGVVQREVKLCLALAGLSRVADMATTLPILQKYGLQGELNPVARA
FT                   FFGMGVTGIAFALVAGTVLSVFLAWVNWRRGGKKYLYLFTAFLWIPFFNNIVAYFNARN
FT                   YTLVDFLFLALRPLP"
FT                   /protein_id="YP_919123.1"
FT   gene            15432..17306
FT                   /db_xref="GeneID:4600331"
FT                   /locus_tag="Tpen_1866"
FT   CDS_pept        15432..17306
FT                   /locus_tag="Tpen_1866"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709784"
FT                   /db_xref="GeneID:4600331"
FT                   /translation="MGMKRYIPLLLLLVTVALGIATVKAAPVTTYTVFVNYTMYTGTAP
FT                   AAGSTYWFNFTITPSLDVVIVTVEDLGGASQRTVYVDNVAVTLPYKLKAGETHRVAVKV
FT                   YFPSALTVAWFGKTILAYNRTEDVNLQVKYVGYGFDSVSYGSYVGSVDNVATLTVKLDT
FT                   PYTMGVTHTFSSVSTVVWLRFHPAMPIKGYTGTAYYTTTFNAYTIGSQPAGTDSYTISN
FT                   NPVTVTVDCPPPVGLYELVWYVSWGGLTEKMLGAPGTPTPNKNYARLVGATFTWKFTPN
FT                   ATYFPTTKVDEYLLVNGSKASSLALSKKGLYNATFVNIGKMNTTFYGVLAYLPPVVRAG
FT                   TMYVYAAELKVNVLSQVGTVGAPSPGFTLSLAGANAPGYFALQVKVPEGVVTVEKAEGV
FT                   AWNRTVLPGIAKDVKTSLDADKLVYTVNYTYTLYYAPIVGGVNFLGAWGIEETPSLTPT
FT                   SPTIATLTASKPVVLNATRNVIRVLDSAGNDVSFVGKAIAIKSSGTYTVKLETVIKVVN
FT                   LYQGKKIPATVRLYDAKGLRLAEKTGEEVTFTVEPGLLYTVESDNGNEVLTQRVTPTQD
FT                   VDVTMEFTKPPAVVIPWEWVWLALAIVFLVVLIYFAKRLKEGLEIVVG"
FT                   /protein_id="YP_919124.1"
FT   sig_peptide     15432..15509
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT                   /locus_tag="Tpen_1866"
FT                   /product="hypothetical protein"
FT   gene            17355..17555
FT                   /db_xref="GeneID:4600308"
FT                   /locus_tag="Tpen_1867"
FT   CDS_pept        17355..17555
FT                   /locus_tag="Tpen_1867"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709785"
FT                   /db_xref="GeneID:4600308"
FT                   /translation="MSWDCGRCEDDTHVRSMEGRVGGGDGAVCYLCGLPAYAYVDGKPV
FT                   CVYHYAQLISKKKVAAEVRAR"
FT                   /protein_id="YP_919125.1"
FT   gene            17555..17845
FT                   /db_xref="GeneID:4600327"
FT                   /locus_tag="Tpen_1868"
FT   CDS_pept        17555..17845
FT                   /locus_tag="Tpen_1868"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pab:PAB7281 hypothetical protein"
FT                   /db_xref="GI:119709786"
FT                   /db_xref="GeneID:4600327"
FT                   /translation="MELAGVGAVSVVLGYAVRKGVNFILGLLGVFVAFLLVLQALGYAV
FT                   VDWAKLVNDAYGLLESLLSQQDLASKLEQVLPGGLVGIAGFMVGWKLGGKL"
FT                   /protein_id="YP_919126.1"
FT   gene            17859..18299
FT                   /db_xref="GeneID:4600350"
FT                   /locus_tag="Tpen_1869"
FT   CDS_pept        17859..18299
FT                   /locus_tag="Tpen_1869"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709787"
FT                   /db_xref="GeneID:4600350"
FT                   /translation="MEAEDFLAVAFVLALATALALGLFTEGVKAVSPAWAGGSSGGGGG
FT                   GSQVSLGVVELEVEGYAPRSAIPPGVLLSAKPLNVVNATCRCPEDPETFKGGVKCICWV
FT                   TVKEGCYPLYPTLCARTNVVCTGKKYRVWWVSGGWVIPTTGG"
FT                   /protein_id="YP_919127.1"
FT   sig_peptide     17859..17951
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.711) with cleavage site probability 0.386 at
FT                   residue 31"
FT                   /locus_tag="Tpen_1869"
FT                   /product="hypothetical protein"
FT   gene            18301..18462
FT                   /db_xref="GeneID:4600339"
FT                   /locus_tag="Tpen_1870"
FT   CDS_pept        18301..18462
FT                   /locus_tag="Tpen_1870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709788"
FT                   /db_xref="GeneID:4600339"
FT                   /translation="MEGFRRELKERALRALREGVKGVDLERALREFEETRSEVWRELEK
FT                   KYRERGLI"
FT                   /protein_id="YP_919128.1"
FT   gene            complement(18459..18707)
FT                   /db_xref="GeneID:4600336"
FT                   /locus_tag="Tpen_1871"
FT   CDS_pept        complement(18459..18707)
FT                   /locus_tag="Tpen_1871"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709789"
FT                   /db_xref="GeneID:4600336"
FT                   /translation="MSERRKEVVDRYLADSSYFSDYWREEVAEFWDYPLLSTLALSEDW
FT                   VHLERELEKIGRAASERAAKRLVKEIREDFELEVELG"
FT                   /protein_id="YP_919129.1"
FT   gene            complement(18892..19323)
FT                   /db_xref="GeneID:4600343"
FT                   /locus_tag="Tpen_1872"
FT   CDS_pept        complement(18892..19323)
FT                   /locus_tag="Tpen_1872"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709790"
FT                   /db_xref="GeneID:4600343"
FT                   /translation="MSRARIESLYRAVYERLRPFECTDNPAECLARSLLALGIPARAVE
FT                   DIREAERIGGYVVVEWGGKKTKRARLSAHEWESLARLIALCRREYADLVRLLNVYKSRY
FT                   PYTWKDVRVLRELAVEGRMSRDARALEAIAKVEHALAAI"
FT                   /protein_id="YP_919130.1"
FT   gene            complement(19362..19532)
FT                   /db_xref="GeneID:4600347"
FT                   /locus_tag="Tpen_1873"
FT   CDS_pept        complement(19362..19532)
FT                   /locus_tag="Tpen_1873"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709791"
FT                   /db_xref="GeneID:4600347"
FT                   /translation="MLELAVIKELQELRKELKDTVKEAIKEALREAIEELLQDPEVKQL
FT                   VRDFLADVREY"
FT                   /protein_id="YP_919131.1"
FT   gene            complement(19986..20183)
FT                   /db_xref="GeneID:4600345"
FT                   /locus_tag="Tpen_1874"
FT   CDS_pept        complement(19986..20183)
FT                   /locus_tag="Tpen_1874"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709792"
FT                   /db_xref="GeneID:4600345"
FT                   /translation="MRGDVQIRIIADKERISEEEYRLIVSAVEELLIRMGLQVRRSRPY
FT                   TARKMRRGVRVYIEARKPRK"
FT                   /protein_id="YP_919132.1"
FT   gene            complement(20180..22081)
FT                   /db_xref="GeneID:4600333"
FT                   /locus_tag="Tpen_1875"
FT   CDS_pept        complement(20180..22081)
FT                   /locus_tag="Tpen_1875"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DEAD/DEAH box helicase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: sai:Saci_1326
FT                   XPB/RAD25-related helicase"
FT                   /db_xref="GI:119709793"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:4600333"
FT                   /translation="MREKKAWGAIGKEVSPDSNPLSAYNSEVERLRLAIRRNRDLAPSL
FT                   EFEIARAIASRLALIRAKGLDTQEIVNDICDAVDSSLSLGENLAIVEKILAKWLGGAYY
FT                   SDNNSPEEVEAQYNSWLESRLAVLADKVELGEASPEEIEEAKQILAQNPRLKDKYAELA
FT                   QKLGVEQYVDWRQILAPQAISELELTEEEASTQIILGVDTSIWGYELLADLAGDEERLK
FT                   ELLREQGLTERDYTARVLSERIRKIRVAKIVVPKKMRDYQRIALRWLLSAHGAVQIPTG
FT                   GGKTLIGSTLAVNLALWGYDTAIIVPTQVLAEQWASHFEREWRLRVNVKYGGVNRRGQG
FT                   LGELITVMVYNTFVSEVKRGYTPFAVIVDESHHAGARELARTLARLARLGVHIYGFSAT
FT                   HKREDTEEQWVLDMLLPKRYEVSPSELQEQGYMVPIELVGIRVTETQEFYQQYEEIQEK
FT                   IRRLSRRIEDGEKHLKKDLMKLVNLRKQLAARSPVKWSSALALINRLAQEHNRVLVWTE
FT                   SQDVALKLAQTLGGKAILSKTPKTERARILKEWGSTFRVLVTCRVLDEGVDVPEVSVGV
FT                   MLASGTTDRQLIQRAGRLLRPAPGKTKATLFYVYVAYTHEETAFHKLKAIFARRGLQ"
FT                   /protein_id="YP_919133.1"
FT   misc_feature    complement(20783..21319)
FT                   /note="DEAD-like helicases superfamily; Region: DEXDc;
FT                   smart00487"
FT                   /db_xref="CDD:128763"
FT                   /locus_tag="Tpen_1875"
FT   misc_feature    complement(20885..21265)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Tpen_1875"
FT   misc_feature    complement(21227..21241)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Tpen_1875"
FT   misc_feature    complement(20966..20977)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Tpen_1875"
FT   misc_feature    complement(20294..20638)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Tpen_1875"
FT   misc_feature    complement(order(20396..20404,20474..20479,20522..20533))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Tpen_1875"
FT   misc_feature    complement(order(20294..20296,20303..20305,20315..20317,
FT                   20378..20380))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Tpen_1875"
FT   gene            complement(23125..23532)
FT                   /db_xref="GeneID:4600332"
FT                   /locus_tag="Tpen_1876"
FT   CDS_pept        complement(23125..23532)
FT                   /locus_tag="Tpen_1876"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709794"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="GeneID:4600332"
FT                   /translation="MVYEKFADKIKDASRAVLKHTFLDMLVHTIREVNDVNVPVLIDEI
FT                   EELQKKAEEEGLQAWVDFLGALKALVCAYGFKNTILVRASYMEQYYRMIRALETDGFES
FT                   EYCEFLTWLGTSFEHTFPPIEKIARERGILR"
FT                   /protein_id="YP_919134.1"
FT   gene            complement(23724..24191)
FT                   /db_xref="GeneID:4600314"
FT                   /locus_tag="Tpen_1877"
FT   CDS_pept        complement(23724..24191)
FT                   /locus_tag="Tpen_1877"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709795"
FT                   /db_xref="GeneID:4600314"
FT                   /translation="MSVTTTVEKTREQIKRVRELYRGAQLKKVDSPVRYVRVYLAAPEH
FT                   IYDYVLTFGHDYAEDKTFAIVHLREIWEGEFFEDIIEEHDELKVWEGAEGDGVILWFLG
FT                   YVGEVIELWSDLDIHVMVEFHEDFEDIVNYYLGAEEDWEEEEEDWEGFCEE"
FT                   /protein_id="YP_919135.1"
FT   gene            complement(24413..24997)
FT                   /db_xref="GeneID:4600324"
FT                   /locus_tag="Tpen_1878"
FT   CDS_pept        complement(24413..24997)
FT                   /locus_tag="Tpen_1878"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709796"
FT                   /db_xref="GeneID:4600324"
FT                   /translation="MSLLDCWVNCDDRQGLCTEHAVESYRATRLAVWRGIYPCGDGGYC
FT                   AGRIGEHRFRVPGTFDVWRRDGITDSTVVRRAVYVGLFRRGGKRWVKVQASRCAPVWLQ
FT                   RAVEEIVTEVWVYRRLSLAQALELIEGFDWGTLRPYWEKPGDEDELPCECDSSRVCYDS
FT                   ASEEEEEDFDDYGEEYEPIDWDEEDWEDEEY"
FT                   /protein_id="YP_919136.1"
FT   gene            complement(25066..25800)
FT                   /db_xref="GeneID:4600307"
FT                   /locus_tag="Tpen_1879"
FT   CDS_pept        complement(25066..25800)
FT                   /locus_tag="Tpen_1879"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709797"
FT                   /db_xref="GeneID:4600307"
FT                   /translation="MCYPHVVVNPYVYYDWEQWLKKCRPEGVLVDTGVHKVFKESGGFE
FT                   YPSGFEYGYARFISRVHAQARVEEFYYVIPDYPSDYPGMEQFYPLNVEKTLESIKRWLT
FT                   RVDSLPGTAVAVVQGKKDDPLSPVRVYSENRELYDEFELVALGPTCASNRWGVLAKMIL
FT                   AFDSVTAKPFHVFGPSLRAVARVAGRTRRFFSFDSSAMYRWCENSWCSDIEERAEAIRA
FT                   YISRYEEIARRWGSQPSILSFF"
FT                   /protein_id="YP_919137.1"
FT   gene            complement(25827..26111)
FT                   /db_xref="GeneID:4600311"
FT                   /locus_tag="Tpen_1880"
FT   CDS_pept        complement(25827..26111)
FT                   /locus_tag="Tpen_1880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709798"
FT                   /db_xref="GeneID:4600311"
FT                   /translation="MKTTVRVKRSTEYNWSEPSFPMVFCDVTFKNGEEEVWRTVDYIIA
FT                   RWNRLLYVYEESETHYTEEDVAESVRVKIKKVGFFSPSPPFSPWFRGST"
FT                   /protein_id="YP_919138.1"
FT   gene            26218..26727
FT                   /db_xref="GeneID:4600346"
FT                   /locus_tag="Tpen_1881"
FT   CDS_pept        26218..26727
FT                   /locus_tag="Tpen_1881"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709799"
FT                   /db_xref="GeneID:4600346"
FT                   /translation="MPILVQFERFNSDVKRWIVSYLSPHGWEKLATHKVFVVDPESEEK
FT                   EEEVEAPIGTTILVSARKVEFYGNARGDDIDKAGYVKVYVDRCGSFPVMAIKDPERRNK
FT                   DVVLDTPLGSYTCTEVVVNEEEDYVNVADAEYIAVALMARFVALVPSEPFKYKALISTK
FT                   AKPKPE"
FT                   /protein_id="YP_919139.1"
FT   gene            complement(26746..26943)
FT                   /db_xref="GeneID:4600302"
FT                   /locus_tag="Tpen_1882"
FT   CDS_pept        complement(26746..26943)
FT                   /locus_tag="Tpen_1882"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709800"
FT                   /db_xref="GeneID:4600302"
FT                   /translation="MRVRVERNGGRYTVYLLDSSGQIKDKFEVDEVFLDGKPAPHLVTT
FT                   DVKSWMVYDLGGKTAMILRS"
FT                   /protein_id="YP_919140.1"
FT   gene            complement(26940..27542)
FT                   /db_xref="GeneID:4600303"
FT                   /locus_tag="Tpen_1883"
FT   CDS_pept        complement(26940..27542)
FT                   /locus_tag="Tpen_1883"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709801"
FT                   /db_xref="GeneID:4600303"
FT                   /translation="MSFLHHFIGYRGARGLFRLTVKPQNFVDFLRGGFIARASSFKHMS
FT                   GEKPEEKRPGRGTVEELVWVLGHLINLEEHKWEMGEVEEATAIKEVRRDFVAQLAKELK
FT                   WACKWKPQWCVLKHLSSLIVHVEEAGTSGDLSPETVEKLQALYKTAWVAIETLLEEWGS
FT                   LGFAAEETDRLRETVTQALKEKGIDAAKLIREDRDSR"
FT                   /protein_id="YP_919141.1"
FT   gene            complement(27627..27809)
FT                   /db_xref="GeneID:4600306"
FT                   /locus_tag="Tpen_1884"
FT   CDS_pept        complement(27627..27809)
FT                   /locus_tag="Tpen_1884"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709802"
FT                   /db_xref="GeneID:4600306"
FT                   /translation="MVKVKLDRNTLALASCEALESLANGFRLMGQVQAATYIENIARAK
FT                   GCPVGGAGYTPQLIL"
FT                   /protein_id="YP_919142.1"
FT   gene            complement(27844..28041)
FT                   /db_xref="GeneID:4600319"
FT                   /locus_tag="Tpen_1885"
FT   CDS_pept        complement(27844..28041)
FT                   /locus_tag="Tpen_1885"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709803"
FT                   /db_xref="GeneID:4600319"
FT                   /translation="MPVPEYIIRKTEAKYPVKYCEFAARIFPGLNVDRCRAGMAQIVGQ
FT                   KWAPNWESGLKAFFVSIGAL"
FT                   /protein_id="YP_919143.1"
FT   gene            complement(28094..28309)
FT                   /db_xref="GeneID:4600322"
FT                   /locus_tag="Tpen_1886"
FT   CDS_pept        complement(28094..28309)
FT                   /locus_tag="Tpen_1886"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709804"
FT                   /db_xref="GeneID:4600322"
FT                   /translation="MPSTLQLQGLSLVETIPVTTTDYADYNFSKLNPNECVVFWFQKNR
FT                   VAVLVCNIGNGYYRVATKPVPPTVKP"
FT                   /protein_id="YP_919144.1"
FT   gene            28378..28872
FT                   /db_xref="GeneID:4600321"
FT                   /locus_tag="Tpen_1887"
FT   CDS_pept        28378..28872
FT                   /locus_tag="Tpen_1887"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709805"
FT                   /db_xref="GeneID:4600321"
FT                   /translation="MISPIILLLLIWLGTSIGIVFVTLNEYIKENGKLDVAAALFALRE
FT                   LSAIALQFIWLIVLLHVWGFLDIRTELGWTAQIPDLSTPQGQAAYVFIFASLVIIAILY
FT                   AEGYVNLAFTVAVFSGVAMLGYIDANVYLQLLGIGVAMLAVFAYVFRSELEEELRRWKL
FT                   R"
FT                   /protein_id="YP_919145.1"
FT   gene            complement(28869..29591)
FT                   /db_xref="GeneID:4600316"
FT                   /locus_tag="Tpen_1888"
FT   CDS_pept        complement(28869..29591)
FT                   /locus_tag="Tpen_1888"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709806"
FT                   /db_xref="GeneID:4600316"
FT                   /translation="MSADRRPVTRVKWETDADVAAGRDVVAWLNDLSPKVLPMGEYVVL
FT                   IHDVSDLHSLAILSRLNRRCTFILEFPVDVDPAFAFTVFELLRFNPRIRFRDPSFSYLR
FT                   GELARLRPGEDTVVTGHLVWRGDFRAILARRNSFYVAPQLGYVASGYFTPDNDPYLYYV
FT                   SRVQGLKPEVVEVPLQPVEVKPPPPPVPVKPRLPREKPQNFVANPEGGGEEGEPEFEEV
FT                   DLEELGEEEEGGEKEEGF"
FT                   /protein_id="YP_919146.1"
FT   gene            complement(29696..30157)
FT                   /db_xref="GeneID:4600309"
FT                   /locus_tag="Tpen_1889"
FT   CDS_pept        complement(29696..30157)
FT                   /locus_tag="Tpen_1889"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709807"
FT                   /db_xref="GeneID:4600309"
FT                   /translation="MPKPPSGKVYVVVGSECPHCKYALENSYSFRALWRSHAERLSIDV
FT                   EDELQLVTAFYLYLSERERLERIAEGGLRTVAGVKTPTVIVSMPEHIRVLPGLPPDMDE
FT                   TKIHVALSSLLYGTDVRLPLRPRKPEKERGEEEEEAKPKKKGRGGGRRR"
FT                   /protein_id="YP_919147.1"
FT   gene            complement(30135..30653)
FT                   /db_xref="GeneID:4600349"
FT                   /locus_tag="Tpen_1890"
FT   CDS_pept        complement(30135..30653)
FT                   /locus_tag="Tpen_1890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119709808"
FT                   /db_xref="GeneID:4600349"
FT                   /translation="MELEELLDRMQELLHFVEQDVSRNNPPTPQLAVLSLSAVINKLLG
FT                   TPPTGEVVYRGRHAVLTFAKTTQLSDEAKRAVIEILEIFERVSSECLGNVAGSDPFTRE
FT                   WVKTTLLRGKASATVIQVNISGNTVVMPPENLLAELQIVVTSARQAYSFTRSVTKVIEV
FT                   VGGAEAPFG"
FT                   /protein_id="YP_919148.1"
FT   gene            complement(30662..31498)
FT                   /db_xref="GeneID:4600305"
FT                   /locus_tag="Tpen_1891"
FT   CDS_pept        complement(30662..31498)
FT                   /locus_tag="Tpen_1891"
FT                   /gene_family="HOG000045296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   tko:TK0777 integrase/recombinase"
FT                   /db_xref="GI:119709809"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="GeneID:4600305"
FT                   /translation="MQEAVAKPEDIRALVENYLGVVKALRSHNTYKTYASVLFAYAKFV
FT                   EDTGKPDPAAFISWLEKNGWEKRTSIRTAYVVLRGFHKFAGLPWTLPPVKKPESVPKAL
FT                   GTEDVRKLLSVASPAEREVIVFLLKTGLRVSEFVHSRCEDVLVVGDGRYMLRVRGKGDK
FT                   VRLVPLTKDVVEIIKARCTGRAGYIFPSPLDPDKPVSARSIQHLVSRVARRAGLQRVTP
FT                   HTLRHTYATLLLNNGVDIRTIQTLLGHAQLTTTQVYTKVDVARMVDAIDSALTIKL"
FT                   /protein_id="YP_919149.1"
FT   misc_feature    complement(30680..31477)
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:166866"
FT                   /locus_tag="Tpen_1891"
FT   misc_feature    complement(30695..31450)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Tpen_1891"
FT   misc_feature    complement(order(30725..30727,30830..30838,31019..31021,
FT                   31097..31102))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Tpen_1891"
FT   misc_feature    complement(order(30725..30727,30752..30754,30821..30823,
FT                   30830..30832,31019..31021,31100..31102))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Tpen_1891"
FT   misc_feature    complement(order(30725..30727,30752..30754,30821..30823,
FT                   30830..30832,31100..31102))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Tpen_1891"
SQ   Sequence 31504 BP; 6718 A; 9393 C; 8420 G; 6973 T; 0 other;
     CCACCGAGAA AGATAAACGA AAAAGGGAGA TAAAAAGCCA GCGCTTTTAC GGTATTACGT        60
     AGAGAATCTT CCTAGCCCAG TCCACCGCGG TGTTGACTAC CCCCTCGGGG AGCCCTAGAA       120
     TCTGGCAGTA CAGGCGGAAG GCGGGCACCA CGAAGTCCTC TATCCCCGAG TAGCCCAAGT       180
     GAACCGCGAA TATCGCCCCG GCTATCACCG CGACTCCCCT CAGCAAGACC ATGAGCCTCT       240
     CGACCGGTCT AGACGCCGCT ATTATGCCTA GGATGACGAC CACGGCGGCC AAGACCAGCC       300
     AGAGCAGGGG CTGTATGAAG GCGAACTTGT AGCTAACTGC TACCACCGTG GCTAGCAACA       360
     GCGTGGGCAA ATCGGTGAGC CTCAGCATAG CCCTGCTACT CCTGCCCAGC AGTACGAGCG       420
     TCAGCGCCCC CGCGAGCACG CTAGCCACGG GGAGGAATAC TAGGAGCGCG AAGACCAAGG       480
     CTCCCTGTAT GCCGCCCAAG AACAAGCCCG TCAAAGCGGA GACGGCTAGC AGTCCGAGCC       540
     ACAGCAGAAC CACGCTAGAC AAGAGCGCCA CGATTACTAT AGCCACGTAC TCCGCCACAG       600
     CCCCCACCAA GTAGCCTACG AGCATCTGCC TGAACATCGC GTTTAGGACG GCGGAGACGA       660
     AGCTGAACAG GGGTACAACG ACGCTCCTAG ACTCTCCCCC CACCCTTATC AGGCGAACCG       720
     CCCCCGTGAT TGCCCCGCCC AAGTACACCA AGAGGAATAC GAAGACGGCT AGCAAGGCGG       780
     GTATCAGCGT GTAGCTAGCC AAGTCCAGCA GGAAGTTGAA CAGCGCGACG ACCACGTCCT       840
     TCTCCTCCAT CAACCCCCAA AGCCCGCCCG CCCCCGACGC GGCGAAGCCC CTAGCCCACG       900
     TAATCAGGTA GGCTAGGAGC CCCGTCAAGC CCAGAGCCGC CACCATGTTC AGCGTTGCCT       960
     CCGTCATCCG CGAGAAGTAG TCGTACGTGC TCAGCACGCC CGGGTACAAC GCCCGGTAGA      1020
     GCGCGAGCTT CCAGCCCTTC GTGGCACCGC TAACAGCCTC CTTAGCCTTG CCGACCGCGG      1080
     CGACCGCGGC GGGAGCCTTC TCCTTGAGCG CGGGGTACAG CCTCGGCGCG TACTCTTTCA      1140
     GCATCCTGTC CACAGCCTCC GTGACGGCGG CGGCTCCGTA CCTCTTGCTG AGCTCAGCCG      1200
     TTAGCCTCTG AACCGCGAGC TTGTCCTCTT GGGGTAGCTC CACCTCGTAT ACCTTTTCGC      1260
     CGGCTACGAC TACGTACTCC TTACCCTCCT TCGTGATTAT CGAGACGTCG CCCTCCGGAG      1320
     TCTTCGCCAC CGCGGCTATG TCCTCCTTTT TAAGCGGGGG CAGTGTCTCC AAGGGCTTAC      1380
     CGTGAACCAT GACCCAAGCG CGCGTCTTCA TCATGCCGCG GACGGCGTCC CTAATCTTGT      1440
     CCATGACCTC GGCGACCTGT CTCTCGTGCT CCTCCTTAGC CTTTGCAACC TCCTCCTCGC      1500
     CCGGGTACTC CTCTATCTCC ACCTCCACCT CGGGCGCCTC CTCGATTTCC GCCTCGGGTA      1560
     TCTCCTCGAT TTCGACCTCG ACGGGCTCCG GCACCTCCTC CGCGGGCAGA ACGCCCATCC      1620
     GCCTAAGCTC CTCCTCGGAG TAGCCCAGCT GTTTGAGGTA CTCGGAAGCC TCGTACTCCT      1680
     TGACCTCTAC AGGCTTCTTC CTCTCCTCAG CCACGGTTAA AGAAGCGGTC TACCGCCTAT      1740
     ATAACCTTTG ACGGGGGGAG AGAAAAAAAG ACCCTTTTTA AGGCTTGGTC AGGTTCACCG      1800
     GGCTTACCGG GGGAGCTAGG GGCTTGATTA TCGCGGGGAC TCCGGCGGAG ACCACGAGGG      1860
     CTAAGACGTT GATTAGCAGG ATGATGCCGG AGACCTGCGG GTACCTCCTG CTCAGGGCTA      1920
     CCCCGGCGAT GCTCCCCAGC ATCATGGGTA GCTCTATGCC TCCGAGAGCC ATCCTGAAAG      1980
     CGCTGGGTAT GAGTAGCACC AAGAGTAGCG TGTTGAGCAG GGCGAAGAGG AGCCTGATAG      2040
     CCTTAGCGGT TCTAACAGCC TCGTCCGGCC TCATGCCACC ACCCCCTTCA CCTTCTCGGC      2100
     TACCTTTTCG GGTATCTCGA CGGTGACGCC CGAGCCGGAG TACCATACCG CGTAGACGAA      2160
     TATCGCTAGG AGCAGTAGCT CCACGGGTAG CATGCCGTAC GCGATGCCGG CTAACGCGGT      2220
     GTTGTATATG CCGTGGGCTA CCACCATTGC CCAGATGTCT CCCCGGGCGA AGAACCACAT      2280
     CGTCAGCGTG GCGATGCCTA TCAAGGCGAT AATCACGGGG GCTTGTAGAC CGTACTGCAT      2340
     CCTGCTGGGC ACGTGCATGA AGAGGAACCA AGTGGTGGCT ATGACTGTGG CTAGCCTATG      2400
     GCTACTGTTA GCCAGTACGT TGTAGTAGGT GGCGGCTCTC CACATCTCCT CCGAGACAGC      2460
     CACGACGAAC AACATGATGA AAGCCCAGAA CTGAGCCTCC AGCCCGCCCG AGCTAGCCGC      2520
     GGGGGCTATA CCCGTGTAGA GCAGGGTGCC GTTGTAGCCT CCCAAGGGCT CAAGCCTCCC      2580
     CTGCAGGAAG AGGTTGGTGA GCAGGGAGAG GACTAGGACG ACTATGAAGG CGGCGAAGCC      2640
     GCCTATCACT CCGCGGGCCA TGTCCGGCTC GGGGGGCTTG AAGCCCCTGT TAGCCAAGAA      2700
     GAGGACGACC ATGGACGTGC CCATCAGTGC TAGGTTGCTG TACCCGTAGC TGACCAAGCT      2760
     GAACAGTATC GCGGCGTTGA GGGCTACCGG CATCACGAGC GTCCACGGGT TGTTGGGCTT      2820
     AGCCTCCCCC CGACCGGGTA TCGCCCCCGC CAGAGCCCCC ACTACCAGCG AGACTATGAG      2880
     GCCGCCCACG GCTCCGATTA CGTAGAGTAT GCCCAGTAGC AGGAAAGCCC TCAGAGCCAC      2940
     GTATGCCAGC AGTATGCCGG CTACCGCTAT GGCGGTGTAG TGGACTAGCG CTACCTTGTA      3000
     GCTCCCCGCC CTCACTCAAG CACCACCTCT ACCTCTCCGA GCCTCTTCTT GAGAGCCCTG      3060
     TACACCAAGT AGACTGCCAC CGCTACGCCC GTAACCATAG CCGCTATTAG CAGGAGCGAC      3120
     GGGGCTCCGC CCACGCCCTC CAAGACAGCC ATGTTCTCCG CTACGTCGGC GGAGTAGCCG      3180
     AAGTAGCTGA GGCTCGCGTC CACCACGAGC TTGATGATGA AGAGGGCTAG GATGTTCTTT      3240
     ATCAGCGTGT TGAGGGTAGC CCTAGGCACC GTTATGGGGA GGAAGGCGGT TACGAAGTTG      3300
     GCTACCAAGC CCAGCGCCAC GTATATACCC GTTATCACTA TGACGGCGTA GATTACGTAC      3360
     TTGAAGACGG TGTAGAGCAG GCTTATAATC GCCTTGCCAA CCGTCTCGGG GCTAGGCTGG      3420
     GTAGCGGCGA GCGGGGGCAC CAAGGGTATG CCTGCCACCT CTGCCGTGAC GACTACGCTC      3480
     CTAAACGCGG CTATGACCCA GAGCGTTATC AGCACCGTGG TGAGCACGGC GTTCACGAGG      3540
     CCCACGGTTT TAATCGCCCT GTCCAAGTCC ACCCCCACCA CCCCTCATAT CAGCCTGTGC      3600
     CTGAGCTTCG TGGCGTAAAT GAAGTACATG CCGAGGACGA AGACTCCCTC CAGCAGTAGG      3660
     TTGGGCAGTC CTAGCGTGTA GCCGAAGGGG TTCCAGCCTA CAATTATCGC TCCCACCATG      3720
     AAGAGTACGA ATACTGCCAC GGCGAAGGCG TCGCTCTTAA GCACCCTTGA AACCGCTTTG      3780
     GCTATACCTT TCTTTCTAGG CATACCTATC GGGAGAAAAA GAGGCTACAC ACCTATTTTA      3840
     AGGTTCTACT CGTAGAGCCA GCTCCTCAGC GACCTGAGCC TCCTCTCCGT CTCCGCGTAC      3900
     TCCCTCCAGA GCCTCTCGGG AGCCGCCTCC GTCTCCTCGT ACAGCCTTAT ATCGTTGTAA      3960
     AGCTCCTCCG GGCTCTCGGC GCTCGCCTCG CTCCCAATCT CGCTTAGAAG CTCCGGTAGC      4020
     CCGCGCTTAA CGGGCTCGAC GGCGCTTATC TTGCCCCTGA TTGCGTGGAC GTCCGGAGAG      4080
     AACACTCTTA CAGCGCCTTC GGGCGTGTAG AGGACTACCT CGTCCTTCTT CACGATAGCC      4140
     CTGCCCGCGG GGCACACCAG TATATACGCG TTTCCCTGAC GCTCCACCTT ACAGCCAGCG      4200
     TACTCGAAAG GCACGATTCT AGGCATACCC GCTCATCAAC GATGAGCGAC GTTGGGCTAT      4260
     AAAAGCGTTG ACGGGGAGAA AAAGGCTACA AAATTTTGTG GTTATTCAGA CCCCTACCTC      4320
     CGCCTCCCAC TGCGCGTACG CCTCCTCAAC CAAGCTGTAA AGCTCCTCCG GAGTGTGCAC      4380
     CTTCTTCTTG AACTTGCCGT CCGTGATGTC GTCGAGGTAG TGCCAGAGAG GAACCCACGA      4440
     GAGAACTCGG GCACCCGGCC CGTACCACCC CTCGGTCTCG CTCCTAAACA CGTAGCCGAA      4500
     CTCCTCTTCG CCTTTAGGTC GAATCACCGT TACGTGCTCG TGTACCTCGA CGAACCCTCC      4560
     GGGGCACTTC AAGAAGTACA CGGCTTCACC CTTCCCGCCG ACACTCTTGG ACGGCGGATA      4620
     CACTTGATGC ACTACGATGC ATCCCCCCAG CATCGGTACA GACGCCTTAC GGTTCATTAT      4680
     ACCTCACCCC GCGGAAGAGT GAATGCCAGC TCGCCCGACT CGACGTAAGC CTTGCTAGAC      4740
     CTCCACTTGT TGTAGGCTCT GCGGGCCATG CCGTAAAGCT CCTCCGGAGA CTCGACCGAC      4800
     TCGACCCTTG TAACCACCGG TTCAACCTCG TCAACGTCGA ACCCCATCGA CTCCAACGCT      4860
     TCTCTAGGCT CATCGTACAA GCCAATCGAC GACAAAACGT CCGACAAAGA CGTATCGGCG      4920
     TTGAACAGCC TGTCCCCCGC AACCTTCAAC AGCCAACCGT CCTCGCTCCT AAAGAACGCT      4980
     TGCTCCGTAA CCGTATTGTC GCGACGCACG GTAACCGATA CGTGCTCGGG CTCGACGTAC      5040
     GCCTCTCCAC GCGGACACTT CAACAGAAAG CCCTCCCCGT AACGCTCAAC CCTACAGCCC      5100
     CCCAGCATCG GCTTTTTGAG TTCGAAGTGA GGATACCTCT TGCTCATCGA GAAACACGAG      5160
     ACCGGAGGAG TATAAAAGCG TTGACGGGGA AAAGCCACAA AATTTTGTGG CTATTCGTAG      5220
     ACCTCGCCGT ACCTCTCCCT CAACCTACGC TTGACCTCCT CGATGTCCTC CTCCCAAGCG      5280
     GTGTACACGG ACTCAGCCAT GCCGTAAAGC TCCTCCGGAG ACTCGGCTTC CTCCTGAAAG      5340
     CCTATCGACG CTAAAGCCTC GCTGAAAGGT CTGGCGGGGT ACCTCAAGTC CCTGCCCTCC      5400
     ACGCTCACAT CGCCCTTGTA GAAAGCCATC CTGTTGTCCT CGAAAAGGAA CACCGCACCC      5460
     TCCTCGCTCA CCACCGCGTT ACCGCGCCTG CAGACAACCC TGTAGCCCCC CGGTACACGC      5520
     TCAACCCTAC AGCCCCCGAG CGTGGGCTTC CTCAACAGGT ACTGCCTCAA CCGCCTATAC      5580
     TCCTCCATCG AGACCGTAGA ACCGTACACG CGCTATAAAA GCGTTGAGGA GAAAAAACAC      5640
     AAAATTTTGT GGCTATCGTT TTCTCTTCTT CTCTTTTTCG CGCAGGTAGA AAGCCACCGC      5700
     GCAGGGGAGG CGGGTCACGT CGGGTGAGAG AGATGCGTGT GAGGGGCGCG CCGCGGAAAG      5760
     CCTACCCGCC TCCCCAGTTA AACGGGTCGT CCTGCGTTAA AAGCTTTTCT CCGAGGTACT      5820
     TGGCTACAAG CTCCTCCACG ATTCTCCTGC TGTGCTCCAC GATTATCCTT GAGCCGCACT      5880
     TGTAGCAGTA GAACTTGCCC TCAATCTTCG CGCATACATC CTCGCTACCG CAGACACAGC      5940
     ACCTAGGCTT AGGCTCCCCT CTCTCCCCGA CGCGCGCGCT CTTATACCTA GCCATCCTCT      6000
     CACAGCCTCC TGAAGCTACT GGGCATGACC TCCCACGCGA ATGTTAACGC CTGCTCGACG      6060
     GTCTCGAAGC ATACGCCGTA CTTCTCCGTG ACCTGTAAGA ACAACTGCCA CTCCAAGAAA      6120
     CCCGCGACTA TCACGACGTC TCCGCCGGGG TTGTTTCTGG GCTCATCGGT GCATATACAA      6180
     TCCCTGCACC TGCACGGCAG GAAGCTAGCC GCGTTAGCCA GAAGCTGGGA GGCGTCTCCC      6240
     CGCCACTTCT CCGTCAAGTA GCGTAGCAAG CCCCTAGGTA GCTTGGAGGA ATCGACTACT      6300
     AGGAGTTTCC GGGTAGCATT TACTCGGTTG ATTTGCTCCT CCGTAAGCCT GTGCATAGCC      6360
     ACCGTTACTC GCTTCAGTTT CGGGCTTATA AACTTTAACC CTAGGGAGAA TTAAAGGAAA      6420
     GGGGAGCCGT ACTCCACACC GTCCTCGGAG CGGTGTGGAC TGCTACTCCG CGAAAAAGGC      6480
     TACAAAATTT TGTGGCTTTT CACTCCTCCT CTTCCTCGGA CTCCTCCCAC CACCACTTCC      6540
     TAACTCTGGG AGGTTGCTCC CAGTACTCCT CCTCGCTCTC CCACTCCTCC CACGGCTCCT      6600
     CCTCTTCTTC AAGCCCCGGG GGAGCCTCGA CAAGCTCTTC TTCGTCCTCG AACTCCACTT      6660
     CCAAGCCTCC GCGCCTAAGC CAATCCCTGA GCCCCATACC TGCCACCCTT CCAGCCAGCT      6720
     TTACGCGCGG CAGACCTAGA TAAGGGTTTA GGATTCGTCC GTGCAGGGTT ATATCGCTTT      6780
     CGGGGGAGGA TTAGCCACAA AATTTTGTGG ATTTACTGTC TCCGCGCCGT CGAAAAGCCC      6840
     CGGCGACCCT TCTTCTGAGA GCCGTAAAGG GCTCGCCTAA GCTCCTCCCT CTCCTTTCTA      6900
     ACCTCGGCGA TACGCTCATA CATCCTAGCA AGCTCTGCCT CGATTTTAGC CGCCCTCGAC      6960
     AGCATCTCCT TGTCCTTGTT ATCGTCCCTG AAAACCTCCT TTCTAAGCTT CATCCAGACG      7020
     TAGTAGAGCT TCCAATACCT AGAAATGACC GCGTCAACCT CCCTCAGCCT TCCCGCCAGC      7080
     TCCTTCATCC TCTTCGCCTT ATACTCCTCC ACGAAAGCTT GGAAAGCCTG ACGCCCCCAC      7140
     ATCTCCCCTC TACCCTCCAC TTTCACCCAC TTATCGTGTA GATGCGGCGG TACCTCCTTC      7200
     TCGGCGTAAT GCCTAGCCTC CTCATCCAGC CCCTGCCACT CCCCCCACAG CATCTTCACT      7260
     TCATCGACAG CCTTTGCGAG CGCAGGTCTC AGCTCCTCCC AGCTCCTAGC GAAATCATTG      7320
     AACTGTGCTA CAGCCAAGGG GGGCACGCCC GCCACCTCCG CCGTAAGGCT TCCATCGCGC      7380
     GCCTGAGCTA CAGCCTTCTC CTCGAACACG TTGCTGAGCC CGAGCCTCAC GCTGTCCGCC      7440
     TCGATTTTCT CCTTGAGCGC CTGTCTAACA TACTCGCTTA CGCTTACGCC GAGCTGAGCC      7500
     GCGATGCGCT TAGCCTGCTC GTAAAGCTCA CCTTCCAAGA CCAAAGGCAC GACCTTAGCG      7560
     TTTCTAAGCT TTTTGGGACG GGGCATAAGC GTTCAAAACA CACAGCAATG TCCACACAAA      7620
     TAAAGCCATC GTTAATTAAT TAATTAACAA ATAATCGAAA CCCCGGTAAG AAGAAAAAGT      7680
     AGCCGAGAAG ACAGCGCCTC TGCGCGCCAG TTTTCGCCAC AAAATTTTGT GGCTAATCCT      7740
     CCCGTTTTTC TTTTCACGGA CTTCCCCCTG TTTTCCGCTA AAAATCATTT TTACCTTTTA      7800
     TGAGCCGCTC CCAGCGCTCC CCGGTAAAAC TCGTTTTCAT TTTTATGGGT TGTTCTCTGT      7860
     TTTCTGAGAG TAGGGGGTAT GCTGAACCGG GGGTATACCC CCAACCCCCT ATTATAATAA      7920
     GTCTAGACTA AAATAGTATA GGGGGTTAAT TATATAACTA TCCAACCTTC CTAGTCTATT      7980
     TTAGACCTAT TCTTACCGCG AAAACGGGGG TATAGGGGGT TCTGGGCATA CCCCTTTTCT      8040
     CAACGAGAAC AAAAAAGAAA AAACTCATTT TAGGCGGGTG TGGGAGCGGG GGCTCCCGCG      8100
     GGTGCAGGTG CTCCAGCCAT CTCTTTTAGC TTTGCTAGGA GCTGTCTGGC TACAGCCTCG      8160
     CTTGTGGCGA ATTCGACCAC GGTTTCCCCC TTAACGTTAT ATTTGCTGAG AACCTGCTCG      8220
     ATGATGTCGT AGCTTCCCGG GATGTTGTCC ACGATAGTCT TGAGGATTCT CGCGGAGACG      8280
     GTTATAATCT CGGCTACAGC CTTGCTCATC TCTGCAATTT CGTCATGCTT CCTAGCCGTG      8340
     GCTAGGGCTA GGGCGCGCTT GAACACCTTC TCCCCCTCTA GGAAGCTCTT GACGTCCTCG      8400
     ACGTTCTTGA ACAGGCTTAC GAGCTGGTAC TCCGCCTTGT TCACCTCGAC GACGTCGGCC      8460
     CATAACAGGT GCAATGCTCC CTTGCCCGTG TCAACGCTCG CCGCTAGGGA TTGAGGCGCG      8520
     TGGAAGAGGT AGCTGGGAGC CATGTGCATG TAGTACCAGC TGGGGAATAG CCGGATGGCT      8580
     ATCTTGGCGG GTATGTTCCA CCACTTGGAG GCGGCTCTCT TAGCCCTCTT CACCCCGTCG      8640
     TCCATCTTGT CGAATGTAGA GAAGACGACC TTAGCCACCA TGACCAGCTC CGTCTCTAGG      8700
     AAGCCCATCT CCTCTATGCG AGCGTAGAGC GCTTTAGCCT CTACGGGGTC GAATACTAGT      8760
     AGCCACATAC GATTCTCCCT CGGCGCTCCC CCTTTTAACG CTATTTCTCT GTGGCTATGC      8820
     ACGGATACAC GGGGATACAC AAAGATGATG TGCATGAAAA TGCACGGGAA AACTTCCTAG      8880
     GGGGGAGAGG GGGGCTTTCT TCTCATAAAA AGCGTTTTTA ACGCATTTTG CGCGTTTAGA      8940
     ACGGGGGTAA AATGCCCAGA GATAAGAACT ACCTGTTCAA GGTGAAGGTT AAGCGGTACA      9000
     AGCGGGGAGG GCACGTAGTA GAGATTGTGG CGCGCGGGCA AGGCTTGAAG AGCGCCTACT      9060
     ACCTAATCGA CAAGCTCCTA AACAACGAGC TTATCCACTA CCAGCCCACG AGCGTCGTCC      9120
     GAAGGCTCAA GAAACGCCAG CGCTTGGAAG GCGGGGGTAA AAGGTTCGTA ATCGAGAGCA      9180
     AGCCGGTCAA GCCGCGCGAG AAGAAGCCCC CTGAGAACGA AAAGCCACAA AATTTTGAGG      9240
     CTAATCCGCC GCCATCCCCG CCGGCTCCCG CCGAGGACTC CGAGGAGGAG CTACCCAGCT      9300
     TCGTCAAGGG CAATCCTTGG GTCGGGATAC TGTCTCAGGG TCGGAGGTAG CGTTTGTTTT      9360
     GTTTCCTTGA GTGTTTGGAT TGTCTTTTCA GCGAAAAAAC GGTTTTTTAA CGGCTTGTCT      9420
     CGGGCTTTTC CCGTCAATCT AAACGCTGTT TGAAAATCGA TTCAACGCTA GGTTTATATG      9480
     CTTGGTCTGC GGGCGTTTAA CCGTGGCTAG GGAGAAAAAC CTCGAAATGC GAAAAGCAAT      9540
     CCTACAGTTA TGGAATCAGG GCTTCAGGAC GCCTAGGGCT GTGGCGGAAC GGTTAGGGGT      9600
     GCCTACGGGG AAAGTAAGGT GGTACATGTG GCAGATGCGC CGCGAGGGTC TTCTCCCGAA      9660
     GAAAGACACG GAGGGAGACC TTTTGGACAA GAGCCTGACG CTCTTGAAGG GCGCGCTTTT      9720
     CCACATCTCC TCTACTCGCA TCGACATCTA CGCCTCAAAC CCAAAGCTGG CTGACTCTCT      9780
     GGCCCGCGCC GAGAACTACG TGAGGGAAGC CATGGAGTTG ATTCAGGTAT ACAGAAGGAT      9840
     GAAGTGGGTG GTTAACAGGT GAAGCGGGAG GACTGGGAGG TCATAGAGGA AGATGAGGAA      9900
     ATCGTAGAAG AGGAGGAGGA GCCCGTGGAA GAGGAGGTCG TAGAGGAGGA CGAGGAAAGG      9960
     GTTAACGAGC CGGATGAAGT AGTGATTGCT AAGCCGGAGC CGAGCCTAGA GAGCTACATG     10020
     ACTCGGACGG AGCTGTTCTT GATGCACGTG TACGAAACAA AGAGGTACTT CAACATGAGC     10080
     CAAGAGGCTA AGAGGAGGGG GATGAAACAG CTCGCCTCTC GCTTCCTCAG GGAATCTAGG     10140
     CAACACTTAC GGGTAGCGTT TCACATGTGC CCCTATCGGC CTCACATGTG CCCCTTGTAC     10200
     GACGTCTGGA CGGGCAAGTG CCCAGTAGGG CTGGAGGACA GGTGCCGCCC GCTGGCATGG     10260
     TCTAAGGCGA GACCGAAGAA GATACGGGGC TGGTTCAGGA AGAAAAAGTA AGCCTGTCTC     10320
     CCTGAAACGT TAAACGTTTT TTGTTTTTAT AGAGGCAACA GACGAGAAAG AGATTTCTCC     10380
     GCTTAATTTA TTTTTATTTT ATAGAGGCAA GAGACGAATA AGAGATTTCT GCGCTTAATT     10440
     TCATTCATCT GGGGAAGGTG TAGGCGCGGA AGGCGTTGTC CACAAAATTT TGTAGCCTTT     10500
     TCTCGCGGAG CCACAGGGCT AGAAGCGCGG TTAGCCGTGC GTAGACCGTC AGCCCCATGA     10560
     GCCACGAGTA GACGGGTATC TTTACGAAGA AGTCCGCGTC CCACCACTTC TCCCAGCCCA     10620
     GCAAGCCGAG CTGGTACCGG TACCACGTGT AGGGGTCTAC GCTGTAGCCA AGCGGTATAG     10680
     CCGCCCATAG GTACGCTAGG TCGTCGAAGA GCGTGTAGGC GAGGAAGTTC CTCAAAGTAG     10740
     CGCTCCACGC GTCCTCCAAG CTGACGGCTA GGACTAGGAG CGTGAACAAC AGGTGGTAGC     10800
     CGGGGGGCTT AACCTCCATG GTCATGTACG CGTCGAACAC GGTGAGTACC GCCGCCCTCA     10860
     ATAAACCGTT AAATAGGCCT CTAAACACGT CTAAAGCGAT GCGTATGGAC AAGAAAAAGC     10920
     TGTTGGTAGT AGCGTTACTG CTAGCAGTTG TAGCCGGAGC CGTCTACCTC GCACACCTAG     10980
     ACGCCGACAA GAGGGAGGTG CCCTCCGAGA CCATCGACAC AGGCAAGTAC ATAGACGCCT     11040
     ACGTCTCCGT CTACGTCAAC GGTAGGCTCG CGGCTACCCA GAGGATGCAC AGCTTTACGA     11100
     GCGCCTTCTC CTACCTAGCG CCCATAGCGT TCACGCCTAC CTCCAGCTTC ACGCAGACTT     11160
     CCACGTTTAC CGGAGTGGTG GAGCCCGTCT CCGCGTACGG CGCGGCGCTG ACCCCGGGGA     11220
     GCTACAGCTG GATACTGCAG AAGGGCAGGT TCTACGGGTG TCCGGCGAGC GCGGCGAGCC     11280
     CGTGGCAGGT AGCCATAACG CAGACCCCGC TTCCTAGGCT GGTGGCGGTC TTCTACAACA     11340
     CGTCCGGCTC GAAGATAGGG GAGGCGGTTT TCTCCGGTAC GAGCGTAGAC CTAGCGAACA     11400
     AGGTGGTGAA CGCTACCGGC ACGGTGCTGT ACTTAACCGC GAGCTTCACC TACACCGGTG     11460
     CTACGGCCAC CAATATAAAG GAGGTGCACT TGGCTAGACC CACCGGACAG GTATACTCGC     11520
     TGGCACCCGG GGCTTCGTGC GGCGGGATGA GGATTACTAA CGACTCGTTC GCCACGGCTA     11580
     TAACCGTCAA CCCCAACGAC GTCGTTACAG TCGTCTACAC CTTCTACTTT AAGAAGCCCC     11640
     TGACCACCAA CTTCGCCTAC ATGTTCCTAG CATTCCTCTA CAACGCGAAA GACCAAGTCG     11700
     TGCCGCTCAA CGCTACGGAC GGCTCCACCT TCACCTTCAA CGTCGCCGTC GCCGTCCCCA     11760
     TAAACACCAC CATATCTGTC TTCACGTCGA GCGGCACCGT CTCCGTGAAG GAGCCAACCG     11820
     TCACCGTGGG CCCGGGGGTA TGGGCGCTGA GCCAAGCCTT CAAGTTCACC AGCAACGACT     11880
     ACGTGACTAG GATACAGCTG AGGGTTAGGT TCGAGAACGG GAAGGACGTC GTGATAGTGG     11940
     ACTACGTGCC GAGCCAGCCG ATACCCGTCA AGCCCGATAG GCCCTACATC TTCAGCGTGA     12000
     GCTTCAGCTA CCCCTTTGTA AACAAGCCTT AAGGCGAGGA GGGATGAGGA GGAGCGTAGT     12060
     AGCGCTACCG CTACTACTCC TAGCCCTGCT AACCGTCAAC GCCGTGCCGG TCAACCCTCC     12120
     AGCCTACACA CTGGGAGTCA GCGTGACGCT TGGAGGAGAG GAGGTGCCCG AGCCCGTAGC     12180
     CGTCGTGTTG AGGGTGGCTT TCAACAAGAC GCTCACGGTC AGGTTCATCG GGGAGTCCAA     12240
     CGGGGAGAAG GTCGGGCTAA CCGTAGCGTA CAAGGTTAAC GGCACGGAGA GGACTGCCAC     12300
     CGCCGGCGTG GACGCGTTGA ACGTGACCGC GGCTTACATC ACGCCTATCA TATACGTATT     12360
     CACGGTGCCC CAGAACGTCA CGGTGGGAGG GACAACCTAC AAGCTGAGCA ATAGCTCGAC     12420
     GGCTACGGTT GACCCCGTAT CTACGGACAC CGTGCTCTTC GTCTACACCG CTCCGTCCAC     12480
     GGCTCCGCCT AGCGGTGGCG GTGGAAACCA GCCCACGGCT CCGACGATGC CGTCTCAGCC     12540
     CTCCATCAAC ACTCCATCGG AGAAGAGTAG GATAAACCTA GGCGAGCTTC TGGTCTGGGT     12600
     TCAAGGGGTC TTAGCATGGC TGATGGAGCA CCCCGAGTAC CTACTGCTGA TAGTCCTAGC     12660
     CCTGCTCGTA GTGCTGGTAG CCTACTACCT GAAGAAGAGG CGGGAGGAGC TGGTCATAGA     12720
     GATAGGGTAA AGGAAAAACG ATAGGTTTTT TCTCCGGTTT TCCGCCCGTT TACACATGCG     12780
     CAGGTTAATC GAGCTTGTAA AGGTGTTGAG GAAGCATAAG AGGGTGCTGA AAGCCGGCAC     12840
     CGCCTTCGCG GCTAGCGTCG TAGCCCTAGG CGTCCTGTGG GTTACAAGCC CACTGCACTT     12900
     CCTCTTCGCG CTCTATGTGG TCACGGGGCT CCTCTTCCTA GCCGTCCTCC ACGGCTTGGA     12960
     CAAGACCTTC GCCTTCCTCC CCTTCGCGCT CATGGTCTTC CTAATCACGG GGTTGACGGG     13020
     GCTCTCGGCT CTACTGCTGA CGGGCAGTTA CGGGCTACAC CGCTACGACC TCCAGCTCCA     13080
     GATAGTCGCG GGAAGCATAG CCGCCGTTAC GGCGTACCTC TCGGTTTACT GGCTCGTGCC     13140
     CCGGGGCAAG TTCGAGGTGA TAGAGGGCTA CGGGGAGCAG TTCCTCGACG AGGTAAGAAG     13200
     GGTCTTCGAG AGGCCCCCTG ACGAGAGGAA GGTCTTGGAG GCTAAGAAGG CTCTCAAGGC     13260
     GGGGGCGAGC CCCCTGTGAG CGAGAAGAAA TGCGAGGTGA TGAGCTTCGG CGAGTGGGTT     13320
     CAGCTTTACG GAGGCGGTGT CAGGGAGTAC TTCGAGTACT TGGTGCTGGA GATGGTGAGG     13380
     CAGAGGGGGG AGGTGTCGCT CACGGCGATA ATGGACGAGC TGAGGAGGCA GGCCGACGGG     13440
     GATAAGCGGG TCAGGGCGTG GTATACCCCC CAGAGGGTCG TGACGCTCCT CGCAATCATG     13500
     GCTAAACAGG GGAAGATAAG GCTCAAGCTC GTGGGCAGTA AGCGGGTGGT CGAGGATGGG     13560
     AGAAGAGGTG CCTAGGTGCT TCTGCGGGGA GGTAGCCGTT ATACGCGTGG GTGACGTACT     13620
     GCTCTGCAAG AACCACTGGC GCAAGGTGCT CGGTGCTCTA GCCAAGATTG GCGACTCGCG     13680
     GGGGGAGGCT ACCTTGGAGG ACGTGAAGGT GGAGGGCGGG GAGCTGGTGC TGAGGGTGTC     13740
     GGGTCGTATA ATCAAGGTTA GGGAAAAGCG ATAGAGATTT TAACCCCCGT TTTCCACAAA     13800
     AATTTGTGGC TAGAAAACCC CGCTCCCAGA TAGTCTGCCC CCGTTGCGGT GCACCGGGTA     13860
     GCATCGAGCG TTTCTACAGC AACGGGAGGG CGTACCTCAG GGTCAGGCAC AGCTTGGGCG     13920
     GAGGGAAGAG GTCTTACTGC TACATAGGCC CCGCGGACAG CTACGTACAC GTGGAGCTGT     13980
     TGCACGCCTT GACGCTCACC AACCTAGTAA ACACAGACCC GGCTCAGGTA GCGGAGAGGG     14040
     CTTTGGAGGA GCTGATAAGC TCCGCTAGGT TCGTCCACGG TAAGAAGGAC TTGGAGGGCT     14100
     GGGTAGCCCG GGCTAAGCTC GCGGTAGACG CCGTTGAAAT CGCGTTGGAG AAGCTTAAAC     14160
     GGGTCTTGGA GGAAAAGGAG GCTGAGCTGG AGGCGCTTAG AAGGGAGGAG GAGAGGGAGC     14220
     TGTTGAGGCA GAACGGTTTA CTCGTGTACA AGTAAAACGA TAAGTTTTTT AACCCCCTCT     14280
     TTTTCCAATT TTCGTGGTGA AACCATGAGC ATAAGAGAAA ACGTCGTTAT AAAGGTACGA     14340
     CGTCTAAAGG ATTTCGTCGA GCACACTAGC AGGGCTGACC GCGTCTTCTA CTACTCTAGG     14400
     GGCACCTACT ACGTGGCGAT TGCAGGGAGT ATGATTTGGG CGGGGGACAT AGGCGTTGAG     14460
     CCCGAGGACG TCAGGAAGGA GTTCCTCAAG GTCTTGAACG TTAAAGGCGT GGAGGTGGAG     14520
     GACATACTCA AGCCCTACGA GGTTCCGGAC TACCTCAAGA GCCTCATGGA GTGAGGGGCA     14580
     TGCGCGCCAA GGACTTCCTA GTCGAGGAGG TAAGGGAGTG GCTGGCCGAG TACCTTGCAA     14640
     GGCATCAGGG GGGCATAGCC ACCGTGCTGG CTAGGTACGC GGCTAGAGAC CTGCGCCGAT     14700
     ACCACCCCGT AGCCGTCAGC CTAGCGATAA CGCAGGTGAA GATGGTCACG GACAAGCTGG     14760
     GGAGGGTCTG GGTCTTGGAC GACAAGCTTA CTAGGTATGC GAAGGTAAGG AAGTACGTTT     14820
     ACAGGCGGGA GAACGGCGGA GTGGGTGAGG TGGTACGCGA GTACTATGCG AATTGATAGA     14880
     CGTCTTGGCT TTCGGCTTAG CCGCGCTCTT CGTCCTAGCG TGGTTCGTCT ACACGGTGAG     14940
     GCTGGCGGTC AAGCCCAGCC TTTTATTCCC CTTCGAATTC GTCGTCTCCG TCTTCTTCCT     15000
     CCTCTTCTTC CTAGCCCTGC TCCTAGCGGT GCACGAGGCG GTGAAGGAGT CGTGCAGAGA     15060
     GAGGTGAAGC TCTGCCTAGC CCTAGCGGGT CTCAGCAGGG TAGCCGACAT GGCTACAACC     15120
     CTGCCGATAC TCCAGAAGTA CGGGCTACAG GGGGAGCTGA ACCCCGTGGC TCGGGCGTTT     15180
     TTCGGCATGG GCGTAACCGG CATAGCCTTC GCCTTGGTCG CCGGCACCGT TCTAAGCGTC     15240
     TTTCTCGCGT GGGTCAACTG GAGGAGGGGC GGGAAGAAGT ACCTCTACCT GTTCACCGCT     15300
     TTCCTCTGGA TACCCTTCTT CAACAACATT GTCGCATACT TTAACGCCCG CAACTATACA     15360
     CTCGTGGACT TTCTTTTCCT AGCCCTCCGA CCTCTACCTT AAAATAGGGG TTTTTTCTCC     15420
     CCTTTTTCTC GATGGGCATG AAAAGGTACA TACCCCTGTT ACTGCTACTG GTAACGGTAG     15480
     CCTTGGGCAT CGCCACCGTA AAGGCGGCTC CCGTCACGAC TTACACGGTC TTCGTCAACT     15540
     ACACCATGTA CACGGGCACC GCTCCAGCCG CGGGTAGCAC CTACTGGTTC AACTTCACAA     15600
     TCACTCCAAG CCTCGACGTC GTCATCGTGA CGGTAGAGGA CTTGGGAGGC GCTAGCCAGA     15660
     GGACGGTCTA CGTGGACAAC GTGGCTGTAA CCCTGCCCTA CAAGCTGAAG GCTGGAGAGA     15720
     CCCACAGGGT AGCCGTCAAG GTCTACTTCC CGAGCGCGCT GACTGTAGCG TGGTTCGGCA     15780
     AGACGATACT CGCCTACAAC AGGACTGAGG ACGTAAACCT GCAGGTAAAG TACGTGGGCT     15840
     ACGGCTTCGA CTCCGTGTCC TACGGGAGCT ACGTGGGTAG CGTGGACAAC GTGGCAACGC     15900
     TGACCGTCAA GCTGGACACG CCTTACACCA TGGGGGTCAC ACACACGTTC AGCTCTGTGT     15960
     CCACGGTCGT CTGGCTCAGG TTCCACCCGG CGATGCCGAT TAAGGGCTAC ACGGGCACCG     16020
     CCTACTACAC CACGACCTTC AACGCCTACA CGATTGGAAG CCAGCCCGCG GGCACCGATA     16080
     GCTACACCAT CTCCAACAAC CCGGTAACCG TCACGGTTGA CTGTCCACCG CCAGTAGGGC     16140
     TCTACGAGCT TGTCTGGTAC GTGAGCTGGG GAGGCTTGAC GGAGAAGATG CTCGGGGCGC     16200
     CGGGCACCCC CACCCCCAAC AAGAACTACG CTAGGCTGGT CGGCGCCACG TTTACTTGGA     16260
     AGTTCACCCC CAACGCCACG TACTTCCCCA CGACCAAGGT TGACGAGTAC CTCTTGGTGA     16320
     ACGGTAGCAA GGCTTCGAGC CTCGCGCTGA GCAAGAAGGG GCTCTACAAC GCCACCTTCG     16380
     TCAACATCGG AAAGATGAAC ACCACGTTCT ACGGAGTGCT GGCATACCTG CCCCCCGTGG     16440
     TCAGGGCGGG TACCATGTAC GTCTACGCCG CGGAGCTTAA GGTCAACGTG CTCTCTCAGG     16500
     TAGGCACGGT GGGAGCCCCG AGCCCCGGCT TCACTCTCAG CTTAGCCGGC GCGAACGCTC     16560
     CCGGCTACTT CGCGCTTCAG GTCAAGGTGC CCGAGGGAGT CGTCACGGTC GAAAAGGCTG     16620
     AGGGAGTGGC GTGGAACAGG ACTGTGCTCC CCGGCATAGC CAAGGACGTC AAGACGAGCC     16680
     TCGACGCCGA TAAGCTGGTC TACACCGTGA ACTACACGTA CACGCTGTAC TACGCGCCTA     16740
     TAGTGGGAGG CGTCAACTTC CTAGGCGCGT GGGGCATAGA GGAGACTCCG AGCCTTACGC     16800
     CGACGAGCCC GACTATAGCC ACTCTGACTG CCAGCAAGCC AGTGGTGCTC AACGCTACTA     16860
     GAAACGTGAT AAGGGTCTTG GACTCCGCGG GCAACGACGT CAGCTTCGTC GGGAAAGCCA     16920
     TAGCGATAAA GAGTAGCGGC ACCTACACCG TCAAGCTTGA GACCGTGATA AAGGTCGTCA     16980
     ACCTCTACCA AGGCAAGAAG ATACCCGCCA CGGTCAGGCT CTACGACGCT AAGGGCTTGC     17040
     GCCTAGCGGA GAAGACCGGG GAGGAGGTAA CGTTCACGGT TGAGCCCGGA CTGCTCTACA     17100
     CGGTCGAATC GGACAACGGT AACGAGGTGC TGACTCAGCG CGTCACGCCT ACACAGGACG     17160
     TCGATGTAAC AATGGAGTTC ACGAAGCCTC CCGCCGTGGT AATTCCGTGG GAGTGGGTGT     17220
     GGCTAGCGCT GGCCATAGTG TTCCTAGTGG TTCTGATATA CTTCGCTAAG AGGCTCAAGG     17280
     AGGGTCTAGA GATAGTAGTG GGGTAAGCCC CGTAAAACGA TAGCTTTTTT TCTTTCTCTC     17340
     TTCTTTTCAA GCATATGAGC TGGGATTGTG GAAGGTGCGA GGACGACACG CACGTCAGGA     17400
     GCATGGAGGG GAGGGTGGGA GGGGGAGACG GCGCCGTGTG CTACCTGTGC GGTCTACCCG     17460
     CATACGCCTA CGTGGACGGT AAGCCCGTGT GCGTGTACCA CTACGCACAG CTCATCTCCA     17520
     AGAAAAAGGT GGCGGCGGAG GTGAGGGCTA GGTGATGGAG CTGGCGGGGG TTGGGGCTGT     17580
     AAGCGTGGTC TTGGGGTACG CGGTTAGAAA GGGGGTCAAC TTCATACTGG GGCTTCTAGG     17640
     CGTTTTCGTC GCCTTCCTCC TAGTCCTTCA GGCTCTGGGC TACGCGGTGG TGGACTGGGC     17700
     TAAGCTGGTA AACGACGCCT ACGGGCTCCT CGAATCCCTG CTATCCCAGC AGGACTTAGC     17760
     CTCGAAGCTT GAACAGGTCT TACCCGGGGG ACTGGTGGGC ATAGCCGGCT TCATGGTGGG     17820
     CTGGAAGCTC GGGGGGAAGC TGTAAAGAGG GGGGCTAAAT GGAGGCTGAG GACTTCCTAG     17880
     CCGTAGCCTT CGTTCTAGCG CTAGCCACAG CCCTAGCCCT CGGGCTGTTC ACGGAGGGGG     17940
     TAAAGGCTGT CAGCCCGGCG TGGGCTGGGG GAAGTAGCGG AGGGGGAGGA GGGGGGTCTC     18000
     AGGTTAGCCT AGGCGTCGTA GAGCTGGAGG TAGAGGGGTA CGCGCCGAGG AGCGCTATAC     18060
     CCCCCGGGGT TCTTTTATCC GCTAAGCCCC TAAACGTTGT CAACGCTACC TGCAGGTGCC     18120
     CCGAAGACCC GGAGACGTTC AAGGGCGGGG TAAAGTGTAT ATGCTGGGTC ACGGTCAAGG     18180
     AGGGGTGCTA CCCCCTGTAT CCCACCCTGT GCGCTAGGAC TAACGTGGTG TGCACGGGTA     18240
     AAAAGTACAG GGTCTGGTGG GTATCGGGGG GCTGGGTCAT CCCCACCACG GGGGGCTAGA     18300
     ATGGAGGGGT TTAGGCGGGA GCTGAAGGAG AGGGCTTTGA GGGCTCTACG GGAGGGGGTA     18360
     AAAGGGGTGG ACTTGGAGAG GGCTCTGAGA GAATTCGAGG AGACTAGGAG CGAGGTGTGG     18420
     AGGGAGCTGG AGAAAAAGTA TAGGGAGAGG GGGCTAATCT AGCCCAGCTC TACCTCCAGC     18480
     TCGAAGTCCT CGCGTATCTC TTTCACTAGG CGCTTGGCGG CTCTCTCGCT CGCCGCTCTA     18540
     CCTATCTTCT CCAGCTCTCT CTCGAGGTGC ACCCAGTCCT CCGAGAGCGC TAGGGTGCTC     18600
     AGGAGGGGGT AATCCCAGAA CTCGGCTACT TCCTCTCTCC AGTAGTCGCT GAAGTAGGAG     18660
     GAATCGGCTA GGTACCTGTC CACTACCTCC TTTCTCCGCT CGCTCATCGA GGGGTATAGA     18720
     GGGGGAGGGG GCTTTAAAAT ATTCCTCGGG AAAAGCCCCG AGAATATGAG GGGTCTACCT     18780
     CCCTCGTTTT CGCCGTTTCT GTGGGGCTCG GGGTATAGCC CAAAAGCCCC GTAAGAGGGG     18840
     GCTAGCCCTC GGACCGAGGG GTGGGGGCTG AATAGCCACA AAATTTTGTG GCTAAATCGC     18900
     GGCTAAAGCG TGCTCTACCT TCGCGATTGC TTCGAGGGCC CGGGCGTCCC TGCTCATCCT     18960
     CCCCTCGACG GCTAGCTCCC TCAGCACTCT TACGTCTTTC CACGTGTAGG GGTACCTAGA     19020
     CTTGTAGACG TTGAGCAATC TGACTAGGTC GGCGTACTCC CTTCTGCACA GGGCTATCAG     19080
     GCGGGCTAGG CTCTCCCATT CATGCGCGCT CAGCCTAGCC CTCTTAGTCT TTTTTCCTCC     19140
     CCATTCGACC ACTACGTAGC CCCCTATCCT CTCAGCCTCC CTTATGTCCT CTACAGCCCT     19200
     AGCCGGGATT CCTAGGGCTA AAAGGCTCCT CGCCAAACAC TCCGCGGGGT TGTCCGTGCA     19260
     CTCGAATGGT CTAAGCCTCT CGTATACCGC TCGGTAAAGG GACTCAATCC TAGCCCTGCT     19320
     CACGGGGGGA TAAGGGAAAA ACAGGGATAA AAAGCCACTT TTCAGTACTC CCTAACATCG     19380
     GCTAGGAAGT CTCGGACTAA CTGCTTTACC TCGGGGTCTT GTAGCAATTC CTCTATAGCC     19440
     TCTCTAAGAG CCTCCTTTAT AGCCTCCTTC ACGGTGTCCT TAAGCTCTTT TCTTAGCTCT     19500
     TGTAGCTCCT TTATTACCGC TAGCTCTAAC ATTGCTTATT CGATGGCTAT ACGCCTTAGG     19560
     GGGATATAAG CCCATCGTTT AAGCCTACAG GCCCTAAAAC GAAAAAGCCC CGAGGAAAAA     19620
     GCCGAGAGAA AAAAGCGAGG AAAAAAGGGC TTAATTCTTC TGGGGCTGGG GGCTGAGGTA     19680
     CTCAGTCAGA GTCCTCTGGT CTAGGTAGAC GTTTATCGGC ACCTGTTTCT TCGGGATTTT     19740
     CCTCGGCATT TCTCGCCTCA CCGAGGTATA GGTAAACGGG GTAGCTAATA AGGATTTCGT     19800
     TTAACTTTTC ACAGGGCTAT ACGTTAGCCA CAAAATTTTG TGGCTAAAGC CCCGAGGAAA     19860
     AAAGCGAGGA AAAATCTAGG GATAAAATCC TAGGAAAAGC CCCGGGAATA AGGGCAGTAG     19920
     CCCCCCCTCA TTTTCAACGA TTCTGCGGGG CACGGGGTAT AGCCCAAAAG CCCCTAGAAA     19980
     AAGGGCTATT TCCTGGGCTT CCTAGCCTCT ATGTAGACTC TCACGCCTCT CCTCATTTTC     20040
     CTAGCCGTGT ACGGTCTACT CCTGCGCACC TGTAGCCCCA TCCTTATGAG TAGCTCTTCG     20100
     ACTGCGCTCA CTATCAGCCT GTATTCCTCC TCGCTTATCC TTTCCTTGTC CGCGATAATC     20160
     CTGATTTGCA CGTCTCCCCT CACTGCAATC CCCTCCTCGC GAATATCGCC TTTAGCTTGT     20220
     GAAACGCCGT CTCCTCGTGC GTGTAAGCCA CGTAGACGTA GAACAGCGTG GCTTTCGTCT     20280
     TTCCAGGCGC CGGTCTCAAT AGCCTCCCTG CTCTCTGTAT GAGCTGTCTG TCAGTCGTAC     20340
     CGCTCGCTAG CATTACGCCT ACGCTTACCT CGGGTACGTC TACTCCCTCG TCTAGCACTC     20400
     TGCACGTCAC TAGTACTCTG AAGGTTGAGC CCCACTCTTT GAGTATCCTC GCGCGCTCGG     20460
     TCTTAGGCGT CTTGCTGAGT ATCGCTTTTC CTCCGAGTGT CTGGGCTAGC TTTAACGCCA     20520
     CGTCTTGGCT CTCAGTCCAC ACTAGTACTC TGTTGTGCTC CTGTGCTAGC CTGTTGATAA     20580
     GCGCTAGCGC CGAGCTCCAC TTAACAGGGC TCCTCGCGGC TAGCTGTTTC CTTAAGTTTA     20640
     CCAGCTTCAT CAAGTCCTTC TTCAAGTGTT TCTCCCCGTC CTCTATGCGC CTGCTTAGGC     20700
     GCCTAATCTT CTCCTGTATC TCCTCGTACT GCTGGTAGAA CTCCTGTGTC TCCGTCACTC     20760
     TTATCCCCAC TAGCTCGATT GGCACCATGT AGCCTTGCTC CTGTAGCTCG CTCGGGCTTA     20820
     CCTCATAGCG CTTAGGTAGT AGCATGTCAA GCACCCACTG CTCTTCTGTG TCCTCGCGCT     20880
     TGTGCGTCGC GCTAAAGCCA TAGATGTGCA CGCCTAGCCT AGCCAGCCTC GCCAGAGTCC     20940
     TCGCTAGCTC CCTAGCCCCT GCATGATGGC TTTCGTCAAC TATCACTGCG AAAGGCGTGT     21000
     AGCCCCGCTT AACCTCGCTC ACGAAAGTGT TGTAGACCAT TACCGTGATT AGCTCGCCTA     21060
     GCCCTTGTCC TCGCCTGTTC ACTCCCCCGT ACTTCACGTT CACTCTGAGC CTCCACTCCC     21120
     TCTCAAAGTG GCTAGCCCAC TGCTCAGCCA GCACTTGCGT GGGCACGATA ATAGCCGTGT     21180
     CATAGCCCCA TAGCGCTAGG TTCACGGCTA GCGTGCTACC GATAAGCGTC TTTCCGCCGC     21240
     CTGTGGGGAT TTGCACGGCG CCGTGCGCGC TGAGTAGCCA TCTAAGCGCT ATCCTCTGGT     21300
     AGTCGCGCAT TTTCTTCGGC ACGACAATTT TAGCCACGCG TATTTTCCTA ATGCGCTCGC     21360
     TTAAAACTCT AGCCGTGTAG TCTCTCTCGG TTAGCCCCTG CTCCCTTAAA AGTTCTTTGA     21420
     GCCTTTCCTC GTCGCCTGCT AGGTCGGCTA GCAGTTCATA GCCCCATATC GACGTGTCCA     21480
     CGCCTAGGAT TATCTGGGTG CTGGCTTCTT CCTCGGTTAG CTCTAGCTCG CTTATGGCTT     21540
     GTGGGGCTAG GATTTGTCTC CAGTCTACGT ACTGCTCTAC GCCTAGCTTT TGGGCTAGCT     21600
     CTGCGTATTT GTCTTTTAGG CGAGGATTCT GGGCTAGGAT TTGCTTAGCT TCCTCGATTT     21660
     CCTCGGGGCT AGCCTCGCCT AGCTCTACCT TGTCGGCTAA CACCGCGAGG CGGCTCTCAA     21720
     GCCATGAATT GTACTGCGCT TCGACTTCCT CGGGGCTATT ATTATCAGAA TAATAAGCCC     21780
     CGCCTAGCCA TTTAGCGAGG ATTTTTTCGA CGATAGCCAA ATTCTCGCCT AGCGAAAGAC     21840
     TAGAATCTAC GGCGTCGCAT ATGTCGTTGA CGATTTCCTG TGTGTCTAGC CCTTTAGCCC     21900
     TTATAAGGGC TAAGCGCGAG GCTATAGCCC TAGCTATTTC GAATTCAAGG CTAGGGGCTA     21960
     AATCGCGGTT ACGCCTTATG GCTAGGCGCA ATCGCTCTAC CTCGCTATTG TAGGCGCTTA     22020
     GAGGATTAGA GTCGGGGCTA ACTTCTTTTC CTATAGCCCC CCACGCCTTT TTCTCTCGCA     22080
     TATTCCTCGC CTAGAATATA CGCCTAAGCT TAAAACGTGG TATTAGTAAT CGACGTTATT     22140
     AATCGACTCT GGGCTAAAAG AAGTTAGCCA AAATCGCCTA TTAGCAATGG CTATAGCCAA     22200
     TAGCAGTAGC CATTAGCTAT AGCCATTAAG CATTAGAAAA AGAGTCGAAT CGCAATTCGA     22260
     CTAAAGGCTA TTAGCCCAAA AACGAAACAA AATTCGACTC TTACGCTATT ATTCGAATTG     22320
     TCAAAACAAA AATCGACGAT AGCCTATTAG CCTTTAGGCT AAACGCTTAT CGACTCTTAC     22380
     TAATCGACAA AAAGCTAGCC GAATTTAGCC TAAGAGTAAA CGACTATAGG CTAAAGCTCT     22440
     TTAGCCTATT GGCTATTAGC CCAAAAACGA ATAGCCATTC GACTATAGGC TATTAGCCCA     22500
     TTGGCTAAAG GCTATTCGAC TCTTACGCTA TTAGCCCCTA TTCCTCTCGC TCTAGCCCCT     22560
     ATTAGCCCTA GCCCTATAGC CCCGTAGAGG TAGAGGAAAA GGCGAAAACC CTCTAGCCCC     22620
     TAGGCTAGCC TGTATCCCTT CTTTCCTCCT TTTTCTTTTT GTTTTTCTTT TCCCTTCTTT     22680
     TCCAATTTCG CGGAATTGGA AATGAGGTTT CGGGGCTTTC GTGGGGCTTT TGGGCTATGC     22740
     CGCGAGCCCG TTTACCCCCG TTTCTCTCCC TAGCCCCCCT CTGTATCCCC CCTCCCGTAT     22800
     ATTGCTCCCG CGACGGGGCG TTTTACACCG ATAAAACGAA ACAGGGGAAG CCTCCCGTTT     22860
     TTTCCCTTTT CGCAAAATTG GAAAAAGCGG AGAAACCTAA AGGAAAAAAG CGCTTAAAAC     22920
     TAGGGCCTGT AAAACGCAAT TTTCCCCTCG AACCCGGGGC TAAAGCCCAA GGGCTAGACC     22980
     CCCTCCGTTA AACCCCCCTC TTACGGGGCT TTTGGGCTAT ACTCTGAGCC CCACAGAAAC     23040
     GGCGAAAAAA CGGGGGGCTA ACCGATTTTG TACCCGGGGC TTTTCCCGAG GAAAACGCGA     23100
     GAAAAAAAGA ACAGTTTTAG GGGTTTACCT GAGGATGCCG CGCTCCCGGG CTATTTTCTC     23160
     TATTGGGGGA AACGTGTGTT CAAAGCTTGT CCCCAGCCAC GTCAGAAACT CGCAGTACTC     23220
     GCTTTCGAAG CCGTCGGTCT CCAAGGCGCG TATCATGCGG TAGTACTGCT CCATGTAGCT     23280
     AGCCCTGACG AGGATTGTGT TCTTGAACCC GTAGGCGCAT ACGAGAGCCT TGAGAGCCCC     23340
     GAGGAAGTCA ACCCAAGCCT GAAGCCCCTC CTCTTCAGCC TTCTTCTGAA GCTCCTCTAT     23400
     CTCGTCGATG AGGACGGGTA CGTTGACGTC GTTGACCTCG CGGATGGTGT GCACGAGCAT     23460
     GTCTAGGAAG GTGTGCTTGA GGACTGCGCG GCTAGCGTCC TTGATTTTAT CGGCGAATTT     23520
     CTCGTAGACC ATGGCTTTTC GCCGAGAATA GAGTAAAACG GGGTAGCTAA TAAACCTTTC     23580
     GTTTTACACA AAACGGGGCT AAACGCATGC TAGCCGCGAA AAACCACAAA ATTTTGTGGC     23640
     TATTCAGCGC GACGGACTCT CCTCACACCC TCGGTAGCCG AGCCTCATCA CACGCGAGAG     23700
     AGAAAAAAGA ACGATTTTAG GGGTTATTCT TCGCAAAAGC CTTCCCAATC CTCCTCTTCC     23760
     TCCTCCCAGT CCTCCTCGGC GCCTAGGTAG TAGTTGACGA TGTCCTCGAA GTCCTCGTGG     23820
     AATTCGACCA TCACGTGAAT GTCTAGGTCG CTCCACAGCT CAATGACCTC GCCGACGTAT     23880
     CCGAGGAACC ACAGGATAAC CCCGTCTCCT TCAGCCCCCT CCCAGACCTT CAGCTCGTCG     23940
     TGCTCCTCTA TTATGTCCTC GAAAAACTCG CCCTCCCAAA TCTCCCTGAG GTGGACGATT     24000
     GCGAAGGTCT TGTCCTCGGC GTAGTCGTGA CCAAAGGTAA GGACGTAGTC GTAGATATGC     24060
     TCGGGTGCGG CTAGGTACAC GCGCACGTAC CTGACGGGGG AATCGACCTT CTTCAGCTGT     24120
     GCTCCCCTGT AAAGCTCTCT GACCCTCTTT ATCTGCTCCC TCGTTTTCTC AACGGTTGTT     24180
     GTCACGCTCA TAGCGGGGTA TAGAACGCGG GGGTAGCTAA TAAAGGTTTC GCTTTATTTT     24240
     TCACGGGGGC TAAACGAAAG CATTTTGTAG CAAATCAGAG CTGTAGGCTC TCCTCACGGC     24300
     TCGGCGCCAA GCATGCTCAT CACGCGGTTC AACACCGAAA CCCTGTTTCG GTCCGAAACT     24360
     AGAAAAAAGC TTCGAGCGAA AGAGCGAGAG AAAAAAAGAG TAATTTTAGG GGCTAATACT     24420
     CCTCGTCCTC CCAGTCCTCC TCATCCCAGT CGATGGGCTC GTATTCCTCT CCGTAGTCGT     24480
     CGAAGTCCTC TTCTTCCTCT TCGCTAGCCG AGTCGTAGCA GACGCGAGAA GAGTCACACT     24540
     CGCAGGGTAG CTCGTCCTCG TCTCCGGGCT TCTCCCAGTA GGGTCTAAGA GTGCCCCAGT     24600
     CGAAGCCCTC GATAAGCTCC AAGGCTTGAG CCAAGGAGAG CCTCCTGTAG ACCCATACCT     24660
     CGGTCACGAT TTCCTCCACA GCCCTCTGAA GCCACACGGG GGCACACCTA GACGCTTGAA     24720
     CCTTCACCCA CCTTTTGCCA CCGCGACGGA AGAGCCCCAC GTAGACGGCG CGCCTGACGA     24780
     CCGTGCTGTC CGTGATGCCG TCTCTTCGCC ACACGTCGAA GGTGCCCGGT ACTCTGAAGC     24840
     GGTGCTCGCC TATGCGTCCG GCGCAGTAGC CGCCGTCTCC GCAGGGGTAG ATGCCGCGCC     24900
     ACACGGCTAG CCGTGTGGCT CGGTAGCTCT CGACTGCGTG CTCGGTGCAC AAGCCCTGCC     24960
     TGTCGTCGCA GTTGACCCAG CAGTCTAGTA GGCTCATGCT TATCACGTAA GAGTGAAACG     25020
     GGGTAGCTAA TAAACCTTTC GTTTAACTTT TCTCGGGGCT AAACGCTAAA AGAACGATAA     25080
     AATCGAGGGC TGAGACCCCC ACCTCCTCGC TATCTCCTCG TAGCGCGAGA TATAGGCGCG     25140
     TATAGCCTCA GCCCTCTCCT CGATATCGCT ACACCAGCTG TTCTCGCACC ACCGGTACAT     25200
     AGCGCTACTA TCGAAGCTGA AGAACCGCCT AGTCCTCCCA GCCACGCGCG CCACAGCCCT     25260
     GAGGCTCGGC CCGAAGACGT GGAAAGGCTT AGCCGTCACG GAGTCAAAGG CTAGAATCAT     25320
     CTTAGCCAAG ACCCCCCACC TATTGCTGGC ACAGGTGGGG CCCAAGGCTA CAAGCTCGAA     25380
     CTCGTCGTAT AGCTCCCTGT TCTCCGAGTA CACCCTGACG GGGCTCAAGG GGTCGTCCTT     25440
     CTTACCCTGC ACCACGGCTA CAGCCGTGCC CGGCAGGCTA TCGACGCGCG TCAGCCACCG     25500
     CTTGATGCTC TCTAACGTCT TCTCGACGTT GAGGGGGTAG AATTGCTCCA TCCCCGGGTA     25560
     GTCCGAGGGG TAGTCCGGAA TCACGTAGTA GAACTCCTCG ACCCTAGCCT GAGCGTGAAC     25620
     CCTAGAGATG AACCTAGCAT AGCCGTACTC GAAGCCCGAG GGGTACTCGA AGCCCCCCGA     25680
     CTCCTTAAAC ACCTTGTGGA CACCCGTATC GACTAAGACG CCCTCAGGTC TACACTTCTT     25740
     CAGCCACTGC TCCCAGTCGT AGTACACGTA TGGATTGACA ACTACATGGG GGTAGCACAC     25800
     CCCAGCGCTC CTCAACCTAC TCACGCTTAT GTAGAGCCGC GGAACCACGG GGAAAAAGGC     25860
     GGGCTAGGCG AGAAAAAGCC AACCTTTTTG ATTTTCACCC TGACGCTCTC GGCTACGTCC     25920
     TCCTCGGTGT AGTGTGTCTC GCTCTCCTCG TATACGTAGA GCAGGCGGTT CCACCTCGCG     25980
     ATAATGTAGT CAACAGTCCT CCAGACCTCC TCCTCGCCGT TCTTGAAGGT GACGTCGCAG     26040
     AACACCATGG GGAAAGAGGG CTCGCTCCAG TTGTACTCCG TTGAACGCTT GACCCTGACG     26100
     GTTGTTTTCA CCGCCTTCAC CGGGTTAGAT AGTGAAAGGG CCGGCTAATA AAGCTTACGC     26160
     TTAACCCTTC TCGGGGAAAA ACGCTTATAT ACCCCTTCAG CTATAACTCT ACCGGCTATG     26220
     CCGATACTGG TACAGTTTGA GCGGTTCAAC AGCGACGTGA AGCGCTGGAT AGTCAGCTAC     26280
     CTATCTCCCC ACGGCTGGGA GAAGCTAGCC ACCCACAAGG TCTTCGTCGT AGACCCCGAG     26340
     AGCGAAGAAA AAGAGGAGGA GGTGGAGGCG CCCATAGGCA CCACGATACT CGTATCCGCT     26400
     AGAAAGGTGG AGTTCTACGG AAACGCTAGG GGAGACGACA TCGATAAGGC GGGCTACGTC     26460
     AAGGTCTACG TGGACAGGTG TGGGAGCTTC CCCGTCATGG CTATCAAAGA CCCAGAGAGG     26520
     CGTAACAAGG ACGTAGTCCT AGACACGCCC CTCGGTAGCT ACACGTGCAC CGAGGTCGTA     26580
     GTCAACGAGG AGGAGGACTA CGTGAACGTG GCGGACGCAG AGTACATAGC CGTGGCTCTG     26640
     ATGGCTAGAT TCGTGGCTCT GGTGCCCTCC GAGCCCTTCA AGTACAAGGC GCTGATAAGC     26700
     ACCAAGGCGA AGCCCAAGCC CGAGTAAAAA CATTCTTTTT TCTTTTCAGC TCCTCAGAAT     26760
     CATGGCCGTT TTACCGCCTA GGTCGTAGAC CATCCAGCTC TTAACGTCCG TGGTGACTAG     26820
     ATGGGGGGCT GGCTTGCCGT CCAAGAAGAC CTCGTCAACC TCGAACTTGT CCTTGATCTG     26880
     CCCCGAGGAG TCCAAGAGGT AGACCGTGTA TCGCCCACCG TTGCGCTCTA CCCTGACCCT     26940
     CATCGGCTGT CCCTGTCCTC CCTTATCAGC TTAGCCGCGT CTATACCCTT CTCTTTGAGA     27000
     GCCTGAGTGA CCGTCTCCCT GAGCCTATCC GTCTCCTCGG CGGCGAAGCC CAAGCTACCC     27060
     CACTCCTCCA GCAATGTCTC GATTGCCACC CAAGCGGTCT TGTACAAAGC CTGAAGCTTC     27120
     TCCACGGTCT CGGGGCTCAA ATCCCCGCTC GTGCCGGCCT CCTCTACGTG GACTATGAGG     27180
     CTGGATAGAT GCTTCAAGAC GCACCACTGG GGCTTCCACT TGCAAGCCCA CTTAAGCTCC     27240
     TTTGCAAGCT GGGCTACGAA GTCGCGCCTA ACCTCCTTTA TCGCGGTAGC CTCCTCGACC     27300
     TCCCCCATCT CCCACTTATG CTCCTCCAAG TTTATGAGGT GCCCCAAGAC CCATACCAGC     27360
     TCCTCAACGG TGCCTCTACC CGGTCTTTTC TCCTCAGGCT TTTCCCCGCT CATATGCTTG     27420
     AAGGAGCTGG CGCGGGCTAT AAAGCCACCG CGCAGAAAAT CCACAAAATT TTGTGGCTTT     27480
     ACCGTCAGCC TAAAAAGCCC CCGCGCCCCC CTATACCCGA TGAAGTGGTG GAGAAAGCTC     27540
     ATGACGATAG GGAGCCCGAT ACCGCTACAA ACTAGAGAAA CCTACCTAGG CACCCCGCTG     27600
     GAAAAAGAGA GAAAAAAGAC TTTATTTTAG AGGATTAGCT GGGGCGTGTA CCCGGCTCCG     27660
     CCTACCGGGC AACCCTTAGC CCGGGCTATG TTCTCGATGT ACGTAGCCGC CTGTACCTGT     27720
     CCCATTAGGC GGAAGCCGTT GGCTAGGCTT TCAAGCGCCT CGCAACTGGC GAGGGCGAGG     27780
     GTGTTTCTGT CGAGCTTGAC CTTGACCACG CTTGTCACCT CTTAGCTAGT CGTTGTAGGC     27840
     GCTTTAAAGG GCGCCGATGC TGACGAAGAA CGCCTTGAGC CCGCTCTCCC AGTTGGGAGC     27900
     CCACTTCTGA CCGACTATCT GAGCCATTCC AGCCCTGCAT CTGTCAACGT TGAGACCGGG     27960
     GAATATCCTT GCGGCGAACT CGCAGTACTT GACGGGGTAC TTTGCCTCGG TCTTCCTAAT     28020
     TATGTACTCG GGTACCGGCA TGTCTGGTCA CTCCCAATGG AGGGCTTCCC GTTTATAAGT     28080
     TTTAGCTTTC GTTTTACGGC TTCACCGTGG GAGGCACGGG CTTGGTAGCC ACCCTGTAGT     28140
     ACCCGTTACC GATGTTGCAG ACGAGGACGG CTACCCTGTT CTTCTGGAAC CAGAAGACGA     28200
     CGCACTCGTT TGGGTTGAGC TTGCTGAAGT TGTAGTCCGC GTAGTCTGTT GTAGTCACGG     28260
     GTATCGTCTC TACTAAACTC AGCCCCTGAA GCTGGAGCGT GCTCGGCATA CCTTTTCGCC     28320
     TTTAAAGGCT CCCCCCACCT TTAAATAGTT GTCTCTCCCT TCTTAGCCCG ATGAGCAATG     28380
     ATTAGCCCGA TAATCCTGCT CCTGTTGATA TGGCTGGGCA CCAGCATAGG CATAGTGTTC     28440
     GTGACCCTCA ACGAGTACAT CAAGGAGAAC GGAAAGCTCG ACGTAGCCGC CGCGTTATTC     28500
     GCACTAAGAG AACTATCGGC GATTGCCCTC CAGTTCATAT GGCTGATAGT CCTCCTCCAC     28560
     GTCTGGGGCT TCCTAGACAT CAGAACCGAG CTGGGTTGGA CGGCGCAGAT ACCCGATTTG     28620
     AGCACGCCTC AGGGGCAGGC GGCGTACGTC TTCATCTTCG CGAGTCTGGT AATCATCGCA     28680
     ATCCTCTACG CTGAGGGATA CGTCAACCTC GCGTTCACGG TGGCGGTGTT CAGCGGGGTA     28740
     GCGATGCTCG GCTACATAGA CGCCAACGTG TACTTGCAGT TGCTCGGCAT AGGAGTAGCG     28800
     ATGCTCGCGG TCTTCGCCTA CGTCTTCAGG AGCGAGCTAG AAGAAGAGCT GAGGCGCTGG     28860
     AAACTCCGTT AAAAACCCTC CTCTTTTTCT CCCCCTTCTT CCTCCTCGCC CAACTCCTCC     28920
     AAGTCCACCT CCTCGAACTC GGGCTCCCCT TCTTCTCCGC CCCCCTCGGG ATTAGCCACA     28980
     AAATTTTGTG GCTTTTCGCG GGGGAGCCGC GGCTTGACGG GCACGGGGGG AGGCGGGGGC     29040
     TTGACCTCTA CCGGTTGAAG GGGCACCTCG ACGACCTCGG GCTTCAAGCC CTGAACCCTC     29100
     GAGACGTAGT AGAGGTAGGG GTCGTTGTCC GGCGTGAAGT AGCCGCTAGC CACGTAGCCA     29160
     AGCTGTGGAG CCACGTAGAA CGAGTTTCTC CGAGCCAGTA TAGCCCTGAA ATCGCCCCGC     29220
     CACACCAAGT GCCCCGTCAC CACGGTGTCC TCGCCCGGTC TAAGCCTCGC AAGCTCGCCT     29280
     CTCAGGTAGC TGAACGAGGG GTCTCTGAAC CTGATTCGGG GGTTGAACCT CAGCAATTCG     29340
     AAGACGGTGA ACGCGAAGGC AGGGTCAACG TCCACAGGAA ACTCCAGTAT GAAGGTGCAC     29400
     CTCCTGTTCA ACCTGCTGAG AATGGCTAAG CTGTGGAGGT CTGAGACGTC GTGTATCAAC     29460
     ACCACGTACT CGCCCATCGG CAGAACCTTG GGGCTCAGGT CGTTGAGCCA AGCCACCACG     29520
     TCCCTCCCAG CCGCCACGTC CGCGTCAGTC TCCCACTTGA CCCTCGTGAC CGGTCTCCTG     29580
     TCCGCGCTCA CGTAGTAGAC CTCCTGTATC CCAGCCCCGG GTATGTAGCC GTGCCTGCCG     29640
     AACGGCTCCT TTATGAAGGA CTTGAAGTAC CCGGGGGGTA AACCCTCGAC TATGACTAGC     29700
     GCCGTCTCCC ACCACCCCTC CCCTTCTTCT TGGGCTTAGC CTCCTCCTCT TCCTCACCCC     29760
     TCTCCTTTTC GGGCTTCCTA GGCCTCAAGG GCAGACGGAC GTCCGTACCG TAGAGGAGGG     29820
     AGCTGAGCGC CACGTGTATC TTCGTCTCGT CCATGTCCGG CGGCAGTCCC GGTAGCACCC     29880
     TGATGTGCTC GGGCATGCTC ACTATGACCG TGGGGGTCTT GACTCCCGCC ACGGTTCTGA     29940
     GACCGCCCTC CGCAATCCTT TCAAGCCGCT CGCGCTCCGA GAGGTACAGG TAGAAGGCTG     30000
     TGACAAGCTG TAGCTCGTCC TCGACGTCTA TGCTCAGCCT CTCGGCGTGG CTCCTCCACA     30060
     GCGCCCTAAA CGAGTAGCTG TTCTCCAAGG CGTACTTGCA GTGGGGGCAC TCAGACCCCA     30120
     CCACGACGTA GACTTTACCC GAAGGGGGCT TCGGCACCTC CCACCACCTC TATGACCTTG     30180
     GTGACGCTAC GCGTGAAGCT GTAAGCCTGC CTAGCGCTGG TCACTACGAT TTGGAGTTCA     30240
     GCGAGGAGGT TCTCGGGAGG CATCACCACC GTGTTACCCG AGATGTTGAC CTGAATAACG     30300
     GTGGCGCTAG CCTTCCCCCT CAGCAGTGTG GTCTTGACCC ACTCCCTCGT AAACGGGTCT     30360
     GAGCCGGCTA CGTTACCCAA GCACTCCGAG GACACGCGCT CGAAGATTTC GAGTATCTCG     30420
     ATGACGGCTC GCTTAGCCTC ATCGCTCAGC TGTGTAGTCT TGGCGAAGGT CAGCACGGCG     30480
     TGCCTACCCC TGTATACCAC CTCGCCCGTG GGGGGAGTCC CCAGCAACTT GTTAATCACG     30540
     GCGCTCAGGC TCAGCACGGC TAGCTGAGGC GTGGGAGGGT TGTTACGGGA GACGTCCTGC     30600
     TCCACGAAAT GGAGTAGCTC CTGCATCCTG TCCAGAAGCT CCTCAAGCTC CATAAAGACA     30660
     CCTACAGCTT TATCGTCAGG GCAGAGTCTA TGGCGTCCAC CATTCTCGCT ACATCGACCT     30720
     TTGTATATAC TTGAGTCGTT GTTAGCTGAG CATGACCCAG TAGCGTCTGA ATCGTCCTGA     30780
     TGTCAACCCC GTTGTTCAAC AGGAGAGTAG CGTAGGTGTG CCTCAGCGTG TGGGGAGTCA     30840
     CGCGTTGAAG ACCCGCGCGC CTAGCCACCC TTGAGACCAA GTGCTGTATG CTCCTAGCGC     30900
     TTACCGGCTT ATCGGGGTCT AACGGGCTGG GAAAGATGTA GCCAGCCCTA CCCGTGCACC     30960
     TCGCCTTGAT AATCTCGACT ACGTCCTTCG TCAGCGGTAC AAGCCTGACC TTGTCACCTT     31020
     TGCCCCTGAC CCTCAGCATG TACCTGCCAT CGCCCACCAC CAGCACGTCC TCGCACCTGC     31080
     TGTGCACGAA CTCGCTTACC CTCAGCCCCG TCTTCAACAG GAATACTATG ACCTCGCGCT     31140
     CGGCTGGGCT AGCCACTGAC AACAGCTTCC TGACGTCCTC GGTTCCCAGT GCTTTGGGGA     31200
     CGGACTCGGG CTTCTTAACC GGTGGCAGAG TCCAAGGCAG ACCGGCGAAC TTGTGGAAGC     31260
     CCCTGAGCAC GACGTACGCG GTTCTGATGC TAGTCCTCTT TTCCCAGCCG TTCTTTTCGA     31320
     GCCACGAGAT GAACGCGGCT GGGTCAGGCT TACCCGTATC CTCTACGAAC TTGGCGTACG     31380
     CGAACAGCAC GCTCGCGTAG GTCTTGTACG TGTTGTGGCT CCTAAGCGCC TTGACTACTC     31440
     CCAGATAGTT CTCCACCAGC GCCCTGATGT CCTCCGGCTT TGCCACCGCC TCTTGCACGG     31500
     CTCA                                                                  31504
//

If you have problems or comments...

PBIL Back to PBIL home page