(data stored in ACNUC7421 zone)

HOGENOMDNA: THESM_1

ID   THESM_1; SV 1; empty ; DNA; empty ; PRO; 1845800 BP.
XX
AC   NC_012883;
XX
PR   Project: 59399;
XX
DE   Thermococcus sibiricus MM 739, complete genome.
XX
OS   Thermococcus sibiricus MM 739
OC   Archaea; Euryarchaeota; Thermococci; Thermococcales; Thermococcaceae;
OC   Thermococcus.
XX
RN   [1]
RP   1-1845800
RX   PUBMED; 19447963.
RA   Mardanov,A.V., Ravin,N.V., Svetlitchnyi,V.A., Beletsky,A.V.,
RA   Miroshnichenko,M.L., Bonch-Osmolovskaya,E.A. and Skryabin,K.G.;
RT   "Metabolic versatility and indigenous origin of the archaeon Thermococcus
RT   sibiricus, isolated from a siberian oil reservoir, as revealed by genome
RT   analysis";
RL   Appl. Environ. Microbiol. 75 (13), 4580-4588 (2009)
XX
RN   [2]
RP   1-1845800
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (29-JUN-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1845800
RA   Ravin,N.V., Mardanov,A.V., Beletsky,A.V. and Skryabin,K.G.;
RT   "Direct Submission";
RL   Submitted (19-FEB-2009) Centre 'Bioengineering' RAS, Prosp. 60-let
RL   Oktiabria, Bld. 7-1, Moscow 117312, Russia
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001463.
CC   DNA Source: Dr. E.A. Bonch-Osmolovskaya, Institute of Microbiology,
CC   RAS (lbo@mail.ru).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1845800
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:604354"
FT                   /country="Russia: western Siberia"
FT                   /isolation_source="high-temperature Samotlor oil reservoir"
FT                   /strain="MM 739"
FT                   /organism="Thermococcus sibiricus MM 739"
FT   gene            complement(4..1137)
FT                   /db_xref="GeneID:8096873"
FT                   /locus_tag="TSIB_0001"
FT   CDS_pept        complement(4..1137)
FT                   /locus_tag="TSIB_0001"
FT                   /gene_family="HOG000244837" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="DUF354 domain containing protein"
FT                   /db_xref="GI:242397998"
FT                   /db_xref="GeneID:8096873"
FT                   /translation="MGGNKMNILIVVNTPAQAHFYKNIYTALKDKGHSVFLLARNYGDT
FT                   IELLNSFGFDYIMYSDPLVSSNKLLKTAQFPLDVMSALLKTIKNKIKPDVIVGGGGYGA
FT                   IISEILNVPNIWYMDGEPMFYSGLYQLEFKMFSRIPRAIITPKAFRQSLGNQHIKVDSY
FT                   KELSYLSPKYYNPNPDILHELGVSKHDTYLLLRFNAFDALHDVNLYGLSYEDKIYLIKK
FT                   LEKLGIKFFISSELPLPAPLEKYKLSIPKHRIHDVIYYSSMLVADTGTMVTEAAVLGVP
FT                   AVMINSSAWKVGVFEELEERYGLIYRYSRGDKGISKVVELSERLSLLKRKWKKKQKRLL
FT                   KEKIDISAFMTWVIENYPQSLHELQENPKIQYKFKAR"
FT                   /protein_id="YP_002993422.1"
FT   misc_feature    complement(289..1122)
FT                   /note="Protein of unknown function (DUF354); Region:
FT                   DUF354; pfam04007"
FT                   /db_xref="CDD:112806"
FT                   /locus_tag="TSIB_0001"
FT   gene            complement(1339..2952)
FT                   /db_xref="GeneID:8094969"
FT                   /locus_tag="TSIB_0002"
FT                   /pseudo
FT   misc_feature    complement(1339..2952)
FT                   /note="Probably pseudogene (Asparagine synthetase)"
FT                   /locus_tag="TSIB_0002"
FT                   /pseudo
FT   gene            complement(3111..3653)
FT                   /db_xref="GeneID:8094970"
FT                   /locus_tag="TSIB_0003"
FT   CDS_pept        complement(3111..3653)
FT                   /locus_tag="TSIB_0003"
FT                   /gene_family="HOG000120413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glycosyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:242397999"
FT                   /db_xref="GeneID:8094970"
FT                   /translation="MGHAQDLKNVILAIEQLKERNIGIKFLIARDGDVREYLEKLAKEK
FT                   CLTDVVIFTGLLPRDRTPEIMSESLVGIANLKELESLEYAMPTKAYEYASCELPVMGSG
FT                   SKELLAFIKESKGGIFVSTNPHGIADEILFLFENPKIRVKMGKRGRRFVKRHYDRKEIA
FT                   KSLKSYLEVLVNGAKDN"
FT                   /protein_id="YP_002993423.1"
FT   misc_feature    complement(3156..>3653)
FT                   /note="This family is most closely related to the GT1
FT                   family of glycosyltransferases. wbuB in E. coli is involved
FT                   in the biosynthesis of the O26 O-antigen.  It has been
FT                   proposed to function as an N-acetyl-L-fucosamine (L-FucNAc)
FT                   transferase; Region: GT1_wbuB_like; cd03794"
FT                   /db_xref="CDD:99968"
FT                   /locus_tag="TSIB_0003"
FT   gene            complement(3632..3850)
FT                   /db_xref="GeneID:8094971"
FT                   /locus_tag="TSIB_0004"
FT   CDS_pept        complement(3632..3850)
FT                   /locus_tag="TSIB_0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398000"
FT                   /db_xref="GeneID:8094971"
FT                   /translation="MDAFKGHEVFFITYDNFRTRQLPYKKYLLENIGTNPLKMLKAFLK
FT                   IGKIIAKERPKRKDKSYTPGTWGMLRT"
FT                   /protein_id="YP_002993424.1"
FT   misc_feature    complement(<3686..3838)
FT                   /note="Glycosyltransferases catalyze the transfer of sugar
FT                   moieties from activated donor molecules to specific
FT                   acceptor molecules, forming glycosidic bonds. The acceptor
FT                   molecule can be a lipid, a protein, a heterocyclic
FT                   compound, or another carbohydrate...; Region:
FT                   Glycosyltransferase_GTB_type; cl10013"
FT                   /db_xref="CDD:176609"
FT                   /locus_tag="TSIB_0004"
FT   gene            complement(3904..4902)
FT                   /db_xref="GeneID:8094972"
FT                   /locus_tag="TSIB_0005"
FT   CDS_pept        complement(3904..4902)
FT                   /locus_tag="TSIB_0005"
FT                   /gene_family="HOG000078178" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="probable glycosyltransferase"
FT                   /transl_table="11"
FT                   /note="COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="GI:242398001"
FT                   /db_xref="GeneID:8094972"
FT                   /translation="MSLSNKASVIVVTYNHEKYIRACLTSVLDNNPLEVIVVDNGSTDG
FT                   TAELVEKEFPQVKLIKNPRNLGYGGGNNLGVRHARGEYVVILNPDTKVEKGWLEELLKP
FT                   LEKEQKLITTPKILTYDGSKINTCGNIEHFTGLTFVRGLNGDPRKFDEFEYLSGLSGAC
FT                   FAMRRSEYFELGGFDENFFSYMEDAELSWRAHAKGFKILYVPTSIVYHDYELKVPSKKI
FT                   YHLEKGRYIILRKYLTWKELLLMLPSLLATEVLTWGYSILNGFEGIKFKIKGTKDGITA
FT                   KVEKIECDRKKLLRSLDWKIPEEQLSYSVVDRLIKRIANFFYWINYKVIVR"
FT                   /protein_id="YP_002993425.1"
FT   misc_feature    complement(4057..4887)
FT                   /note="Predicted glycosyltransferases [General function
FT                   prediction only]; Region: COG1216"
FT                   /db_xref="CDD:31409"
FT                   /locus_tag="TSIB_0005"
FT   misc_feature    complement(4270..4887)
FT                   /note="Glycosyltransferase family A (GT-A) includes diverse
FT                   families of glycosyl transferases with a common GT-A type
FT                   structural fold; Region: Glyco_tranf_GTA_type; cl11394"
FT                   /db_xref="CDD:176938"
FT                   /locus_tag="TSIB_0005"
FT   misc_feature    complement(order(4615..4617,4621..4623,4792..4794,
FT                   4861..4863,4867..4869))
FT                   /note="active site"
FT                   /db_xref="CDD:132997"
FT                   /locus_tag="TSIB_0005"
FT   gene            complement(4906..5778)
FT                   /db_xref="GeneID:8094973"
FT                   /locus_tag="TSIB_0006"
FT   CDS_pept        complement(4906..5778)
FT                   /locus_tag="TSIB_0006"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Glycosyl transferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398002"
FT                   /db_xref="GeneID:8094973"
FT                   /translation="MKTLIVIPAYNEELTIGSVVALAKKFGDVLVVDDGSFDRTSEIAR
FT                   EAGAVVIRHEVNKGKGQALRTGFEYALSKEYDVVVTLDADGQHNPDEIPLLLEPIVKGK
FT                   ADLVIGSRYLNGSKKKIPLYRRLGLWVLNKGTKVAAGVGVDSQSGFRAISEKALEKLDL
FT                   NSPDYSVETDMIVKARGEGLKIMEVPISVRYDVPRKHKKNPLSHGLGVLARIVSLIGYR
FT                   RPLLLFGVLSLISFIVAGILAYLALEPYYRGGNVYLTQAIGAGIFVIIGIQLFVAGLML
FT                   NVLAKMVRE"
FT                   /protein_id="YP_002993426.1"
FT   misc_feature    complement(5245..5766)
FT                   /note="DPM_DPG-synthase_like is a member of the
FT                   Glycosyltransferase 2 superfamily; Region:
FT                   DPM_DPG-synthase_like; cd04179"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="TSIB_0006"
FT   misc_feature    complement(order(5524..5526,5749..5751,5755..5757))
FT                   /note="Ligand binding site; other site"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="TSIB_0006"
FT   misc_feature    complement(order(5524..5529,5677..5679))
FT                   /note="Putative Catalytic site; other site"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="TSIB_0006"
FT   misc_feature    complement(5524..5532)
FT                   /note="DXD motif; other site"
FT                   /db_xref="CDD:133022"
FT                   /locus_tag="TSIB_0006"
FT   gene            complement(5847..8144)
FT                   /db_xref="GeneID:8094974"
FT                   /locus_tag="TSIB_0007"
FT   CDS_pept        complement(5847..8144)
FT                   /locus_tag="TSIB_0007"
FT                   /gene_family="HOG000073980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Oligosaccharyl transferase, STT3 subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398003"
FT                   /db_xref="GeneID:8094974"
FT                   /translation="MKLEEAFKPKVALPVLTAITLILRLIPLRHKYILGYDPYFHLAYI
FT                   EEALKAGDWFNFLTIAGGPWGRQINNAHPLGLWMTPAYVYKVLKVFGVSLYNAFRITPV
FT                   IFGVLTVVFLYLALLKLYDEKKAFFASLFLAISFGHVFRSMANYYRGDNYMLFWYSVAL
FT                   LGVALAISMKDKLGNLRFALYLVPAFASGFASIFWQAYYPIFIFLLANAVFLAVGAFIL
FT                   DKKENLLDALALVLSTVLGAFMANSLGGKFGYGMLGYDQLGKRVAEKLMLEFGTIKDAY
FT                   LLVHVKYLVPLGLAFIILIFILGKFIKDRKARAGVLIGLAVLGVFVLFHRFEALKELST
FT                   GFGIFIEAPIQETQPSSFSDLWKAFSISLFLAPLFFLRFDPNRVNMSDFLILGLIFPSI
FT                   YMIKTWTRFLFIGSAAIALMAGIGVVELYETLNRLDGRKVSAVGIGLLVLLPMVNGGFS
FT                   IKETYSLRPYANEHWEEALTWLRENSNQNDVVLTWWDYGHFVTYYARRSPIAQGSPNTG
FT                   VALYYLDKLDENWAMSLGVDYVVVSYYDFLKFGAIVDTAKMHPKYNITEKYGLIVLPLT
FT                   SKIGALVFQRGDYKIIAKPGERWNVIVNLNGQVISPKELYVEYQGRVMKPGLSASNTNT
FT                   YLYINLDYKYAIFMNEEAFNTTLVRLFINANEPYELVYSDRGMIKILRLKHPNVRVEKE
FT                   NEKVILHFENATGTGLGIWGFLDNGTKVFEKWYEVKGKEEFELPEEVNGTVIRYAYAVG
FT                   KKIVDRGIFRRD"
FT                   /protein_id="YP_002993427.1"
FT   misc_feature    complement(5862..8051)
FT                   /note="Uncharacterized membrane protein, required for
FT                   N-linked glycosylation [General function prediction only];
FT                   Region: COG1287"
FT                   /db_xref="CDD:31478"
FT                   /locus_tag="TSIB_0007"
FT   gene            complement(8206..8742)
FT                   /db_xref="GeneID:8094975"
FT                   /locus_tag="TSIB_0008"
FT   CDS_pept        complement(8206..8742)
FT                   /locus_tag="TSIB_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398004"
FT                   /db_xref="GeneID:8094975"
FT                   /translation="MIGVVASIIGGLILKEYVMFIAPILFGLSLKNRDFGLVGYFLYII
FT                   YSSSKVVSGDVYTYEELMNALIFGFSGVLLLDDVLRREVRVRKPEIIPILFVLFGFVIP
FT                   ESFLAGGVLYFLMMKPDLKVALPVVGVILAFAIFKENLLGLGASGQAVVFGGFVLFTLT
FT                   VAFLMREVKRVDMLR"
FT                   /protein_id="YP_002993428.1"
FT   gene            complement(8743..10041)
FT                   /db_xref="GeneID:8094976"
FT                   /locus_tag="TSIB_0009"
FT   CDS_pept        complement(8743..10041)
FT                   /locus_tag="TSIB_0009"
FT                   /gene_family="HOG000073983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DUF58 domain containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398005"
FT                   /db_xref="GeneID:8094976"
FT                   /translation="MKREDFIVILSLLLILEGYLGDNIVPALVGFSIVVYLFILRSKAN
FT                   FDIKGERILEDTRLEENKSEKVTVRLENKGENAVVKIDESTEDFEVSSVPPSLLERGES
FT                   RGFVYYLTPRYKGEFSLGPAKVTAEDERGLYLEEFSIGSEEKIFVYPSVEGIKEAAKAD
FT                   YNLRLAELYKKSQFIGTEGVEIKDLREYRHGDDFKRIDWKASVRLGELIIREMLKESDA
FT                   DVYIFVDNTNEMRKGIKMAKVDYASTLALQLAATLIKSYRVGMVIYDEESADFIKAAKS
FT                   MAHLENMRRKLNLRWKKGAMSLRAKLEVKLSKKGRDFLNKVLPLKKGRRGSKGIFEGLS
FT                   LIKMPSFLIFISDLNNPSDLYKAIAQAKWNHKVLLLSPNPILFYGGELDRETLKRLYRA
FT                   YLEREKILKRFNALAPTIDLGPSDYIREIAKVV"
FT                   /protein_id="YP_002993429.1"
FT   misc_feature    complement(8770..9963)
FT                   /note="Uncharacterized conserved protein (some members
FT                   contain a von Willebrand factor type A (vWA) domain)
FT                   [General function prediction only]; Region: COG1721"
FT                   /db_xref="CDD:31907"
FT                   /locus_tag="TSIB_0009"
FT   misc_feature    complement(<9307..9498)
FT                   /note="Protein of unknown function DUF58; Region: DUF58;
FT                   pfam01882"
FT                   /db_xref="CDD:145184"
FT                   /locus_tag="TSIB_0009"
FT   gene            complement(10045..10974)
FT                   /db_xref="GeneID:8094977"
FT                   /locus_tag="TSIB_0010"
FT   CDS_pept        complement(10045..10974)
FT                   /locus_tag="TSIB_0010"
FT                   /gene_family="HOG000236943" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Methanol dehydrogenase regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398006"
FT                   /db_xref="GeneID:8094977"
FT                   /translation="MEGKEFMEKLKTEISKAVVGKEDVIELLTIALLSEGHVLIEGIPG
FT                   VAKTTIAKAFSNAIGLKFSRIQLTPDLLPADIIGIFYYDQKTGEWTIKHGPIFANVILA
FT                   DEVNRAQPKTQSALLEAMQEKQVTIEGVTHKLPEPFLVIATMNPLEHEGVYILPEAQLD
FT                   RFMLKIEVGFPDKDEEMGLLKRKSRGEFWEVNPIIKHEELLELMGKVKGVSVSDEIIEY
FT                   IYSIASKTRSDERLLFGASPRAGEHLLYAAKASAFLDGRDYVIPDDVKKVAPAVLAHRL
FT                   LLKAEYELEGVTTKEIIREVLEETEVPV"
FT                   /protein_id="YP_002993430.1"
FT   misc_feature    complement(10048..10974)
FT                   /note="MoxR-like ATPases [General function prediction
FT                   only]; Region: COG0714"
FT                   /db_xref="CDD:31058"
FT                   /locus_tag="TSIB_0010"
FT   misc_feature    complement(10459..10920)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="TSIB_0010"
FT   misc_feature    complement(10828..10851)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="TSIB_0010"
FT   misc_feature    complement(order(10534..10536,10660..10662,10825..10848))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="TSIB_0010"
FT   misc_feature    complement(order(10657..10671,10684..10686))
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="TSIB_0010"
FT   misc_feature    complement(10132..>10662)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="TSIB_0010"
FT   misc_feature    complement(10483..10485)
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="TSIB_0010"
FT   gene            complement(10964..11983)
FT                   /db_xref="GeneID:8094978"
FT                   /locus_tag="TSIB_0011"
FT   CDS_pept        complement(10964..11983)
FT                   /locus_tag="TSIB_0011"
FT                   /gene_family="HOG000254339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398007"
FT                   /db_xref="GeneID:8094978"
FT                   /translation="MNRVFYAIMLIVGVSIMIMPLSVPVFKSSADYSVLNTDWNGVSSF
FT                   GKLLYSKGEITPVLSTYDSVNLGERKGTLIIVGPNLDFTNEEIVELRKFLENGNALILA
FT                   DDFGTGNEILEGLGLEQRFGRGELITPIYSKNHHYPVTAEIVDSDLSKNVERIVMYNPS
FT                   VILNSQNALVYTPNSSIFKNNYGAFVIVEKVEHGNGEVILISDPDLFTNSLFRENEEFI
FT                   KNLLDYASGPFYIDEAHHRDFNPYSSGTITIRRAVNKEFVFYYILLVAAIAFIIESGLW
FT                   LRVLEKIFSLLLIFAREEKESLEEIIKSLEKDGLNRELLIKIINEIKNGSKLGGSHGR"
FT                   /protein_id="YP_002993431.1"
FT   gene            complement(11980..13743)
FT                   /db_xref="GeneID:8094979"
FT                   /locus_tag="TSIB_0012"
FT   CDS_pept        complement(11980..13743)
FT                   /locus_tag="TSIB_0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398008"
FT                   /db_xref="GeneID:8094979"
FT                   /translation="MRGRSFISILIIITILSGFAYAEDYSKVEGDDYGVYIYFNDMLGN
FT                   FNSIIKDILEDKNDTVIKAESFYSLANVTVEEVVKYNSFGIRPSAVGLAYRFKGLGEGV
FT                   FILSSSHQRFMESLENGDFLEARTNLFSMKASMDDIYLNLAHVSGIRLIGENGEALNFE
FT                   LEETYEALEKLEGLIERYEERLNRLAAPSEFSIFSSKESPFLHENVTFYGYTLGLENVK
FT                   VIINNASYTPEIINGGFRLRYSFNETGLYEVYAQAMNGSHVVTSNVIRIEVQKIPTQII
FT                   ALEKTGTIVTVEGYLLDYFGSPLKGKEIILEMDGENYKSLTDENGTFSFDLGEFYEEKN
FT                   VTMSFLGDDEHEGTITKLTLLPPKSKLTIRLFFEESEVREGEEVRIPGYVNGTSDEIPL
FT                   EVYVDDKLTETINARGNFTLLLRFDRGEHAVYVKFPGNEEFAESVSNIVEVQAIPYNYL
FT                   QRLLLFIVFLVLGFIGYKLLTRRPKVVVETKPKEEQKSIAVSEEKPDLIKSYRFLYGLF
FT                   RRLYNLPKSITPRELLKKLENESFFSELRRATFLHEATFYGKKRLGAREIIEGVRSVAT
FT                   AIVKVFVREEL"
FT                   /protein_id="YP_002993432.1"
FT   gene            13812..14552
FT                   /db_xref="GeneID:8094980"
FT                   /locus_tag="TSIB_0013"
FT   CDS_pept        13812..14552
FT                   /locus_tag="TSIB_0013"
FT                   /gene_family="HOG000254337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398009"
FT                   /db_xref="GeneID:8094980"
FT                   /translation="MELKYIVSAALGISGGIMVLRGFLAANQSYINLGIAGMFLGAVVL
FT                   TLKSSKYVKKDSLDILLKSHKGFFKALLSNLRLEGKAVYIPPYENLPEGGIFVPLHEEF
FT                   DIDPARLDEGTFFLTETPDEKSMGLLITSLGKSLLEKYEGHLEAPISSVPELEASAGSV
FT                   LRALGVAKRVHIEENESEVRVILTPEVSCSFEECERAPCPICASVLLGLAKATNNMVGV
FT                   ESFEKKDYGIEIKARKLGEVREWM"
FT                   /protein_id="YP_002993433.1"
FT   gene            complement(14536..15963)
FT                   /db_xref="GeneID:8094981"
FT                   /locus_tag="TSIB_0014"
FT   CDS_pept        complement(14536..15963)
FT                   /locus_tag="TSIB_0014"
FT                   /gene_family="HOG000101642" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="[R] COG1672 Predicted ATPase (AAA+
FT                   superfamily);pfam01637, Arch_ATPase, Archaeal ATPase"
FT                   /db_xref="GI:242398010"
FT                   /db_xref="GeneID:8094981"
FT                   /translation="MRFVNREHEIEVLHKARELSKRKLYTVVIYGMRRVGKTRLLLEFL
FT                   EENDLYFFVNKTKTSESLLREYEEILRKKGVITKYESLSTWDEFFGVLFERFNGAVAFD
FT                   EFQEFQKVDPSVFPLLQKLIDTNENRAGLMLIFTGSTIGMMEKLFKDSKEPLYGRIKRE
FT                   IHLKELGIKGAYEMTKELKIGDLDDFMTLYALFGGFPKYYVTIKDEGLEGKSSEEIIKN
FT                   LFFTPSAPLEEEVPKILSMEFGRRSGVYYDILEAVANGATSISKIAGYLNRKETSLTRH
FT                   LKELTKYFKLLSYDRAVLGKEGVIYIRHPLINFWFRFIHPRLSEYEAMREDLGKEVMSM
FT                   LPDYVGKRFDFISRELLWILNHKGELPFKFTQMGRHWGYYREEGVRRVYEIDLVAVSRD
FT                   RKKALFGECKWRGKPVDGKKVFEELKKKSELTGWKGDKYYLIIAKRVKNAPEEAIVLDE
FT                   KAILKVLDSSEGLTSIP"
FT                   /protein_id="YP_002993434.1"
FT   misc_feature    complement(15358..15957)
FT                   /note="Archaeal ATPase; Region: Arch_ATPase; pfam01637"
FT                   /db_xref="CDD:145008"
FT                   /locus_tag="TSIB_0014"
FT   misc_feature    complement(14704..15021)
FT                   /note="Archaea bacterial proteins of unknown function;
FT                   Region: DUF234; pfam03008"
FT                   /db_xref="CDD:145908"
FT                   /locus_tag="TSIB_0014"
FT   gene            16091..16333
FT                   /db_xref="GeneID:8094982"
FT                   /locus_tag="TSIB_0015"
FT   CDS_pept        16091..16333
FT                   /locus_tag="TSIB_0015"
FT                   /gene_family="HOG000296234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398011"
FT                   /db_xref="GeneID:8094982"
FT                   /translation="MDVEDYMLLFLSSWVLISALAVGTVDVFLTLTLIGLLITLEVGSF
FT                   FLSKEQKESLKPLVELLLVIFAIIVMKKVYEVLSG"
FT                   /protein_id="YP_002993435.1"
FT   gene            complement(16495..16872)
FT                   /db_xref="GeneID:8094983"
FT                   /locus_tag="TSIB_0016"
FT   CDS_pept        complement(16495..16872)
FT                   /locus_tag="TSIB_0016"
FT                   /gene_family="HOG000138071" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HEPN domain protein"
FT                   /transl_table="11"
FT                   /note="[S] COG1895 Uncharacterized conserved protein
FT                   related to C-terminal domain of eukaryotic chaperone,
FT                   SACSIN;pfam05168, HEPN, HEPN domain"
FT                   /db_xref="GI:242398012"
FT                   /db_xref="GeneID:8094983"
FT                   /translation="MTPSAIERVKSSIEIARRFLKSAERTFEIGDYVMVEIAAYNSAFH
FT                   SVRALLFAKGYKERSHQCLVIAVRELYRTNPKIVELMNIFDKLRISRHNVQYGGALVDE
FT                   EEAEFVLRFAREVLEIVEQLV"
FT                   /protein_id="YP_002993436.1"
FT   misc_feature    complement(16498..16854)
FT                   /note="HEPN domain; Region: HEPN; cl00824"
FT                   /db_xref="CDD:154022"
FT                   /locus_tag="TSIB_0016"
FT   gene            complement(16910..17461)
FT                   /db_xref="GeneID:8094984"
FT                   /locus_tag="TSIB_0017"
FT   CDS_pept        complement(16910..17461)
FT                   /locus_tag="TSIB_0017"
FT                   /gene_family="HOG000120401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="predicted nucleotidytransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398013"
FT                   /db_xref="GeneID:8094984"
FT                   /translation="MPILEHFKKFTGFKVLEYFILHPACEIHLKELARTLKISPGSAKL
FT                   YCDLFESEDILISKRKGNLRLFRLNNDDFAVKEIKKTYYLVLLKEKGIQYICKNCSSLA
FT                   IYGSFASGEFDEKSDLDILVIGNKEDINYQLLHEIEDKVGVRFQLTVIPFYKWEKMKEE
FT                   KDHFTESVIRKHLLIKGAPL"
FT                   /protein_id="YP_002993437.1"
FT   misc_feature    complement(16964..17185)
FT                   /note="Nucleotidyltransferase (NT) domain of Staphylococcus
FT                   aureus kanamycin nucleotidyltransferase, and similar
FT                   proteins; Region: NT_KNTase_like; cd05403"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="TSIB_0017"
FT   misc_feature    complement(order(17018..17020,17024..17026,17099..17101,
FT                   17105..17110,17129..17131,17138..17146))
FT                   /note="active site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="TSIB_0017"
FT   misc_feature    complement(order(17099..17101,17105..17110,17129..17131,
FT                   17138..17146))
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="TSIB_0017"
FT   misc_feature    complement(order(17018..17020,17099..17101,17105..17107))
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="TSIB_0017"
FT   misc_feature    complement(order(17018..17020,17024..17026))
FT                   /note="antibiotic binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="TSIB_0017"
FT   gene            17592..18578
FT                   /db_xref="GeneID:8094985"
FT                   /locus_tag="TSIB_0018"
FT   CDS_pept        17592..18578
FT                   /locus_tag="TSIB_0018"
FT                   /gene_family="HOG000237151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398014"
FT                   /db_xref="GeneID:8094985"
FT                   /translation="MSWRDYWDLITIITLSLLLDLLIAFYPDSLLRKALGLAFVLFFPG
FT                   YVFITALFPEKKELDNLERLALSFGLSIAIVPLIGLGLNYTPWGIRLIPILVSLTVFNL
FT                   IFGIAAIYRRANAVDPWIPRISSEKLKEELEWGKSSKLDKALTVILIIAIISSIATLGY
FT                   VITHPKPGEKFTEFYILGPEGKAADYPTELFVGEKARVILGIANHEYRDVTYHVEVWLV
FT                   NLTYDFETNETIIYNMYIVDYFNVTLPHKPVDIEGNWTPQWETNYTFTINRAGKWQLWF
FT                   LLFKDERSPVPGPLKGDYAQTNATQRILDAIEGEIQSLKLNIEVREI"
FT                   /protein_id="YP_002993438.1"
FT   misc_feature    17673..18467
FT                   /note="Protein of unknown function (DUF1616); Region:
FT                   DUF1616; cl01959"
FT                   /db_xref="CDD:154678"
FT                   /locus_tag="TSIB_0018"
FT   gene            18809..20008
FT                   /db_xref="GeneID:8094986"
FT                   /locus_tag="TSIB_0019"
FT   CDS_pept        18809..20008
FT                   /locus_tag="TSIB_0019"
FT                   /gene_family="HOG000078152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398015"
FT                   /db_xref="GeneID:8094986"
FT                   /translation="MSRKIKSQVVIALMAMASISGLYYLGDLQAQSPMPLEEAKKGDLI
FT                   EFTGICVNSKENFAVLYNGSEIIVVFETLESGKVYKIRGKLTDPDKSYVQAFEINQTSP
FT                   KALPLETVTGAYWVDDYCQLLTPQRISLNTCLNASKGERVIVEGLYYNKRFYVVNYTRL
FT                   GFENSPEDSMPFLIRGSVIYGGNPATIWDGEEEVRVYLPYKQTLEVGDYVEVIGTAKLY
FT                   STLTIYVNDRSDIRVLGRARKCPIGEEKIGEIAYGVCAVKKSTKTYISLNCTSIPLYGF
FT                   SVRVGDLIEFEAIRRKNSLYCLECKVSRPREALENSICNPVPDQPSKIEGRVAWVKLYS
FT                   NGFGIANITNGNCWTLLKLSKSIGVTLEEGGHVVAFGFHTTYREMPAFEVASREDVIKD
FT                   "
FT                   /protein_id="YP_002993439.1"
FT   gene            20018..21169
FT                   /db_xref="GeneID:8094987"
FT                   /locus_tag="TSIB_0020"
FT   CDS_pept        20018..21169
FT                   /locus_tag="TSIB_0020"
FT                   /gene_family="HOG000230261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="DUF112 superfamily"
FT                   /db_xref="GI:242398016"
FT                   /db_xref="GeneID:8094987"
FT                   /translation="MLRELILGMLGGTLTGLTPSLHVNTLASLINNLDFPLEGFSFVVL
FT                   AYAMGLTHTFLDAFPSTFFGVPDEGTALSVLPAHRLALQGKGLEVINLSLRASLLAAIF
FT                   SIALIPLYLIIAPYYTPEIGRAIVFFLAFLIVVTEKGIKKLYALFVLLLAGALGIVSDL
FT                   LPLREPFYHLFVGLFGVPAILLSLDNNNKISGGNDTIEMSQSQLVGFSFLGTIFGMMAS
FT                   LLPTFTSSQAALIGSFIARSERTFLTITFAVNTANFVFGLGNFYSTGKTRNGILVLIRE
FT                   LYYPISLQEFLILLLATLAVAAIVNLYGLWLSKKLVTLIERIDYRTLNALILTTTVLGS
FT                   LFLDGLFGLLVLIAATLVGLTAVFLGVKRTACMGVLMLKVMLG"
FT                   /protein_id="YP_002993440.1"
FT   misc_feature    20072..21166
FT                   /note="Tripartite tricarboxylate transporter TctA family;
FT                   Region: TctA; cl00772"
FT                   /db_xref="CDD:153985"
FT                   /locus_tag="TSIB_0020"
FT   gene            21283..22593
FT                   /db_xref="GeneID:8094988"
FT                   /locus_tag="TSIB_0021"
FT   CDS_pept        21283..22593
FT                   /locus_tag="TSIB_0021"
FT                   /gene_family="HOG000073763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Putative ATPase of the AAA superfamily"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398017"
FT                   /db_xref="GeneID:8094988"
FT                   /translation="MVRVVIQLDDYLVKLAADLPRRFEYARGLRRRFIFEELQGKVNSF
FT                   MGGGRCATVFLPGLRATGKTTLLGQLYFYTHSLSSEVIYLPVDELKLLGFTLIEAVERY
FT                   LEIFRPERPVLLLDEVQYDEKWPLTLKVLNDRKQFLIIATGSSALNLKESPDLARRAEH
FT                   IHVHPLTFREYLYLSEGVLGKGSLKPLLDFDVELIERSMAESAPYLWKAEEYLRTGSLP
FT                   FSFDRKEPEVYEAVFTLIERMIYRDLPQVKGFDSQTLEKTLKLLFLLANPKGERFSYER
FT                   LSKILGMAKGTVISTINALIKAGILVEIPSIGGMTKKVKKGPKLKFLAPTLRAALLYKS
FT                   GELEKGLSALLEDAVAFYLSKIGKLEYEPEKGGADFVLTVDGRKYVVEVGLGKDRVTQV
FT                   RRSMERVSADGGIVIGEKFYANDDILSIPWRRFLVLI"
FT                   /protein_id="YP_002993441.1"
FT   misc_feature    21442..22590
FT                   /note="Predicted ATPase (AAA+ superfamily) [General
FT                   function prediction only]; Region: COG1373"
FT                   /db_xref="CDD:31564"
FT                   /locus_tag="TSIB_0021"
FT   gene            22679..23293
FT                   /db_xref="GeneID:8094989"
FT                   /locus_tag="TSIB_0022"
FT   CDS_pept        22679..23293
FT                   /locus_tag="TSIB_0022"
FT                   /gene_family="HOG000073977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Methyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398018"
FT                   /db_xref="GeneID:8094989"
FT                   /translation="MNQVMSMRREIVFMIVGLLLGAAGFKIGGALFSDISISENNEIAT
FT                   GEFDVRISKTGSSFYNDLKLFEFNDLKPGDEIKAEFYIKNSGDFNISKILIIPHVQDLE
FT                   SGDLNGAEALVDNTTEIGELSQNLILEWIVITQSNQTYTLSDYSGKSLHELNNQSISLL
FT                   TAPFAPSEVLKVTMFFLVNPEAGNEIQKDLCLISMQIYAEQ"
FT                   /protein_id="YP_002993442.1"
FT   misc_feature    22688..23254
FT                   /note="Camelysin metallo-endopeptidase; Region:
FT                   Peptidase_M73; pfam12389"
FT                   /db_xref="CDD:152824"
FT                   /locus_tag="TSIB_0022"
FT   gene            23280..24131
FT                   /db_xref="GeneID:8094990"
FT                   /locus_tag="TSIB_0023"
FT   CDS_pept        23280..24131
FT                   /locus_tag="TSIB_0023"
FT                   /gene_family="HOG000068103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative sugar-catabolism phosphotransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398019"
FT                   /db_xref="GeneID:8094990"
FT                   /translation="MQSSEFLNFFFFSYLVFAMIGIIFDMDGVIYRGNQPIDGVKEVIE
FT                   FLKSNKIPFVFLTNNSTRDAKMYREKLQGMGIEVEEDRIITSGHATAQYLKKHFEKGNV
FT                   FVVGGKGLVEEIKSIDWPVISLEEAKEKWREIGYVVVGMDPQLTYEKLKYGCLAIRNGA
FT                   RFIGTNPDTTYPGEEGILPGAGSIIAALKVATEKEPLIIGKPNEPVFEVVREKLNADEI
FT                   WVVGDRLDTDIAFAKKIGAKAIMVLTGVNTLEDIEKSEVKPDIVLPSIKELLEYIKVHL
FT                   EI"
FT                   /protein_id="YP_002993443.1"
FT   misc_feature    23331..24113
FT                   /note="Predicted sugar phosphatases of the HAD superfamily
FT                   [Carbohydrate transport and metabolism]; Region: NagD;
FT                   COG0647"
FT                   /db_xref="CDD:30992"
FT                   /locus_tag="TSIB_0023"
FT   misc_feature    23343..>23609
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cd01427"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="TSIB_0023"
FT   misc_feature    order(23352..23360,23451..23456)
FT                   /note="active site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="TSIB_0023"
FT   misc_feature    23352..23369
FT                   /note="motif I; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="TSIB_0023"
FT   misc_feature    23451..23453
FT                   /note="motif II; other site"
FT                   /db_xref="CDD:119389"
FT                   /locus_tag="TSIB_0023"
FT   gene            complement(24230..24394)
FT                   /db_xref="GeneID:8094991"
FT                   /locus_tag="TSIB_0024"
FT   CDS_pept        complement(24230..24394)
FT                   /locus_tag="TSIB_0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398020"
FT                   /db_xref="GeneID:8094991"
FT                   /translation="MDILVDFYEVPSPLTFLKLEEYLEELLSIRVDLVMESALKPKISQ
FT                   AAHKEVVYI"
FT                   /protein_id="YP_002993444.1"
FT   gene            24826..25380
FT                   /db_xref="GeneID:8094992"
FT                   /locus_tag="TSIB_0025"
FT   CDS_pept        24826..25380
FT                   /product="Inorganic pyrophosphatase"
FT                   /gene_family="HOG000236472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="TSIB_0025"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="GI:242398021"
FT                   /db_xref="GeneID:8094992"
FT                   /translation="MKIKEVIEMNPFHDLEPGPEVPEVVYALIEIPKGSRNKYELDKKT
FT                   GLIKLDRVLYSPFYYPVDYGVIPQTWYDDDDPFDIMVIMREPTYPLTIIEARPIGLFKM
FT                   IDSGDRDYKVLAVPVEDPYFKDWKDLDDVPKAFLDEIAHFFRRYKELQGKEIIVEGWEN
FT                   ADKAKQEILRAIELYKEKFKK"
FT                   /transl_table="11"
FT                   /protein_id="YP_002993445.1"
FT   misc_feature    24892..25353
FT                   /note="Inorganic pyrophosphatase. These enzymes hydrolyze
FT                   inorganic pyrophosphate (PPi) to two molecules of
FT                   orthophosphates (Pi). The reaction requires bivalent
FT                   cations. The enzymes in general exist as homooligomers;
FT                   Region: pyrophosphatase; cd00412"
FT                   /db_xref="CDD:29533"
FT                   /locus_tag="TSIB_0025"
FT   misc_feature    order(24922..24927,25081..25086)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29533"
FT                   /locus_tag="TSIB_0025"
FT   misc_feature    order(24937..24939,24979..24981,25015..25017,25267..25272)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:29533"
FT                   /locus_tag="TSIB_0025"
FT   misc_feature    order(24943..24945,25045..25047,25060..25062,25141..25143,
FT                   25156..25158)
FT                   /note="metal binding sites; metal-binding site"
FT                   /db_xref="CDD:29533"
FT                   /locus_tag="TSIB_0025"
FT   gene            25413..25976
FT                   /db_xref="GeneID:8094993"
FT                   /locus_tag="TSIB_0026"
FT   CDS_pept        25413..25976
FT                   /locus_tag="TSIB_0026"
FT                   /gene_family="HOG000229315" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase subunit E'"
FT                   /EC_number="2.7.7.6"
FT                   /note="Participates in both the initiation and recycling
FT                   phases of transcription"
FT                   /db_xref="GI:242398022"
FT                   /db_xref="GeneID:8094993"
FT                   /translation="MYRLLRVKDIVRIPPKMFTLDPKEAAKIVLREAYEGIYNKDEGVV
FT                   LAVLEVHEISEGVIIPGDGATYHDVVFDVLVWKPEMHEVVEGEVIDVVPYGAFIRIGPM
FT                   DGLVHISQLMDDYVVFDEKNAQFVGKEKGHVLKLGDVVRARIIAISEKSKIIRENKVGL
FT                   TMRQPGLGKFDWIEKEKRKAESGG"
FT                   /transl_table="11"
FT                   /protein_id="YP_002993446.1"
FT   misc_feature    25413..25958
FT                   /note="DNA-directed RNA polymerase subunit E'; Provisional;
FT                   Region: PRK08563"
FT                   /db_xref="CDD:169488"
FT                   /locus_tag="TSIB_0026"
FT   misc_feature    25416..25655
FT                   /note="RNAP_E_N: RpoE, N-terminal ribonucleoprotein (RNP)
FT                   domain. RpoE (subunit E) is a subunit of the archaeal RNA
FT                   polymerase (RNAP) that is homologous to Rpb7 of eukaryotic
FT                   RNAP II, Rpc25 of eukaryotic RNAP III, and Rpa43 of
FT                   eukaryotic RNAP I. RpoE...; Region: RNAP_E_N; cd04331"
FT                   /db_xref="CDD:73171"
FT                   /locus_tag="TSIB_0026"
FT   misc_feature    order(25416..25430,25434..25436,25440..25442,25512..25517,
FT                   25536..25538,25548..25553,25650..25652)
FT                   /note="RpoF interaction site; other site"
FT                   /db_xref="CDD:73171"
FT                   /locus_tag="TSIB_0026"
FT   misc_feature    25659..25955
FT                   /note="S1_RpoE: RpoE, S1-like RNA-binding domain. S1-like
FT                   RNA-binding domains are found in a wide variety of
FT                   RNA-associated proteins. RpoE is subunit E of archaeal RNA
FT                   polymerase. Archaeal cells contain a single RNA polymerase
FT                   made up of 12 subunits, which...; Region: S1_RpoE; cd04460"
FT                   /db_xref="CDD:88426"
FT                   /locus_tag="TSIB_0026"
FT   misc_feature    order(25659..25664,25668..25676,25710..25715,25719..25721,
FT                   25839..25841,25845..25847,25917..25919,25950..25952)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88426"
FT                   /locus_tag="TSIB_0026"
FT   misc_feature    order(25680..25682,25704..25706,25731..25733,25737..25739)
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88426"
FT                   /locus_tag="TSIB_0026"
FT   gene            25979..26164
FT                   /db_xref="GeneID:8094994"
FT                   /locus_tag="TSIB_0027"
FT   CDS_pept        25979..26164
FT                   /locus_tag="TSIB_0027"
FT                   /gene_family="HOG000229326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase subunit E''"
FT                   /EC_number="2.7.7.6"
FT                   /note="Catalyzes the transcription of DNA into RNA using
FT                   the four ribonucleoside triphosphates as substrates"
FT                   /db_xref="GI:242398023"
FT                   /db_xref="GeneID:8094994"
FT                   /translation="MTEKACRHCHYITNEDRCPACGSRDLSDEWFDLVIILDPENSRIA
FT                   QTLGVKKPGKYAIRVR"
FT                   /transl_table="11"
FT                   /protein_id="YP_002993447.1"
FT   misc_feature    25979..26161
FT                   /note="Transcription elongation factor Spt4; Region: Spt4;
FT                   cl12033"
FT                   /db_xref="CDD:175392"
FT                   /locus_tag="TSIB_0027"
FT   gene            26166..26708
FT                   /db_xref="GeneID:8094995"
FT                   /locus_tag="TSIB_0028"
FT   CDS_pept        26166..26708
FT                   /locus_tag="TSIB_0028"
FT                   /gene_family="HOG000229337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:242398024"
FT                   /db_xref="GeneID:8094995"
FT                   /translation="MSRNFYYKLTEDLRNELKKPLGELIEGKMPQPYLKSREELKKAPF
FT                   LVTVGDVVTENVLKVGIKPSVAIYDYKTKRKEYEPDIEFGAVVLTTKNPPGTITKALLN
FT                   AVKKSFELAKKGKRVYLKVNGEEDLAAIPAVIYAPEGALVIYGQPDEGIVLIKVTSECK
FT                   RRCAKLLRKMEVVHDGD"
FT                   /protein_id="YP_002993448.1"
FT   misc_feature    26172..26705
FT                   /note="Protein of unknown function (DUF359); Region:
FT                   DUF359; cl00832"
FT                   /db_xref="CDD:174413"
FT                   /locus_tag="TSIB_0028"
FT   gene            26698..26994
FT                   /db_xref="GeneID:8094996"
FT                   /locus_tag="TSIB_0029"