(data stored in ACNUC8465 zone)

HOGENOMDNA: THEPD_2

ID   THEPD_2; SV 1; empty ; DNA; empty ; PRO; 1781889 BP.
XX
AC   NC_008698;
XX
PR   Project: 58563;
XX
DE   Thermofilum pendens Hrk 5 chromosome, complete genome.
XX
OS   Thermofilum pendens Hrk 5
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermofilaceae;
OC   Thermofilum.
XX
RN   [1]
RP   1-1781889
RX   PUBMED; 18263724.
RA   Anderson,I., Rodriguez,J., Susanti,D., Porat,I., Reich,C., Ulrich,L.E.,
RA   Elkins,J.G., Mavromatis,K., Lykidis,A., Kim,E., Thompson,L.S., Nolan,M.,
RA   Land,M., Copeland,A., Lapidus,A., Lucas,S., Detter,C., Zhulin,I.B.,
RA   Olsen,G.J., Whitman,W., Mukhopadhyay,B., Bristow,J. and Kyrpides,N.;
RT   "Genome sequence of Thermofilum pendens reveals an exceptional loss of
RT   biosynthetic pathways without genome reduction";
RL   J. Bacteriol. 190 (8), 2957-2965 (2008)
XX
RN   [2]
RP   1-1781889
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (21-DEC-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1781889
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Dalin,E., Tice,H., Pitluck,S., Thompson,L.S., Brettin,T.,
RA   Bruce,D., Han,C., Tapia,R., Schmutz,J., Larimer,F., Land,M., Hauser,L.,
RA   Kyrpides,N., Kim,E., Anderson,I., Olsen,G., Reich,C., Woese,C. and
RA   Richardson,P.;
RT   "Direct Submission";
RL   Submitted (14-DEC-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000505.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001423
CC   Source DNA and archaea available from Carl Woese
CC   (carl@phylo.life.uiuc.edu)
CC   Contacts: Carl Woese (carl@phylo.life.uiuc.edu)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1781889
FT                   /note="type strain of Thermofilum pendens Hrk 5"
FT                   /strain="Hrk 5"
FT                   /mol_type="genomic DNA"
FT                   /organism="Thermofilum pendens Hrk 5"
FT                   /db_xref="taxon:368408"
FT   gene            30..881
FT                   /db_xref="GeneID:4602200"
FT                   /locus_tag="Tpen_0001"
FT   CDS_pept        30..881
FT                   /locus_tag="Tpen_0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   tte:TTE0754 membrane-associated phospholipid phosphatase"
FT                   /db_xref="GI:119718919"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="GeneID:4602200"
FT                   /translation="MARSKLDYLFAAVSVLLLVSPLIAYLTGNWVGFWRLATNLGDEPA
FT                   YVALAVVLYFLVDQGLGFSVLLALSTTAWLNVVVKNTLRLPRPPRELWLANAEGYGFPS
FT                   GHSQTSTTFWSSLSLKTRRLGVVVLGVAVVAIVGASRIMLNVHYPWDVAGGIALGLAVS
FT                   YASYYLFDRLPGKASLSSAVLAVYGLAVGGLYLVVADATIARIGGLIVGLSVYPLVSEK
FT                   VSLAGKPLAWRAVLAAVALVVAMLLTTVAKAQPVPVQFIAYLATGATVVSLPLLLKRAE
FT                   KA"
FT                   /protein_id="YP_919414.1"
FT   misc_feature    201..524
FT                   /note="PAP2_like proteins, a super-family of histidine
FT                   phosphatases and vanadium haloperoxidases, includes type 2
FT                   phosphatidic acid phosphatase or lipid phosphate
FT                   phosphatase (LPP), Glucose-6-phosphatase,
FT                   Phosphatidylglycerophosphatase B and bacterial acid...;
FT                   Region: PAP2_like; cl00474"
FT                   /db_xref="CDD:174227"
FT                   /locus_tag="Tpen_0001"
FT   misc_feature    order(267..269,279..281,339..347,450..452,468..470,
FT                   480..482)
FT                   /note="active site"
FT                   /db_xref="CDD:48084"
FT                   /locus_tag="Tpen_0001"
FT   gene            complement(887..1984)
FT                   /db_xref="GeneID:4600534"
FT                   /locus_tag="Tpen_0002"
FT   CDS_pept        complement(887..1984)
FT                   /locus_tag="Tpen_0002"
FT                   /gene_family="HOG000291973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: peptidase M18, aminopeptidase I; peptidase
FT                   M20; peptidase M42 family protein; KEGG: gka:GK2713
FT                   hypothetical protein"
FT                   /db_xref="GI:119718920"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="GeneID:4600534"
FT                   /translation="MSAYKLDEKSLNVLKEITEIVAPSGFEEPVLERIKQYYSEYADEV
FT                   RRDNLGSLILVKRGSSERPKVLVAGHVDEVGFLVTGITPEGFITFTTLGGWFEQVLLAQ
FT                   RVVIRTKKGEVYGVITSKPPHLLTPEERQKVVQFSQMYIDVGATSKEEVEKLGVRIGDP
FT                   VAPWSPFTRTAFEDRIMAKALDDRVGAFIAMEVLKHLRLNGIDHPNTLYAAATVQEEVG
FT                   LRGAETVGWVADHDVAIVTEVDIAGDVPGIKPSEAPAKLGKGPSIIVYDRSMIPNPRFK
FT                   EFVIEVAEEAKIPYQLSAVSGGTDAGRLHLYKGGRPSIVIGVPTRHIHSHVSIVSLSDV
FT                   ENAVRLVLELVKRLDQETLKRFVNI"
FT                   /transl_table="11"
FT                   /protein_id="YP_919415.1"
FT   misc_feature    complement(<1757..1984)
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Tpen_0002"
FT   misc_feature    complement(896..1963)
FT                   /note="Cellulase M and related proteins [Carbohydrate
FT                   transport and metabolism]; Region: FrvX; COG1363"
FT                   /db_xref="CDD:31554"
FT                   /locus_tag="Tpen_0002"
FT   misc_feature    complement(947..1834)
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Tpen_0002"
FT   gene            2136..3023
FT                   /db_xref="GeneID:4600535"
FT                   /locus_tag="Tpen_0003"
FT   CDS_pept        2136..3023
FT                   /locus_tag="Tpen_0003"
FT                   /gene_family="HOG000058567" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-acetyl-1-alkylglycerophosph ocholine esterase"
FT                   /transl_table="11"
FT                   /note="KEGG: pab:PAB2176 hypothetical
FT                   2-acetyl-1-alkylglycerophosph ocholine esterase"
FT                   /db_xref="GI:119718921"
FT                   /db_xref="InterPro:IPR003089"
FT                   /db_xref="GeneID:4600535"
FT                   /translation="MLTLLLTTVVAVVVLLLVAVAFSASRKLASPPRKVGQWSPGDMGY
FT                   TYEKLEVKTSDGLTLRGWLIPRGSDRTVLVVHGYTSSKWDEWYIKPVIDILARNNFNVV
FT                   AFDMRAHGESDGRYTTLGLREVEDISKIIDLLEEKGLASRLGMIGYSMGGAITLMTAAR
FT                   EDRVKAAVADSPYIDIRASGKRWVKRVGAPLRYLLLASYPLIIYFTSKTTRTDPSKLVM
FT                   FNYASLIRKPLLIIAGRNDDLVALEEIETFFNENKKVNPNTELWVTDSKHVSAIQDYPK
FT                   EYEKRVVEFFERWL"
FT                   /protein_id="YP_919416.1"
FT   misc_feature    2334..3011
FT                   /note="Esterase/lipase [General function prediction only];
FT                   Region: COG1647"
FT                   /db_xref="CDD:31833"
FT                   /locus_tag="Tpen_0003"
FT   misc_feature    2349..>2603
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176940"
FT                   /locus_tag="Tpen_0003"
FT   misc_feature    <2514..3005
FT                   /note="Eukaryotic protein of unknown function (DUF829);
FT                   Region: DUF829; pfam05705"
FT                   /db_xref="CDD:147710"
FT                   /locus_tag="Tpen_0003"
FT   misc_feature    2580..2594
FT                   /note="nucleophilic elbow; other site"
FT                   /db_xref="CDD:29806"
FT                   /locus_tag="Tpen_0003"
FT   misc_feature    2586..2588
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29806"
FT                   /locus_tag="Tpen_0003"
FT   gene            3025..4311
FT                   /db_xref="GeneID:4601889"
FT                   /locus_tag="Tpen_0004"
FT   CDS_pept        3025..4311
FT                   /locus_tag="Tpen_0004"
FT                   /gene_family="HOG000223150" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major facilitator transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pfu:PF0443 putative membrane transport protein"
FT                   /db_xref="GI:119718922"
FT                   /db_xref="InterPro:IPR007114"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="GeneID:4601889"
FT                   /translation="MPEGRPRVKVIVASLALFVLFYFMGYYMLNPILRTLHAEGLIPGK
FT                   SEVEWRFNAGLIATLLQGTGLVLSFVWGVLADKVGRRPVIFTLGVIMGLGLLLVSQARS
FT                   YAELLAYFIAFGVGYVGVGPAIYAFISDALPSESRGRGYASYYVSSVLAMILGLIVAGV
FT                   LLPWRTAYMLAGLLTLVFSVLLFYSSRGIFIGYSEKGAREARRYSLRESLPSLRKKSVL
FT                   LVLLMIIPWTIPWGMLSIWSIDYISTKWGVSTGTASLIIAAATASIALGHIVGGTLSDR
FT                   LAGKGDYTGRTKVSLLGVVVGYVSMMLMVTYPYPYGSTNFKDLLVPSALAVGGMMFTTF
FT                   AYPNINTVLSEVVVPEHRGTVFAVYSVLNNLGWTLGPTVYTLLLKAFSGVYADQVSAMT
FT                   AAASTIVSLWLIPALCWLLLHRVYPKEKI"
FT                   /protein_id="YP_919417.1"
FT   misc_feature    3058..>3606
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cd06174"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Tpen_0004"
FT   misc_feature    3067..4155
FT                   /note="Major Facilitator Superfamily; Region: MFS_1;
FT                   pfam07690"
FT                   /db_xref="CDD:148990"
FT                   /locus_tag="Tpen_0004"
FT   misc_feature    order(3100..3102,3109..3117,3121..3126,3196..3198,
FT                   3205..3210,3217..3219,3229..3234,3238..3243,3379..3384,
FT                   3391..3396,3403..3408,3415..3417,3451..3456,3463..3468,
FT                   3484..3486)
FT                   /note="putative substrate translocation pore; other site"
FT                   /db_xref="CDD:119392"
FT                   /locus_tag="Tpen_0004"
FT   gene            complement(4314..5123)
FT                   /db_xref="GeneID:4601654"
FT                   /locus_tag="Tpen_0005"
FT   CDS_pept        complement(4314..5123)
FT                   /locus_tag="Tpen_0005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mba:Mbar_A3550 cobalt transport ATP-binding protein"
FT                   /db_xref="GI:119718923"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4601654"
FT                   /translation="MIRFENVRFSYGEGLFEMRDLNVEIKRGEFVGVIGHSGAGKTTFA
FT                   KLAVGLLKPRSGRVLVDGKDTRTTPVSELARKVGYVYQNPDLMIFSPTILDEVGFALRN
FT                   MGYPESKVKDMVLRALESVDLSKPLDASPHMLSFGEKHRLAIASVLVTEPDVLILDEPT
FT                   TGLDYARCLQLFRVLEKLYKGGKTVVVITHDLDLLGMFSTRVLVFEKGRLIRDGATEEV
FT                   LLDTEFLEEKGFIPTQLQRLSKMLGLKAYSPSKIAEYIIELRKKKGI"
FT                   /protein_id="YP_919418.1"
FT   misc_feature    complement(4431..5123)
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4488..5117)
FT                   /note="Domain I of the ABC component of a cobalt transport
FT                   family found in bacteria, archaea, and eukaryota.  The
FT                   transition metal cobalt is an essential component of many
FT                   enzymes and must be transported into cells in appropriate
FT                   amounts when needed.  This...; Region:
FT                   ABC_cobalt_CbiO_domain1; cd03225"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4998..5021)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(order(4545..4547,4641..4646,4875..4877,
FT                   4995..5003,5007..5012))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4875..4886)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4689..4718)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4641..4658)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4623..4634)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   misc_feature    complement(4539..4559)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0005"
FT   gene            complement(5120..5941)
FT                   /db_xref="GeneID:4601508"
FT                   /locus_tag="Tpen_0006"
FT   CDS_pept        complement(5120..5941)
FT                   /locus_tag="Tpen_0006"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pab:PAB0249 ABC transporter, ATP-binding protein"
FT                   /db_xref="GI:119718924"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4601508"
FT                   /translation="MRNLNVKYLGSKDWTLRAVDFEANRGELVIIMGPSGCGKTTLFRV
FT                   LAGLIPSLLPGTVEGQAVVEGIDVVSSGYKGLAGVVGLVYQNPEMQVVTRSVLEELAMG
FT                   PENLGLPREEIRARIDWVVDMLNLHDFLGRDPQTLSGGEKQLVAIASVLTSKPKVLLLD
FT                   EPTSMLDHRGTRLVLDAIAELKKEGLTVIVAEHRVEWAAEVADRVVVMGRGTILLEGKP
FT                   EEVFSRVEDIQRYGVRPPGVAEVAYELRKRGVNVPIPVKMSDSWVLLGERG"
FT                   /protein_id="YP_919419.1"
FT   misc_feature    complement(5240..5941)
FT                   /note="ABC-type cobalt transport system, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: CbiO;
FT                   COG1122"
FT                   /db_xref="CDD:31319"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5297..5941)
FT                   /note="Domain I of the ABC component of a cobalt transport
FT                   family found in bacteria, archaea, and eukaryota.  The
FT                   transition metal cobalt is an essential component of many
FT                   enzymes and must be transported into cells in appropriate
FT                   amounts when needed.  This...; Region:
FT                   ABC_cobalt_CbiO_domain1; cd03225"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5822..5845)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(order(5354..5356,5450..5455,5684..5686,
FT                   5819..5827,5831..5836))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5684..5695)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5498..5527)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5450..5467)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5432..5443)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(5348..5368)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0006"
FT   misc_feature    complement(<5171..5269)
FT                   /note="Cobalt ATP-binding cassette C terminal; Region:
FT                   CoABC_C; pfam12370"
FT                   /db_xref="CDD:152805"
FT                   /locus_tag="Tpen_0006"
FT   gene            complement(5938..6714)
FT                   /db_xref="GeneID:4601489"
FT                   /locus_tag="Tpen_0007"
FT   CDS_pept        complement(5938..6714)
FT                   /locus_tag="Tpen_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalt transport protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cobalt transport protein; KEGG: pho:PH0131
FT                   cobalt transport system permease protein"
FT                   /db_xref="GI:119718925"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="GeneID:4601489"
FT                   /translation="MLSGLYVERKSFFHSLDPRVKLLWATLVLAASIATQFNGLKSFPV
FT                   FVSAIAALTLSGIGAGLAAVLIFNSLVFLLITTLVWAGMYSGHGSPVFVLGFLRITDVG
FT                   LLVASGKFFLIMSPVFAFITFFVTTKPYHVAWTLEKMGMPSKVSTAFVIAVSLLPTMVK
FT                   ATRDVIDIQKLRGLALDRGSVLDRLRNYIPIIVPVISRLLSDVWDLSLVLASRYVGYSK
FT                   RRTYLLEPRWSSRDTVFALLSLVFYGVIIAWGLQLL"
FT                   /protein_id="YP_919420.1"
FT   misc_feature    complement(6034..6690)
FT                   /note="Cobalt transport protein; Region: CbiQ; cl00463"
FT                   /db_xref="CDD:163835"
FT                   /locus_tag="Tpen_0007"
FT   gene            complement(6756..7313)
FT                   /db_xref="GeneID:4601128"
FT                   /locus_tag="Tpen_0008"
FT   CDS_pept        complement(6756..7313)
FT                   /locus_tag="Tpen_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rxy:Rxyl_0227 hypothetical protein"
FT                   /db_xref="GI:119718926"
FT                   /db_xref="GeneID:4601128"
FT                   /translation="MALVALSAAVYGGLLAATAPITIVPGFTWLRPGNALAPLFGMFFG
FT                   IPGCLGAAIGNLLADILSGYFGVGSFGGFIGNFLIAYIPFKFVRDHSFGSASSIGEFYI
FT                   WGVIVQAFVSAIYICWWLDVMQSVVGLPVFVIWAVIATSILINNITVNAVLSPILGVIL
FT                   FPLVKSRGLYWKDRVMPQKSTA"
FT                   /protein_id="YP_919421.1"
FT   gene            complement(7764..9167)
FT                   /db_xref="GeneID:4601061"
FT                   /locus_tag="Tpen_0009"
FT   CDS_pept        complement(7764..9167)
FT                   /locus_tag="Tpen_0009"
FT                   /gene_family="HOG000223151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transglutaminase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   tma:TM0007 hypothetical protein"
FT                   /db_xref="GI:119718927"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="GeneID:4601061"
FT                   /translation="MSGGSCYTNTLEYLKHPLPAEVSELLRRGELRKAEGELRRLAETS
FT                   PQPLAKRFEFELERIRRMGYEYPYTVEEAFRQLRKRVEDLTLEEFASLISRGCVDHAVI
FT                   EGEVRVHRRFEPNAFWLCGDLSSRRKSLGDERSDLNELTLKWRAERVLSAAREKGGGYV
FT                   LPLRYRVRARVSLKRSPRELGEPVRVWIPLPRVEGIHSEFRLLDYSVKPVHVAPPDHPQ
FT                   RTAYFELYGDTREVWVEYEFTSRGFHVEVDPREASVDPDSEVARRYLSERPPHIAFTGE
FT                   LREFVDRLTRGAASPYEKVQRIWGWITENVRYTYAKDYIFYDNIPEYVFREKRGDCGMQ
FT                   ALLFITMCRIAGVPARWESGWYMHPLSPGMHDWAQFYLEPYGWLYADPSFGNKRKGGEW
FT                   RNTFYLGSTEGYRLASNIEVYAEFDPPKRYIRSDPVDSQRGEVETPSRNLYYDEWDFAL
FT                   EIVSVEKLA"
FT                   /protein_id="YP_919422.1"
FT   misc_feature    complement(7974..8687)
FT                   /note="Transglutaminase-like enzymes, putative cysteine
FT                   proteases [Amino acid transport and metabolism]; Region:
FT                   COG1305"
FT                   /db_xref="CDD:31496"
FT                   /locus_tag="Tpen_0009"
FT   misc_feature    complement(8004..8321)
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="Tpen_0009"
FT   gene            9259..9918
FT                   /db_xref="GeneID:4601653"
FT                   /locus_tag="Tpen_0010"
FT   CDS_pept        9259..9918
FT                   /locus_tag="Tpen_0010"
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenylate kinases"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: tte:TTE2271 adenylate kinase and related
FT                   kinases; TIGRFAM: adenylate kinases; PFAM: adenylate
FT                   kinase; adenylate kinase, lid domain protein"
FT                   /db_xref="GI:119718928"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR011769"
FT                   /db_xref="GeneID:4601653"
FT                   /translation="MQTIRVSILGPPGAGKGTYASEVARFFGVPHVSTGELLRQEIRKG
FT                   SELGRRVATYVSRGLLVPDDVVNELVGSRLSQGDCAKGFVLDGYPRTLQQALFLEKHYP
FT                   LDKAVLLSVSLKVAVERLSGRLYCPNCGETYHVSWKPPRKPGVCDNCGSRLVRRRDDDP
FT                   EVVEARFREYWRLTLPVVDFYREKGKLLEFDANGDSRELAPRLVSILAGALAKTST"
FT                   /transl_table="11"
FT                   /protein_id="YP_919423.1"
FT   misc_feature    9271..9894
FT                   /note="adenylate kinase; Reviewed; Region: adk; PRK00279"
FT                   /db_xref="CDD:166885"
FT                   /locus_tag="Tpen_0010"
FT   misc_feature    9271..9864
FT                   /note="Adenylate kinase (ADK) catalyzes the reversible
FT                   phosphoryl transfer from adenosine triphosphates (ATP) to
FT                   adenosine monophosphates (AMP) and to yield adenosine
FT                   diphosphates (ADP). This enzyme is required for the
FT                   biosynthesis of ADP and is essential for...; Region: ADK;
FT                   cd01428"
FT                   /db_xref="CDD:30189"
FT                   /locus_tag="Tpen_0010"
FT   misc_feature    order(9358..9360,9373..9375,9442..9444,9517..9522,
FT                   9526..9531,9541..9543)
FT                   /note="AMP-binding site; other site"
FT                   /db_xref="CDD:30189"
FT                   /locus_tag="Tpen_0010"
FT   misc_feature    order(9373..9375,9517..9519,9529..9531,9631..9633,
FT                   9763..9765,9775..9777)
FT                   /note="ATP-AMP (Ap5A)-binding site; other site"
FT                   /db_xref="CDD:30189"
FT                   /locus_tag="Tpen_0010"
FT   gene            9958..10458
FT                   /db_xref="GeneID:4601462"
FT                   /locus_tag="Tpen_0011"
FT   CDS_pept        9958..10458
FT                   /locus_tag="Tpen_0011"
FT                   /gene_family="HOG000223152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sto:ST1739 hypothetical protein"
FT                   /db_xref="GI:119718929"
FT                   /db_xref="GeneID:4601462"
FT                   /translation="MVGERLGRFQVMALLQAARYYVLTGDLEKAYSFGLNRAIFYAWAK
FT                   RRGVPVAASREKIARGVEVEKDSSGRTLVYVGDEAAYLSEHGWFTMGGQDQTPELFERE
FT                   VKSRVEKVMPFEEAWRIAVEYVKSFDKRTLLSQADFYEKVYLPVRDSFPEIPPRKGRQT
FT                   TLF"
FT                   /protein_id="YP_919424.1"
FT   gene            complement(10593..11075)
FT                   /db_xref="GeneID:4601129"
FT                   /locus_tag="Tpen_0012"
FT   CDS_pept        complement(10593..11075)
FT                   /locus_tag="Tpen_0012"
FT                   /gene_family="HOG000223153" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pai:PAE1069 hypothetical protein"
FT                   /db_xref="GI:119718930"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="GeneID:4601129"
FT                   /translation="MSQQSSKKIVLPRDVSPDHVLGLLEVLHTMGGLTDSMYVGDAVHE
FT                   NIQVLPKAIDVAEALGLIKTHKGNLQLTELGKRVARSDPKSIKKLLRNAISNIEPLAEI
FT                   ASTLKEKKRMTVEEFDAIIGKYYPGNVEEARKNVLIWGAFLHLFVMDEEDEEILPI"
FT                   /protein_id="YP_919425.1"
FT   misc_feature    complement(10620..10967)
FT                   /note="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit; Region: ABC_transp; cl01965"
FT                   /db_xref="CDD:154682"
FT                   /locus_tag="Tpen_0012"
FT   gene            11154..12647
FT                   /db_xref="GeneID:4601059"
FT                   /locus_tag="Tpen_0013"
FT   CDS_pept        11154..12647
FT                   /locus_tag="Tpen_0013"
FT                   /gene_family="HOG000209113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mta:Moth_0405
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:119718931"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:4601059"
FT                   /translation="MLALLIAVSASLARMAEAYIVSLLIALVLGSLMARNKVVESIMLP
FT                   VLDILQSIPILGFFPAALAMFIANLPRALGVEAAAVFLIVTSLVWNMIFGVYASIKSLE
FT                   PSVFDMARVYSLGAVSRFFYIYVPASRAALLANSLISWAGGWFFLTAAEVITLGEEEYK
FT                   LTGIGAFIMESYNRGDYASFYIGVAALFATIMATYVLLWNPAVKSVRDLPLPSVSAFYE
FT                   KFSEVVSRVWSGLGEALVWVEARVKLPGFVPRVVGATLLVVALFYLGSGVAGLLSLDVV
FT                   GVAKSFLHELPLSLARVSIVLVFSLVLSLLIAYLTYSFRRAAMLIGASGELLASVPAII
FT                   WWPLLGYVALTFSWGPLVVLFTVLLQGSLWYLYFNILVFGLGSIRKEHEELAAVYGVKG
FT                   WHFFRSIFFPSVFPSLLTGALSSWGGAWNATIAAEYVTLGQRTIDLGGVGALLNRYTVE
FT                   GEAGKTALAALFLSLVIVAVDKAVWARLFSRLSGKFAGE"
FT                   /protein_id="YP_919426.1"
FT   misc_feature    11193..12614
FT                   /note="ABC-type anion transport system, duplicated permease
FT                   component [Inorganic ion transport and metabolism]; Region:
FT                   COG4986"
FT                   /db_xref="CDD:34591"
FT                   /locus_tag="Tpen_0013"
FT   misc_feature    <11193..11723
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Tpen_0013"
FT   misc_feature    12090..12581
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Tpen_0013"
FT   misc_feature    order(12099..12101,12129..12140,12144..12173,12180..12185,
FT                   12189..12191,12258..12263,12267..12269,12273..12275,
FT                   12282..12287,12297..12302,12309..12311,12360..12362,
FT                   12402..12407,12414..12416,12435..12446,12453..12458,
FT                   12501..12506,12534..12539,12546..12551,12555..12560,
FT                   12567..12572,12579..12581)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Tpen_0013"
FT   misc_feature    order(12147..12191,12435..12452)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Tpen_0013"
FT   misc_feature    order(12189..12191,12243..12245,12453..12455,12495..12497,
FT                   12504..12506,12534..12536)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Tpen_0013"
FT   misc_feature    order(12312..12350,12366..12371,12381..12383)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Tpen_0013"
FT   gene            12649..13386
FT                   /db_xref="GeneID:4601060"
FT                   /locus_tag="Tpen_0014"
FT   CDS_pept        12649..13386
FT                   /locus_tag="Tpen_0014"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE1066 taurine(sulfate) transport ATP-binding
FT                   protein, putative"
FT                   /db_xref="GI:119718932"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4601060"
FT                   /translation="MQTILSIRNIVKTFKEGGKTLPVLDHISFDVGEEFVAILGPSGCG
FT                   KTTLLRIIAGLEKADSGEIVFARGDSRIGFIFQSPTLLPWLTVLENVALPLRANGVPRR
FT                   EAEEKARKYISLVGLQAFENFYPHELSGGMKQRVNIARALAVEPVLLLMDEPFSQLDPL
FT                   TAESLRSEILDMWMWGVTTVRAIIMVTHNVDEAVFMADRIIVLTTRPAKIAGIVHVDLP
FT                   RPRDRRSPEFQKVEDQVYEYISA"
FT                   /protein_id="YP_919427.1"
FT   misc_feature    12655..13377
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    12661..13311
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars...; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    12766..12789
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    order(12775..12780,12784..12792,12880..12882,13108..13113,
FT                   13219..13221)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    12871..12882
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    13036..13065
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    13096..13113
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    13120..13131
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   misc_feature    13207..13227
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Tpen_0014"
FT   gene            complement(13738..14094)
FT                   /db_xref="GeneID:4601715"
FT                   /locus_tag="Tpen_0015"
FT   CDS_pept        complement(13738..14094)
FT                   /locus_tag="Tpen_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718933"
FT                   /db_xref="GeneID:4601715"
FT                   /translation="MKVLDARLYGERWTVAYRENDKWQVGIYIPENASLREVTVLEKHD
FT                   RPELFVLLEGEITLVVSEDGSELREVKMEPGKLYVVDEWHNAYRPGGRRGVALVVEAPG
FT                   VETEYMEVSPRCNE"
FT                   /protein_id="YP_919428.1"
FT   misc_feature    complement(13795..13986)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Tpen_0015"
FT   gene            complement(14127..14903)
FT                   /db_xref="GeneID:4601713"
FT                   /locus_tag="Tpen_0016"
FT   CDS_pept        complement(14127..14903)
FT                   /locus_tag="Tpen_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718934"
FT                   /db_xref="GeneID:4601713"
FT                   /translation="MKVAVVALPEAREPEAALQWLKGYLGAIGVEPSLVRANVSLEEVA
FT                   AVIAEQDAVIVVGAAGNRKAVEVIGNALGLKLEVNKEALELVTGYYMDRVDIPGNVEEL
FT                   AITPEFSYVIPNERGPVPAFVAFSLTDDRFVAATPPGFEETIETFEAGIQDFFREKTGK
FT                   KYSVTFSMDVECGVEEAESIVSEVNSGVKGVFARLDARFYTGKGLPLTFTAYSETPEGL
FT                   SDAMERVEELVKKLAAEKGLRLVEKEKAGGVKEEDL"
FT                   /protein_id="YP_919429.1"
FT   misc_feature    complement(14181..14849)
FT                   /note="Predicted nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA [General function
FT                   prediction only]; Region: CinA; COG1058"
FT                   /db_xref="CDD:31258"
FT                   /locus_tag="Tpen_0016"
FT   misc_feature    complement(14424..14849)
FT                   /note="MoCF_BD: molybdenum cofactor (MoCF) binding domain
FT                   (BD). This domain is found a variety of proteins involved
FT                   in biosynthesis of molybdopterin cofactor, like MoaB, MogA,
FT                   and MoeA. The domain is presumed to bind molybdopterin;
FT                   Region: MoCF_BD; cl00451"
FT                   /db_xref="CDD:174210"
FT                   /locus_tag="Tpen_0016"
FT   misc_feature    complement(order(14463..14465,14472..14474,14481..14486,
FT                   14721..14729))
FT                   /note="MPT binding site; other site"
FT                   /db_xref="CDD:58165"
FT                   /locus_tag="Tpen_0016"
FT   gene            complement(14900..15331)
FT                   /db_xref="GeneID:4600797"
FT                   /locus_tag="Tpen_0017"
FT   CDS_pept        complement(14900..15331)
FT                   /locus_tag="Tpen_0017"
FT                   /gene_family="HOG000015361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside 2-deoxyribosyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: nucleoside 2-deoxyribosyltransferase; KEGG:
FT                   mac:MA0537 C-Myc-responsive protein"
FT                   /db_xref="GI:119718935"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="GeneID:4600797"
FT                   /translation="MKVYLAAPMRGDRSALANVKKLLQALEERGYVVLTKHVADDVLDV
FT                   EKGMTPREVFERDIRLLEEADVLVAEVSYPSLGVGFEIAYFLLRGKPVIALALRERLES
FT                   VSAMIRGITWENFRLVAYSDVDEAIEKLDSMLPGSVDMQ"
FT                   /protein_id="YP_919430.1"
FT   misc_feature    complement(15029..15325)
FT                   /note="Nucleoside 2-deoxyribosyltransferase; Region:
FT                   Nuc_deoxyrib_tr; cl01450"
FT                   /db_xref="CDD:154407"
FT                   /locus_tag="Tpen_0017"
FT   gene            complement(15375..15887)
FT                   /db_xref="GeneID:4600678"
FT                   /locus_tag="Tpen_0018"
FT   CDS_pept        complement(15375..15887)
FT                   /locus_tag="Tpen_0018"
FT                   /gene_family="HOG000115326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AsnC family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pab:PAB1236 transcriptional regulator"
FT                   /db_xref="GI:119718936"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="GeneID:4600678"
FT                   /translation="MIIDEKDAAILELLQENARLVIKEISKRIGSPITTTHARLKRLER
FT                   EGVIKAYRAILDPKKLGYDTLAYVFISFSRDRGLDQRKVAQEIAKIPEVQEVHIITGEW
FT                   DILAKVRVGSVDELGDLVVNRLRNIEGVEKTYTSVVLEVVKETTKLPIRIDKANLARLP
FT                   ARNPGTT"
FT                   /protein_id="YP_919431.1"
FT   misc_feature    complement(15432..15887)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   Lrp; COG1522"
FT                   /db_xref="CDD:31711"
FT                   /locus_tag="Tpen_0018"
FT   misc_feature    complement(15552..15881)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Tpen_0018"
FT   gene            complement(15929..16618)
FT                   /db_xref="GeneID:4600522"
FT                   /locus_tag="Tpen_0019"
FT   CDS_pept        complement(15929..16618)
FT                   /locus_tag="Tpen_0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718937"
FT                   /db_xref="GeneID:4600522"
FT                   /translation="MGDGERRPSKFVSSRRIRAFFTREGDVLYLDLDGETYSGVGDFVP
FT                   IPVGKLRGLRLEEIPEGVSIEPVEYMEKNIFYILRMGSLFTYEVKVNRGGVEVSVDEWF
FT                   SEWRSYIGIEAYQEALLSVLKELMDSGFVSYVDLESGEEMLYVSFVVPLPGSLTVFKAL
FT                   KVVRRLVRELELEVTRRASILALREAKRKLRRIAERGLEESFLERVSRIFYSGVGGGEE
FT                   GISKKSK"
FT                   /protein_id="YP_919432.1"
FT   gene            16728..16955
FT                   /db_xref="GeneID:4600506"
FT                   /locus_tag="Tpen_0020"
FT   CDS_pept        16728..16955
FT                   /locus_tag="Tpen_0020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pai:PAE3109 hypothetical protein"
FT                   /db_xref="GI:119718938"
FT                   /db_xref="GeneID:4600506"
FT                   /translation="MLLGVAGMLLIIAAWIASFKDVPSPRLSSLYAAGSFLLAVHSVLI
FT                   GDPVFLVLNSLATALALLNLYRWYRGRAKP"
FT                   /protein_id="YP_919433.1"
FT   gene            16955..17656
FT                   /db_xref="GeneID:4600487"
FT                   /locus_tag="Tpen_0021"
FT   CDS_pept        16955..17656
FT                   /locus_tag="Tpen_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HAD family hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mka:MK0970 predicted hydrolase of the HAD
FT                   superfamily"
FT                   /db_xref="GI:119718939"
FT                   /db_xref="InterPro:IPR005833"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="GeneID:4600487"
FT                   /translation="MTRAVFFDMGGVLVFDRGFAHHLARNVSLALREAGLEYSEEEVLR
FT                   AWKESSVHGDELETWDLVRSMVLLRKLGVTPKPLLAEKVYKAVLESYVQGFSLDEEAEH
FT                   ALSLSRSLGFTVGLITNVGSYEIVRRRLEEAGLLKYVDVIVASQAVAWKKPSPRIFELA
FT                   CYLAGVEPGNAVHVGDDPRIDVEGAKKAGLRAVQVLKAGPPRSPYADAWVNSVGEVPGI
FT                   LEDWVSKGLFR"
FT                   /protein_id="YP_919434.1"
FT   misc_feature    16955..17626
FT                   /note="Predicted hydrolase (HAD superfamily) [General
FT                   function prediction only]; Region: COG1011"
FT                   /db_xref="CDD:31215"
FT                   /locus_tag="Tpen_0021"
FT   misc_feature    17252..17548
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Tpen_0021"
FT   misc_feature    17312..17314
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="Tpen_0021"
FT   gene            complement(17592..18203)
FT                   /db_xref="GeneID:4600384"
FT                   /locus_tag="Tpen_0022"
FT   CDS_pept        complement(17592..18203)
FT                   /locus_tag="Tpen_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pab:PAB1504 hypothetical protein"
FT                   /db_xref="GI:119718940"
FT                   /db_xref="GeneID:4600384"
FT                   /translation="MSTGSSKTYLSFLLFLYVSGGYVSRKTLSSELGLGEGVVRSHLRF
FT                   LNERGLVRSVRAGNALTDSGRNGVRGLLEAMSAKRLGLAPAWELNAREAVYVLLHGYPP
FT                   AENVVKLRDEAVREGADGAVIAVFDGGKFRLPPGGEDLCSYAPRLCGEVLGEAEEEDCL
FT                   LVVFGERLGAAVKGLVGILLSEKAPWRPSLLESLELLLRS"
FT                   /protein_id="YP_919435.1"
FT   misc_feature    complement(<18009..18167)
FT                   /note="Repressor of nif and glnA expression
FT                   [Transcription]; Region: COG1693"
FT                   /db_xref="CDD:31879"
FT                   /locus_tag="Tpen_0022"
FT   gene            complement(18184..18681)
FT                   /db_xref="GeneID:4600999"
FT                   /locus_tag="Tpen_0023"
FT   CDS_pept        complement(18184..18681)
FT                   /locus_tag="Tpen_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718941"
FT                   /db_xref="GeneID:4600999"
FT                   /translation="MDKNPICVSGEKSPGRKIAGLLVLALLAWAIIASGFAAYLYLENE
FT                   RLSASLRSYASRTVLVNIGIDYGNGTIVWFNSTPLPSGSSALTALVAVAKVEYKTSQMG
FT                   AYVTSVNGVSEKFLSKNEGYSWLWYRYDPGKSQLVMGQVAADKYILANGDVIVWRYEHW
FT                   KF"
FT                   /protein_id="YP_919436.1"
FT   gene            complement(18674..19213)
FT                   /db_xref="GeneID:4601317"
FT                   /locus_tag="Tpen_0024"
FT   CDS_pept        complement(18674..19213)
FT                   /locus_tag="Tpen_0024"
FT                   /gene_family="HOG000223155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718942"
FT                   /db_xref="GeneID:4601317"
FT                   /translation="MDARRIAAVAVFTSTAVVFRVAKNLVTTVQFVNIPLAMAFVSSAI
FT                   LGYKEGFLVGFLSYVLSDMLIGPGFWTLVNPFLAGAFSAVFGFSYRRGLEKTYLFVSAF
FT                   LSCFLFDVTTSVLFYMIFGLKPLDALVFGLLGLFVPVVGGFLVGVGPLTEFSTSALAVA
FT                   LLEALERRLGKNINIG"
FT                   /protein_id="YP_919437.1"
FT   misc_feature    complement(<18848..19132)
FT                   /note="Protein of unknown function (DUF1393); Region:
FT                   DUF1393; cl01942"
FT                   /db_xref="CDD:174693"
FT                   /locus_tag="Tpen_0024"
FT   gene            complement(19238..19495)
FT                   /db_xref="GeneID:4601062"
FT                   /locus_tag="Tpen_0025"
FT   CDS_pept        complement(19238..19495)
FT                   /locus_tag="Tpen_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718943"
FT                   /db_xref="GeneID:4601062"
FT                   /translation="MLEKLLLGWLLAVFFSFIILAVLVTLAAAERVTGVTPWSSLSVFR
FT                   AYAETAVLPLVLAFLAVVVIYVLTRYAGKALDFLVQRINL"
FT                   /protein_id="YP_919438.1"
FT   gene            complement(19513..20814)
FT                   /db_xref="GeneID:4601063"
FT                   /locus_tag="Tpen_0026"
FT   CDS_pept        complement(19513..20814)
FT                   /locus_tag="Tpen_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pai:PAE3285 hypothetical protein"
FT                   /db_xref="GI:119718944"
FT                   /db_xref="GeneID:4601063"
FT                   /translation="MDKKVVYALLAVAVAVAAGLSLLLLKQAAPPGSVQQPQPSCQPTS
FT                   LVYVYLDEAQKNLGDTITSNFKVVLQQYGINIVNVPVCYLPASSLPEKLRVYPALLLKG
FT                   NISALEQLVVGEVGGYKVLNPGVSAYMASSAGASPVFTYQSEAIIVNSTAPFTGIRAGE
FT                   DDMRRILSQLSLSNVSRITYVTPSSVSFTLTRLPAIVFKSDYNLSKGYAFIKPLGNGYY
FT                   TFREDVSGRVLEYFGVQVYEIRTPPPSYLAREGVPVGSSSLTLYILEDYHCPFCAKLMA
FT                   SLGDTFTRLAKSGSLKVVLVDLIVHPEVAEMHALAKCVYNKTGDGYLYFNLSRKLYDKL
FT                   NQGVSTTLEDLSSIASTYTGKALIDECLKQVNAGAEHVRSLSQKLISDGYTGTPTLIFW
FT                   NPEKGKGLVVPGCLDINACMTQGQLDEVLSWLKS"
FT                   /protein_id="YP_919439.1"
FT   misc_feature    complement(19573..20034)
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="Tpen_0026"
FT   gene            21018..22220
FT                   /db_xref="GeneID:4602077"
FT                   /locus_tag="Tpen_0027"
FT   CDS_pept        21018..22220
FT                   /locus_tag="Tpen_0027"
FT                   /gene_family="HOG000223042" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alanine aminotransferase"
FT                   /transl_table="11"
FT                   /note="catalyzes the transamination of pyruvate or with
FT                   glutamate; activity is seen with alanine, glutamate, and
FT                   aspartate with either 2-oxoglutarate or pyruvate as the
FT                   amino acceptor"
FT                   /db_xref="GI:119718945"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:4602077"
FT                   /translation="MSKTRLSERIGRLDYPIRKYNALARSLEEKGEKVIYLNIGDPLKY
FT                   DFTPPSELVEEACRALREGHHYYSPSEGLKELREAIAFKEKSWNGVQVDPKNVLVTNGV
FT                   SEGINALYAALVNEGDEVLIPDPSYPLYINFADFYNAKKVFYRTLEEEGWRPDPDDIRR
FT                   KITDKTRFIVINNPHNPTGAVYPEKTVKEILDIAAEHGLPVVSDEIYDALVFEGSFKST
FT                   AAVASEDNVVIGMNGFSKTFLVTGWRLGYIYLRGPEEKIADLRAALLGFLMTRLSAVTP
FT                   LQVALARFAVKAPKHLEDLKRRLDERRRYTVRRLNEIPGVSLATSPAGAFYAFPRIDVD
FT                   MDDEEFTKRLLLEEKVFVVYGSGFGPLGARHVRLVFLPPVQQLEEAFVRMERFMRRVAG
FT                   S"
FT                   /protein_id="YP_919440.1"
FT   misc_feature    21063..22205
FT                   /note="tyrosine aminotransferase, eukaryotic; Region:
FT                   tyr_amTase_E; TIGR01264"
FT                   /db_xref="CDD:130331"
FT                   /locus_tag="Tpen_0027"
FT   misc_feature    21120..22193
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0027"
FT   misc_feature    order(21324..21332,21402..21404,21552..21554,21645..21647,
FT                   21726..21728,21732..21737,21759..21761)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0027"
FT   misc_feature    order(21333..21335,21432..21434,21624..21626,21753..21761,
FT                   21861..21863,21870..21872)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0027"
FT   misc_feature    21735..21737
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0027"
FT   gene            complement(22217..22636)
FT                   /db_xref="GeneID:4601384"
FT                   /locus_tag="Tpen_0028"
FT   CDS_pept        complement(22217..22636)
FT                   /locus_tag="Tpen_0028"
FT                   /gene_family="HOG000223156" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PilT domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein, PINc; KEGG: pai:PAE2829 hypothetical
FT                   protein"
FT                   /db_xref="GI:119718946"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="GeneID:4601384"
FT                   /translation="MGDVTRIVVDTDILLHDTFEDSEKHAEASELLDEADRIYLASIVV
FT                   HEYLWLLLTKFKIDIDSVREKLEEYFSDARFIYISENSEVFMGALDLMKEDKADPSMIN
FT                   DYIILVLAQRMGATLATYDEELREIAKKLGVPVAP"
FT                   /protein_id="YP_919441.1"
FT   misc_feature    complement(22223..22621)
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:175014"
FT                   /locus_tag="Tpen_0028"
FT   gene            complement(22624..22920)
FT                   /db_xref="GeneID:4600505"
FT                   /locus_tag="Tpen_0029"
FT   CDS_pept        complement(22624..22920)
FT                   /locus_tag="Tpen_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718947"
FT                   /db_xref="GeneID:4600505"
FT                   /translation="MWVNNIFAFRGELYVAGKKRFIARVDEEGNVKLPLAVLKDMGVTL
FT                   PAYVSITREGSALLLRFRTKRSPLRLGRQIRTEEMEKLIKEALDELVIARWET"
FT                   /protein_id="YP_919442.1"
FT   gene            22971..23333
FT                   /db_xref="GeneID:4601339"
FT                   /locus_tag="Tpen_0030"
FT   CDS_pept        22971..23333
FT                   /locus_tag="Tpen_0030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718948"
FT                   /db_xref="GeneID:4601339"
FT                   /translation="MRDGVRFSLLEDFKQLPAALQRQPRGERWDLLVVDEFMTAEIVST
FT                   GDALLLAMYAEVEAPAGPIPQPTDPDITLVPEGGTLKLKAFTRYPMQGTLIYHSIIKKI
FT                   NEFRRTLAALLAVSSK"
FT                   /protein_id="YP_919443.1"
FT   gene            23511..24437
FT                   /db_xref="GeneID:4601777"
FT                   /locus_tag="Tpen_0031"
FT   CDS_pept        23511..24437
FT                   /locus_tag="Tpen_0031"
FT                   /gene_family="HOG000167994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility C-terminal
FT                   domain; KEGG: mth:MTH380 UDP-glucose 4-epimerase"
FT                   /db_xref="GI:119718949"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="GeneID:4601777"
FT                   /translation="MNVGITGGAGFIGFNTARYLASRGFQVVVLDDFSRATVGREDLEK
FT                   VGAEVYEGDVRDAEALRRFLSGVDAVIHLAALVDVRESEERPEEYWSVNVEGTRALLAE
FT                   ASRAGVRKVVFASSAAVYGDLGGLTAGEEVDARPKSFYGLTKRVGEELCRFFSGRGVVC
FT                   VALRIFNVYGEYSRRGVIYEFARRVLSGLPVKVYGDGNQTRDFVYVGDVARAFEAVIAE
FT                   WSGGFEVFNVASGRCVSVNELVRLFEQVTGKRVGVLREPARPEEIRRSCASTEKAARML
FT                   GFRASTSLEEGVRRVVEWVARYAEDKV"
FT                   /protein_id="YP_919444.1"
FT   misc_feature    23511..24416
FT                   /note="UDP-glucose 4-epimerase [Cell envelope biogenesis,
FT                   outer membrane]; Region: GalE; COG1087"
FT                   /db_xref="CDD:31284"
FT                   /locus_tag="Tpen_0031"
FT   misc_feature    23529..24431
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Tpen_0031"
FT   gene            24418..24918
FT                   /db_xref="GeneID:4601541"
FT                   /locus_tag="Tpen_0032"
FT   CDS_pept        24418..24918
FT                   /locus_tag="Tpen_0032"
FT                   /gene_family="HOG000223024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metallopeptidase-like"
FT                   /transl_table="11"
FT                   /note="KEGG: sai:Saci_1740 conserved crenarchaeal protein"
FT                   /db_xref="GI:119718950"
FT                   /db_xref="InterPro:IPR006025"
FT                   /db_xref="GeneID:4601541"
FT                   /translation="MPRIRYERARDVEELVEDIVACLGLDWIDVRRLHFVRSHGSRSKA
FT                   YARIYGVPRIFQVALGLKPLYIIEVVSENFDKLGDAEKIKVLIHELMHIPRSFSGGLRP
FT                   HGKYTSRQNVEKLFKEYLARKRSKNIYGTLGNRIETHGKAPRPAGKSRKAGVVKRGKTR
FT                   RGR"
FT                   /protein_id="YP_919445.1"
FT   misc_feature    24427..24783
FT                   /note="Predicted metallopeptidase [General function
FT                   prediction only]; Region: COG4900"
FT                   /db_xref="CDD:34509"
FT                   /locus_tag="Tpen_0032"
FT   gene            24935..25309
FT                   /db_xref="GeneID:4601674"
FT                   /locus_tag="Tpen_0033"
FT   CDS_pept        24935..25309
FT                   /locus_tag="Tpen_0033"
FT                   /gene_family="HOG000223157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718951"
FT                   /db_xref="GeneID:4601674"
FT                   /translation="MIKSILGSIANDSRKHAEIYSGILRILREVGPAITEEDFSRLEGI
FT                   VKTHIRMEEEMIETLNRFFKEVDDKRVEYLFRYILDDEVKHHRLLLNILELIVKREVVT
FT                   EKDIWDFIWREVPFHGTPGG"
FT                   /protein_id="YP_919446.1"
FT   misc_feature    <24938..25216
FT                   /note="Ferritin-like superfamily of diiron-containing
FT                   four-helix-bundle proteins; Region: Ferritin_like; cl00264"
FT                   /db_xref="CDD:176577"
FT                   /locus_tag="Tpen_0033"
FT   misc_feature    order(24971..24973,24980..24982,25091..25093,25181..25183,
FT                   25190..25192)
FT                   /note="dinuclear metal binding motif; other site"
FT                   /db_xref="CDD:153097"
FT                   /locus_tag="Tpen_0033"
FT   gene            complement(25306..25722)
FT                   /db_xref="GeneID:4601675"
FT                   /locus_tag="Tpen_0034"
FT   CDS_pept        complement(25306..25722)
FT                   /locus_tag="Tpen_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718952"
FT                   /db_xref="GeneID:4601675"
FT                   /translation="METGKNVEEVVLRVSEELERFGLKNIVSEDSRTLIVLLDVAEGKE
FT                   VPVLTTFSEESFSIVVPVNASVSELEERLSGLGGKVHTMDLGENLAGIVVEAEGLPGAE
FT                   ELAGKLREVGRLLESLLSSEKVGVCCSGEVLVEA"
FT                   /protein_id="YP_919447.1"
FT   gene            complement(25762..26838)
FT                   /db_xref="GeneID:4601383"
FT                   /locus_tag="Tpen_0035"
FT   CDS_pept        complement(25762..26838)
FT                   /locus_tag="Tpen_0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718953"
FT                   /db_xref="GeneID:4601383"
FT                   /translation="MPVVALLEGWYASIARSGEAFRLTPNEWKVLVSVVNSTTVSRVSE
FT                   QAKLPYSTVIDVMRRLSGNGLGIHFIPYFDLAGLRKVFALIEGAPISGYPLYTTNVYRL
FT                   IGRGFFTGVLGLVPDYLVNEFFASLPREPVATVVGDEYRHWAPTGRLTRYVAAHGIVVP
FT                   AYDQLEDVLYASRGPVTRREKKWVDWVDVLIVYFKMKYAFTKLSDVYSLAKSVFGTAPP
FT                   SRQLMSYHYRTHVSPLWSYNGVSFRIDRHLAPERVYVLRGNASKVAARTLIEAPFFFEA
FT                   LVNEESSVLLAQTPCYMSPLVYRVLAETRVDLPYGELLVAESWSFEWLTSDAVKHYRDH
FT                   NEWLHPSVSVRMLPPDAK"
FT                   /protein_id="YP_919448.1"
FT   gene            26954..27238
FT                   /db_xref="GeneID:4601382"
FT                   /locus_tag="Tpen_0036"
FT   CDS_pept        26954..27238
FT                   /locus_tag="Tpen_0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718954"
FT                   /db_xref="GeneID:4601382"
FT                   /translation="MAEGGKTCEKSYYYYRRVAEAVLREADIAELKDLALELVIAEVKA
FT                   KIVMCGGGEEERRDAESLLEDIEKAKKLLYKAYVLMSTKGRSRKVVRWI"
FT                   /protein_id="YP_919449.1"
FT   gene            27229..27654
FT                   /db_xref="GeneID:4601273"
FT                   /locus_tag="Tpen_0037"
FT   CDS_pept        27229..27654
FT                   /locus_tag="Tpen_0037"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718955"
FT                   /db_xref="GeneID:4601273"
FT                   /translation="MDLTGNIHRLLLEASRSLKSGVIDPQEFHKLGMVLLSTALLTEDN
FT                   YFFVLSNTMYTLADALSSFLKVSSMPLSMEYRGKTEALIEEVKSELSHALQEIGEAISS
FT                   GDKCRALLASSSMLRVSYRVNMLAETLKNVVVVGNQE"
FT                   /protein_id="YP_919450.1"
FT   gene            27657..28199
FT                   /db_xref="GeneID:4601274"
FT                   /locus_tag="Tpen_0038"
FT   CDS_pept        27657..28199
FT                   /locus_tag="Tpen_0038"
FT                   /gene_family="HOG000227050" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative adenylyl cyclase CyaB"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: putative adenylyl cyclase CyaB; PFAM:
FT                   adenylate cyclase; KEGG: pai:PAE0832 adenylate cyclase"
FT                   /db_xref="GI:119718956"
FT                   /db_xref="InterPro:IPR008172"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="GeneID:4601274"
FT                   /translation="MPREVEVKFRVEGHDVLRRKLREAGAAYVDTVDQVDIYFQHPCRD
FT                   FASTDEALRLRVNYSGSGSYAELTYKGPKEGGWAKNREEIVARVEAAEALRKILERLGF
FT                   SEVATLRKHREFYVLDGTEVSLDYVEGLGFFVEIEDKGGGVEALREVVSRLGLTGEPLP
FT                   KTYLELYLEEKATRQRT"
FT                   /protein_id="YP_919451.1"
FT   misc_feature    27666..28163
FT                   /note="Adenylyl cyclase (AC) class IV-like, a subgroup of
FT                   the CYTH-like superfamily; Region: CYTH-like_AC_IV-like;
FT                   cd07890"
FT                   /db_xref="CDD:143628"
FT                   /locus_tag="Tpen_0038"
FT   misc_feature    order(27666..27668,27672..27674,27678..27680,27759..27761,
FT                   27765..27773,27816..27818,27822..27824,27834..27836,
FT                   27867..27869,27906..27908,27990..27992,27996..27998,
FT                   28035..28037,28065..28067,28071..28073,28152..28154)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:143628"
FT                   /locus_tag="Tpen_0038"
FT   misc_feature    order(27666..27668,27672..27674,28065..28067,28071..28073)
FT                   /note="putative metal binding residues; other site"
FT                   /db_xref="CDD:143628"
FT                   /locus_tag="Tpen_0038"
FT   misc_feature    order(27666..27668,27672..27674,27678..27680)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:143628"
FT                   /locus_tag="Tpen_0038"
FT   misc_feature    order(27672..27674,27678..27680,27768..27770,27816..27818,
FT                   27834..27836,27867..27869,27906..27908,27996..27998,
FT                   28065..28067)
FT                   /note="putative triphosphate binding site; other site"
FT                   /db_xref="CDD:143628"
FT                   /locus_tag="Tpen_0038"
FT   misc_feature    order(27807..27809,27813..27815,27858..27860,27864..27866,
FT                   27870..27875,27903..27905,27909..27923,27927..27929,
FT                   27936..27941,27945..27953,27957..27962)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:143628"
FT                   /locus_tag="Tpen_0038"
FT   gene            complement(28180..28614)
FT                   /db_xref="GeneID:4602229"
FT                   /locus_tag="Tpen_0039"
FT   CDS_pept        complement(28180..28614)
FT                   /locus_tag="Tpen_0039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718957"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="GeneID:4602229"
FT                   /translation="MSSHVTMRGLLVRGVTALAIVLALMYLFSTSLYIPVPVYKGVSVG
FT                   NIVVAVLSIVFLIKAESLATPLASEVALHLKLQPGRVGGVAKWALRLLSLLVLYGGFFG
FT                   VAVPVFDVFLEHHVSRVVYDSVFVVAAAVTVYELVKSAVS"
FT                   /protein_id="YP_919452.1"
FT   gene            28685..29707
FT                   /db_xref="GeneID:4601187"
FT                   /locus_tag="Tpen_0040"
FT   CDS_pept        28685..29707
FT                   /locus_tag="Tpen_0040"
FT                   /gene_family="HOG000072911" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-inhibited division protein A"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; FAD
FT                   dependent oxidoreductase; KEGG: pai:PAE1725 thioredoxin
FT                   reductase"
FT                   /db_xref="GI:119718958"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:4601187"
FT                   /translation="MAGTHMKKYDVVIVGAGIAGLTAALYAARQKLSTLVVSADLGGQL
FT                   LLTTEIQNFPGFMSIGGLELIRRVEEQAKTYGAEIVFDEVVGVEEREGVFVVKTASGAE
FT                   YASDALILAFGKSPREMGVPGEREFKGRGVSYCVICDAPLYRGRRVALVGWGAHNYENI
FT                   ILLRDYASKVYWVFPGEKPIEEDELLREALSKGNVELVPFSEPAEVKGDKRVQALVVRD
FT                   KRTSELRTLEVDGVFVEIGYVTKTGFLRGFVELNEKGEIVVDKACRTSRPGVFAAGDVT
FT                   EMPHKQAVIAAAMGACAALSAYAYVMEKRGRKVVSTADWRHVEIPGKKKEGGGLAIKLR
FT                   "
FT                   /protein_id="YP_919453.1"
FT   misc_feature    28703..>28801
FT                   /note="Anaerobic glycerol-3-phosphate dehydrogenase [Amino
FT                   acid transport and metabolism]; Region: GlpB; cl10040"
FT                   /db_xref="CDD:175070"
FT                   /locus_tag="Tpen_0040"
FT   misc_feature    28709..29545
FT                   /note="thioredoxin-disulfide reductase; Region: TRX_reduct;
FT                   TIGR01292"
FT                   /db_xref="CDD:162288"
FT                   /locus_tag="Tpen_0040"
FT   gene            complement(29704..30792)
FT                   /db_xref="GeneID:4600982"
FT                   /locus_tag="Tpen_0041"
FT   CDS_pept        complement(29704..30792)
FT                   /locus_tag="Tpen_0041"
FT                   /gene_family="HOG000227597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="radical SAM domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: ape:APE1865 pyruvate
FT                   formate-lyase activating enzyme"
FT                   /db_xref="GI:119718959"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:4600982"
FT                   /translation="MSDKLLGKPFVREAAFWEPVQGKPGYVKCNLCNRRCVIAPGRFGV
FT                   CGVRKNIDGKLYTLVYGLLTAANLDPIEKKPLSHFYPGSAVFSVSTPGCNFFCQFCQNW
FT                   EISQSRLERGLYGHYYPPEDVVREAKRLQADGISYTYNEPTIFYEFMLDTARLAKKEGL
FT                   FNTMVTNGYISPEALDELAPYLDAATVDFKGGGDPEFYRKFMGVPDPSPIYDTLLRMKE
FT                   KGIHVEITNLVVPIVGDDEEKLRSLARWVAENLGDETPFHLLRFYPHYKMIDYPPTEVG
FT                   DLEKLAGVAREEGLKYVYIGNVWGHPLENTYCPKCGHRVIERRGFFIVKWDLTEDNRCP
FT                   VCGAKINIKGSYRKRSWDVFFY"
FT                   /protein_id="YP_919454.1"
FT   misc_feature    complement(29854..30648)
FT                   /note="Pyruvate-formate lyase-activating enzyme
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: PflA; COG1180"
FT                   /db_xref="CDD:31373"
FT                   /locus_tag="Tpen_0041"
FT   misc_feature    complement(29932..30522)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Tpen_0041"
FT   misc_feature    complement(order(29995..30000,30097..30099,30226..30228,
FT                   30283..30291,30364..30369,30373..30375,30487..30495,
FT                   30499..30501,30505..30507,30511..30513))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Tpen_0041"
FT   gene            complement(30844..31857)
FT                   /db_xref="GeneID:4600983"
FT                   /locus_tag="Tpen_0042"
FT   CDS_pept        complement(30844..31857)
FT                   /locus_tag="Tpen_0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dual specificity protein phosphatase"
FT                   /transl_table="11"
FT                   /note="PFAM: Dual specificity protein phosphatase;
FT                   metal-dependent phosphohydrolase, HD sub domain; KEGG:
FT                   tko:TK0241 protein-tyrosine phosphatase"
FT                   /db_xref="GI:119718960"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:4600983"
FT                   /translation="MARFRDLGGGLYWSSCPDDDLLETLAKRGLGLVVDLTEEECQYSV
FT                   PSGVDRVNYPIPDFSFRAFEGVLVKAVLPSLRYLESGRGVLVHCYGGIGRSGSTVAMIL
FT                   ALRDGSSFEGVLRRLRRLGYENETLSQALAVRWFYRVKGLLDVGFLERLLLELEDEGYW
FT                   KFLDHASSVAGVALDVLESLSGIYGFDRRDYVNAYLAGLLHDVGRVLGPEERHHEVGAE
FT                   WVKRNPLLRGVCDVDIVSFAVYHHRRKTRLTEDPRIERLGVKAGVIAAAVRLGDAFKNA
FT                   YAGEGTYVGTELRGSRLVIVINGHLNKGVDKRRIEEKAKALEELDRSIAVEVEEEL"
FT                   /protein_id="YP_919455.1"
FT   misc_feature    complement(31498..31830)
FT                   /note="Protein tyrosine phosphatases (PTP) catalyze the
FT                   dephosphorylation of phosphotyrosine peptides; they
FT                   regulate phosphotyrosine levels in signal transduction
FT                   pathways. The depth of the active site cleft renders the
FT                   enzyme specific for phosphorylated Tyr (; Region: PTPc;
FT                   cl00053"
FT                   /db_xref="CDD:173992"
FT                   /locus_tag="Tpen_0042"
FT   misc_feature    complement(order(31570..31575,31582..31584,31591..31596,
FT                   31684..31686))
FT                   /note="active site"
FT                   /db_xref="CDD:29029"
FT                   /locus_tag="Tpen_0042"
FT   misc_feature    complement(order(31591..31593,31684..31686))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:29029"
FT                   /locus_tag="Tpen_0042"
FT   misc_feature    complement(31030..31362)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Tpen_0042"
FT   gene            31935..33326
FT                   /db_xref="GeneID:4600578"
FT                   /locus_tag="Tpen_0043"
FT   CDS_pept        31935..33326
FT                   /locus_tag="Tpen_0043"
FT                   /gene_family="HOG000224930" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   tko:TK2169 zinc-dependent protease, TldD/PmbA family"
FT                   /db_xref="GI:119718961"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="GeneID:4600578"
FT                   /translation="MHEDDVKLVLGKAGSLGVQFAEVRFEESTREIISYVNGRIASMSN
FT                   QRLRGVGVRVLYNGNFGFASTFDLSRDGLLSALEEAFKAARALGPGNKRLAEVEASKRR
FT                   YSIEGVKRHPARAELAEKLDLVKRAYETLKSGGASSAVVRYGAYYGRVEVYTSEGLEVS
FT                   SERLVTGVSATAVLRENGRVGDGTETYGASKGLEAFTGDRAPEAIAEKALEVARAALNA
FT                   SRPPAGLQTVITRPELTGVFAHESFGHLTEGDGVFAGSSPLVGRLGEVLASEQVTIVDS
FT                   GFDERGGYVLLADDEGVPTERTILVEKGVLKGYLHSRESAALTGMKPTGNGRAQSFAHD
FT                   VIVRMRNTFFEAGDWTEEEIIRETRHGILLDKPAGGQVEEDGTFTFNARIGYIVENGEL
FT                   KQPVRDVVLAGNILEMLKYVDAAGKNVEISTSPFGGCGKWGQMVHVGDGGPTLRVSRLL
FT                   VGGER"
FT                   /protein_id="YP_919456.1"
FT   misc_feature    31941..33320
FT                   /note="Putative modulator of DNA gyrase; Region: PmbA_TldD;
FT                   cl00398"
FT                   /db_xref="CDD:174174"
FT                   /locus_tag="Tpen_0043"
FT   gene            33323..34651
FT                   /db_xref="GeneID:4600465"
FT                   /locus_tag="Tpen_0044"
FT   CDS_pept        33323..34651
FT                   /locus_tag="Tpen_0044"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   mma:MM0126 PmbA protein"
FT                   /db_xref="GI:119718962"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="GeneID:4600465"
FT                   /translation="MIGEIPYLAEWLVKRALELGADEAEASFSVYRERSVKSEGAYPKA
FT                   LSRASVDVWIRVAKGKRVAIVTATSLDRDVLSEILERGVAMARVAEEDPHWGGLPDPEG
FT                   PTHGWVGFDEGVATLGADWLIAAVRELAEEVRGRFPDVKVTGSGASAASGYSYVYNSRG
FT                   LRAEDRGTSMGVYLSTKASHAGGEGTGFAFIHSRSMVAELEGLAERASRLALDAARGEK
FT                   LGSSVTGNVLFKPYPLAELLDYLLVPALNAMNVLEGLSPLRDKVGEKVLGEMTLLDDGT
FT                   LPGGIETSLFDAEGVPRRRTLLVERGVLRGYLHNTYTARRMSTKSTGNAGRARGSYTVS
FT                   RSNMVVEGGDESEEELARDAAVVVDGSLLSVHTVNYVTGNFSVVATNPYLVKNGELKPL
FT                   KPVTIAGNIYQSAPTLRFSRTPRNTYTGFYLPETLVGKVTVSG"
FT                   /protein_id="YP_919457.1"
FT   misc_feature    33335..34648
FT                   /note="Putative modulator of DNA gyrase; Region: PmbA_TldD;
FT                   cl00398"
FT                   /db_xref="CDD:174174"
FT                   /locus_tag="Tpen_0044"
FT   gene            complement(34661..35494)
FT                   /db_xref="GeneID:4600933"
FT                   /locus_tag="Tpen_0045"
FT   CDS_pept        complement(34661..35494)
FT                   /locus_tag="Tpen_0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sat:SYN_00288 uncharacterized protein involved
FT                   in formate dehydrogenase formation"
FT                   /db_xref="GI:119718963"
FT                   /db_xref="GeneID:4600933"
FT                   /translation="MSKGNLKEKLKEIQKDIPIEEGSLATYVGLIEVQEEAKGFYAEKF
FT                   RDIDVEKVQEGFKEGKPAFLSLPLEISEEDIEKAYAAVTGYLSESLPETREPIARIEES
FT                   RKTGELRLKELSDALFAGDEEHVHGVAERVGVDPEILEAVIAWSLQPIFQALSDAVSSK
FT                   VDFSTWTSGRCPVCGGPTKLEYVDAGGHAHLRCQFCGTEWGYPEGKCPYCGNSDRKTVV
FT                   EIPVKGEDKFKLMVCYKCGGYWKVVDERVVGGGVPRELYDIWSFRLDLLATGGER"
FT                   /protein_id="YP_919458.1"
FT   misc_feature    complement(34757..>35356)
FT                   /note="formate dehydrogenase accessory protein FdhE;
FT                   Provisional; Region: PRK03564; cl11689"
FT                   /db_xref="CDD:175360"
FT                   /locus_tag="Tpen_0045"
FT   gene            complement(35568..36461)
FT                   /db_xref="GeneID:4600416"
FT                   /locus_tag="Tpen_0046"
FT   CDS_pept        complement(35568..36461)
FT                   /locus_tag="Tpen_0046"
FT                   /gene_family="HOG000152293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   mja:MJ0202 hypothetical protein"
FT                   /db_xref="GI:119718964"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="GeneID:4600416"
FT                   /translation="MRIHPECVLCIYRTRAGEVLASNLSDEAKVEALGKLTVFYGGLVE
FT                   PSSSTVVLAWKAFRKVKELLGAEDPYRYFKEQSHAAAMSVVERLAARAEGLEGYERFKY
FT                   FLSLSVAANLVDPGSPMGVSPEQLLEKASSLRFARDETDRLYLTLLQSSRVTYLLDNCG
FT                   EAVFDGLVLRELRRMGIQLKIVAKGAPYQNDVTHDDALRMGFQELGEVVSTGSDFPGVV
FT                   PGYVSEEAVKALEWADVVISKGMANFEAFLMSPPKTAVFVAFVAKCRPIAQAARVNPGD
FT                   AVAAFLRYPQGLRQSL"
FT                   /protein_id="YP_919459.1"
FT   misc_feature    complement(35610..36461)
FT                   /note="Protein of unknown function DUF89; Region: DUF89;
FT                   cl00680"
FT                   /db_xref="CDD:153930"
FT                   /locus_tag="Tpen_0046"
FT   gene            36543..37196
FT                   /db_xref="GeneID:4601186"
FT                   /locus_tag="Tpen_0047"
FT   CDS_pept        36543..37196
FT                   /locus_tag="Tpen_0047"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: pai:PAE1598
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="GI:119718965"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="GeneID:4601186"
FT                   /translation="MVSLGSVKVLGNPVLQEILGKLRSRDTPRREFRELLFKAGVFEAY
FT                   EIAEELPTEECSVETPLGRRAPCVRVTGKLAIVAVLRAALPMAMGMLEVFPDAALGFVA
FT                   AKRLEADAPPRDWRLEVSVPYVSMPPDAENLVIVDPMLATGSTLASVIERLKGGGYSYG
FT                   RLYVATVISTEQGIRRVLSVEPEARIYTLSVDPELNDKAFIVPGLGDAGDRAFG"
FT                   /protein_id="YP_919460.1"
FT   misc_feature    36561..37193
FT                   /note="Phosphoribosyl transferase domain; Region:
FT                   Pribosyltran; cl00309"
FT                   /db_xref="CDD:174099"
FT                   /locus_tag="Tpen_0047"
FT   gene            37222..37554
FT                   /db_xref="GeneID:4600785"
FT                   /locus_tag="Tpen_0048"
FT   CDS_pept        37222..37554
FT                   /locus_tag="Tpen_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fis family transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718966"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:4600785"
FT                   /translation="MSSREGVLRSFLSRARGFRGVAAVEGGKVYLAGEITREQVERAAE
FT                   AFSFASEVLRKARGIGVKVLVAEGEGGGLVYAKYGFTSYVVAVYRDISLGVAYHEVKRL
FT                   VAELAG"
FT                   /protein_id="YP_919461.1"
FT   gene            37596..37829
FT                   /db_xref="GeneID:4600786"
FT                   /locus_tag="Tpen_0049"
FT   CDS_pept        37596..37829
FT                   /locus_tag="Tpen_0049"
FT                   /gene_family="HOG000222891" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sai:Saci_1791 hypothetical protein"
FT                   /db_xref="GI:119718967"
FT                   /db_xref="GeneID:4600786"
FT                   /translation="MAVITVRIDEETKRLMESVKINWSEFIRRAIREKIAEERRKNLAK
FT                   AVLINERVRKRSRGEEKAEDIVRRFRDARSGS"
FT                   /protein_id="YP_919462.1"
FT   gene            37810..38232
FT                   /db_xref="GeneID:4600784"
FT                   /locus_tag="Tpen_0050"
FT   CDS_pept        37810..38232
FT                   /locus_tag="Tpen_0050"
FT                   /gene_family="HOG000012975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sso:SSO1786 hypothetical protein"
FT                   /db_xref="GI:119718968"
FT                   /db_xref="GeneID:4600784"
FT                   /translation="MREAVVDASVVVKWFVEEEGSDKALKVRDMYVEGEVELVAPELLV
FT                   YEVLNALYYKRLFSEEEMAQVLEALEAYSFKLYPLKGEYARKALEISYRCDVTVYDASY
FT                   VALAVLRDTYVYTADEKLARRLGEPYSGRVKLISSL"
FT                   /protein_id="YP_919463.1"
FT   misc_feature    37810..38181
FT                   /note="PIN domain; Region: PIN; cl09128"
FT                   /db_xref="CDD:175014"
FT                   /locus_tag="Tpen_0050"
FT   gene            complement(38231..38286)
FT                   /db_xref="GeneID:4600589"
FT                   /locus_tag="Tpen_R0001"
FT   misc_RNA        complement(38231..38286)
FT                   /note="C/D box small nucleolar RNA as predicted by Rfam
FT                   (RF00095), score 28.05"
FT                   /db_xref="GeneID:4600589"
FT                   /locus_tag="Tpen_R0001"
FT   gene            38357..39124
FT                   /db_xref="GeneID:4600611"
FT                   /locus_tag="Tpen_0051"
FT   CDS_pept        38357..39124
FT                   /locus_tag="Tpen_0051"
FT                   /gene_family="HOG000068441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pto:PTO1223 hypothetical protein"
FT                   /db_xref="GI:119718969"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="GeneID:4600611"
FT                   /translation="MYPLTLYALSAVSGVLVGFALGLVGGGGSILAIPLLLYFAGLSSV
FT                   LDQDTAVHVAIGTTSVAVGLNALANFAMHLKSGNAELKAGAVFAGIGTVASTLGALLGR
FT                   QTKGQLLLALLGVAMVLLSFWVASKRRYAGGKTSLKRLAAGSALVGFVSGFLGIGGGFL
FT                   VAPALLWAGLDVKKAIGTSLLAVGLFGLSTSAVYASAGYADYAIAAAYLAGGVLGGRLG
FT                   VHVSTRAPREKVALAYSALIAAVGVYTVLKALG"
FT                   /protein_id="YP_919464.1"
FT   gene            39217..39618
FT                   /db_xref="GeneID:4600532"
FT                   /locus_tag="Tpen_0052"
FT   CDS_pept        39217..39618
FT                   /locus_tag="Tpen_0052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718970"
FT                   /db_xref="GeneID:4600532"
FT                   /translation="MASRVVVELRFKGSGEPLTFELEPGRTVEVELGNRSPETLVYRFT
FT                   LRRIEGFVSYTIVKLEAGGKTSYVGRSTKPGVTLEVLVHPGESGALRLGAVSPRTSEDD
FT                   FKVEIEVTVERVAAATLPEKAPVLRAQRL"
FT                   /protein_id="YP_919465.1"
FT   gene            complement(39606..40943)
FT                   /db_xref="GeneID:4600533"
FT                   /locus_tag="Tpen_0053"
FT   CDS_pept        complement(39606..40943)
FT                   /locus_tag="Tpen_0053"
FT                   /gene_family="HOG000027235" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amino acid permease-associated region"
FT                   /transl_table="11"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mba:Mbar_A2178 amino acid transporter"
FT                   /db_xref="GI:119718971"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="GeneID:4600533"
FT                   /translation="MSRLKRELGLGYATLFGVGLILGAGIYVLIGRAAGIVGDAVWASV
FT                   AFSGVIAVATAFSYAELSSIFAKAASTYTYVREAFPGAGLLAFFAAWMLFFGGVAGAAT
FT                   AALGFAGYFSRLAGLGEGWVVPVTVALLAVLSVLNWWGIKESAFLSAVFTVIEAGGLVL
FT                   VVLLGFLFPARSPGYLSFNPSVDPVMAVLVGAAVFYFAYTGFEYQPTLSEETVDPERVI
FT                   PKSIVLAVSVTTLLYLLVSLSVVRLMSWEELGASKAPMADAASRAWPPAFHLLMFIALF
FT                   ATTNTSLGFLVSASRLAYGLAEEGVAWSGFGRVDGWRRTPHVAVAFTGVLAALLVFATD
FT                   YLPSVTGWRLSFGGQEYQLIDLVGKTASLAVLLAFFVVNAAVVALRRREGLSRRFRVPL
FT                   NVGDFPVLPVLADILIAVFVALSFWDWIVWLSTALVAALGLLLYKR"
FT                   /protein_id="YP_919466.1"
FT   misc_feature    complement(<40710..40934)
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="Tpen_0053"
FT   misc_feature    complement(<39924..>40382)
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="Tpen_0053"
FT   gene            complement(40977..41369)
FT                   /db_xref="GeneID:4600489"
FT                   /locus_tag="Tpen_0054"
FT   CDS_pept        complement(40977..41369)
FT                   /locus_tag="Tpen_0054"
FT                   /gene_family="HOG000223158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: neq:NEQ026 hypothetical protein"
FT                   /db_xref="GI:119718972"
FT                   /db_xref="GeneID:4600489"
FT                   /translation="MSSPLGLFFSFCALGIFTCVFFVFSMSETIEFELVRPVNPAGVSF
FT                   IKYLWGAIGARNRSLLEDRERRGELTRLIQKLGFALEEKVGGNKLVTGRVVLTLENGRP
FT                   VRLALRDVKVWAETGALEGEVAVELK"
FT                   /protein_id="YP_919467.1"
FT   gene            complement(41509..41985)
FT                   /db_xref="GeneID:4600383"
FT                   /locus_tag="Tpen_0055"
FT   CDS_pept        complement(41509..41985)
FT                   /locus_tag="Tpen_0055"
FT                   /gene_family="HOG000223159" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ape:APE1013 hypothetical protein"
FT                   /db_xref="GI:119718973"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="GeneID:4600383"
FT                   /translation="MMAAQKRRGISPVIATVIIVAVTIAIAIAVAFWMTGIVGIFTGTV
FT                   EKLEIVSLYAVPNAQGGWDVTVIVKNTGTISTSIDNIFINGVPVKNCNPAITPNPDVTA
FT                   TPQPLKPGGDPLTITFTLGNGNECGGTKFTSGVSIEVKLHSTGGKEYPKLITLP"
FT                   /protein_id="YP_919468.1"
FT   gene            42110..42186
FT                   /note="tRNA-Gln1"
FT                   /db_xref="GeneID:4600382"
FT                   /locus_tag="Tpen_R0002"
FT   tRNA            42110..42186
FT                   /db_xref="GeneID:4600382"
FT                   /locus_tag="Tpen_R0002"
FT                   /product="tRNA-Gln"
FT   gene            complement(42190..42597)
FT                   /db_xref="GeneID:4600984"
FT                   /locus_tag="Tpen_0056"
FT   CDS_pept        complement(42190..42597)
FT                   /locus_tag="Tpen_0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718974"
FT                   /db_xref="GeneID:4600984"
FT                   /translation="MQNRATDIRGFRAEKAVEVPGEVVVLVVVVAVAVAAAFWLANMAT
FT                   QQMGLEILDLKASASRSGGKTVVTVYAWNRGTKPATIVAVKVNGQVYEQRVAVEPGSSA
FT                   SITVEAPPADALEVVVVTASGREYPLIVGVP"
FT                   /protein_id="YP_919469.1"
FT   gene            42798..42929
FT                   /db_xref="GeneID:4600985"
FT                   /locus_tag="Tpen_0057"
FT   CDS_pept        42798..42929
FT                   /locus_tag="Tpen_0057"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718975"
FT                   /db_xref="GeneID:4600985"
FT                   /translation="MKFGKAEREVDVKDTGKVVVAYDARSEWARRVAEGVLRELGLK"
FT                   /protein_id="YP_919470.1"
FT   gene            complement(42992..43756)
FT                   /db_xref="GeneID:4600970"
FT                   /locus_tag="Tpen_0058"
FT   CDS_pept        complement(42992..43756)
FT                   /locus_tag="Tpen_0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin/glutaredoxin-like"
FT                   /transl_table="11"
FT                   /note="KEGG: sto:ST2281 hypothetical protein"
FT                   /db_xref="GI:119718976"
FT                   /db_xref="GeneID:4600970"
FT                   /translation="MLTVYVHPRCADSYRVYRLLSSRTPQSTRITYLDTEKYPFRALEY
FT                   GVFSVPAFSLNGRLVLQGYFEDEEVVSLASGAGLRVSSLDEAFSRLLKSVYYSLTVASA
FT                   VYVAGDLSVVAGSKSYLMSASGAFFVPEGEKFPEYAARRLSQTPFSEVEQGLLRNIAGN
FT                   FARDLYWLTGEVPTRERVEKLGEGFFEAWLLARASIGRVFVPQSSPRPGLRERVSKAWS
FT                   YVLGVIDKAGARVKEEQESIPQGWVEEASAQA"
FT                   /protein_id="YP_919471.1"
FT   misc_feature    complement(43031..43756)
FT                   /note="Predicted thioredoxin/glutaredoxin
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG5494"
FT                   /db_xref="CDD:35053"
FT                   /locus_tag="Tpen_0058"
FT   gene            44153..45499
FT                   /db_xref="GeneID:4602144"
FT                   /locus_tag="Tpen_0059"
FT   CDS_pept        44153..45499
FT                   /locus_tag="Tpen_0059"
FT                   /gene_family="HOG000250646" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="amidohydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   tko:TK0758 metal-dependent amidohydrolase"
FT                   /db_xref="GI:119718977"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="GeneID:4602144"
FT                   /translation="MATLVIRDADTILTMNSARPVLRHQSILVDGNVVAAVGDYSSLVA
FT                   SYGAPDEVIDGRGKVVLPGFYDLHTHIAMAGFRGLAADAGDVIYRVFWPLERLLSGESV
FT                   YRFALLGGLEALKSGVVLVADHYFFMRDVARALVELGLRGLLGHTYMDRDGPFTGEREL
FT                   REALDFVERWRGHELITPVLAPHAPDTVSRDNLLYFAELSREKNLFVHMHLAQTLREFK
FT                   TVKEETGYTPVRYALRLGLLGGRSIVAHANYVDENEKALLAHSGSVIVQCPSTYFMSGT
FT                   PFHAYDYWQLGGNVAIGTDAPCYNDNVDFFEEMRLLVYGQRMKLEKSGVWRAYDVLEMA
FT                   TRLSARLVGVRGGFVGKGALADLVLVNLSSVRLRPFLDPFSNIVYAASSGDVDTVIVNG
FT                   RVVLKGGRHVSLDEERIVSQAEAEARMLLRRALDESPELESIIGRDKEI"
FT                   /protein_id="YP_919472.1"
FT   misc_feature    44153..45403
FT                   /note="N-ethylammeline chlorohydrolase; Provisional;
FT                   Region: PRK06038"
FT                   /db_xref="CDD:102135"
FT                   /locus_tag="Tpen_0059"
FT   misc_feature    44162..45379
FT                   /note="Superfamily of metallo-dependent hydrolases (also
FT                   called amidohydrolase superfamily) is a large group of
FT                   proteins that show conservation in their 3-dimensional fold
FT                   (TIM barrel) and in details of their active site. The vast
FT                   majority of the members have...; Region:
FT                   metallo-dependent_hydrolases; cl00281"
FT                   /db_xref="CDD:174087"
FT                   /locus_tag="Tpen_0059"
FT   misc_feature    order(44357..44359,44363..44365,44789..44791,44900..44902,
FT                   45050..45052)
FT                   /note="active site"
FT                   /db_xref="CDD:30035"
FT                   /locus_tag="Tpen_0059"
FT   gene            45522..46241
FT                   /db_xref="GeneID:4600488"
FT                   /locus_tag="Tpen_0060"
FT   CDS_pept        45522..46241
FT                   /locus_tag="Tpen_0060"
FT                   /gene_family="HOG000274897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="purine phosphorylases family protein 1"
FT                   /transl_table="11"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: sto:ST0975 hypothetical 5'-methylthioadenosine
FT                   phosphorylase"
FT                   /db_xref="GI:119718978"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="GeneID:4600488"
FT                   /translation="MAKPLHILAKPEDIAPRVIASGDPARVKQLSSYLDNPRLVNENRG
FT                   FLVYTGTYKGVPVTVATHMIGAPSAAIVFEELIMLGAKLIVRFGTCGGFLPEMRVGDFV
FT                   IATGASYSGGGTMNTYSPGECMAAVPDYDVLSALVESASRHGLKYFLGPVVSSDNFYSG
FT                   IEYLNRWINRGMIAVDMEAATLFVVGRLRRVKTGASFVVSDVIGEAYKKMATAEELREA
FT                   VDKASRAVLDAVISVKV"
FT                   /protein_id="YP_919473.1"
FT   misc_feature    45522..46223
FT                   /note="Uridine phosphorylase [Nucleotide transport and
FT                   metabolism]; Region: Udp; COG2820"
FT                   /db_xref="CDD:32648"
FT                   /locus_tag="Tpen_0060"
FT   misc_feature    45537..46226
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Tpen_0060"
FT   gene            46241..47020
FT                   /db_xref="GeneID:4601780"
FT                   /locus_tag="Tpen_0061"
FT   CDS_pept        46241..47020
FT                   /locus_tag="Tpen_0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FkbM family methyltransferase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   mlo:mll9724 hypothetical protein"
FT                   /db_xref="GI:119718979"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="GeneID:4601780"
FT                   /translation="MPSRERAEKILFLLGELLYESQRVLSSSHAVLVFGAHRFVVPKGW
FT                   ADSSLRNLEHVFVKHDYDRIPGFTRVPRGSTVVDLGAYVGFFSVKVHSESPGARLVAVE
FT                   ANPQACRYLRHNLRMNGVRSEAYCLAVGESDGVGRLFVAEDPVNSSLLEEYSSSFSRVS
FT                   GVARVAQLSLSSLWRRLDVGHASLLKVDVEGVEERVLRASRDVLTPGCVDRVVVEVHPP
FT                   YSSPSRVVELLERGFHVATYYDYEAPFQVFVYGWAKR"
FT                   /protein_id="YP_919474.1"
FT   misc_feature    46466..46900
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Tpen_0061"
FT   gene            47105..47818
FT                   /db_xref="GeneID:4601781"
FT                   /locus_tag="Tpen_0062"
FT   CDS_pept        47105..47818
FT                   /locus_tag="Tpen_0062"
FT                   /gene_family="HOG000274897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="purine phosphorylases family protein 1"
FT                   /transl_table="11"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: sai:Saci_1247 5'-methylthioadenosine phosphorylase"
FT                   /db_xref="GI:119718980"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="GeneID:4601781"
FT                   /translation="MTMPYHIKAERVAGRVLVVGDPGRARLVAGMLEDARLVNENRGLL
FT                   VYNGFWRGVEVSVATHGMGGAGAAIVFEELLQLGGRTLVRLGTTGAIRGEVEVGDFVVP
FT                   SSAFHHPGGLFLQYFGDICVSPSPDLELAWLLASEARSAGLKVWTAPVVSSDAFYAETG
FT                   EVISRWASFGAVSVEMECATLFAVTRLRGARSAAILLVNGSLVQPGKRMVSESELEERL
FT                   VKGAEVALDVLAKSP"
FT                   /protein_id="YP_919475.1"
FT   misc_feature    47105..47806
FT                   /note="Uridine phosphorylase [Nucleotide transport and
FT                   metabolism]; Region: Udp; COG2820"
FT                   /db_xref="CDD:32648"
FT                   /locus_tag="Tpen_0062"
FT   misc_feature    47111..47809
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Tpen_0062"
FT   gene            47832..48263
FT                   /db_xref="GeneID:4601232"
FT                   /locus_tag="Tpen_0063"
FT   CDS_pept        47832..48263
FT                   /locus_tag="Tpen_0063"
FT                   /gene_family="HOG000223160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718981"
FT                   /db_xref="GeneID:4601232"
FT                   /translation="MGVCPRRLTEFNVAGKEIREKRKLLVYGSCLAYEYPELLREYSEG
FT                   RVDLAVCLEAEHFNVVALKLASMLARVDVEEVVVLTVDGSPHCVQLHHAVEEAKKVTGR
FT                   SPRTRHLVIEEGKVVEVDEKAVKTARYLSRVQRLLDKSL"
FT                   /protein_id="YP_919476.1"
FT   gene            48287..48808
FT                   /db_xref="GeneID:4600546"
FT                   /locus_tag="Tpen_0064"
FT   CDS_pept        48287..48808
FT                   /locus_tag="Tpen_0064"
FT                   /gene_family="HOG000055774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tko:TK2102 hypothetical protein"
FT                   /db_xref="GI:119718982"
FT                   /db_xref="GeneID:4600546"
FT                   /translation="MAGKGRASLFIALASILSALTAVLTYFPGLALPSPTGGYTHVGDT
FT                   IIYVSALLFGPWMGLVVGLVGPVIADFLVGYPRWYVTLVAHGLQGFIAGYGAGKKFKTQ
FT                   LVLMVAAGLVMSFTYFVVNVYVKGLGPALVSLARDIFGQTLVSIVLASLLLKALEKAPA
FT                   VKRAQELLRK"
FT                   /protein_id="YP_919477.1"
FT   misc_feature    48374..>48664
FT                   /note="Protein of unknown function (DUF1393); Region:
FT                   DUF1393; cl01942"
FT                   /db_xref="CDD:174693"
FT                   /locus_tag="Tpen_0064"
FT   gene            48840..49646
FT                   /db_xref="GeneID:4600887"
FT                   /locus_tag="Tpen_0065"
FT   CDS_pept        48840..49646
FT                   /locus_tag="Tpen_0065"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718983"
FT                   /db_xref="GeneID:4600887"
FT                   /translation="MGEDICWSGSPSPASYLGSYLRGLVPTVAVAALESSAGLLPPVLA
FT                   GLSSSLAFVLKWALPGMSPVEGLLYVLGALLAILVALLDWIINVRVGLLAFSLVAFVGV
FT                   EALRVVLGLSLGLGARLALLSLFSAGWVLAVDLRRRTYRYFVGYRKVGITGGLLRRVER
FT                   YISGDMVSDVIVVKPLLGRLLGFGHVVPVTPSGLGLGETFSVGAAGASAFKGLAVGVGG
FT                   GRIVRDIAPREWNCLYGVKNPDRVRDLILLGCAPQGRSAGAAAAER"
FT                   /protein_id="YP_919478.1"
FT   misc_feature    49257..>49427
FT                   /note="Bacterial membrane flanked domain; Region: DUF304;
FT                   cl01348"
FT                   /db_xref="CDD:154346"
FT                   /locus_tag="Tpen_0065"
FT   gene            complement(49607..50323)
FT                   /db_xref="GeneID:4600888"
FT                   /locus_tag="Tpen_0066"
FT   CDS_pept        complement(49607..50323)
FT                   /locus_tag="Tpen_0066"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalt transport protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cobalt transport protein; KEGG: bcl:ABC1935
FT                   cobalt ABC transporter permease"
FT                   /db_xref="GI:119718984"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="GeneID:4600888"
FT                   /translation="MARLPSPKDFLSSLNPLTKLALFLVGIFQVALLGDPKYALLHLLL
FT                   SSTLLALVRPKVGKAEFAAALSTLVGYTWVNTALYIYNYSMSPWDAARNALQLTARVAI
FT                   IILYSMTFVATTTPKALTVALTEQLGVPYVYAFMSFVTLRMAPLIRRDLENMIAYRRIK
FT                   GYFSWKAPHRYVASYAFPLLFLAVRRSITLALSMQARGFGKYAERTNLEKTRFRRGDLL
FT                   FALAYLSAAAAPALLP"
FT                   /protein_id="YP_919479.1"
FT   misc_feature    complement(49664..50296)
FT                   /note="Cobalt transport protein; Region: CbiQ; cl00463"
FT                   /db_xref="CDD:163835"
FT                   /locus_tag="Tpen_0066"
FT   gene            complement(50307..51893)
FT                   /db_xref="GeneID:4601012"
FT                   /locus_tag="Tpen_0067"
FT   CDS_pept        complement(50307..51893)
FT                   /locus_tag="Tpen_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: lxx:Lxx21860 ABC transporter, ATP-binding protein"
FT                   /db_xref="GI:119718985"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4601012"
FT                   /translation="MAEVLVNNLSVFYHSSGLQVLKGVSFQLDRGECLLLLGPTGSGKS
FT                   TLLLTLAGAIPQVIPASVSGELSVGGKNPVEEGLLGMAGKVGLLFQDPEAQVVMPTVFE
FT                   EVAFPMENLLEPPERIVARVGELLDLVSLKRYARSEVDTLSTGLKQKLALASVLAMDPE
FT                   VFLLDEPTAHIDPRTAKEIYALVKRLKDEGKTFILVEHRVEYVAGIADKVLYLEDGRGV
FT                   LARSIGELVEKVGAEKLVDAGVWIPPEYLPRKNPANPRTAGTPRENREPLVDVSSLEVR
FT                   AGPEVILRDVSLRARRGEVTLVIGPNGSGKTTLLKAIAGLVRPSSGEVRVAGGRPSPRL
FT                   VAFVAQIPDHQFTERTVVEEVASVLGGSRREERLRRARRVLEARGLGHLSDRVVYELSQ
FT                   GEKRLVSFVEMYMLDKPVYLLDEPTFGLDFKYSLTVARSIAELASSGKAVVVVTHDSWI
FT                   LPLLSPKVYGLSHGRIVFEGELPELLTKSDVWKYLNFEPPAPLKGLANIEEARIAVQEY
FT                   AERLRNYGEVA"
FT                   /protein_id="YP_919480.1"
FT   misc_feature    complement(50460..51893)
FT                   /note="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase [General function
FT                   prediction only]; Region: COG1123"
FT                   /db_xref="CDD:31320"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51234..51878)
FT                   /note="Domain I of the ABC component of a cobalt transport
FT                   family found in bacteria, archaea, and eukaryota.  The
FT                   transition metal cobalt is an essential component of many
FT                   enzymes and must be transported into cells in appropriate
FT                   amounts when needed.  This...; Region:
FT                   ABC_cobalt_CbiO_domain1; cd03225"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51759..51782)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(order(51291..51293,51387..51392,51621..51623,
FT                   51756..51764,51768..51773))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51621..51632)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51435..51464)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51387..51404)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51369..51380)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(51285..51305)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50475..51047)
FT                   /note="Domain I of the ABC component of a cobalt transport
FT                   family found in bacteria, archaea, and eukaryota.  The
FT                   transition metal cobalt is an essential component of many
FT                   enzymes and must be transported into cells in appropriate
FT                   amounts when needed.  This...; Region:
FT                   ABC_cobalt_CbiO_domain1; cd03225"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50958..50981)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(order(50532..50534,50628..50633,50856..50858,
FT                   50955..50963,50967..50972))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50856..50867)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50676..50705)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50628..50645)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50610..50621)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   misc_feature    complement(50526..50546)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72984"
FT                   /locus_tag="Tpen_0067"
FT   gene            complement(51871..52473)
FT                   /db_xref="GeneID:4601056"
FT                   /locus_tag="Tpen_0068"
FT   CDS_pept        complement(51871..52473)
FT                   /locus_tag="Tpen_0068"
FT                   /gene_family="HOG000252253" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter, permease protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tfu:Tfu_0587 ABC transporter, permease
FT                   protein"
FT                   /db_xref="GI:119718986"
FT                   /db_xref="GeneID:4601056"
FT                   /translation="MREEKLRVEELVLTAVLSAIIGAVFLVWSNVVWGASKLVLGLTLT
FT                   PIIYGMWFIGATVPAYIVRKPLVALLGEFLAAVLELFYGSQFASTVLLYGFMQGLMSEL
FT                   VFFATRYKRWDWATMALAGAAPALWAAPADTVLYGITNPLSPGQRVVFWSLYFVSGALI
FT                   AGVLVKALIDYVAKSSSLLDYFAVGKSVKKIGGSTSQ"
FT                   /protein_id="YP_919481.1"
FT   misc_feature    complement(52129..52434)
FT                   /note="ABC-type cobalt transport system, permease
FT                   component; Region: ABC_cobalt; cl01943"
FT                   /db_xref="CDD:154667"
FT                   /locus_tag="Tpen_0068"
FT   gene            52657..53619
FT                   /db_xref="GeneID:4600899"
FT                   /locus_tag="Tpen_0069"
FT   CDS_pept        52657..53619
FT                   /locus_tag="Tpen_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: pfu:PF0601 hypothetical
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="GI:119718987"
FT                   /db_xref="GeneID:4600899"
FT                   /translation="MFPETVASSVFVPYLRRVLVSELRKLNMSQTDIARLTGVTQAAVS
FT                   KILREKQGSRYGSTGLDVPENEIRVVARKIAKILSQGNINEAGFLSNRYWWLIAASGDA
FT                   CKAHEKYGWRKSECYICTKVVYPNLDVSRGLVMADMERALIVLWSSEYFGLLIPEVLTN
FT                   IAMAIPGAKSIYDVAAVPGRISRSKSGEILYRQPEFGASRHLSGILLSINGKYRAVINI
FT                   KYDEIVEEALVSMGLRFKEFSSEDYPSANPAASAAAELLEECPDCKALVDVGGENVESV
FT                   TYIFGNRAVEVANIAVSLSEIYYAVAVKKGKIIYSIETL"
FT                   /protein_id="YP_919482.1"
FT   misc_feature    52672..52989
FT                   /note="Predicted transcriptional regulator [General
FT                   function prediction only]; Region: COG2522"
FT                   /db_xref="CDD:32592"
FT                   /locus_tag="Tpen_0069"
FT   misc_feature    53071..53553
FT                   /note="Archaeal phosphomethylpyrimidine kinase; Region:
FT                   MethylPyrKinase; cl00871"
FT                   /db_xref="CDD:154054"
FT                   /locus_tag="Tpen_0069"
FT   gene            53689..54753
FT                   /db_xref="GeneID:4601778"
FT                   /locus_tag="Tpen_0070"
FT   CDS_pept        53689..54753
FT                   /locus_tag="Tpen_0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TrmB"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   tvo:TVN1149 predicted transcription regulator"
FT                   /db_xref="GI:119718988"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011571"
FT                   /db_xref="GeneID:4601778"
FT                   /translation="MSERVPGEAGGGTPRDNAIQLLKLLGLTGLEAELYLLLLEKGPLS
FT                   APEISDYLVKHRPQIHVALTRLSSKGYIEELGGRPKKYRAVDPQLLLNLFLKDFDSLAK
FT                   KALSYMRGLSKPSLEEKFGVWIIREPEVAKSRIAELLDSATIDALIMGDIKFLHMLSDK
FT                   IEAAVERGVRVYVLSYSLGERGAKFIVEDMPFLKKLRVAISGDLVVVVDSERGGVLKAR
FT                   PTLPIRHGYLIEERTLTDYLSHDFMNRWVSSKVIVDENYDMPLKFTFHRMALYETKKLL
FT                   LENKKLRLKATGYEIDTGARVEVSGRIVDAVLDLPAGYAHFKVETDSGVIRVGGLDAIV
FT                   EEIAGEYFEIYEES"
FT                   /protein_id="YP_919483.1"
FT   misc_feature    <53821..53952
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Tpen_0070"
FT   misc_feature    54055..54732
FT                   /note="Archaeal transcriptional regulator TrmB; Region:
FT                   Regulator_TrmB; pfam11495"
FT                   /db_xref="CDD:151932"
FT                   /locus_tag="Tpen_0070"
FT   gene            complement(54750..56405)
FT                   /db_xref="GeneID:4601779"
FT                   /locus_tag="Tpen_0071"
FT   CDS_pept        complement(54750..56405)
FT                   /locus_tag="Tpen_0071"
FT                   /gene_family="HOG000223161" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="radical SAM domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE1112 hypothetical
FT                   protein"
FT                   /db_xref="GI:119718989"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:4601779"
FT                   /translation="MKRVDVALIHAPSVYDFRERPYVHYGPISDVIPSKPVFDMYPAGF
FT                   FSLASYLEERGVKTGIFNLAAKMVNDPRFDVPRFLRSLEASVYGIDLHWLVHAHGALEI
FT                   ARLVKELRKGHVVLGGFSATYYWREILEKFPYVDAIVLGDTTEPVFFEVVQALEAGRLD
FT                   KLGEVPNLAYRDENGRVRFNGLRYVPVELDELRPKYDIVVKVMVRSGITYSIPWSTFLK
FT                   HPVTAVITYKGCTFNCLACGGSRFTYNVIYGRRKLGVKKPETLFEEYKEITERLKAPIF
FT                   FVNDLQVLGKSYVERLVSLLRSERAGVEVFFEFFTPPPRDFLAVLRSAEERVYLQISPE
FT                   THDESIRSTYGRPYTNSSLKAFLRNAEDLGFTRVDLYFMVGLPGQTPENVKGIGSFFEE
FT                   LRRIAPKVVDAFVAPLAPFVDPGSPAFHMSGKYGYRLFAYTLSDHRKLLLADKWYLMLN
FT                   YETRWMTRAEIAAATYNAVESLATSKYRAGVIDEEYFREVMESIQLARRGGRPEILDSK
FT                   ETLREEELYPMKALNLSYLTPKVILEIAKYMVRS"
FT                   /protein_id="YP_919484.1"
FT   misc_feature    complement(54831..56372)
FT                   /note="Fe-S oxidoreductase [Energy production and
FT                   conversion]; Region: COG1032"
FT                   /db_xref="CDD:31235"
FT                   /locus_tag="Tpen_0071"
FT   misc_feature    complement(55878..56285)
FT                   /note="B12 binding domain_like associated with radical SAM
FT                   domain. This domain shows similarity with B12
FT                   (adenosylcobamide) binding domains found in several
FT                   enzymes, such as glutamate mutase, methionine synthase and
FT                   methylmalonyl-CoA mutase, but it lacks the...; Region:
FT                   radical_SAM_B12_BD; cd02068"
FT                   /db_xref="CDD:30206"
FT                   /locus_tag="Tpen_0071"
FT   misc_feature    complement(55227..55724)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cl14056"
FT                   /db_xref="CDD:176838"
FT                   /locus_tag="Tpen_0071"
FT   gene            complement(56507..56833)
FT                   /db_xref="GeneID:4601571"
FT                   /locus_tag="Tpen_0072"
FT   CDS_pept        complement(56507..56833)
FT                   /locus_tag="Tpen_0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718990"
FT                   /db_xref="GeneID:4601571"
FT                   /translation="MERVAEAAAFLSAAEEKFSKDEDFERDARLAILLALRAVSEDLGS
FT                   LDPIELAGTLPERIIGEVILLKEISTRAYSVRGEALLEASREAVEIAVSIILYRVASNQ
FT                   GEQP"
FT                   /protein_id="YP_919485.1"
FT   gene            complement(56850..57920)
FT                   /db_xref="GeneID:4600937"
FT                   /locus_tag="Tpen_0073"
FT   CDS_pept        complement(56850..57920)
FT                   /locus_tag="Tpen_0073"
FT                   /gene_family="HOG000223162" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="radical SAM domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: sto:ST0626
FT                   hypothetical protein"
FT                   /db_xref="GI:119718991"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:4600937"
FT                   /translation="MLYIVHTTGQCNLKCDYCGGSFDPRKVPWSVKYDYHLLKKLVERD
FT                   EDSIVAFYGGEPLLNKDFVKWVLENVRAKHFVIQTNGTLVKSLPERYWHMFDAVLLSVD
FT                   GRESVTDKHRGSGVYRRVVESARWLREIGFKGDLIARMTVTEDTDIYEDVKHLLSLGLF
FT                   SHVHWQLDVVWSDRWKCFSCWRDGNYLPGVAKLVKEWLEEMRRGKVLGIAPFKALITRA
FT                   FHKSYSAPPCGAGVSSFSILTDGRIVACPIAVEERWALVGRVEDGEIHPERAPKISEPC
FT                   SSCRYFEFCGGRCLYAYMERLWGEDGFREVCVATQRFIDIVLSTLNEVKELLSAGVVSM
FT                   SDIYYPPFNNTVEVIP"
FT                   /protein_id="YP_919486.1"
FT   misc_feature    complement(56964..57920)
FT                   /note="Predicted Fe-S oxidoreductases [General function
FT                   prediction only]; Region: COG0535"
FT                   /db_xref="CDD:30881"
FT                   /locus_tag="Tpen_0073"
FT   misc_feature    complement(57441..57908)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Tpen_0073"
FT   misc_feature    complement(order(57495..57497,57678..57686,57753..57758,
FT                   57762..57764,57864..57872,57876..57878,57882..57884,
FT                   57888..57890))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Tpen_0073"
FT   gene            complement(57954..58676)
FT                   /db_xref="GeneID:4601872"
FT                   /locus_tag="Tpen_0074"
FT   CDS_pept        complement(57954..58676)
FT                   /locus_tag="Tpen_0074"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718992"
FT                   /db_xref="GeneID:4601872"
FT                   /translation="MNVKNILVGLFLIFVLLQILEAYLYNTLDAGYLEVTDVDFSGNVE
FT                   NLTLRIYLSNPYSVPLQFQEVSVKAKCGSSFYGASRGNVTVPPASHSVLQLEVGIPFGE
FT                   EACNFTLVEYPMLLVTRLTGITFINKSKQFQLAIPGYGARFLWAGWNKTSVKLGECVDI
FT                   EVHVKPPGPYRLTVLAELTGFAPEAVAQYEGLGDGVFTFCPKEPSSFKLKGYFLQVSAQ
FT                   DATWTQAPGYPPRLRVEP"
FT                   /protein_id="YP_919487.1"
FT   gene            complement(58722..58985)
FT                   /db_xref="GeneID:4601900"
FT                   /locus_tag="Tpen_0075"
FT   CDS_pept        complement(58722..58985)
FT                   /locus_tag="Tpen_0075"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718993"
FT                   /db_xref="GeneID:4601900"
FT                   /translation="MRIEEAIKTVEKTLREKGYSVTREVEDGDQVLVVQLGDRKAKVRF
FT                   HGEAGELLELHLKYENVPGVTILKCERYLESMRCIEDLLSRL"
FT                   /protein_id="YP_919488.1"
FT   gene            59056..59916
FT                   /db_xref="GeneID:4601901"
FT                   /locus_tag="Tpen_0076"
FT   CDS_pept        59056..59916
FT                   /locus_tag="Tpen_0076"
FT                   /gene_family="HOG000219608" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: oxidoreductase domain protein; NADP
FT                   oxidoreductase, coenzyme F420-dependent; homoserine
FT                   dehydrogenase, NAD-binding; 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; KEGG: bxe:Bxe_A0271
FT                   oxidoreductase"
FT                   /db_xref="GI:119718994"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="GeneID:4601901"
FT                   /translation="MRLGFIGTGAMGFPMAARLARTGHELFVWNRTIEKARPLEQYGAR
FT                   VASSLDELSRVAEVVFVMVSDDEASREVLSAVLREGRPRIIVNHSTVSPMYTREAVEEA
FT                   KRRGVEYLAIPVMGGPSDIERGEGVCIVGGREEVFREVEPLTSAYCKEHVLVGSQENAS
FT                   VIKLALNSMYFSALEALAEALLLVEAWNVEPKVFFDAASRLWLRVVVDRYAKRLLDEKY
FT                   PTSFQLRLAAKDLHYAVFSGYHKGQPLPMLSELAKTFLEASTIGGLGRRDYTRIYYFLK
FT                   RGSTG"
FT                   /protein_id="YP_919489.1"
FT   misc_feature    59056..59898
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Tpen_0076"
FT   misc_feature    59056..>59433
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="Tpen_0076"
FT   gene            complement(59913..60965)
FT                   /db_xref="GeneID:4601792"
FT                   /locus_tag="Tpen_0077"
FT   CDS_pept        complement(59913..60965)
FT                   /locus_tag="Tpen_0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718995"
FT                   /db_xref="GeneID:4601792"
FT                   /translation="MKVIYVKDPVKAPPSPIAIVEEPEVLKAYLDDDLNPVRCFDEEGF
FT                   EKPCPEIKVSREDTVFMGGVVSEVLASQYNCSYIDDRVVRLNPSFNPENAKSYLEVAKN
FT                   PPGSEEIAKDTVLIVVPGSLISRKSMASAVAGLLERGEIRVKAVIDFDAGLNYRVAKID
FT                   EWDVLSRYDYWWEVPWNYVVASGRNLRRFVELLTERPVEKPPKKLQVKNYVSLDDFLQS
FT                   FLEWFGRASSASEKRREVRRFVAFVDENLFEAEGGYRAAVLVKNTRRSVVARWYFTRKF
FT                   ELRAFDGFPPEAVRDVDMEAVLGNVPRESQARIPSHLAAFFVRQAVLSPVRIEDFLAVK
FT                   AHRWVEVAYL"
FT                   /protein_id="YP_919490.1"
FT   gene            complement(60972..61805)
FT                   /db_xref="GeneID:4602016"
FT                   /locus_tag="Tpen_0078"
FT   CDS_pept        complement(60972..61805)
FT                   /locus_tag="Tpen_0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718996"
FT                   /db_xref="GeneID:4602016"
FT                   /translation="MSYPEVYHDISILLLPEALSELKKASAPQLEEISPVEKYLPQLLT
FT                   AATERLKSRGLGVEEKEFQEVFRYGITSIARAYAEGDWRFYAFFSELFTKISIIDSLYE
FT                   WSINIASLPPRATFFEVNTVAPVYLSRLSQRVSGSPGIITEKRFLYNSTFKEIYDEYSR
FT                   RYDLKLNVVPLEDADRLASLNGTVDVLVFATLDAMSLGWRTILGMASSLLKKGGTLIAI
FT                   VPDNKREGLRSLLRAWRIPDYEPPETLATNLQDSRFTKIRYSTKGPFSAFVAQKR"
FT                   /protein_id="YP_919491.1"
FT   gene            complement(61805..62611)
FT                   /db_xref="GeneID:4600711"
FT                   /locus_tag="Tpen_0079"
FT   CDS_pept        complement(61805..62611)
FT                   /locus_tag="Tpen_0079"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119718997"
FT                   /db_xref="GeneID:4600711"
FT                   /translation="MSKLGVQRVFRARCPACSQVEVVEVNDKLLEEAQNNPLGLAGVAF
FT                   QHETHVFIVYVDRNGGERGTRVFPLLQARGKGLYEVKVQPELLRGLRNIGGFTIESRRL
FT                   NYRVTGYFEPPSSSIKVYKGETSLEVDFRRDVSYQTTKAWMELLAEALDSSYSYSPTDY
FT                   VNAVRLLDVLIEEKPFEYIKQVFWLITNASNITVKVRPSEAMLLRKYRPSIIFEKYNGG
FT                   FVNRVLEAPSVKVSDILGLENPQIMFSYVEALLSLQRRGVIDLVIG"
FT                   /protein_id="YP_919492.1"
FT   gene            complement(62608..63123)
FT                   /db_xref="GeneID:4600810"
FT                   /locus_tag="Tpen_0080"
FT   CDS_pept        complement(62608..63123)
FT                   /locus_tag="Tpen_0080"
FT                   /gene_family="HOG000233969" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small GTP-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ehi:95.t00027 Rab family GTPase; TIGRFAM:
FT                   small GTP-binding protein; PFAM: Miro domain protein; Ras
FT                   family protein; SMART: Ras small GTPase, Ras type; Ras
FT                   small GTPase, Rho type; Ras small GTPase, Rab type"
FT                   /db_xref="GI:119718998"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="GeneID:4600810"
FT                   /translation="MIATVKISLCGPGGVGKTSLARKFVEGSYNPQERLTVGIQHFFRK
FT                   IQLDGRELHVVIWDLGGEHRFRFLAPAFLKGAKGVVYVFDLTREETFLEIDEWRKITES
FT                   VLGKVPSILIGNKADLEEYRIVPYNLAREYALSKGFLEYFEVSARTGARVEEAFLFLLR
FT                   TIVQSVRV"
FT                   /protein_id="YP_919493.1"
FT   misc_feature    complement(62635..63111)
FT                   /note="Rab family.  Rab GTPases form the largest family
FT                   within the Ras superfamily.  There are at least 60 Rab
FT                   genes in the human genome, and a number of Rab GTPases are
FT                   conserved from yeast to humans. Rab GTPases are small,
FT                   monomeric proteins that function...; Region: Rab; cd00154"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(63106..63111)
FT                   /note="Rab subfamily motif 1 (RabSF1); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(63070..63093)
FT                   /note="G1 box; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62677..62685,62767..62769,62773..62778,
FT                   62938..62940,63016..63018,63037..63039,63067..63087))
FT                   /note="GTP/Mg2+ binding site; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(63037..63069)
FT                   /note="Rab subfamily motif 2 (RabSF2); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62998..63018,63037..63039))
FT                   /note="Switch I region; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(63016..63018)
FT                   /note="G2 box; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62890..62892,62905..62907,62917..62919,
FT                   62926..62931,62950..62952,62956..62958,63001..63009,
FT                   63013..63015))
FT                   /note="effector interaction site; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62908..62916,62926..62928,62947..62952,
FT                   63004..63006,63010..63015))
FT                   /note="GDI interaction site; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(63001..63015)
FT                   /note="Rab family motif 1 (RabF1); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62962..62964,62968..62970,62989..63012))
FT                   /note="GEF interaction site; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62950..62964)
FT                   /note="Rab family motif 2 (RabF2); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62938..62949)
FT                   /note="G3 box; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62902..62919,62923..62934,62938..62940))
FT                   /note="Switch II region; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(order(62914..62919,62923..62931))
FT                   /note="Rab family motif 3 (RabF3); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62902..62907)
FT                   /note="Rab family motif 4 (RabF4); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62863..62880)
FT                   /note="Rab family motif 5 (RabF5); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62785..62799)
FT                   /note="Rab subfamily motif 3 (RabSF3); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62767..62778)
FT                   /note="G4 box; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62677..62685)
FT                   /note="G5 box; other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   misc_feature    complement(62635..62637)
FT                   /note="Rab subfamily motif 4 (RabSF4); other site"
FT                   /db_xref="CDD:133250"
FT                   /locus_tag="Tpen_0080"
FT   gene            complement(63192..64388)
FT                   /db_xref="GeneID:4600811"
FT                   /locus_tag="Tpen_0081"
FT   CDS_pept        complement(63192..64388)
FT                   /locus_tag="Tpen_0081"
FT                   /gene_family="HOG000223062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminotransferase, class I and II"
FT                   /transl_table="11"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; aminotransferase,
FT                   class I and II; KEGG: ape:APE2248 aspartate
FT                   aminotransferase"
FT                   /db_xref="GI:119718999"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="GeneID:4600811"
FT                   /translation="MGWETSFRLSKAASQLGAEEAFVYLARSLELKRRGVDVVSFGIGQ
FT                   PDFQPPPHVISEAKKAMDEGFNGYGPSLGMPELREAIASFVSEEYGVDVKAEEVAVTVG
FT                   AKSAIFMAMISLLEPGDEVIIPDPSYPLYESVARFAGAKPVFLRLHRGNGYKVTFEEVE
FT                   KLVTPKTRMIVLNYPENPVGTTMDQRDVEELVDFSAKRGIVVLSDEIYDHFVYEKKHFS
FT                   TLQTSSWRDAVYYVNGFSKTFGMTGWRLGYVISNKELISKLSVVANNIYSCPVTFEQIA
FT                   AAKALKEGLSWFKPILEGYRKRRDLIYREFLSIKGVKVVKPEGAFYIFPDFTEVIREKG
FT                   LKNERELADRLLEERGVVVLPGTAFPKEGGKGHLRFSFAVSENDIVRGIARIKEWIES"
FT                   /protein_id="YP_919494.1"
FT   misc_feature    complement(63195..64283)
FT                   /note="aspartate aminotransferase; Provisional; Region:
FT                   PRK06108"
FT                   /db_xref="CDD:168398"
FT                   /locus_tag="Tpen_0081"
FT   misc_feature    complement(63207..64274)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0081"
FT   misc_feature    complement(order(63642..63644,63666..63671,63675..63677,
FT                   63756..63758,63849..63851,63999..64001,64071..64079))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0081"
FT   misc_feature    complement(order(63546..63548,63555..63557,63642..63650,
FT                   63777..63779,63969..63971,64068..64070))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0081"
FT   misc_feature    complement(63666..63668)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Tpen_0081"
FT   gene            64539..65021
FT                   /db_xref="GeneID:4601972"
FT                   /locus_tag="Tpen_0082"
FT   CDS_pept        64539..65021
FT                   /locus_tag="Tpen_0082"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719000"
FT                   /db_xref="GeneID:4601972"
FT                   /translation="MEELVKSVKETLNMIDAGIRDKKFPEQMRIYIEQLGRNLRHFIEV
FT                   IEVTGRENTIQSPISPSSRSAMFNLRKAFYATLSREIKQNKVDKERSLEEWRKVASRII
FT                   ETFEKRGLTEAPSKIILTYEIKEEDGKRYIAFRDARILYFGLEGILSVSLVEQPGA"
FT                   /protein_id="YP_919495.1"
FT   gene            complement(64964..65332)
FT                   /db_xref="GeneID:4600361"
FT                   /locus_tag="Tpen_0083"
FT   CDS_pept        complement(64964..65332)
FT                   /locus_tag="Tpen_0083"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719001"
FT                   /db_xref="GeneID:4600361"
FT                   /translation="MENVGRDVKALMRKLLLNSNAFFSNGYLNSEGRKVFEEMARFLVY
FT                   EKPFLKRRIRRVRKEGSLEEVVRLAESILGEEAVSEILRSQHQGPYAVKGSPDEALASL
FT                   QAPGCSTRLTDKIPSSPK"
FT                   /protein_id="YP_919496.1"
FT   gene            complement(65354..65488)
FT                   /db_xref="GeneID:4600758"
FT                   /locus_tag="Tpen_0084"
FT   CDS_pept        complement(65354..65488)
FT                   /locus_tag="Tpen_0084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719002"
FT                   /db_xref="GeneID:4600758"
FT                   /translation="MEELTMEEFLRKLAGKRIRVKNVEAAPPSLILESMGKVYRVRVK"
FT                   /protein_id="YP_919497.1"
FT   gene            65641..67482
FT                   /db_xref="GeneID:4600759"
FT                   /locus_tag="Tpen_0085"
FT   CDS_pept        65641..67482
FT                   /locus_tag="Tpen_0085"
FT                   /gene_family="HOG000258896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.16"
FT                   /note="Catalyzes the first step in hexosamine metabolism,
FT                   converting fructose-6P into glucosamine-6P using glutamine
FT                   as a nitrogen source"
FT                   /db_xref="GI:119719003"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="GeneID:4600759"
FT                   /translation="MGVFRGKNVCGIVGIVSEDLNVAPLVVECLRRLEYRGYDSVGVAV
FT                   LDDGKLFVRKGAGKIDSVDSAKCLKCLHGHTGVGHTRWATHGPPTDENAHPHVDCTGRL
FT                   AVVHNGILENYRELKSWLQERGHVFRSNTDTEVFAHLVEEYLKEEGDFFKAFKKSLKAI
FT                   RGSYALAVVTSLEPRKIFFARKHSPLVIGIADGKMFVASDIPAFLEYTNKVVILNDGEL
FT                   GYVEPRGLHLETLEGGVVDVNRRVIVVPWTAELARKEGFPHYMLKEIHEQPRVIAETIR
FT                   GFGPDYERGAELLSDAEVIYVVASGTSYHASLYFALLTMKIAGKKVIPLISSEYAGYVS
FT                   SASERDALLAVSQSGETIDTLMAMRAFKERGVRTVSLTNVIGSVISRESDHQVYMKAGP
FT                   EIGVAATKTFTVQLTALTWLSALIARNVGAMDEKDAESLLERMKKIPDLAEKVINAYSG
FT                   WCKETGTFMSEKSSAYYLSRGLGLPIALEGALKLKEIAYVHAEGYPAGESKHGPIALVE
FT                   RGFPVVFVSVERELEKKLLGNVEEMRARGAYTIGVVPQDSELRGHFDREVVVPSSDEVA
FT                   VPILATIPLQLVAYYSAVERGLDPDKPRNLAKTVTVE"
FT                   /transl_table="11"
FT                   /protein_id="YP_919498.1"
FT   misc_feature    65668..67479
FT                   /note="glucosamine--fructose-6-phosphate aminotransferase;
FT                   Reviewed; Region: PRK00331"
FT                   /db_xref="CDD:166912"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    65668..66315
FT                   /note="Glutamine amidotransferases class-II
FT                   (Gn-AT)_GFAT-type. This domain is found at the N-terminus
FT                   of glucosamine-6P synthase (GlmS, or GFAT in humans).  The
FT                   glutaminase domain catalyzes amide nitrogen transfer from
FT                   glutamine to the appropriate substrate...; Region: GFAT;
FT                   cd00714"
FT                   /db_xref="CDD:48478"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    order(65668..65670,65746..65748,65884..65889,65893..65898,
FT                   65923..65925,65965..65970,66040..66045)
FT                   /note="glutaminase active site; other site"
FT                   /db_xref="CDD:48478"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    66538..66912
FT                   /note="SIS (Sugar ISomerase) domain repeat 1 found in
FT                   Glucosamine 6-phosphate synthase (GlmS) and
FT                   Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is
FT                   found in many phosphosugar isomerases and phosphosugar
FT                   binding proteins. GlmS contains a N-terminal...; Region:
FT                   SIS_GlmS_GlmD_1; cd05008"
FT                   /db_xref="CDD:88405"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    order(66553..66558,66586..66591,66598..66603,66622..66624,
FT                   66628..66630,66640..66642,66649..66651,66715..66717)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88405"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    order(66559..66564,66694..66702)
FT                   /note="active site"
FT                   /db_xref="CDD:88405"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    67015..67473
FT                   /note="SIS (Sugar ISomerase) domain repeat 2 found in
FT                   Glucosamine 6-phosphate synthase (GlmS) and
FT                   Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is
FT                   found in many phosphosugar isomerases and phosphosugar
FT                   binding proteins. GlmS contains a N-terminal...; Region:
FT                   SIS_GlmS_GlmD_2; cd05009"
FT                   /db_xref="CDD:88406"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    order(67075..67077,67117..67119,67129..67131,67135..67137,
FT                   67141..67143,67147..67149,67159..67161,67165..67173,
FT                   67177..67188,67237..67242,67252..67254,67258..67263,
FT                   67450..67455,67468..67470)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88406"
FT                   /locus_tag="Tpen_0085"
FT   misc_feature    order(67111..67113,67120..67122)
FT                   /note="active site"
FT                   /db_xref="CDD:88406"
FT                   /locus_tag="Tpen_0085"
FT   gene            67524..68657
FT                   /db_xref="GeneID:4600657"
FT                   /locus_tag="Tpen_0086"
FT   CDS_pept        67524..68657
FT                   /locus_tag="Tpen_0086"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar-phosphate nucleotidyl transferase"
FT                   /transl_table="11"
FT                   /note="KEGG: pai:PAE3024 sugar-phosphate nucleotidyl
FT                   transferase"
FT                   /db_xref="GI:119719004"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="GeneID:4600657"
FT                   /translation="MRPLNEGYHKFMLKISGNPIFFYPLSSLLQAAGQRVILVVDREMQ
FT                   IDWVKEFLREKNYAHVEVRVQPGESLEDAFLTATKDVSDEWFLLVFGDVVAPPEALRML
FT                   METYEESQRPSALVIPRAEMSTYGVAYLSGMSIKKVYPGGDVGDSSFVLGGAFVLPVQF
FT                   LELVENGSGFFEALNTVVDKMGMDAALWTGSWVAVDYPWDLISALYEILGSSCKSVIHP
FT                   GARVSPLAVLEGCVIVEEGAYIDHYAVVRGPAYIGRNVLVGKGAFVREYTSLEEGSTVG
FT                   AFSEVKRSVLEPSATAGSYSLIVDSVLGPYSVAEPRTTVISEIRGEKRIARPLPLQGVL
FT                   SKKRKLGVFVAPRGRIAAGSVVGPGVLIHGDGRVEEV"
FT                   /protein_id="YP_919499.1"
FT   misc_feature    67524..68612
FT                   /note="Nucleoside-diphosphate-sugar pyrophosphorylase
FT                   involved in lipopolysaccharide biosynthesis/translation
FT                   initiation factor 2B, gamma/epsilon subunits
FT                   (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis,
FT                   outer membrane / Translation, ribosomal structure...;
FT                   Region: GCD1; COG1208"
FT                   /db_xref="CDD:31401"
FT                   /locus_tag="Tpen_0086"
FT   misc_feature    67524..68120
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="Tpen_0086"
FT   misc_feature    order(67638..67640,67794..67796,67800..67802)
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="Tpen_0086"
FT   misc_feature    68196..68645
FT                   /note="Left-handed parallel beta-Helix (LbetaH or LbH)
FT                   domain: The alignment contains 5 turns, each containing
FT                   three imperfect tandem repeats of a hexapeptide repeat
FT                   motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing
FT                   hexapeptide repeats are often enzymes...; Region: LbetaH;
FT                   cl00160"
FT                   /db_xref="CDD:107413"
FT                   /locus_tag="Tpen_0086"
FT   misc_feature    order(68409..68411,68415..68417,68427..68429,68433..68435,
FT                   68463..68465,68481..68483,68487..68489,68586..68588,
FT                   68601..68606,68610..68612,68640..68642)
FT                   /note="putative trimer interface; other site"
FT                   /db_xref="CDD:100038"
FT                   /locus_tag="Tpen_0086"
FT   misc_feature    order(68586..68588,68592..68597,68610..68612)
FT                   /note="putative CoA binding site; other site"
FT                   /db_xref="CDD:100038"
FT                   /locus_tag="Tpen_0086"
FT   gene            68664..69788
FT                   /db_xref="GeneID:4601398"
FT                   /locus_tag="Tpen_0087"
FT   CDS_pept        68664..69788
FT                   /locus_tag="Tpen_0087"
FT                   /gene_family="HOG000223163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   afu:AF1897 hypothetical protein"
FT                   /db_xref="GI:119719005"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:4601398"
FT                   /translation="MSSSERARVSVIVTVYRHARRLRSLLEALCNQETSFPVEVIVVAD
FT                   EPDEEVLGILREKACVKSLVSENRRGKVRALNEAISLSQGDVLIFLDNDVTVQDRKFVE
FT                   KIYKWLQDFDVAEIKKIARVDTFIGKLVYYDYMSFGVASYIFEKRVKRCAGLNGAAMAF
FT                   TRKALKELGGYRNVVLEDMDIGFRSFFHGFRYKYIWDTEVVVDPPSSLREWLNQRLRWS
FT                   VGAWTWIDDYVFHFSKIASIDYALESFAALFAMFPGGIVYASILLAEGLPLLKLGLLAG
FT                   STVGGLFAPLVPVLAIYETVSMFLPPLPLSLVAIAVAYSALVVPIAYRIGYKVKPQHFA
FT                   TYILFYSTLWFTVMLAGFIRVFVFRKRDVTGWQL"
FT                   /protein_id="YP_919500.1"
FT   misc_feature    68667..69752
FT                   /note="Glycosyltransferases, probably involved in cell wall
FT                   biogenesis [Cell envelope biogenesis, outer membrane];
FT                   Region: COG1215"
FT                   /db_xref="CDD:31408"
FT                   /locus_tag="Tpen_0087"
FT   misc_feature    68694..69206
FT                   /note="CESA_like is  the cellulose synthase superfamily;
FT                   Region: CESA_like; cd06423"
FT                   /db_xref="CDD:133045"
FT                   /locus_tag="Tpen_0087"
FT   misc_feature    68937..68945
FT                   /note="DXD motif; other site"
FT                   /db_xref="CDD:133045"
FT                   /locus_tag="Tpen_0087"
FT   gene            complement(69803..70297)
FT                   /db_xref="GeneID:4601655"
FT                   /locus_tag="Tpen_0088"
FT   CDS_pept        complement(69803..70297)
FT                   /locus_tag="Tpen_0088"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tko:TK0023 hypothetical protein"
FT                   /db_xref="GI:119719006"
FT                   /db_xref="GeneID:4601655"
FT                   /translation="MSSIPQLVEKIAGMVPGFRGYSGGSLSADDQLIRKKVSLILDEAR
FT                   LRVERLEFNVKRKNVSLGLRLDDLRIELMKASQLLKQPGASSPGKASIDDESLQRLLEE
FT                   DLKLISTASRIFERVVALTPALEPKEFLEKVNEAISLVVEAENVIRERDNLLKRVLLET
FT                   P"
FT                   /protein_id="YP_919501.1"
FT   gene            complement(70492..70656)
FT                   /db_xref="GeneID:4601057"
FT                   /locus_tag="Tpen_0089"
FT   CDS_pept        complement(70492..70656)
FT                   /locus_tag="Tpen_0089"
FT                   /gene_family="HOG000109203" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: det:DET0980 hypothetical protein"
FT                   /db_xref="GI:119719007"
FT                   /db_xref="GeneID:4601057"
FT                   /translation="MSHQKITAYCVKCRKQVEMKNPQQVTLKNGRLAYKGTCPNCGTTV
FT                   YRFIGRVKQ"
FT                   /protein_id="YP_919502.1"
FT   gene            70840..71190
FT                   /db_xref="GeneID:4601058"
FT                   /locus_tag="Tpen_0090"
FT   CDS_pept        70840..71190
FT                   /locus_tag="Tpen_0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   sso:SSO0931 hypothetical protein"
FT                   /db_xref="GI:119719008"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:4601058"
FT                   /translation="MSYSTTSEMAHLKAPCEEISRRVLPAVRSILVRYLYEQEGLTQLQ
FT                   IAKLLGISQSSVSRYLNSQRGLSQRDILEIPSIDEKLRETVHGIVEGKLRGEEALCSIC
FT                   QYIRMMSREVSG"
FT                   /protein_id="YP_919503.1"
FT   misc_feature    70894..>71154
FT                   /note="Predicted transcriptional regulator [General
FT                   function prediction only]; Region: COG2522"
FT                   /db_xref="CDD:32592"
FT                   /locus_tag="Tpen_0090"
FT   gene            complement(71159..72589)
FT                   /db_xref="GeneID:4601387"
FT                   /locus_tag="Tpen_0091"
FT   CDS_pept        complement(71159..72589)
FT                   /locus_tag="Tpen_0091"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-polyprenyl-4-hydroxybenzoate decarboxylase and
FT                   related decarboxylases-like"
FT                   /transl_table="11"
FT                   /note="KEGG: mta:Moth_0095 carboxylyase-related protein"
FT                   /db_xref="GI:119719009"
FT                   /db_xref="GeneID:4601387"
FT                   /translation="MSLKETLKLLESSDKLMRIGGELAPSIEIPWLSIQLSRETDKALL
FT                   YDRVKGGALSLATNLFYGKLPLVLNAPSVERIIERAARVLHLLSTPAAQPTDKLGLLAS
FT                   LAWIADYYPTVKEAPGGAVRILQGYDVNLLEMPFLKHSREEEYPVLVNPIIVASSRATG
FT                   DREIASQRVQVVDEKTMVLHVPRGSPLQFLIEKSSRSRSSLDVGILAGTVPALYPASLL
FT                   TWLTPVDKILLAGVLSESKISVVKTEEGLVIPYPTEVAIIGELEPGDERPEGRMLYENG
FT                   EVYGGSPMPVVHVKKILLSPSPVFYSSIIHPERSDVAQVYSLVASLLVLLMKSLAPEIQ
FT                   ELRFLGHDAFRTVIAKVATHRRERLLSIGGEILFLSAAVNPYVDTVILVGPDVDVEDPT
FT                   ILAKVLLENVDPDRDIIHVDQADAELLPRSSRRGKVIVLANAPGARGASRVESKLEKTP
FT                   ESERLFLELTRKLRGSSS"
FT                   /protein_id="YP_919504.1"
FT   misc_feature    complement(71243..72538)
FT                   /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
FT                   Region: UbiD; cl00311"
FT                   /db_xref="CDD:174100"
FT                   /locus_tag="Tpen_0091"
FT   gene            complement(72603..73013)
FT                   /db_xref="GeneID:4601085"
FT                   /locus_tag="Tpen_0092"
FT   CDS_pept        complement(72603..73013)
FT                   /locus_tag="Tpen_0092"
FT                   /gene_family="HOG000223164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sso:SSO0205 hypothetical protein"
FT                   /db_xref="GI:119719010"
FT                   /db_xref="GeneID:4601085"
FT                   /translation="MSEFVKLFAANLTNWVEAQKAFLDTVEAVEKNLENADRLELILTT
FT                   RAAFSHMVKTIEAFDKWLQDPFIVGHMPREMLLDVQRSVWEILKKLLELDIRHTTAFRD
FT                   MLLKLSEDGKLNPVFFMPRGEQKPEERFRVSY"
FT                   /protein_id="YP_919505.1"
FT   misc_feature    complement(72612..72983)
FT                   /note="Uncharacterized protein conserved in archaea
FT                   (DUF2153); Region: DUF2153; cl01966"
FT                   /db_xref="CDD:154683"
FT                   /locus_tag="Tpen_0092"
FT   gene            complement(73057..74619)
FT                   /db_xref="GeneID:4601385"
FT                   /locus_tag="Tpen_0093"
FT   CDS_pept        complement(73057..74619)
FT                   /locus_tag="Tpen_0093"
FT                   /gene_family="HOG000252767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative thymidine phosphorylase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: putative thymidine phosphorylase; PFAM:
FT                   glycosyl transferase, family 3; Pyrimidine nucleoside
FT                   phosphorylase, C-terminal domain; KEGG: tko:TK0352
FT                   thymidine phosphorylase"
FT                   /db_xref="GI:119719011"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="GeneID:4601385"
FT                   /translation="MVPVFEVVWMKLKTRILPFESAHYTVVLDQSVAKKLDVRPSDRVL
FT                   VRFNGKTVVAIANIAKEFSHEHVGVYVNIAKALGISDGDEVEVEATSPPASLQAIRKKL
FT                   QGLSLESDEIYQVVKDIVDGKLSELELAAFVTAVHFQGMTPSEIYSFTLSMVETGQRLR
FT                   LKRKPILDKHSLGGVPGDKTSLLVVPIIASLGFTIPKTSSRAITSAAGTADRMEVLAPV
FT                   NLSIDEIERIVEKTNACLVWGGALNLAPADDIIIRVEYPLGIDPFYIPSILAKKLAVGS
FT                   THVVLDVPTGRGTKVKTLEEAKRISQSFFEIARMFGMNLQAVATYAEEPIGHAIGPALE
FT                   AREALIALRELRPGDLVDKAASLAGTLLEMVGVENGYETAMEALRTGKAEKKLREIIEA
FT                   QGGDPDVTPEEIPLGDKTYTLYSEEDGFVYYIDNSLLANIGKIAGAPIDKGAGVYIHVK
FT                   LGEKVRKGDPLLTVYSSSSAKLQAVERILEDSKPVLVGRTAGRRMLLERIQYQPPRQLV
FT                   LER"
FT                   /protein_id="YP_919506.1"
FT   misc_feature    complement(73099..74553)
FT                   /note="thymidine phosphorylase; Provisional; Region:
FT                   PRK04350"
FT                   /db_xref="CDD:167804"
FT                   /locus_tag="Tpen_0093"
FT   misc_feature    complement(74143..74334)
FT                   /note="Glycosyl transferase family, helical bundle domain;
FT                   Region: Glycos_trans_3N; pfam02885"
FT                   /db_xref="CDD:145834"
FT                   /locus_tag="Tpen_0093"
FT   misc_feature    complement(<73708..74124)
FT                   /note="Glycosyl transferase family, a/b domain; Region:
FT                   Glycos_transf_3; pfam00591"
FT                   /db_xref="CDD:144256"
FT                   /locus_tag="Tpen_0093"
FT   misc_feature    complement(73171..73341)
FT                   /note="Pyrimidine nucleoside phosphorylase C-terminal
FT                   domain; Region: PYNP_C; pfam07831"
FT                   /db_xref="CDD:116444"
FT                   /locus_tag="Tpen_0093"
FT   gene            74694..76538
FT                   /db_xref="GeneID:4601386"
FT                   /locus_tag="Tpen_0094"
FT   CDS_pept        74694..76538
FT                   /locus_tag="Tpen_0094"
FT                   /gene_family="HOG000014651" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase-like; KEGG: pai:PAE3427 aldehyde
FT                   ferredoxin oxidoreductase (aor)"
FT                   /db_xref="GI:119719012"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="GeneID:4601386"
FT                   /translation="MAAKGWWGRVLWVDLSRKSTKVQELDGGILLSHVGGRGLAVRLLW
FT                   DYTSPGVDPLSPENLLVFSAGPITALPGPSTGKLVVASKSPLTHGYGDGNLGTRAAVML
FT                   RWAGYDAVVFKGKSPKPVYVYVENEKVEFLDADDLWGLDTFSAEKRLLERHGKDAGVLL
FT                   IGPSGERMVKMATVVSQSGRSGGRPGIGAVMGSKNLKAVVFRGDKMPEVAEQSLLRKTA
FT                   AEAYASAKSKPPYSFWMRQGTMATIQWSQENSVLPTFNFSEGVFDESSGIDGFAMERLK
FT                   VSQRGCPNCNSICGNVILDDEGAESELDYENVAMLGSNIGLGDLRKVARLNRLADMWGI
FT                   DTIGLGSALGFAIEASQRGLLKDRIEWGDFDKILELSREISLGEGPVGSVLSEGVEHAS
FT                   KVLGCEECAVHVKGLSVSAYDCHAAPGMALSYGVSSVGAHHKDAWVISWEVAHGRFEYS
FT                   KAKAKRVYELQRIRGGFFENLVACRLPWVELGLELDWYVKLFNYATGLSWTLDDHLKVA
FT                   DRTITLIRSYWVREYLAEGRRWGRQLDYPPLKWFTKPYTRGPLKGARLDPQKYDELLGN
FT                   YYELVGWDHRGVPRASTLERLGLSYVRTELQRMTELTN"
FT                   /transl_table="11"
FT                   /protein_id="YP_919507.1"
FT   misc_feature    74703..76499
FT                   /note="Aldehyde:ferredoxin oxidoreductase [Energy
FT                   production and conversion]; Region: COG2414"
FT                   /db_xref="CDD:32549"
FT                   /locus_tag="Tpen_0094"
FT   misc_feature    74709..75317
FT                   /note="Aldehyde ferredoxin oxidoreductase, N-terminal
FT                   domain; Region: AFOR_N; cl08354"
FT                   /db_xref="CDD:158266"
FT                   /locus_tag="Tpen_0094"
FT   misc_feature    75345..76490
FT                   /note="Aldehyde ferredoxin oxidoreductase, domains 2 & 3;
FT                   Region: AFOR_C; pfam01314"
FT                   /db_xref="CDD:144786"
FT                   /locus_tag="Tpen_0094"
FT   gene            76541..76771
FT                   /db_xref="GeneID:4601851"
FT                   /locus_tag="Tpen_0095"
FT   CDS_pept        76541..76771
FT                   /locus_tag="Tpen_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamineS protein"
FT                   /transl_table="11"
FT                   /note="PFAM: thiamineS protein"
FT                   /db_xref="GI:119719013"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="GeneID:4601851"
FT                   /translation="MSVRIIFYGFLIDVAKARELTVGVEKPTRLEEILGEGFLAKSGKD
FT                   LVVLVNDLPATLDTYVRPGDVVKILPHIGGG"
FT                   /protein_id="YP_919508.1"
FT   misc_feature    76547..76768
FT                   /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
FT                   /db_xref="CDD:176416"
FT                   /locus_tag="Tpen_0095"
FT   misc_feature    order(76640..76642,76679..76681,76754..76756)
FT                   /note="charged pocket; other site"
FT                   /db_xref="CDD:176352"
FT                   /locus_tag="Tpen_0095"
FT   misc_feature    order(76685..76696,76748..76753)
FT                   /note="hydrophobic patch; other site"
FT                   /db_xref="CDD:176352"
FT                   /locus_tag="Tpen_0095"
FT   gene            76839..77237
FT                   /db_xref="GeneID:4601570"
FT                   /locus_tag="Tpen_0096"
FT   CDS_pept        76839..77237
FT                   /locus_tag="Tpen_0096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719014"
FT                   /db_xref="GeneID:4601570"
FT                   /translation="MNASFLGSLLKVLYNRLTLTKGQIALASRLLASEVFGPAPESKLT
FT                   VIDAASKALSYLGLRAEVSIEKGVLTVSLPCPATECVLREICPVPYFVAASVDLLSGVK
FT                   CYPVQGGNGTVVSLSDGKCTFKLRVYEV"
FT                   /protein_id="YP_919509.1"
FT   gene            77227..77649
FT                   /db_xref="GeneID:4601714"
FT                   /locus_tag="Tpen_0097"
FT   CDS_pept        77227..77649
FT                   /locus_tag="Tpen_0097"
FT                   /gene_family="HOG000222346" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   pai:PAE2987 hypothetical protein"
FT                   /db_xref="GI:119719015"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="GeneID:4601714"
FT                   /translation="MRYRLTPSIVRGWLYCRVCGRCCENTEMILLEEDVERISSYTGLR
FT                   AEDFAERLGGRFKLKNVNGKCVFFDAEKGSCTIYPVRPIGCSLYPVVVDEYEGLTVDEY
FT                   CPLSKLVGSYEKEKAGAVLRALYPKLGLQPPPYRRP"
FT                   /protein_id="YP_919510.1"
FT   misc_feature    77269..77544
FT                   /note="Uncharacterized protein family (UPF0153); Region:
FT                   UPF0153; cl00497"
FT                   /db_xref="CDD:174245"
FT                   /locus_tag="Tpen_0097"
FT   gene            complement(77609..78292)
FT                   /db_xref="GeneID:4602014"
FT                   /locus_tag="Tpen_0098"
FT   CDS_pept        complement(77609..78292)
FT                   /locus_tag="Tpen_0098"
FT                   /gene_family="HOG000015512" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF120; KEGG:
FT                   afu:AF2106 putative transcriptional regulator"
FT                   /db_xref="GI:119719016"
FT                   /db_xref="InterPro:IPR002834"
FT                   /db_xref="GeneID:4602014"
FT                   /translation="MSKDYEVFPLLLEMAKRGCLVAPRRLSRIEILKTLGLTPWRFKKL
FT                   VEAAEEEGYIERRVHGRMVFYVVTERGRALLRRVYDDLKRTIDSSTFLTLRGYVVPGLG
FT                   EGAIYMGIPRYVEAFKEVLGYEPYPGTLNIKLVDEDVYLRRALREKRVGFRIEGFRLDE
FT                   GRESCGVTVYKAMIMANGVTVSGAALDIDKTKHGDEILELIAPVRLRDELRLKDGDKVE
FT                   VVIPV"
FT                   /protein_id="YP_919511.1"
FT   misc_feature    complement(77618..78265)
FT                   /note="Transcriptional regulator of a riboflavin/FAD
FT                   biosynthetic operon [Transcription / Coenzyme metabolism];
FT                   Region: COG1339"
FT                   /db_xref="CDD:31530"
FT                   /locus_tag="Tpen_0098"
FT   misc_feature    complement(77618..77998)
FT                   /note="Domain of unknown function DUF120; Region:
FT                   CTP-dep_RFKase; cl12259"
FT                   /db_xref="CDD:175419"
FT                   /locus_tag="Tpen_0098"
FT   gene            complement(78346..78747)
FT                   /db_xref="GeneID:4602015"
FT                   /locus_tag="Tpen_0099"
FT   CDS_pept        complement(78346..78747)
FT                   /locus_tag="Tpen_0099"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719017"
FT                   /db_xref="GeneID:4602015"
FT                   /translation="MASLELEDLLDLALGLAEKAIYVLLASYIVAFTAALLGVGEALKL
FT                   PPVAAAVYFTGALLLKVIRGVLPSLQGRGAYLFALAPSTVGLAALINALFNYAETRVEL
FT                   YAYAVMAVIFALKVYSEKRGYVVIMAGSP"
FT                   /protein_id="YP_919512.1"
FT   gene            78832..79392
FT                   /db_xref="GeneID:4601252"
FT                   /locus_tag="Tpen_0100"
FT   CDS_pept        78832..79392
FT                   /locus_tag="Tpen_0100"
FT                   /gene_family="HOG000223166" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidase, zinc-dependent"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase, zinc-dependent; KEGG: afu:AF0330
FT                   hypothetical protein"
FT                   /db_xref="GI:119719018"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="GeneID:4601252"
FT                   /translation="MAEYLVRLYPVNIAPERVEWLKEQLTRIFNAEVLVDTKTVGFGTV
FT                   LRFFDEERDQVNAEYLLEELKNRIGVTPSQRALVVIGADGYVEGLNFVFGVANDGWGGI
FT                   VFTERLNPEFYGEQFSEELFRARLLKEAIHELGHSFGLGHCRQNCVMRFSNSVYDVDSK
FT                   PPFFCKRCSAAISRYYPGLLRII"
FT                   /protein_id="YP_919513.1"
FT   misc_feature    <78967..79347
FT                   /note="Peptidase family M54; Region: Peptidase_M54;
FT                   cl00835"
FT                   /db_xref="CDD:174414"
FT                   /locus_tag="Tpen_0100"
FT   gene            complement(79398..80129)
FT                   /db_xref="GeneID:4601716"
FT                   /locus_tag="Tpen_0101"
FT   CDS_pept        complement(79398..80129)
FT                   /locus_tag="Tpen_0101"
FT                   /gene_family="HOG000222847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   sso:SSO0456 hypothetical protein"
FT                   /db_xref="GI:119719019"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="GeneID:4601716"
FT                   /translation="MSRVEDSVQQRKAELRRSVWSKLERMEVAISPRPCYGKIPSFVGI
FT                   HSATQRLIKTDVYRNARVVYSTPDTSTRLLREETLRRGKTLVVSIPGLKGYVIVRPDEL
FT                   EPGDVRLASSVKGAVTKGDRITLLEGLKIDLVVLGSVAVNTDGARLGRGDGMHDLEYAL
FT                   LREMYAVAESTPVATLVHDLQILEEPIPMLMHDVPIDYIASPYRLITVERKHRKPPGVI
FT                   WEMLPIDFIKSTPILRRLFGI"
FT                   /protein_id="YP_919514.1"
FT   misc_feature    complement(79515..80096)
FT                   /note="5-formyltetrahydrofolate cyclo-ligase family;
FT                   Region: 5-FTHF_cyc-lig; cl00360"
FT                   /db_xref="CDD:174145"
FT                   /locus_tag="Tpen_0101"
FT   gene            80302..80550
FT                   /db_xref="GeneID:4600864"
FT                   /locus_tag="Tpen_0102"
FT   CDS_pept        80302..80550
FT                   /locus_tag="Tpen_0102"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CopG family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: tko:TK2270 hypothetical protein"
FT                   /db_xref="GI:119719020"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="GeneID:4600864"
FT                   /translation="MTQRPELSKSFYITERGDYTSVTKIVSVKLPVGLIDALDELIQKG
FT                   YFQNRSDAIREAIRKLLTNYRELDSRKISSGLMVGLR"
FT                   /protein_id="YP_919515.1"
FT   misc_feature    80365..>80517
FT                   /note="Uncharacterized protein family (UPF0156); Region:
FT                   RHH_2; cl01448"
FT                   /db_xref="CDD:163980"
FT                   /locus_tag="Tpen_0102"
FT   gene            complement(80567..80914)
FT                   /db_xref="GeneID:4600865"
FT                   /locus_tag="Tpen_0103"
FT   CDS_pept        complement(80567..80914)
FT                   /locus_tag="Tpen_0103"
FT                   /gene_family="HOG000269896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA synthetase, beta subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase, beta subunit;
FT                   PFAM: t-RNA-binding domain protein; KEGG: afu:AF1453
FT                   methionyl-tRNA synthetase (MetS)"
FT                   /db_xref="GI:119719021"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="GeneID:4600865"
FT                   /translation="MGYERYCMSQITISEFQRLDIRIGRILSAEPIKRSDKLLLLKVDL
FT                   GTEQRQIVAGLAPYYKPEELVGKEVAVLANLQPKTIMGFVSQGMLLAAVEDGKPVLLVP
FT                   EKEVKVGAKVS"
FT                   /protein_id="YP_919516.1"
FT   misc_feature    complement(80570..80884)
FT                   /note="tRNA-binding-domain-containing Escherichia coli
FT                   methionyl-tRNA synthetase (EcMetRS)-like proteins.  This
FT                   family includes EcMetRS and Aquifex aeolicus Trbp111
FT                   (AaTrbp111). This domain has general tRNA binding
FT                   properties.  MetRS aminoacylates methionine...; Region:
FT                   tRNA_bind_EcMetRS_like; cd02800"
FT                   /db_xref="CDD:48402"
FT                   /locus_tag="Tpen_0103"
FT   misc_feature    complement(order(80570..80581,80591..80593,80600..80602,
FT                   80606..80608,80612..80614,80630..80641,80675..80677,
FT                   80684..80692,80738..80740,80879..80881))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48402"
FT                   /locus_tag="Tpen_0103"
FT   misc_feature    complement(order(80648..80650,80657..80659,80678..80680,
FT                   80690..80692,80768..80770,80804..80806))
FT                   /note="putative tRNA-binding site; other site"
FT                   /db_xref="CDD:48402"
FT                   /locus_tag="Tpen_0103"
FT   gene            81045..81347
FT                   /db_xref="GeneID:4600476"
FT                   /locus_tag="Tpen_0104"
FT   CDS_pept        81045..81347
FT                   /locus_tag="Tpen_0104"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719022"
FT                   /db_xref="GeneID:4600476"
FT                   /translation="MVGKQSFDRKVIFTEADLILLSLLNGEKKISDLRQAASLSTTSIY
FT                   NNINKLLEWGLIEDDRVGSPGNRIIRLTEKGLRVARILKMLEDELTPKVVELKPE"
FT                   /protein_id="YP_919517.1"
FT   misc_feature    81099..81302
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Tpen_0104"
FT   gene            81360..81926
FT                   /db_xref="GeneID:4600656"
FT                   /locus_tag="Tpen_0105"
FT   CDS_pept        81360..81926
FT                   /locus_tag="Tpen_0105"
FT                   /gene_family="HOG000078666" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isochorismatase hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: tac:Ta0454
FT                   isochorismatase"
FT                   /db_xref="GI:119719023"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR003881"
FT                   /db_xref="GeneID:4600656"
FT                   /translation="MPKYAVLVIDMLEEFVRGRLRAENAEKIVKPIKRLIDFAHETGIP
FT                   VIHAVDQHYPDVDFEFRLWGAHAVRGAAESKIVEELAPSEKDFVVPKRRYDAFMFTDLD
FT                   MLLRELGVTTLIVTGIHTHICVQQTVLGAFYRGYSVIVPLECVAAFNDTWHKIGLDYMK
FT                   NYANATLMNLDELLEKLSREVHTKQ"
FT                   /protein_id="YP_919518.1"
FT   misc_feature    81369..81884
FT                   /note="Isochorismatase family; Region: Isochorismatase;
FT                   pfam00857"
FT                   /db_xref="CDD:144449"
FT                   /locus_tag="Tpen_0105"
FT   misc_feature    81372..81848
FT                   /note="Cysteine hydrolases; This family contains
FT                   amidohydrolases, like CSHase (N-carbamoylsarcosine
FT                   amidohydrolase), involved in creatine metabolism and
FT                   nicotinamidase, converting nicotinamide to nicotinic acid
FT                   and ammonia in the pyridine nucleotide cycle. It...;
FT                   Region: cysteine_hydrolases; cd00431"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Tpen_0105"
FT   misc_feature    order(81387..81389,81633..81635,81732..81734)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Tpen_0105"
FT   misc_feature    81717..81722
FT                   /note="conserved cis-peptide bond; other site"
FT                   /db_xref="CDD:29548"
FT                   /locus_tag="Tpen_0105"
FT   gene            complement(81929..82816)
FT                   /db_xref="GeneID:4600854"
FT                   /locus_tag="Tpen_0106"
FT   CDS_pept        complement(81929..82816)
FT                   /locus_tag="Tpen_0106"
FT                   /gene_family="HOG000045294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   mth:MTH893 integrase-recombinase protein"
FT                   /db_xref="GI:119719024"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="GeneID:4600854"
FT                   /translation="MSSVKAPFAERSNDELIDLYISHLVARNRSEKTIKSFKSILEEFV
FT                   RFLGDRHVSQVTVYDVDFFLAHLRRKGWKKDSIYTAAVAVKRFLEFLGLGGNIAGFELP
FT                   KREKRLPRYLEAEEVFRMVNAAENLRDKLIVLLLFTTGLRVSELVSLRVSDVDLEKRTL
FT                   RVRGKGSKERLVYFPDYVADLLRSYMKGLNSEWLFPSETAEHIHYTTVERVLKRLKEKA
FT                   GIEKKVTPHTLRHSFATLSLAAGLDIREIQELLGHSNLNTTQVYAHVSRERLKRDYERV
FT                   WSSLLDPRSAKEQS"
FT                   /protein_id="YP_919519.1"
FT   misc_feature    complement(81977..82774)
FT                   /note="site-specific tyrosine recombinase XerC; Reviewed;
FT                   Region: xerC; PRK00236"
FT                   /db_xref="CDD:166866"
FT                   /locus_tag="Tpen_0106"
FT   misc_feature    complement(81983..82768)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Tpen_0106"
FT   misc_feature    complement(order(82019..82021,82124..82132,82313..82315,
FT                   82382..82387))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Tpen_0106"
FT   misc_feature    complement(order(82019..82021,82046..82048,82115..82117,
FT                   82124..82126,82313..82315,82385..82387))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Tpen_0106"
FT   misc_feature    complement(order(82019..82021,82046..82048,82115..82117,
FT                   82124..82126,82385..82387))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Tpen_0106"
FT   gene            complement(82818..83285)
FT                   /db_xref="GeneID:4601010"
FT                   /locus_tag="Tpen_0107"
FT   CDS_pept        complement(82818..83285)
FT                   /locus_tag="Tpen_0107"
FT                   /gene_family="HOG000227641" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   pai:PAE3481 hypothetical protein"
FT                   /db_xref="GI:119719025"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="GeneID:4601010"
FT                   /translation="MSEEEVKYYKADIAGLYPIKVPQPEGEQTAYLLLLETAEWKDKAL
FT                   PIIIGENEGLAIQSALMGVKYERPMTHDLIVSILDALGVEVEKVSIDALLNNSVYTATI
FT                   YLKRTVNGKVEEINVDSRPSDGIAIAVRTGSPIYVAAHLEKHARRLEELGI"
FT                   /protein_id="YP_919520.1"
FT   misc_feature    complement(82845..83255)
FT                   /note="Uncharacterized ACR, COG1259; Region: DUF151;
FT                   cl00553"
FT                   /db_xref="CDD:153848"
FT                   /locus_tag="Tpen_0107"
FT   gene            complement(83282..83941)
FT                   /db_xref="GeneID:4601011"
FT                   /locus_tag="Tpen_0108"
FT   CDS_pept        complement(83282..83941)
FT                   /locus_tag="Tpen_0108"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pai:PAE1141 hypothetical protein"
FT                   /db_xref="GI:119719026"
FT                   /db_xref="GeneID:4601011"
FT                   /translation="MDWMSGELEKQYRALLRVYLYRSFGNLSEQEAEYMLEVAYADFLN
FT                   YIAVERDVIFEEGYEGAVLMILRDMYLNNEMELDKTLSEWFEVWAWKWRQRVKLALKEE
FT                   EESKLASEVENKVQALLPKVSKLYEWAKRYAIGSLVRHGEVCFTNLLAETVVKEVFFKV
FT                   ASSEEPEKAAKFLSENPAFIISEIAKRVKELSAFKGNLVVVRLNPLFFESQRGENV"
FT                   /protein_id="YP_919521.1"
FT   gene            complement(84299..84991)
FT                   /db_xref="GeneID:4601130"
FT                   /locus_tag="Tpen_0109"
FT   CDS_pept        complement(84299..84991)
FT                   /locus_tag="Tpen_0109"
FT                   /gene_family="HOG000132014" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pab:PAB2113 hypothetical protein"
FT                   /db_xref="GI:119719027"
FT                   /db_xref="GeneID:4601130"
FT                   /translation="MSVEEIFEKALSENRKNLSLGEAFAVCEYYGLPLLGYRFIGVDEE
FT                   VPEALGLSYPVVVKVDSPDIVHKTEYGGVKTGIKSREELVKAIEDIKRSVKAKNPNARI
FT                   NGFIVQEQVSNAHEVIIGGLKDEQFGPVIAFGLGGVLVEILRDVAFDIAPITPQEARDL
FT                   ITRIKGYQILEGYRGIPKANIDALSEVLSKASRMFADIAKYVKEMDLNPTFVSSEWVKI
FT                   ADARFTLL"
FT                   /protein_id="YP_919522.1"
FT   misc_feature    complement(<84338..84955)
FT                   /note="Acyl-CoA synthetase (NDP forming) [Energy production
FT                   and conversion]; Region: COG1042"
FT                   /db_xref="CDD:31244"
FT                   /locus_tag="Tpen_0109"
FT   gene            complement(84998..86218)
FT                   /db_xref="GeneID:4601399"
FT                   /locus_tag="Tpen_0110"
FT   CDS_pept        complement(84998..86218)
FT                   /locus_tag="Tpen_0110"
FT                   /gene_family="HOG000230163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; KEGG: pai:PAE2053 pleiotropic regulatory protein,
FT                   conjectural"
FT                   /db_xref="GI:119719028"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="GeneID:4601399"
FT                   /translation="MEIPAIEGGKPVREKFKEYYPTFTEREKSLVLDALSSGRLVYSSG
FT                   SYVKRFEEEFARYVGVRHAVATINGTAALHTAVASLGIGPGDEVITTPFSFVATATAIL
FT                   HHNAIPVFGDIELESLNLDPETIVDKITSRTKAILVVHLAGYPAEMDEILKIAREHGLY
FT                   VIEDCAQAIGSEYRGRKVGGIGDVGAFSFYQTKNMTTGEGGMVTTNRDDVYAYARMFVD
FT                   QGQEAKYYHSILGWNYRMTELQGALGLGQLERVDQLNENRARIAKVYLDELQGLDGDLV
FT                   LLPKVRPYVKHTWHIFQVLLNLEKLRVDRDRVLEALRAENVLALVAYPRVIYENPLFQR
FT                   MIGYGKGCPWKCPFYGGSVSYRKGLAPKAEMAARSVITLPTLAGMDEEDAIDTAKALKK
FT                   VLLYYKR"
FT                   /protein_id="YP_919523.1"
FT   misc_feature    complement(85049..86179)
FT                   /note="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis
FT                   [Cell envelope biogenesis, outer membrane]; Region: WecE;
FT                   COG0399"
FT                   /db_xref="CDD:30748"
FT                   /locus_tag="Tpen_0110"
FT   misc_feature    complement(85052..86140)
FT                   /note="3-amino-5-hydroxybenzoic acid synthase family
FT                   (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
FT                   (PLP)-dependent aspartate aminotransferase superfamily
FT                   (fold I). The members of this CD are involved in various
FT                   biosynthetic pathways for secondary...; Region: AHBA_syn;
FT                   cd00616"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="Tpen_0110"
FT   misc_feature    complement(order(85238..85240,85631..85636,85646..85648,
FT                   85709..85711,85718..85720,86006..86011))
FT                   /note="inhibitor-cofactor binding pocket; inhibition site"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="Tpen_0110"
FT   misc_feature    complement(order(85631..85633,85646..85648,85709..85711,
FT                   85718..85720,85934..85936,86006..86011))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="Tpen_0110"
FT   misc_feature    complement(85631..85633)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99740"
FT                   /locus_tag="Tpen_0110"
FT   gene            complement(86273..87076)
FT                   /db_xref="GeneID:4600997"
FT                   /locus_tag="Tpen_0111"
FT   CDS_pept        complement(86273..87076)
FT                   /locus_tag="Tpen_0111"
FT                   /gene_family="HOG000222685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal dependent phosphohydrolase"
FT                   /transl_table="11"
FT                   /note="SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: ape:APE1666 hypothetical protein"
FT                   /db_xref="GI:119719029"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="GeneID:4600997"
FT                   /translation="MCEGKTLVSKSIIEKWKKADAFVARLVDYLESDEEVAALLEMSNI
FT                   NAVQRLGYNDHGPVHARIVAGTSLEILSMLTRSSVELSSLKHGTARSLDEVKFILVAAS
FT                   YLHDIGNSIHREYHEATGSLLAKDIVDRALRYTFPEMETRRRVFLRQEVLSAIFSTEMN
FT                   TKPLTVEASIVKLADGLDMSEGRARLSYKLGKIDMHSLSALNVKRVELTCSEQVPIVVE
FT                   VYMGDMAGFFQVERVLLPKLESSKLKGMVRIDIFDGSGRKVASLT"
FT                   /protein_id="YP_919524.1"
FT   misc_feature    complement(86318..87049)
FT                   /note="HD supefamily hydrolase [General function prediction
FT                   only]; Region: COG3294"
FT                   /db_xref="CDD:33103"
FT                   /locus_tag="Tpen_0111"
FT   misc_feature    complement(<86534..86815)
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Tpen_0111"
FT   gene            complement(87169..88485)
FT                   /db_xref="GeneID:4600998"
FT                   /locus_tag="Tpen_0112"
FT   CDS_pept        complement(87169..88485)
FT                   /locus_tag="Tpen_0112"
FT                   /gene_family="HOG000072173" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase; KEGG: mja:MJ0232 enolase"
FT                   /db_xref="GI:119719030"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="GeneID:4600998"
FT                   /translation="MTMRYNMEDEFSITHVKARWVLDSRGNPTVEAEVRTFAGGYGSAI
FT                   VPSGASTGTHEALELRDGGKRFHGKGVSKAVENVNKIIAPEILGEDSRKQEEIDSKMIS
FT                   LDGTPNKSRLGANAILSVSLAVAHAAADTYGLPLFQYLGGALASTLPVPLMNIINGGKH
FT                   AGNELKIQEFLIVPVGASSFSEALAIGSEVYHSLRGYLKEKYGVSAINVGDEGGFAPPM
FT                   SRTREALDALIHAVKNAGYEPGRDVVLALDAAASEFYDEKRGVYAIDGAELTREKLIEF
FT                   YESLVEEYPIVSIEDPLYEEDFEGFAEVTRSLKIQVVGDDLFVTNVERLRRGIEAGAAN
FT                   ALLLKVNQIGTLTEALSAARMALENNYSVIVSHRSGETEDVTISHIAVALNAGQIKTGA
FT                   PARSERNAKYNELLRIEEYLGGRARYPGIKAFKAYKRTL"
FT                   /transl_table="11"
FT                   /protein_id="YP_919525.1"
FT   misc_feature    complement(87181..88458)
FT                   /note="phosphopyruvate hydratase; Provisional; Region: eno;
FT                   PRK00077"
FT                   /db_xref="CDD:166769"
FT                   /locus_tag="Tpen_0112"
FT   misc_feature    complement(87232..88440)
FT                   /note="Enolase: Enolases are homodimeric enzymes that
FT                   catalyse the reversible dehydration of
FT                   2-phospho-D-glycerate to phosphoenolpyruvate as part of the
FT                   glycolytic and gluconeogenesis pathways. The reaction is
FT                   facilitated by the presence of metal ions; Region: enolase;
FT                   cd03313"
FT                   /db_xref="CDD:48188"
FT                   /locus_tag="Tpen_0112"
FT   misc_feature    complement(order(87235..87237,87244..87249,87256..87258,
FT                   87265..87270,87274..87282,87349..87357,87823..87825,
FT                   87829..87831,87850..87855,87898..87903,87910..87915,
FT                   87922..87927,87988..87996,88357..88359,88393..88395,
FT                   88405..88431,88435..88437))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48188"
FT                   /locus_tag="Tpen_0112"
FT   misc_feature    complement(order(87526..87528,87601..87603,87730..87732,
FT                   88333..88335))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:48188"
FT                   /locus_tag="Tpen_0112"
FT   misc_feature    complement(order(87298..87300,87361..87369,87451..87453,
FT                   87841..87843,87997..87999))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:48188"
FT                   /locus_tag="Tpen_0112"
FT   gene            88618..89382
FT                   /db_xref="GeneID:4601055"
FT                   /locus_tag="Tpen_0113"
FT   CDS_pept        88618..89382
FT                   /locus_tag="Tpen_0113"
FT                   /gene_family="HOG000283478" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleotidyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: ape:APE0255
FT                   mannose-1-phosphate guanyltransferase"
FT                   /db_xref="GI:119719031"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="GeneID:4601055"
FT                   /translation="MPQNFGVVLCGGEGKRLRPLTYYFQKAMIPVGTQQKPLLEYIVRL
FT                   LAYHGLRRIILLVGYKGQQIVNYFNSGERYGVNISYVWDDPNYGGNGGALFNAYVRGFF
FT                   EGSDNILVYYGDILSDINLSDFLSFHERGQYAATLALSPNYRVAVGVAELDGDRVVKLV
FT                   EKPPLGKPVTIGVVAIRTKALEYLRELVEEKREVDIMGDFIRVLLERGLKVGGYLTNSF
FT                   WFDLGTTEAYEKLDPVEVDRRFSFLFQSRESP"
FT                   /protein_id="YP_919526.1"
FT   misc_feature    88633..89298
FT                   /note="NTP_transferases catalyze the transfer of
FT                   nucleotides onto phosphosugars; Region: NTP_transferase;
FT                   cd04181"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="Tpen_0113"
FT   misc_feature    order(88642..88653,88693..88698,88867..88869,88957..88959,
FT                   88963..88968)
FT                   /note="active site"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="Tpen_0113"
FT   misc_feature    order(88642..88650,88786..88788,88957..88959,88963..88965)
FT                   /note="Substrate binding site; other site"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="Tpen_0113"
FT   misc_feature    order(88963..88965,89290..89292,89296..89298)
FT                   /note="Mg++ binding site; other site"
FT                   /db_xref="CDD:133024"
FT                   /locus_tag="Tpen_0113"
FT   gene            complement(89300..90499)
FT                   /db_xref="GeneID:4600646"
FT                   /locus_tag="Tpen_0114"
FT   CDS_pept        complement(89300..90499)
FT                   /locus_tag="Tpen_0114"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: mta:Moth_0444 geranylgeranyl
FT                   reductase"
FT                   /db_xref="GI:119719032"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:4600646"
FT                   /translation="MGLIEGRYEAVVIGLGPAGAAALKRLQELGIKAVGIERKKAPEEP
FT                   AVCGEFLPEPSAIEFISRFPSVRKAYEYIGLARRTNAIRRIILSFAGGKTYNLEIPGFT
FT                   VSRKEMVSKLIEGSDYVTGSDVVGIRRVGDAYLVKTRRGKEFSASYVIAADGFPSATRR
FT                   LLGLPAGLQPEDYAVGVNLKMETPSMPRDTIFMYASSFTQGGYAWIIPVGDGLSNVGIG
FT                   LRFNYVKKGANPLKALTSFVELERRGFLDSSRQLEEPRSRMIPVSGFYSEPSTGKVLFA
FT                   GDSLGAVNPINGGGIFTAMALGILAAESVWLGNPGIYDERSWREIGQVLSIGRAYRVLV
FT                   DFLYEHFDHVAVLTALFPRFLLEKILKGEKTPIKGILEIGIGRKTSYRPPRGQASRKPP
FT                   "
FT                   /protein_id="YP_919527.1"
FT   misc_feature    complement(<89573..90487)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase;
FT                   Region: Pyr_redox; cl14644"
FT                   /db_xref="CDD:176943"
FT                   /locus_tag="Tpen_0114"
FT   misc_feature    complement(89336..90481)
FT                   /note="Dehydrogenases (flavoproteins) [Energy production
FT                   and conversion]; Region: FixC; COG0644"
FT                   /db_xref="CDD:30989"
FT                   /locus_tag="Tpen_0114"
FT   gene            complement(90518..90874)
FT                   /db_xref="GeneID:4602164"
FT                   /locus_tag="Tpen_0115"
FT   CDS_pept        complement(90518..90874)
FT                   /locus_tag="Tpen_0115"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PadR-like family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: tko:TK1143 transcription regulator, PadR-like family"
FT                   /db_xref="GI:119719033"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="GeneID:4602164"
FT                   /translation="MAQNSKEVRLKREKIRVNTVIKLYTLILLAEGEKHGYELMRTLEQ
FT                   MIEAPIGPSQIYPFLRNLENAGLVTSREAGSRDKKVYSLTPQGYEFLKEILEKSLNVIQ
FT                   TAIRVLGREKVCLP"
FT                   /protein_id="YP_919528.1"
FT   misc_feature    complement(<90581..90817)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Tpen_0115"
FT   gene            complement(90942..91565)
FT                   /db_xref="GeneID:4601173"
FT                   /locus_tag="Tpen_0116"
FT   CDS_pept        complement(90942..91565)
FT                   /locus_tag="Tpen_0116"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: gme:Gmet_1167
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="GI:119719034"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="GeneID:4601173"
FT                   /translation="METLDKLFESGVYSPTNFAMSLGLDRKLRGIVYNLARGRVLDVGC
FT                   GDGYYSLPLLENAQEVVCVDPLARKGSESDPRLHVVKAIAEYLPLRSKSVEFSTAMFSF
FT                   RDFLDKPRGLSEMKRASRIGVFIVEIFNPSTWFRPFLYAYVLFIAPLLAFLVSRGKGKG
FT                   WRLLYPTIRIMPRASLFERMGGKVLVSKGFGSLAIVYLPVNPRG"
FT                   /protein_id="YP_919529.1"
FT   misc_feature    complement(91017..91565)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Tpen_0116"
FT   gene            complement(91588..92496)
FT                   /db_xref="GeneID:4601174"
FT                   /locus_tag="Tpen_0117"
FT   CDS_pept        complement(91588..92496)
FT                   /locus_tag="Tpen_0117"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polyprenyl synthetase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: sto:ST0487
FT                   hypothetical isoprenyl diphosphate synthase"
FT                   /db_xref="GI:119719035"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="GeneID:4601174"
FT                   /translation="MASLASIEDRIAYLGGLLTRYSGDRVKELFPEIVEEASYALFGGK
FT                   MLRGTLSLLVASMFTAQVEKVLPIALAVELMHAASLVHDDIADASPTRRGRPSFWSKYG
FT                   LEDAITVPHVLMPVAISLVADAGVEAVKESMNAWRRSALGQLWDTRILRGREVPVGYEK
FT                   LIEYKTAAVFEASCTLPLIAIGRRDIVESGRVYGRFFGLLYQVLDDFSDAERGVVDSGS
FT                   TRLLLREASRSSGSLAEYVEGLAGRYFGMLVEVSGQLESSLVDFAYASMNAFAREAGEH
FT                   VARVVRAITSGKHGVGKFQRT"
FT                   /protein_id="YP_919530.1"
FT   misc_feature    complement(<91855..92406)
FT                   /note="Isoprenoid Biosynthesis enzymes, Class 1; Region:
FT                   Isoprenoid_Biosyn_C1; cl00210"
FT                   /db_xref="CDD:174035"
FT                   /locus_tag="Tpen_0117"
FT   misc_feature    complement(order(91861..91863,91873..91875,91882..91887,
FT                   91978..91980,92233..92235,92245..92247,92254..92259,
FT                   92266..92268,92353..92355))
FT                   /note="substrate binding pocket; other site"
FT                   /db_xref="CDD:173830"
FT                   /locus_tag="Tpen_0117"
FT   misc_feature    complement(order(91861..91863,91870..91875,92233..92235,
FT                   92242..92247))
FT                   /note="substrate-Mg2+ binding site; other site"
FT                   /db_xref="CDD:173830"
FT                   /locus_tag="Tpen_0117"
FT   misc_feature    complement(92233..92247)
FT                   /note="aspartate-rich region 1; other site"
FT                   /db_xref="CDD:173830"
FT                   /locus_tag="Tpen_0117"
FT   misc_feature    complement(order(91861..91869,91870..91875))
FT                   /note="aspartate-rich region 2; other site"
FT                   /db_xref="CDD:173830"
FT                   /locus_tag="Tpen_0117"
FT   gene            92553..93383
FT                   /db_xref="GeneID:4601607"
FT                   /locus_tag="Tpen_0118"
FT   CDS_pept        92553..93383
FT                   /locus_tag="Tpen_0118"
FT                   /gene_family="HOG000201526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TatD family hydrolase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: mka:MK0546 Mg-dependent DNase"
FT                   /db_xref="GI:119719036"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="GeneID:4601607"
FT                   /translation="MIDAHCHLTYPGLKERVENVLAEARRALKAVVTSGLPYDAEKSPG
FT                   FPGAKEALALSERYRGFVFVTLGLHPTQVPEMSDEEVAEYINFIEENRDRIVGIGEIGL
FT                   DKYWLSSEDDLKRAREVFLSLLEVAEKLGKPVVIHSRKAEEEAVEILSSYSLDGRVLLH
FT                   SFTGNMTTAKKALDMGYFFSINYKVTNTKSMRKIAKTFPLESILTETDSPFLSHEAGVN
FT                   TPLQVRLILEEISRLRGLGFEEVDAITTRNAVSFFGLEKQTSERTSDKSLPRDT"
FT                   /protein_id="YP_919531.1"
FT   misc_feature    92553..93326
FT                   /note="TatD like proteins;  E.coli TatD is a cytoplasmic
FT                   protein, shown to have magnesium dependent DNase activity;
FT                   Region: TatD_DNAse; cd01310"
FT                   /db_xref="CDD:30053"
FT                   /locus_tag="Tpen_0118"
FT   misc_feature    92556..93329
FT                   /note="putative deoxyribonuclease YjjV; Provisional;
FT                   Region: PRK11449"
FT                   /db_xref="CDD:171118"
FT                   /locus_tag="Tpen_0118"
FT   misc_feature    order(92565..92567,92571..92573,92967..92969,93039..93041,
FT                   93183..93185)
FT                   /note="active site"
FT                   /db_xref="CDD:30053"
FT                   /locus_tag="Tpen_0118"
FT   gene            93423..94901
FT                   /db_xref="GeneID:4600921"
FT                   /locus_tag="Tpen_0119"
FT   CDS_pept        93423..94901
FT                   /locus_tag="Tpen_0119"
FT                   /gene_family="HOG000008988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; RimK
FT                   domain protein ATP-grasp; KEGG: mja:MJ1229 pyruvate
FT                   carboxylase subunit A"
FT                   /db_xref="GI:119719037"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="GeneID:4600921"
FT                   /translation="MGEIRKLLVANRGEIAVRIFRTARDLGIKTVAVYSDADKLSLHRL
FT                   LADESYYLGPPEPAKSYLNAERIVKIAVSAGADAVHPGYGFLSQNPSFARMVIEEGLIW
FT                   VGPKPETMKLVGDKLGARKFFSSKGIPVVPGAFEAVDFNSALSIAEEIGFPVIVKPAGG
FT                   GGGIGMFVAHTPEDLEKNLEKARQLAGSAFARTEVYVEKYFPRAKHIEVQILGDKRGRV
FT                   VHLFERECSVQRRYQKVVEEAPSPSLTQEEREKLLSAAVKAAEACGYENAGTFEFLFDV
FT                   ESRNFYFLEVNSRIQVEHPVTELVTGLDIVKLQLTVAEGGEIPFRQGEVQLRGHAIEAR
FT                   VYAEDPSSGFIPSPGRITYLREPAGPWVRVDSGVYEGFEVPPFYDPLLMKVVSWGQDRE
FT                   EARTRLLRALNELRISGVKHNKYLIVRVLEDARFRDASYTTRLLEDPAFYENLLSEDPA
FT                   PDAERRIVQAQEGGEKGERTRINAWRVLARIHPG"
FT                   /protein_id="YP_919532.1"
FT   misc_feature    93432..94754
FT                   /note="acetyl-CoA carboxylase biotin carboxylase subunit;
FT                   Validated; Region: PRK08591"
FT                   /db_xref="CDD:169508"
FT                   /locus_tag="Tpen_0119"
FT   misc_feature    93432..93758
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Tpen_0119"
FT   misc_feature    93771..94382
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Tpen_0119"
FT   misc_feature    94434..94754
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Tpen_0119"
FT   gene            complement(94898..95812)
FT                   /db_xref="GeneID:4601199"
FT                   /locus_tag="Tpen_0120"
FT   CDS_pept        complement(94898..95812)
FT                   /locus_tag="Tpen_0120"
FT                   /gene_family="HOG000256146" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="spermidine synthase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; Methyltransferase type 12; KEGG: sto:ST0346
FT                   spermidine synthase"
FT                   /db_xref="GI:119719038"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:4601199"
FT                   /translation="MAEEQGFGVLWYTEWLSSLEAHVHGIKRIIYDGRTKYQRVTLAET
FT                   GSFGLTLFLDGYAQSSEYDEFVYHESLVHPAMLTHPHPEKVLVIGGGEGATLREVLKHP
FT                   SVKRAVMVDIDEELVEIVKRYMWKWHRSSFDDPRVELLFMDGKKFVEETSERFDVIILD
FT                   LTDPVSGTPGVHLYTKEFYETIYDKLTPQGVMVTQATSTRYNVKAFSVINNTVASVFPV
FT                   ARPYKVFVATFYSEWGFALGSKGRDPLKIDKEEISRRLQSLDLRYLDLETFYYLFHIPK
FT                   YIREEMQKYTQISTRDNPLQIEI"
FT                   /protein_id="YP_919533.1"
FT   misc_feature    complement(94955..95785)
FT                   /note="spermidine synthase; Provisional; Region: PRK00811"
FT                   /db_xref="CDD:167071"
FT                   /locus_tag="Tpen_0120"
FT   misc_feature    complement(95219..95560)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Tpen_0120"
FT   misc_feature    complement(order(95324..95326,95375..95383,95471..95476,
FT                   95528..95548))
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Tpen_0120"
FT   gene            complement(96035..96937)
FT                   /db_xref="GeneID:4601200"
FT                   /locus_tag="Tpen_0121"
FT   CDS_pept        complement(96035..96937)
FT                   /locus_tag="Tpen_0121"
FT                   /gene_family="HOG000223167" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ape:APE0531 putative manganese transport system
FT                   substrate-binding protein"
FT                   /db_xref="GI:119719039"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="GeneID:4601200"
FT                   /translation="MSRRSLALVAVVVLVALGIGYLLLSPGLSPQAPRAGGLKIVVTFY
FT                   SLKGDIEYLLCQGDEVIPVTPQGVDPHEYQLTPSDVARIREGSLIVSTAHAPFEQKIKQ
FT                   LVETGELKSRLIEIPRIPGIKLLVNPSTGTLNYHWPIYDPNNYIAYINYTAHVMASLRP
FT                   ECASTYLSKASGLIANITSIERSAPRLNLVAVGSSPVVQYSVEWMGINVSYLLIKEADL
FT                   PATPQDIATIEDAMARGAINVVVISKGLETTSAGKTLVDLASKYGKPVLYVPSPISSES
FT                   TYEKILVVVKEVEKVLQKG"
FT                   /protein_id="YP_919534.1"
FT   misc_feature    complement(96254..96829)
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="Tpen_0121"
FT   misc_feature    complement(order(96470..96472,96626..96628,96635..96640))
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="Tpen_0121"
FT   gene            97111..97863
FT                   /db_xref="GeneID:4601608"
FT                   /locus_tag="Tpen_0122"
FT   CDS_pept        97111..97863
FT                   /locus_tag="Tpen_0122"
FT                   /codon_start="1"
FT                   /product="ABC transporter related"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ape:APE0532 putative manganese transport system
FT                   ATP-binding protein"
FT                   /db_xref="GI:119719040"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:4601608"
FT                   /translation="MHAQTVELRGVSFAYSDGEPILNNENLFLSGPGLVTILGPNGSGK
FT                   TTLFKVVLGLLKPSSGSVVINGEDVTGNPVKAGKYASLVPQLSAIRRDLPLTAHELVNF
FT                   VLRTRGRCKGRECEAKTMEALEAVGAAGIADKKLSEMSGGQLQRVLLARALATGADILL
FT                   LDEPLSGIDPSGREYILGEIEKISKRKLVVMTTHDPVLTLNKSKTIVVFNRGVRAVGSP
FT                   GDVFKLDLLRKAYGSNVLLIEKCLHVIS"
FT                   /protein_id="YP_919535.1"
FT   misc_feature    97126..97854
FT                   /note="ABC-type Mn/Zn transport systems, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: ZnuC;
FT                   COG1121"
FT                   /db_xref="CDD:31318"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97129..97770
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97225..97248
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    order(97234..97239,97243..97251,97366..97368,97603..97608,
FT                   97699..97701)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97357..97368
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97531..97560
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97591..97608
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97615..97626
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   misc_feature    97687..97707
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tpen_0122"
FT   gene            97877..98677
FT                   /db_xref="GeneID:4601609"
FT                   /locus_tag="Tpen_0123"
FT   CDS_pept        97877..98677
FT                   /locus_tag="Tpen_0123"
FT                   /gene_family="HOG000223168" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-3 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; KEGG: ape:APE0534 putative
FT                   manganese transport system permease protein"
FT                   /db_xref="GI:119719041"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:4601609"
FT                   /translation="MYIDPRWLIVILGSSVSFSVLSPVIHARRLNFFAATLPHSSLLAV
FT                   SLGYLLSFLLGYSPTLWAIPISVALSFLLVVLIHRGVSEDSATSAFVSFSVSASVAAMY
FT                   YILTKFPSEVSLWSYILGDPLLVTWEDVAVTVVVTAVATLSTLLIYMKEVVIGLDRDFS
FT                   QLLGINVNLHDYLVVFVLTLVSISLLKVVGFVLEHVVLLLPATVSVQLAKSAKEFLGYS
FT                   LLVSTVSGLLGLFTSIYANVAPSAMYGFVMLGLYLAVLLRGEAR"
FT                   /protein_id="YP_919536.1"
FT   misc_feature    <98216..98674
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cl00462"
FT                   /db_xref="CDD:176819"
FT                   /locus_tag="Tpen_0123"
FT   gene            98674..99066
FT                   /db_xref="GeneID:4602186"
FT                   /locus_tag="Tpen_0124"
FT   CDS_pept        98674..99066
FT                   /locus_tag="Tpen_0124"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CopG family transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: ape:APE0535 hypothetical protein"
FT                   /db_xref="GI:119719042"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="GeneID:4602186"
FT                   /translation="MRDKRRVGVSLDGDVFEELERVAKAFNTDRSHIVNMAAREYLLEK
FT                   FHYAKPHSCEGVMIISYDPARGQEVAEAIEESKSLVVSRSHFHTGDGCCLEILYLKGDS
FT                   EEIWLLEKRVSHLCDVCRFVPSHRLQ"
FT                   /protein_id="YP_919537.1"
FT   misc_feature    98674..99033
FT                   /note="Predicted transcriptional regulators containing the
FT                   CopG/Arc/MetJ DNA-binding domain and a metal-binding domain
FT                   [Transcription]; Region: NikR; COG0864"
FT                   /db_xref="CDD:31204"
FT                   /locus_tag="Tpen_0124"
FT   gene            complement(99047..99655)
FT                   /db_xref="GeneID:4602187"
FT                   /locus_tag="Tpen_0125"
FT   CDS_pept        complement(99047..99655)
FT                   /locus_tag="Tpen_0125"
FT                   /gene_family="HOG000222308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF207; KEGG:
FT                   pfu:PF2034 hypothetical protein"
FT                   /db_xref="GI:119719043"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="GeneID:4602187"
FT                   /translation="MSFHARSSAGGDPWEYLRRKALEQFERHLEEGRVDEDIVDLLRLV
FT                   NNTKNCYTTSSCSGRIQVSCGEHPGAKGRLVVVAKWHRTVSLQELVSVLDSLQEESVWL
FT                   SVHPPIFHVVARDLSVARKLLAGARNSGFKHSGIQGLGRRVVVEIMSMERLEVPIRVQG
FT                   VEVVRRESLPILLETANEFLLRGKSRLGVLRKVFTEACD"
FT                   /protein_id="YP_919538.1"
FT   misc_feature    complement(99050..99625)
FT                   /note="Methyltransferase TYW3; Region: TYW3; cl00689"
FT                   /db_xref="CDD:174349"
FT                   /locus_tag="Tpen_0125"
FT   gene            complement(99652..100380)
FT                   /db_xref="GeneID:4602188"
FT                   /locus_tag="Tpen_0126"
FT   CDS_pept        complement(99652..100380)
FT                   /locus_tag="Tpen_0126"
FT                   /gene_family="HOG000274897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="purine phosphorylases family protein 1"
FT                   /transl_table="11"
FT                   /note="PFAM: purine and other phosphorylases, family 1;
FT                   KEGG: sto:ST0975 hypothetical 5'-methylthioadenosine
FT                   phosphorylase"
FT                   /db_xref="GI:119719044"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="GeneID:4602188"
FT                   /translation="MFRHPLSKKVYHIKASPEQVSPKILVCGDPGRVEAASSLLDGATV
FT                   VNRHRGYLVVTGEYRGERVTLATHGIGAPSAAIVFEELAMLGAKVMIRAGTCGGLTPIA
FT                   ESGKIALIEAAAYENSGTLYQYFGGVSMPAYATPEVVLTLESVLREKGLSFVRGIALSH
FT                   DAFHKVEENARRWASLGVDFLEMESATLFALGRLRGVKVGAMALVVDNLLSGSELVEGR
FT                   EELELKMVEAGLEALRRMKV"
FT                   /protein_id="YP_919539.1"
FT   misc_feature    complement(99661..100368)
FT                   /note="Uridine phosphorylase [Nucleotide transport and
FT                   metabolism]; Region: Udp; COG2820"
FT                   /db_xref="CDD:32648"
FT                   /locus_tag="Tpen_0126"
FT   misc_feature    complement(99670..100347)
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Tpen_0126"
FT   gene            complement(100380..101042)
FT                   /db_xref="GeneID:4600712"
FT                   /locus_tag="Tpen_0127"
FT   CDS_pept        complement(100380..101042)
FT                   /locus_tag="Tpen_0127"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pai:PAE3148 hypothetical protein"
FT                   /db_xref="GI:119719045"
FT                   /db_xref="GeneID:4600712"
FT                   /translation="MRVSCEKALFASDTHCRRGRKCRALEILASIAEREGAECLFVAGD
FT                   LFDNFHFKASRRLLIEEFSKIIDVERLPAVFAASLSSSSHDPLLDSPLEEIIDGKRLLF
FT                   SNGAVEVQVGGRQFIVIHGDRLVGSGVLAFLLNFVAERLGRKLYLEEAHRRVLGLGDEW
FT                   LVMGHTHIPGIDREKRLVNLGSWKTSWKGGLPYWRKAKPTVLLVDDNGLRLEEVSIT"
FT                   /protein_id="YP_919540.1"
FT   misc_feature    complement(100485..101018)
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Tpen_0127"
FT   misc_feature    complement(order(100539..100541,100677..100679,
FT                   100776..100781,100908..100910,100998..101000,
FT                   101004..101006))
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Tpen_0127"
FT   misc_feature    complement(order(100539..100541,100677..100679,
FT                   100779..100781,100908..100910,100998..101000,
FT                   101004..101006))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Tpen_0127"
FT   gene            101136..102635
FT                   /db_xref="GeneID:4600713"
FT                   /locus_tag="Tpen_0128"
FT   CDS_pept        101136..102635
FT                   /locus_tag="Tpen_0128"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:119719046"
FT                   /db_xref="InterPro:IPR006025"
FT                   /db_xref="GeneID:4600713"
FT                   /translation="MLKEKFPGALLALVVVAVLGVASLAYAQPGKGNLTVYIDVFENGN
FT                   ASVKIVVSPGDKGFVQLALPRFEKVYACGGSASGYRVVNSTSGAYFYFNSTIYFAEKGS
FT                   SLALCYNFPYAVLMSGSRGWFMSPLLWSSEPEVVVYVKLPLVKRITYESPSSVGVSGNY
FT                   RVYVLSPLVEQYIGNRVVVEYDLQSSTPVDTILYSSGGSTITVKFPVYYRSIALKVRDV
FT                   ATSAIAELSLIAGLRPSNVTFVFYLPERSMGGISALGFVMGEDVNAGGKGPVNLNLALI
FT                   RYAPGYLETTVIHELVHVYLGAAGVEANDNTRWFHEGMAQYVSILVAKKLGVNISEYES
FT                   ELNESAASYYNYTGGKIGFIENWPSDAVKEGEAYLASYYVVHTLATKYGGENFVKRVFA
FT                   TLQGRHITTTREIVNVLSQAAGTNLAPLFREWGFRDVEDWTPSNAKTPPSNSTSTPSSS
FT                   STGNSRFLIAMIALLAVIFIVTYVVNAVVERELRIAEHAPV"
FT                   /protein_id="YP_919541.1"
FT   misc_feature    <102000..>102428
FT                   /note="Aminopeptidase N [Amino acid transport and
FT                   metabolism]; Region: PepN; COG0308"
FT                   /db_xref="CDD:30656"
FT                   /locus_tag="Tpen_0128"
FT   gene            complement(102659..102910)
FT                   /db_xref="GeneID:4600714"
FT                   /locus_tag="Tpen_0129"
FT   CDS_pept        complement(102659..102910)
FT                   /locus_tag="Tpen_0129"
FT                   /gene_family="HOG000044619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pfu:PF1909 ferredoxin"
FT                   /db_xref="GI:119719047"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="GeneID:4600714"
FT                   /translation="MARSMAKLKVTIDRDQCISDMACVSLCPEVFEMNEEDGKSSIVAK
FT                   YRVGNNLGEGLVPGELEDCVKSAAEACPVSIIHVEKVE"
FT                   /protein_id="YP_919542.1"
FT   misc_feature    complement(102671..102886)
FT                   /note="Ferredoxin [Energy production and conversion];
FT                   Region: Fer; COG1141"
FT                   /db_xref="CDD:31336"
FT                   /locus_tag="Tpen_0129"
FT   gene            103136..106324
FT                   /db_xref="GeneID:4600715"
FT                   /locus_tag="Tpen_0130"