(data stored in ACNUC8465 zone)

HOGENOMDNA: THPAR1_1

ID   THPAR1_1; SV 1; empty ; DNA; empty ; INV; 2540030 BP.
XX
AC   NC_007344;
XX
DE   Theileria parva strain Muguga chromosome 1, complete sequence, whole
DE   genome shotgun sequence.
XX
OS   Theileria parva strain Muguga
OC   Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Piroplasmida;
OC   Theileriidae; Theileria.
XX
RN   [1]
RP   1-2540030
RX   PUBMED; 15994558.
RA   Gardner,M.J., Bishop,R., Shah,T., de Villiers,E.P., Carlton,J.M., Hall,N.,
RA   Ren,Q., Paulsen,I.T., Pain,A., Berriman,M., Wilson,R.J., Sato,S.,
RA   Ralph,S.A., Mann,D.J., Xiong,Z., Shallom,S.J., Weidman,J., Jiang,L.,
RA   Lynn,J., Weaver,B., Shoaibi,A., Domingo,A.R., Wasawo,D., Crabtree,J.,
RA   Wortman,J.R., Haas,B., Angiuoli,S.V., Creasy,T.H., Lu,C., Suh,B.,
RA   Silva,J.C., Utterback,T.R., Feldblyum,T.V., Pertea,M., Allen,J.,
RA   Nierman,W.C., Taracha,E.L., Salzberg,S.L., White,O.R., Fitzhugh,H.A.,
RA   Morzaria,S., Venter,J.C., Fraser,C.M. and Nene,V.;
RT   "Genome Sequence of Theileria parva, a Bovine Pathogen That Transforms
RT   Lymphocytes";
RL   Science 309 (5731), 134-137 (2005)
XX
RN   [2]
RP   1-2540030
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (02-NOV-2005) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2540030
RA   Gardner,M., Bishop,R., Shah,T., de Villiers,E., Carlton,J.M., Hall,N.,
RA   Ren,Q., Paulsen,I.T., Pain,A., Berriman,M., Wilson,R.J.M., Sato,S.,
RA   Ralph,S.A., Mann,D.J., Xiong,Z., Shallom,S.J., Weidman,J., Jiang,L.,
RA   Lynn,J., Weaver,B., Shoaibi,A., Wasawo,D., Crabtree,J., Wortman,J.R.,
RA   Haas,B., Angiuoli,S., Creasy,T.H., Lu,C., Suh,B., Silva,J.C.,
RA   Utterback,T., Feldblyum,T., Pertea,M., Allen,J., Taracha,E.L.,
RA   Salzberg,S.L., White,O., Fitzhugh,H.A., Morzaria,S., Venter,J.C.,
RA   Fraser,C.M. and Nene,V.;
RT   "Direct Submission";
RL   Submitted (03-JUN-2005) Parasite Genomics Group, The Institute for Genomic
RL   Research, 9712 Medical Center Drive, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AAGK01000001.
XX
FH   Key             Location/Qualifiers
FT   source          1..2540030
FT                   /strain="Muguga"
FT                   /mol_type="genomic DNA"
FT                   /organism="Theileria parva strain Muguga"
FT                   /chromosome="1"
FT                   /db_xref="taxon:333668"
FT   gene            complement(<3039..>4658)
FT                   /db_xref="GeneID:3502671"
FT                   /locus_tag="TP01_0001"
FT   mRNA            complement(<3039..>4658)
FT                   /db_xref="GI:71031772"
FT                   /db_xref="GeneID:3502671"
FT                   /locus_tag="TP01_0001"
FT                   /transcript_id="XM_760435.1"
FT                   /product="hypothetical protein 1"
FT   CDS_pept        complement(3039..4658)
FT                   /locus_tag="TP01_0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein 1"
FT                   /db_xref="GI:71031773"
FT                   /db_xref="GeneID:3502671"
FT                   /translation="MNSVVTYSISSTSAKQITLDINKTTSTNDSDYSKNGKYRTFTAKP
FT                   GKSFNKVVKKKLYIWECKNNDQAVKVVLMGSGNNKKHLLILLKSSNFVILYKTGRNKPW
FT                   TNITSKRHDPTNLKFFDIDKELTSSDYEVTIYEFSYRFTFKAGVNCKRINYGDVVIWTH
FT                   TDDKFEYITNFDLDLVKNEFFVFDDKRKSRKVNYEGPIISSVTPRTASASTPSTPKYQY
FT                   ASATKVTLDISKTQFTCFEYSLKSGVIRTFTPRSNCFIIKVTHCTTVIWESKTDVFGIR
FT                   VTYVDVVKYLFLLLDNDKFLLFHQPPDRNKPWIDITYTRVNLSKLKFFAENDMELKSTD
FT                   YSVNLVSYSYSLEFNAGVKCQKVKYGNEDVWTNSDDTDFGYIKSLLIDLVANKFRVKND
FT                   SGQLKKLDFKPSTPRLIPIPEQQYQQAPPQSRPTPTYPRPPIPARPPYPSHQLPVQPQP
FT                   IHPGPQLSVRQPVRPPAYSEIQYDTPETPSYPPPPYSESQHDTPETPSYPPPPYSESQH
FT                   DTPEPPSYPPPPYSESQHEAPQ"
FT                   /protein_id="XP_765528.1"
FT   gene            complement(<5178..>6593)
FT                   /db_xref="GeneID:3502672"
FT                   /locus_tag="TP01_0002"
FT   mRNA            complement(<5178..>6593)
FT                   /db_xref="GI:71031774"
FT                   /db_xref="GeneID:3502672"
FT                   /locus_tag="TP01_0002"
FT                   /transcript_id="XM_760436.1"
FT                   /product="hypothetical protein 2"
FT   CDS_pept        complement(5178..6593)
FT                   /locus_tag="TP01_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein 2"
FT                   /db_xref="GI:71031775"
FT                   /db_xref="GeneID:3502672"
FT                   /translation="MTAKWLVINLLLYIRLLCQLNSVVAHPTSGTRSPTNGFQTSRGQY
FT                   STPNGQTTFPEINVTRVSTPASNSTKQVTLDVDKTGSTNDYEYSKENKDNKYHTYTVKQ
FT                   GNVITKVTKGNAVMWDSKNDDYGLKAIYMDHHNSPKYLAVLLQSGKFVLIYRAAYDVIE
FT                   RSDTNMNITHQRYDVTKLKFLGDSDAVIDASSYEPTIADRYYSFEFKNGAKCKKIKFGD
FT                   DVLWKHDSEFGQIVSFHLDLISNKFFLKNHNGDVKSIEYTTGSLKVTTVTTNCLLLPTP
FT                   ESTTVSPELTTLAPESTTVIPDQTETTATFAESTSSYNPSTLDLNTRNSTRDFDYSKTD
FT                   NVHVYTAKSNHSFSKITRGSNTVWEAPDNVSAKSVIFVDESIKYVTIDLGGGFYRTVQV
FT                   DPKSQTNTKTNNTRTKNIPLILLVPLILLPPTLLTLLILLLLKHLLLLKKQKQLLKLEQ
FT                   PLPLNQQMLLPHM"
FT                   /protein_id="XP_765529.1"
FT   gene            complement(<7216..>17805)
FT                   /db_xref="GeneID:3502673"
FT                   /locus_tag="TP01_0003"
FT   mRNA            complement(<7216..>17805)
FT                   /db_xref="GI:71031776"
FT                   /db_xref="GeneID:3502673"
FT                   /locus_tag="TP01_0003"
FT                   /transcript_id="XM_760437.1"
FT                   /product="hypothetical protein 3"
FT   CDS_pept        complement(7216..17805)
FT                   /locus_tag="TP01_0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein 3"
FT                   /db_xref="GI:71031777"
FT                   /db_xref="GeneID:3502673"
FT                   /translation="MRKCMIFIKLLFYIALLHKWNGVESQPTSSGRSNSSGSQGSRAQS
FT                   TTPKSQNQTQSSQSQSQSTASATSRRRTGTTGAQGSQPTKPPSQPASSNGSGSHASPRA
FT                   STGQSSTPKSQPTTPTSQSQPKSTASRTSSTGVGQARGTPSSATSQPSRGVGVGRGSQP
FT                   KATAATIGTSTPTTPPTPTTSAAQTKATPTTGARPATQPKVTPASASSTQPKSQANVTP
FT                   VSGSAAPSVSTSATPTKPVSQSTPTTSVTKVTLNIDTTKESTSELDYSKIGDIHNYTPK
FT                   QNHLFSKVTHGSVVVWESKTEVHGTRVTYVCIIKYLVVLLSNDMFLLFHQSSGTWTDVT
FT                   KERYDVDKLKFFGENDAALNKSSYSTTLISYSYSLEFNAGVKCQKVKYGNEDVWKHSDD
FT                   TDFGSIKSLFIDLISNQLSVKNESGQLKKLEYKPKESNGTTSETADATKEPTTPTTVTT
FT                   KSDPTTTATATETSSSTLTTESDTATTQTTPVTTPTSSGSSVTQSKRLESSSTSGNIHT
FT                   FTSGVSHSAVDASQGASVLDSGSSSSTLVLTEYKKLPSIRLTTSTDTDTSSKSQTATPV
FT                   TTTTTNVALDIDKKQSTDQFEYSDINNYRIYVAKTNFVFNKIVQGTTVIWESKDYCATS
FT                   VTTKTIDNKVFLAIVLSNGMFTLVEKSSGKWTDITFDRHNVTSLKFYGDRDTEIKSSKY
FT                   SVTMSGLSYNLDFNTNVDCKKIKYNNVTLWSHTDDSEFGTIKSLSLDLAKNVFFVKNSA
FT                   DIVKKLELKYISLDIDKKQSTDESDYSKSDCHTYMTKSNFVFNRIVQGTDFVWKSQVLF
FT                   GTKVTAAGDFLTILLNNGTFKLFQKSVGEWIDITPNKHDIGKLKFYGEGDRLLKSYDYS
FT                   VTLSCLAFSYEFNVGSECHKVKYGDDVLWNHSDDSQFGTIKTFSLDLPKNQFTIKNNSG
FT                   TVKNVEFKYVILDLNTMESTDHFDRTGDDGIFKFVVKSGYVFSKVVQGTSVVWEPRDSA
FT                   YCTEVTYIVAGDFKYLSAVLDNGSCLLLYKTSKDKPFKDITSTSYNVTRLKFLTDDNSE
FT                   LSTSDYKVTVAEHCYNLEFNSDVKCSKITHNGADLWKHSDDTQFGTIKSLHLNLINNQL
FT                   GLKNQSNTLKELQVPLPPTPDVTDTTGTKITIDLNETKEVEGMFTYSHDGKCHTYATAG
FT                   FGNTFGKVMKGTRVVWEPVGNVQAKKIIYVDDHVKNVVVVLTDGKFLLLKQSDNNWDDV
FT                   TKYTLDVSKLVFLGDNHGATSLGVSASVTVVDTAMTLTPDDQSKLISGSASSSPVTSPV
FT                   SQPKSATVTTTPATTPQTQGPAPAKDPEAKSTTTTAPQVSGPAVTPSTATPSPAKVTSP
FT                   PAATLSGTEVTPPKVAVSGTPVTLDIDNTQSASEYDYKDEGGVVTYTPKENHVFSKVTE
FT                   GPIVLWKSDDVSGTMVRICSKLLVILFNNNEFKLFEQSEGNWIDITDKRHNLTKLKFFN
FT                   DSNAQIKPTEYTVTIVELSYRIQFSQGTICRKITLGNDIIYNYQDDTDFGSIGSLDLDL
FT                   VSNGFFVKNESGDLKSVTKPVILDLETTKSTPEFDISYIEGSDHIYIPKENRVFNKVVR
FT                   GPTLIWESKDNVCATIVTISSKFLSILFDNNTFKLFQESEKQWTDITSDRHNVASLKFY
FT                   GDNNVEIKLSDYIVSMSGLSYNFEFKTGVKCKKITLDNVTLWSHTDDTQFGTIKSFSLG
FT                   LVLNGFFIKNESGTVKPAEPTKVTLDIEKTQSTDQLEYKDQNGVVTYTGKDCHVFSKIM
FT                   QGSTVVWESEENLFATKVIKDGNKNSLSINLSNGTTKEFQQSDSKWTESQTSSPVTTSS
FT                   SSAQTATTETATTGTTTTTKTVLDIDIKKSTDQFQYSNSGGFTKFVARPGYGFTKVTKG
FT                   NSVVFQSTRILFGTIVTYMDSCNYVSAQFINGMFKDFQLSGTKWTESKPIQSNNTPFTS
FT                   FDYKVTVTNYIYEFQFNEGAECKTVKYGNVQVYRHTDHPFQRSFGSIKSFSVDLVKNRF
FT                   FIKNQSCSMRELPYEPPLDTKSIDTTQRLLLTRGQSTTDVIEAVDVRPITLDLTTATNN
FT                   KFSRTDKDGYVTYTANPGFVFGKVTHGANIVWESDSNIFGNLVRIKSESNNMFLVILLD
FT                   NSTFKLFQFSDGTVFKDITAEKRDVTKLKFLGEGGEINPSDFKVSLADFEFSYEFHDRV
FT                   KCLRITLGNECVYEHKGGFGAIKSLSLDLVLNKFSTVEVKSVSLDIDKSQSTNEFDHTE
FT                   KNGVSTFSPKSGHVFTKVTHSNTAIWESDGNVCATIVNTKTSDNKVFLSIFLSNNMFKL
FT                   FLKSSDGAFKDITNQRHDVKKLKFLGQDDSPLKSTDYSVSMSGHTFLCEFNRGFNCLGV
FT                   KLGNEDIWKPDGDPKFSTIKSLSLDLIDNKFSLKNESGDIKPVVIPVILDISKTQSTSE
FT                   FEYLKEYEFHKYTVKSCYLFTKVTEGAKVVWESNDTVGGTLVTTTGEFLAILLNNNLFK
FT                   LFLKSSEWEDITKSRIDISGLKFLTDDSEIGTSDYKVTISCHSYILEFNPGVECHKITH
FT                   RGIDLWKSDDDQKFKSVKSLSLCLLSNQLSVTNESGTVKDLKLTSDTTETESTAPVTKY
FT                   ITLDVDKKQSTSEFECKEKNGVTSYTAKSDIVFTKITHKTTVVWESGGNVCAILVSVKA
FT                   EFLAILLSNNQFKLFQKSSDGTWKDITSQRHNISNLKFLGQGGSVLKSPDYSVSMSGLI
FT                   LVYEFNTKCTKIMLENENIWKPDDDPKFPKIKSLSLDIASNKFSLKSDTAVKELELSLA
FT                   TSTESATKSATATSVTDPTTQTTPESVTGFPTKSSPESTTTTQPNVSTTTQSVTPTPTG
FT                   TTVTSVTLDINTTNSTQQFECKEKNGVISYVAKSGNVFTKVTHGQTSVWESSGNVSGAM
FT                   VTTKKDEFIAILLDNKKFLIFQNSDNKWTDVTCDRCDLDELSFFSDDTVLTSSQYKIVL
FT                   SDLSYNLQFNDGVKCSKITHKGVRVWPVPDGSKTTTDTDDTTKTIDDTTSSKSASDDTG
FT                   FGFIKSLHLDLVANKFSVKNESDQVKEFEYKPVKSKIITSSSGGTLSVDAVPGLYKLNL
FT                   GLTQSQYDIVKVGKSFEYHFKPNVKCSMILFNDDTTSYYHPTVWNSPNQDDVFGTKVVV
FT                   SDDVKYLLLLLNNNMYKMFTHFYNRWVEISRDRRDVSKLKFYGIQEVSDSSSSLTVPES
FT                   DRQLTPSDYKFSISDFVFSFEFNEGILCRKINLGDMIVYNYDILKTPIKSFNINLRTNQ
FT                   FSVNNRFGDANVELVQRPDTLITIDLNVCETTFEYQYLKTDDDFHTYVPLFGYAFNKIV
FT                   RGSNDIWESTTDCSLKVVYMDSAKLLAILMDNNKFFLFQESSGTFRDITSMRHDVSNLK
FT                   FLDTRDSELTSSDLKITIVNNSYRYEFKDGVRCQTVKYSDDVLWRHSDHTKFGTIVSFH
FT                   LGLVSNKFFVKNQSDQLKMIEYRPGTLPIVTDVNRNTSSELDIDKKGSTDRYDYENNGD
FT                   DHIFTPKSGCEFSKVVRGEKVIWEASENLFAKDVIFDEANNYVTIELTNGSFRTITLSD
FT                   TTT"
FT                   /protein_id="XP_765530.1"
FT   gene            complement(<18028..>20668)
FT                   /db_xref="GeneID:3503550"
FT                   /locus_tag="TP01_0004"
FT   mRNA            complement(join(<18028..18116,19351..>20668))
FT                   /db_xref="GI:71031778"
FT                   /db_xref="GeneID:3503550"
FT                   /locus_tag="TP01_0004"
FT                   /transcript_id="XM_760438.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(18028..18116,19351..20668))
FT                   /locus_tag="TP01_0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nutrient reservoir activity [goid
FT                   0045735]"
FT                   /db_xref="GI:71031779"
FT                   /db_xref="GeneID:3503550"
FT                   /translation="MNIRITYKSILLIILLGFVRCADKPDDQPTAKSVGLVAYSDSEEE
FT                   ENFDVTDLTEIGQQTIGRINSDYPTHQSIQENKLQTELQKLQTEIKKLHTKLRQLQTEL
FT                   RKYYPGYLAPTTQQQEQHYGSPQTQPVIHEPEPLIEPEPYGEYQSESLQSEQVQYGHDG
FT                   PKQYTQLQVPQEREQYYEPPTTQPQQEQYQYYVSPQPQLQDQAQQYGTMDQSYQYYAPP
FT                   PIRRPIPCYPEVAYQSYYFPRYPPYIPPQVTEPQQTEHYYVPPQTQQPSPQPDTEYATP
FT                   PQELSQEVTPIQPPSIDQSDSTVKSGHKQGSVKRKKPSRKTHKIELYKKDAGGNLVEMS
FT                   DNDYFITHMDVDKGKYLFNSNLEQIRSEGEIVYEHLSGTPYCSVLKHRRRYNIFILTNP
FT                   EGFILVKKVEGVWRKFPKSIPDFLKLYTQDSEGSEILLTEGIRIFTFGLSLLSILVLSL
FT                   SELSMLLLIL"
FT                   /protein_id="XP_765531.1"
FT   gene            complement(<20951..>21967)
FT                   /db_xref="GeneID:3503551"
FT                   /locus_tag="TP01_0005"
FT   mRNA            complement(<20951..>21967)
FT                   /db_xref="GI:71031780"
FT                   /db_xref="GeneID:3503551"
FT                   /locus_tag="TP01_0005"
FT                   /transcript_id="XM_760439.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(20951..21967)
FT                   /locus_tag="TP01_0005"
FT                   /gene_family="HOG000135907" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031781"
FT                   /db_xref="GeneID:3503551"
FT                   /translation="MNKCIAYNCIFISIIIRYINCSDKDPDQTEVDSDEEDNFDVIVSQ
FT                   IENLLEDETAGDSVISDNIKQHGLGHIVYNSYGSESISTTQPTDFLDEESGIIEGPSGP
FT                   HDQVSTQTTPIPHLDKSEVGDDKKEAAAVKPSKISESLIFMKKGDDGGLFQMIEGQDYK
FT                   LIFDDGTTLKFEFYNELEQVIYNGDNIYVHMPKRLYALELTCNKTTNVFVIALEDSFLY
FT                   IDYRAGMWRANSRKIPNYVKFYGKDSEGVEFEFSKEHYSFYLTEKGAFRYVFFPEIPCA
FT                   KVVINNRLIWEKTPEDKSLLSVHINIKGDVFLKFKTHVSLFAKKRNEYKYLYDMGRK"
FT                   /protein_id="XP_765532.1"
FT   gene            complement(<22238..>23719)
FT                   /db_xref="GeneID:3503552"
FT                   /locus_tag="TP01_0006"
FT   mRNA            complement(<22238..>23719)
FT                   /db_xref="GI:71031782"
FT                   /db_xref="GeneID:3503552"
FT                   /locus_tag="TP01_0006"
FT                   /transcript_id="XM_760440.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(22238..23719)
FT                   /locus_tag="TP01_0006"
FT                   /gene_family="HOG000135906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031783"
FT                   /db_xref="GeneID:3503552"
FT                   /translation="MNILLSYICIIFIIIGYVHCADKPTNLPAGGHGNEDDSDESENYN
FT                   LIVKGIENILEDDDDKAAGETVVSDNLMKHGLGPLTNQGYIPPFPYQPQADSYSNYYQS
FT                   NDFGYVSESGKYECTHYKPQYPLHQQNLLPPVIYPPPSFQPIFVPHPPQTILIQPQPQV
FT                   IPSPVTYIGYPYQSYAPPNQQKVSYIPTTKPVRVEKPKPDQLVGDKPSKDKDETKEQSS
FT                   QPTEPSGTDQHLQPEHIPVEVGSDDEETEEGAVGGAGGGDEDEEDFGKEKKKEKDLEGK
FT                   KSKDIKKCESIEFLKKNAREEFVKMDIFDYDIDFNDSNVIMYRFWLSPSEVRCDGKTVW
FT                   KRINKNYRPKSMTYNKRYNTFSIRFKNVFLLETLVGDIWEGCVFKYPNYARLYAQDSEG
FT                   NLVLLTEADYYLDVTPKGHYKFDVDGLKCVRVEFKIEGVVWEKKPGDKYPVIICLTERS
FT                   GIIMYFEGETFIYGRRGGKFKLLTCRKNRRISYAK"
FT                   /protein_id="XP_765533.1"
FT   gene            complement(<25166..>26808)
FT                   /db_xref="GeneID:3503553"
FT                   /locus_tag="TP01_0007"
FT   mRNA            complement(join(<25166..25170,25281..>26808))
FT                   /db_xref="GI:71031784"
FT                   /db_xref="GeneID:3503553"
FT                   /locus_tag="TP01_0007"
FT                   /transcript_id="XM_760441.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(25166..25170,25281..26808))
FT                   /locus_tag="TP01_0007"
FT                   /gene_family="HOG000135280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031785"
FT                   /db_xref="GeneID:3503553"
FT                   /translation="MNKNIVYNFILIFTIIQCVESQDNNPDQPADEKEEDDEDNFDVLD
FT                   IDEIIQQRISRFDDPQYQPQYQQLQESQYPTQPQTQPQPQTQPQHYPGYQPEPTYYQRE
FT                   SSEYYTYQPEQPPVDPLAQPQQYDQYQPYVPPQPQPTQPQYQYYGPSQPAQPTYQYYVP
FT                   VTQPSIPLTQPTQPSYQYYGQPQPQPPAILYPTQQPQQQYYGQPLPQTPAIPHPAQPSY
FT                   QYYITPTYPIQQPSYQYYITPTYPTQQPSYQYYGPAPTQTPEQYYVPPTTQHQVAQQPT
FT                   ESVKRKRTRDSEDQGEEEDEEESVKPIGPLLKKYDIKFYKRSHLGNLVEMTEEECFVIY
FT                   VDRTKTKIKFKKDLEQIRCEGEIIYVHSHGEPYCSLLTHSKPTNIYVLNIGQGFILIRK
FT                   VKGSWIRTDHVIPDFVKFYTQDPLGNEVLLTEGDYSIDFTSCGSFTYELRPGVKCYKIE
FT                   VKEITAWKKTEDDDGFPEFIYVSPKFTVIIKFKKYTKTLERRIRKYQLLRTR"
FT                   /protein_id="XP_765534.1"
FT   gene            complement(<27234..>28600)
FT                   /db_xref="GeneID:3503554"
FT                   /locus_tag="TP01_0008"
FT   mRNA            complement(join(<27234..27290,27323..>28600))
FT                   /db_xref="GI:71031786"
FT                   /db_xref="GeneID:3503554"
FT                   /locus_tag="TP01_0008"
FT                   /transcript_id="XM_760442.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(27234..27290,27323..28600))
FT                   /locus_tag="TP01_0008"
FT                   /gene_family="HOG000135280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031787"
FT                   /db_xref="GeneID:3503554"
FT                   /translation="MNKHIAYNFVLIFIIIKYVKSQDNNPEQPADEKEEGDEDNFDVLD
FT                   LDKIIAERISRFDDPRYQPDYQQITESQYLPQMLIQPQQYDQLPSQQQLHYVQELLEPE
FT                   QYGQYQPYQTQTSQPLTQPQQYDQYQPYVPPQPQPTQPSYQYYGPSQPAQPTYQYYITP
FT                   SQPTQQPTYQYYGVSQPTQEFYQTYLPTQPQTEVSQPPQPQPQPEPEPQPIAQEFQQPE
FT                   DDDNFYVTEHDQQHQGPSATDPGFLYGPTQPTTQPITQESTHYVPPQTQDQVAQQPTES
FT                   VKRKRTQDSEDQGEGEEEDEEVSAKRKKPLLKLYDIKLLKNDSDGMLVEMTEEDYLIIF
FT                   SDRAKTKLKFKADLEQIECEGDIIYVHSHGTPYCSGLAISRYTKIFILASIDEFILIKK
FT                   TRGSWETTQKTIPDYVNIYTQDDEGNDFYFKIILQIRISPRHRMS"
FT                   /protein_id="XP_765535.1"
FT   gene            complement(<28816..>30312)
FT                   /db_xref="GeneID:3503555"
FT                   /locus_tag="TP01_0009"
FT   mRNA            complement(<28816..>30312)
FT                   /db_xref="GI:71031788"
FT                   /db_xref="GeneID:3503555"
FT                   /locus_tag="TP01_0009"
FT                   /transcript_id="XM_760443.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(28816..30312)
FT                   /locus_tag="TP01_0009"
FT                   /gene_family="HOG000135280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031789"
FT                   /db_xref="GeneID:3503555"
FT                   /translation="MNKSVIYTYTLVFFIVKFTDCSDKPTDQSTNRGVGLVPHTDSDEE
FT                   EYNNFDVSNLTEIEHQTGVQISPQYTTHYQPIPEPQYHQQLQPQTQQYGQYQPHVPLPQ
FT                   VTQPQTQEQQYPITYQHYWSPVPQVTQETQPIDYYITPIFQPSPTQYEQLTYYHVPPTT
FT                   QPQPIQPSYQYYVPTQTQVTQESQTQQTYQQHYGFYQPLQLNETQTEVRLSEDIEETFE
FT                   EKLVTQEMDHLLGKLKQKIGHPDKTQVSKQQPIQPGKRTQTSGDEDGDEEEEEDEEEPI
FT                   KRHPLIRIIKSKTIKLFKKDSSGNLVEMNNDDYVVKHNDSHKRKYKLIADLEQIRCEDE
FT                   IIYVHSSGAPYCTLLTHSRRTNIIIITNSNGFTLIKKTKGRWKRTDYLIPDFVNLYTQD
FT                   SGGNEVIINNKDYTIDFTSKASFRYILLPGVKCYKIEVKDIIVWKKTVDLDRGFPKMIY
FT                   VSPKLRVIINCEGYSKMFIRRVNRYQLVYSKKTIGVAKYT"
FT                   /protein_id="XP_765536.1"
FT   gene            complement(<31535..>32184)
FT                   /db_xref="GeneID:3503556"
FT                   /locus_tag="TP01_0010"
FT   mRNA            complement(join(<31535..31612,31660..>32184))
FT                   /db_xref="GI:71031790"
FT                   /db_xref="GeneID:3503556"
FT                   /locus_tag="TP01_0010"
FT                   /transcript_id="XM_760444.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(31535..31612,31660..32184))
FT                   /locus_tag="TP01_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031791"
FT                   /db_xref="GeneID:3503556"
FT                   /translation="MKNTYTFLLYFGIWLFSLCSSCFKLDIDQISKYRKGGIEINVYRD
FT                   DSGNFYKHKPSKPFLLKELYYDDDVIYFDPLLTSDQLLISASVLWVLDNPTVIHLNLEK
FT                   SSVILLNESNSSLSVEAIFSEKTISNINHKSHPDSDKLVDVDIQQTRDYDSNSLNVSVN
FT                   QLHLSGNGLEKFKRTSKSFWLWRSYNPCNRGRCSRKL"
FT                   /protein_id="XP_765537.1"
FT   gene            <33474..>38072
FT                   /db_xref="GeneID:3503557"
FT                   /locus_tag="TP01_0011"
FT   mRNA            <33474..>38072
FT                   /db_xref="GI:71031792"
FT                   /db_xref="GeneID:3503557"
FT                   /locus_tag="TP01_0011"
FT                   /transcript_id="XM_760445.1"
FT                   /product="ABC transporter"
FT   CDS_pept        33474..38072
FT                   /locus_tag="TP01_0011"
FT                   /gene_family="HOG000134769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   ATP binding [goid 0005524]; go_function: ATP-binding
FT                   cassette (ABC) transporter activity [goid 0004009];
FT                   go_process: transport [goid 0006810]"
FT                   /db_xref="GI:71031793"
FT                   /db_xref="GeneID:3503557"
FT                   /translation="MGKRRQISDLFNSTFQEPDDKPVSEHHYWESKSYSKTYFNNKSRF
FT                   LKFRYYDSVTVLKFLFFHWVAKWASLLSKQYVEPYKLHPLPVADQVLRWHPVFSKNLSD
FT                   CLIALESYETRQYGHPNTRPTRSVLLRALFLTFWKRTTFGLLGIIVTNVLSMSIALLVK
FT                   HLLGILNTSSFTLLKIFLFLFAVIGLQIVDGLLIENFSYYLLRLKSVWEHSVAIGVFQH
FT                   GMCYRRKYFNNINGSNSLSVCNGVLHTCSPDSDCSRNPLFCPARRYQNKDITPNMFTFE
FT                   YYDCFYVSLFVESAIPIVNFLSNFIYGVVLISMQIKINLWVLYVIGLVFCFLMVVVEII
FT                   NTYLFHFICLVKDYRISECIEIISELPLINKLLYDDIAINIITETRNSELLLILVRLFF
FT                   TLLNKSLCVICNNVTFFVLMNYFVKSVRDAEVIKDVDTGGFLSSFYIFFRIINSMFMFP
FT                   YALGRLTTAYISYNRVKKYLKDCSPNFYISDNRHTGPTEMSSDLPDVTTELAKDVVVLY
FT                   KDASFAWVHNRKDFASKNNEVQLKNVNFQLKRGEIALMTGSQGCGKSNFIKSVLGEMTL
FT                   VGGSMAVVPLHTSMPIFYASEEIWLKEGTIRSNITFGHRFDEEIYNLVIEKLELETDIL
FT                   SWERGDLRVVSDNAHSLSCGQRVRMEMARAIYAYLVFSKVNKDYNRSQCSFLLCLDGSF
FT                   HGLDPYVSRTVFFNLFNAKNGVLVKDDLAVIVSSSLTLLDKCVSPTKLGHFPKIPVYEI
FT                   DNKSVHFNCYLSDVFSYKKTSNAFEYITPPSGPYELNFFTKDMMKLCYSSSNTSSSRNH
FT                   LTKSKYRRSLTSIIQECYSDDKFNPYLLYFRAAGFTFVLFTIFSLASGVMDNSKFVLAT
FT                   NLTDYMFKKAGDYDDGATVDMSDVVSHSDSALNVMLIIVSVIMGCSLVSVLLFTVSSLM
FT                   ASRRIHEYCLTSVFKNSSSVIKIKKQINQIITYFSSDIVFVDECIGDMIFTTFLSFIQT
FT                   AISIGTLFYTIPLSVPFIFISLVIAFEFIVLNIVKSFKSIQLGSLETMSHINTTCEDAI
FT                   LGSPIYRSFKKEWELVNDIIERNDYKTRCWFLANSFASWASVSFNWLFSLTTALFLTGL
FT                   IIFDKFTDFKMNVGYFGLGLSLSMSAIKSFNNCSFCFARLQVFICSLRRFLCFIPPGSK
FT                   YVFDKFRNVHQEDLVISSSKPEDQINTTNLLRRRAIEFKDTNPNFLKRMLFRPKFNFMY
FT                   VSNYLPSEHTGVVLKDLCVYTNSLMNKEGLILNNINATPSKSDIIGIIGRTGAGKTTLL
FT                   SVLEDNVRNRTGQVLLDGRDLQEIPKSVLRHIVGVLPQLPFVFKGWTIRRFLDPRRLFT
FT                   DDDINEALENCGLLDFVNCLPGGRKLDTVVVPKPLNTGKKILDQDPKESFNRGKESYRE
FT                   DSSMTIDAPKSTGTMLSVTQLRTLWFAKLVLCRHQYRMLIIDEPPSDNISEDGSEVQDM
FT                   GIPIYELLDKYFKHCTCFVTAHFSKVLKSCTSVWVMHHGRLIKTCSASEVSKNESISNV
FT                   IEEMVTKYSNQP"
FT                   /protein_id="XP_765538.1"
FT   gene            complement(<38315..>38981)
FT                   /db_xref="GeneID:3502707"
FT                   /locus_tag="TP01_0012"
FT   mRNA            complement(join(<38315..38452,38485..38672,38703..38785,
FT                   38848..>38981))
FT                   /db_xref="GI:71031794"
FT                   /db_xref="GeneID:3502707"
FT                   /locus_tag="TP01_0012"
FT                   /transcript_id="XM_760446.1"
FT                   /product="protein kinase C interacting protein 1"
FT   CDS_pept        complement(join(38315..38452,38485..38672,38703..38785,
FT                   38848..38981))
FT                   /locus_tag="TP01_0012"
FT                   /gene_family="HOG000061064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase C interacting protein 1"
FT                   /db_xref="GI:71031795"
FT                   /db_xref="GeneID:3502707"
FT                   /translation="MFHIYYFIIFVFMISSRFWLVSSFFTRLNLTPFYKQLTFIPTKKT
FT                   NFDTLKSSFSALKSMPNSENPEELTVFHKIVKGELPCKKVYEDDLVLAFYDIQPASPSH
FT                   ILIIPKEMDGLASLSDATERHEKVLGHMLVKAAHIAKENNLGDFRVVINSGPGALQTVF
FT                   YLHMHLMSGRRFNWPPG"
FT                   /protein_id="XP_765539.1"
FT   gene            complement(<39457..>40565)
FT                   /db_xref="GeneID:3502708"
FT                   /locus_tag="TP01_0013"
FT   mRNA            complement(join(<39457..39564,39719..39854,39886..39953,
FT                   39986..40090,40122..40370,40401..>40565))
FT                   /db_xref="GI:71031796"
FT                   /db_xref="GeneID:3502708"
FT                   /locus_tag="TP01_0013"
FT                   /transcript_id="XM_760447.1"
FT                   /product="exosome complex exonuclease Rrp45"
FT   CDS_pept        complement(join(39457..39564,39719..39854,39886..39953,
FT                   39986..40090,40122..40370,40401..40565))
FT                   /locus_tag="TP01_0013"
FT                   /gene_family="HOG000135911" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exosome complex exonuclease Rrp45"
FT                   /note="go_function: 3'-5'-exoribonuclease activity [goid
FT                   0000175]; go_function: RNA binding [goid 0003723];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:71031797"
FT                   /db_xref="GeneID:3502708"
FT                   /translation="MIISDNEIHFLQNPNSDISTLLIGQDCLKNGLRIDGRSLDSHVYV
FT                   SIDFDGPPGTSLISFGNTVVFTCISQEIVEPNSERPNEGFLFFNVETSPFTSESYEPGK
FT                   TTDQEHNLIYFLENMFKESSCLDLETLCITSGKQVWALRVYVHVLQDDGNLLSACSLSA
FT                   LASLLHYRKPLMELSDELNHSFYGLWHKGTPLNIYHVPMFVTVWLLEAPDHSLLDHNLS
FT                   EYKFVLEPNSFEEKLLKTQVSILFNQFGEVLWIYKNGSTPVPLETFESAISVSF"
FT                   /protein_id="XP_765540.1"
FT   gene            complement(<40846..>43243)
FT                   /db_xref="GeneID:3502709"
FT                   /locus_tag="TP01_0014"
FT   mRNA            complement(join(<40846..43139,43171..>43243))
FT                   /db_xref="GI:71031798"
FT                   /db_xref="GeneID:3502709"
FT                   /locus_tag="TP01_0014"
FT                   /transcript_id="XM_760448.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(40846..43139,43171..43243))
FT                   /locus_tag="TP01_0014"
FT                   /gene_family="HOG000135910" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: host cell plasma membrane [goid
FT                   0020002]; go_function: cell adhesion molecule activity
FT                   [goid 0005194]; go_process: cytoadherence to
FT                   microvasculature [goid 0020035]"
FT                   /db_xref="GI:71031799"
FT                   /db_xref="GeneID:3502709"
FT                   /translation="MTLMWDHRMFTGKKKGTWFADYNKIEKKRIGRNLSAEIVPPYNAV
FT                   QYYNKLPYELGIEKKKKKKRILRYRASHRFYIYMASSGIKKWIEDNMTLMHETYNYSPS
FT                   VLLGGSISNRFREFYDSSSVGLAHLFLYNILSKKYPAQDYLKELEKLGKADPFSRFVDA
FT                   SSIFAPEKLRKVVKWFLKGSFVKQFMREKTKLTLKQLVRSEVLRDALESITFVTHSMAN
FT                   LQVIQNAEYWGRAYPNSSFYFRRGGVISVIDNTIKNWSDDGYTRSISEKLKNHVDLNED
FT                   DLKIADFQHIHNMESVKWDKSLNTEILKSFNEFLELGSVKALEGRNHILYEVVKDSRDN
FT                   LEQNIENTIFFGRILNSPKIESNLRKYLRRAVNFGNFILDRAEKNVDHAIWFGIKLNLD
FT                   KVMRVVDELHKLQRKLSNNESWNLTGAFIDVIEDLVEVLTNRTSRNPIDVPLNYGMPTI
FT                   SNLYGRMSVDERRIEFQQSMCSEHCGAIWKAILAFTISTLRNPGSIKSYEKNLSSTTSL
FT                   SELNSPNYVNNVRFILKGDAWTGFYDTLLPKSMKKELEVMEFGKSFYIANILKLASVLM
FT                   NRMGYVYTATTMKVQAPYFGNFTTEWMKERKKNRTKILFSALALGTMATYTVLECMDIA
FT                   QHAVDMGHPPVETCWYLVKPPSMHCAIEPISNLAISASSVAIRDVFSSTILALTGPYMM
FT                   IPMGIYAGWTLLKRQFKILHRLDMAISSVFSRLWRRVNTKDMIRSIANLFSNRKQYRKE
FT                   IEAAALESKQTGNEEVKTQTGFADDGNTFSYTHMD"
FT                   /protein_id="XP_765541.1"
FT   gene            45924..48760
FT                   /db_xref="GeneID:3502710"
FT                   /locus_tag="TP01_0015"
FT   mRNA            join(45924..46443,46592..46732,46764..47486,47589..47694,
FT                   47733..47998,48111..48265,48342..48489,48555..48760)
FT                   /db_xref="GI:71031800"
FT                   /db_xref="GeneID:3502710"
FT                   /locus_tag="TP01_0015"
FT                   /transcript_id="XM_760449.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(45950..46443,46592..46732,46764..47486,47589..47694,
FT                   47733..47998,48111..48265,48342..48489,48555..48744)
FT                   /locus_tag="TP01_0015"
FT                   /gene_family="HOG000135909" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031801"
FT                   /db_xref="GeneID:3502710"
FT                   /translation="MTIHRNILKQKNKPFKNSKSNKVKKNFSTSAVQKISPILSRKNKK
FT                   YQIISKNKKIRLNLQEESPRNVFVLPFHSEINSFEVINALLSFHSSNSSAKSSYSKDGW
FT                   LLSQPILLNQAFTHDGIPRRLIFYTCPRNLTDILYSASASDIILCLFRGASQDSPAFDE
FT                   LGYRILSSLRLQGIPSPVGVNFESALPGDRQPSSTLVRRYFHSEFGLDKKFTSVFSEKD
FT                   LRTVLSLIGCVSTSDLSWRRDRGYMLSLNHTYDSDKKELVLEGYVKGLGFTVRHPVHLT
FT                   SFGDFIIKKIDLLSDICPASTNSSKISVEKTVEELHNEDLSQLLSESECLNYVSHENSN
FT                   SLDISNNVQNLNNYLNDGNHFHEDFSSKLRINKISAEGELLPDDNEMDQDTYYDYDNGS
FT                   EGSVLSDESDFDLDDILETSSNSSKKIEFEQRSLEELSFPDEVDTPVDVLAKDRFRKYR
FT                   SLKNIRSSVWDPYESLPIEYYKINEFENFRATMSSSKTQLKKSCEITNVSGSFISLTLV
FT                   NFPPEDYATLSSSSRFPLVSTILPYERKVSVVNFNVARTSEGPDLLPSKTPLNLFCGFR
FT                   RFPSIPIYSKSINVDRGKRGLYDRFFKKGDNCVATIYGLSLCPPTPVLALDQNETVLFG
FT                   GHVSGSEPCRIIMKRILLTGYPMKVHKRRAIVRYMFFNPSDIKYFKPVQLFTKKGLRGK
FT                   ILQSLGTHGHMKCLFSDFITQDDIVCLPLYKRVFPKWNPHTWTKQL"
FT                   /protein_id="XP_765542.1"
FT   gene            complement(<48868..>51687)
FT                   /db_xref="GeneID:3502711"
FT                   /locus_tag="TP01_0016"
FT   mRNA            complement(join(<48868..49160,49296..50272,50291..>51687))
FT                   /db_xref="GI:71031802"
FT                   /db_xref="GeneID:3502711"
FT                   /locus_tag="TP01_0016"
FT                   /transcript_id="XM_760450.1"
FT                   /product="sortilin"
FT   CDS_pept        complement(join(48868..49160,49296..50272,50291..51687))
FT                   /locus_tag="TP01_0016"
FT                   /gene_family="HOG000282051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sortilin"
FT                   /db_xref="GI:71031803"
FT                   /db_xref="GeneID:3502711"
FT                   /translation="MMKIRFNTFIILNVLVWGLRVWCVDDVGITAKEGESLEYTSVNGE
FT                   PVVNAVGKKKVSVTEISFDSIVEDLVWCGPENRVVLLKTASGRIYRSTNSGKQWSEITN
FT                   TLSNTSNTVSTVSNAMNSSSSVDKFHVDSMFVCESDKNVVAVLGTGNTHYISSDGALTF
FT                   KQLGFKGEVNMFFFHPSKASWSLLSTWEGDCLSKGTGGDCRHVVYMSRDLGASFKRVAE
FT                   YVGQFSWGDPTHGSADRIYFSRYDMAFGDQPKQDGWNDAISFRYTDDYGATQQQLLSGG
FT                   NKFLVSNGYIFVARVADSSKQTVKLCVSTDNGVTFNEARISTDLDEKSYTILDTSEGAV
FT                   IIHVGHHYEGSDVEVGNVYISDASGLNYSLSLPNNVRASSGECEFDKVLSMEGVYLANF
FT                   RDDSGGYLDPSQQFKTHINGNVATKSDNMTQVIIHIVIQLTLLYLVNIYIFSYHCYINN
FT                   RVFIIVIRRNVGHKKIESNVRTVISFNKGAQWNYLTPPKVDSYGQQYQCDPDRCYLHLH
FT                   GITQFKNFAPFYSVENAVGLILGTGNVGDHLSFDAANVNTFLSRDGGLTWREVHKGAFI
FT                   YEFGDHGGLLVMAQDQSRTREVVFSWNEGASWFDFSLSKHDLSVNNIVIEPSSSATEFL
FT                   LYGNRNGVGVVFHLDFATLNQPACRGIWAINSSSSDYETWVPRDMTGNECLLGKKVTYK
FT                   RRKQASECFNGRDFKRSVDRELCQCTRQDYECEVGFTRAIGSDVCKVEGHFLEREGCTS
FT                   ASYFYTNAYRKVPGDVCVGGWVPDLVAVPCPPHSPLSKESKLLLAFMLVLALFMAAVVY
FT                   VSNDERFKHLFHNYGFKSFQYVPYSTLNQRKTSLGGRFEPELGFIDAEQEHEEIPTLLS
FT                   YLHDNDKHQESKTIELL"
FT                   /protein_id="XP_765543.1"
FT   gene            <52672..>56084
FT                   /db_xref="GeneID:3503477"
FT                   /locus_tag="TP01_0017"
FT   mRNA            join(<52672..52824,52955..53081,53178..53283,53364..53429,
FT                   53461..53716,53795..54580,54704..54775,54806..55004,
FT                   55088..55776,55806..55838,55974..>56084)
FT                   /db_xref="GI:71031804"
FT                   /db_xref="GeneID:3503477"
FT                   /locus_tag="TP01_0017"
FT                   /transcript_id="XM_760451.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(52672..52824,52955..53081,53178..53283,53364..53429,
FT                   53461..53716,53795..54580,54704..54775,54806..55004,
FT                   55088..55776,55806..55838,55974..56084)
FT                   /locus_tag="TP01_0017"
FT                   /gene_family="HOG000135282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031805"
FT                   /db_xref="GeneID:3503477"
FT                   /translation="MYFVKIWAFAIFSKSVWCFFTSPDFTPKNEVPLPKDFTIQSVDDY
FT                   DQSELKKLTEYRQRHRKTLDGALCAAAFVRNGNTFTDCTTTEAPDGSVGREWCYLEVQL
FT                   IGTGARDWDFCAGVIDYDALRYKASSLMELRRMELEQAYRSLVREERRVDSTLSKYEEV
FT                   CGSGEQDYESDILRLETSLKGVDRAIAQLKANSSSLLSLTNSLDSLEDERDLLTKSALH
FT                   NRKNCSVVRGYLDQSKPDGLRASYYNNPYFRGVPSGFIDHEDVNLMWEDFVPVFGVPHD
FT                   SFSVRIEGFLRIPSTDVYTFYVRSDCNVRLFLDEEVIASQGFDPESDRGGPVVTQPING
FT                   RPTMNVFVKSNSFHLIGGKRYPITVEYSHQKVLKYYNSNIARLALSWSSTSFPEQIITS
FT                   EHFFKGSGQNSDISISGLEGQYYTLYFYLFINMLRSMLENGAQAFKGVSNFVIADVPGK
FT                   FIGARMITMHTKPTEQLVSFEVSNHSLVYVAIPTLSNTHPKDEDGVSFEKTFDVLSVYG
FT                   VGDNCGAAFTQIEFTIYWKKFQAGNVKLLLPDDTSSIIFILPAITSGLCKGDVSIISYT
FT                   PSDKCVASSSSNELSGCVAGFGNGMPSEVGWITAKDKLAGEFLRREFPKMVELRYFHFL
FT                   PRGALRASEVSFRFSDGSEEDFAITDELRYEFRTPVMVQWARIEIKAVEQLEGTENTTG
FT                   GVFTLFGVICEGIRPVKEKQIDTVDIAFCSGNCDPSNALIIDSGHTKSSHGNLYYGWNT
FT                   KANPIQCTDNIDTATANNKGFKLKDNKWSLEVPYHGVFRIKVKLGALCKDLKEVSLTIN
FT                   GYEVLGSENLEKNSTVTYVGIINMEKVGRIELGSETEGLGLLSFNLSSTLNEI"
FT                   /protein_id="XP_765544.1"
FT   gene            <56181..>56768
FT                   /db_xref="GeneID:3503478"
FT                   /locus_tag="TP01_0018"
FT   mRNA            join(<56181..56393,56541..>56768)
FT                   /db_xref="GI:71031806"
FT                   /db_xref="GeneID:3503478"
FT                   /locus_tag="TP01_0018"
FT                   /transcript_id="XM_760452.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(56181..56393,56541..56768)
FT                   /locus_tag="TP01_0018"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031807"
FT                   /db_xref="GeneID:3503478"
FT                   /translation="MADLEESEVVGEINHPGIELDADFKGIVFRNYIPRDENLRKLCKS
FT                   SLEDYSAIENTIDQQIDQTILNYQSEDILSLVRPRRQNWDLKRELNRKRQVLSSRTDAA
FT                   ILRLLRERRDEEPLQVNNIENQTLIHQFPDIDTDDSEDMDIE"
FT                   /protein_id="XP_765545.1"
FT   gene            <56962..>57792
FT                   /db_xref="GeneID:3503479"
FT                   /locus_tag="TP01_0019"
FT   mRNA            <56962..>57792
FT                   /db_xref="GI:71031808"
FT                   /db_xref="GeneID:3503479"
FT                   /locus_tag="TP01_0019"
FT                   /transcript_id="XM_760453.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        56962..57792
FT                   /locus_tag="TP01_0019"
FT                   /gene_family="HOG000135281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031809"
FT                   /db_xref="GeneID:3503479"
FT                   /translation="MESTPLPKLRIVPSSDPGFDSNHFSVPPPLNTSANPYSFPSNSNI
FT                   PQYSPANFSNPANLSHSRPFTSVNRSISNDEVVLFAVHPQTIVRPLRRRVYRRIGEVLE
FT                   AFLSSLESKGFTRGSVLARLKATPWFPRLFDYDGIGCLIKIFQNYVCHSHTLVVPLLFK
FT                   EVYEVYAPEMDRTCASQVLRIGINPDTDNRKALVMGAIDFTEETMSIYRNPLDQNISFS
FT                   VSRVNKSVDRFNRSNVRITPVNVDKTPAQFENATNNTISDNGSIIIAIIIVNNT"
FT                   /protein_id="XP_765546.1"
FT   gene            58311..60113
FT                   /db_xref="GeneID:3503480"
FT                   /locus_tag="TP01_0020"
FT   mRNA            join(58311..58881,58969..59761,59875..60113)
FT                   /db_xref="GI:71031810"
FT                   /db_xref="GeneID:3503480"
FT                   /locus_tag="TP01_0020"
FT                   /transcript_id="XM_760454.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(58357..58881,58969..59761,59875..60101)
FT                   /locus_tag="TP01_0020"
FT                   /gene_family="HOG000135908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031811"
FT                   /db_xref="GeneID:3503480"
FT                   /translation="MLFYYSTILKIFSLLSLIKYSNSFILNTHFLFNNLYHNKLYNNLN
FT                   DNICDKNLYNNLFNGGKLFNWCLYATKSKLKAVRKFTRDRPKKTTPAAIYPSPTLYYGN
FT                   VHDHFGAPPEYLAIPVQDTLDILRNGKLSELISLLKSGITGSELSKVLSDNSFHADLTK
FT                   ELNTIKEISEFQNDDVSNDLYLYFEPIINKPEEYEHYVDKFYTFKKLQSYWAEREQKLY
FT                   NTILRQLFSRLRSIAYKLKDTGLSLTEFANPTLWHKYGVFKPVPNCKMVENYLTKHQIA
FT                   INFDIKNLYFRDENNEIKSNFENFYSKLYKLDDSNTTTDTESSNNTHTNNTDTNINTDN
FT                   NSTVEDSYSLYDDKGVVETAFSIDENGKLPSDLVDRIVDDLTDLGVLNPKEPWTINLSR
FT                   IEELQEQFTSEKSQHAYAIRDFYLSLKFPHYQIETDPYILESYVNHQYRTKTYERDLLV
FT                   KYNNWLKSGAPRETFKPMNVKYKHMAIWHSLSKNQRRRLVQKYVKTQTTPVTQPTK"
FT                   /protein_id="XP_765547.1"
FT   gene            complement(<60529..>64682)
FT                   /db_xref="GeneID:3503481"
FT                   /locus_tag="TP01_0021"
FT   mRNA            complement(join(<60529..63083,63191..>64682))
FT                   /db_xref="GI:71031812"
FT                   /db_xref="GeneID:3503481"
FT                   /locus_tag="TP01_0021"
FT                   /transcript_id="XM_760455.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(60529..63083,63191..64682))
FT                   /locus_tag="TP01_0021"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031813"
FT                   /db_xref="GeneID:3503481"
FT                   /translation="MTPGEPLPTFKKIVNVWKKDHPQHLKANNALTKSVNHFINGLNSF
FT                   VNSQRKSGLVVEDLDLTKYDMSYYIGYLVDESEDLYREPVLGFGYKEHSSIAQTELLLE
FT                   PEMLTEYTWNAFLKVYLFYALYSSKTTYRYKLNSVVWGDPSFLNFSQSYSQFNKQYGDD
FT                   FKGFVDRVSDIGGEFGEGFGKEMGEDKFDEMIDTENLNMLDDMPFEDYENSNSGVEDDN
FT                   LQMDNNKLYQEEDEEEEEEEEEDKERSTRRGWGLNRYCPYYEFEMEWHPDQERFETLCK
FT                   GSIAPSFVKAAFLKLRNKTFLQLDMYERLSLLVWLGAILSYSNVGKNFIDDRNEEFFLL
FT                   KSQLMKTEDEKKIVKRPKVISRELMELEERYLQRPVLLGLDRFYNSYYYFGLDYERRIY
FT                   VQTMPQLRFIQNRIIRRSKYLRKPSINPKFFTFDLSEFAQKFTQDRIFNQIKGKRGRKR
FT                   ESSTQQQDDNSNNNNPKRNKPNPPNTQTKITNLLTLDAKENVSNKKSNNNNSNNTDNPA
FT                   DNVDNDTTYNDSSINTPDRLVSDTASNDTTNRDDANGNAANTSDSGDKETGENVKEEMM
FT                   RKKRSKGRTRNRPKVRRSRQMFDRHPTYFGTVEEYLEYLANAPAVLSWCVIDSHKSLKR
FT                   FITRLSQHTTNERNLAFKLLQIEPDFSLPSFEILTYKSPTILGEMLLPLLRGVYRFFKN
FT                   SFTKIVLSTTILSSATTVNDAGSGRNSSAQNEKIKVRMDEVYNNGLYLNLYVNHMIKKC
FT                   LAFCVSDLEGCRQCLKQILELVYLFEFVTNRYYNHTKWLEMRNEWRLNLEAIYTQLNTE
FT                   SPNLRRFLNQKVKPQGEHKPNCYANSPNSQDNNMGNELMMMVEKAGLWFRFFEVYSYDP
FT                   SLDFSVSTAVNYNKFADEHGDLLNSALSEPDKIDIFELLNSLKVNDTMVFFSGGLLELI
FT                   GSVSDLLKDIQESLGIKVNEEKHTNKTSKSSKTKKKRKKRDRDADSDVNLTDIESLTDP
FT                   NDLYQLYDIDDAEQTNISKDDNSTKSSSRKSSKKSQTPPETNTNTADATIENTPTDINI
FT                   NLNNNTSDNKTDTADNTHTTYTAADNTVTTVNPVNNVKEEKVEKTPKPKRAKKSKSPNG
FT                   DSSSNNEVNQETDSVLSDTSPVNNSVTPETTNNAVKEENQENATPKEESVTDDNEELID
FT                   QIKLLLAKLEHNYRNAPQETCQVRILSLTTNLIDLQLPANLSNSPPTMKNTVNDSSNAV
FT                   GDSDLVKEVKDEKVSDSFSQMKIFCLNLTVESLAYDEDSDREEEDLDEKFGLVKNLRRV
FT                   CRTMSRIEKTRATKKVTEEPTFTPRPNSASPSQVFNLTLPILLKYPKHLHLPNFMYSYQ
FT                   RFVYH"
FT                   /protein_id="XP_765548.1"
FT   gene            complement(<64848..>67607)
FT                   /db_xref="GeneID:3503482"
FT                   /locus_tag="TP01_0022"
FT   mRNA            complement(join(<64848..65221,65284..66420,66495..67470,
FT                   67542..>67607))
FT                   /db_xref="GI:71031814"
FT                   /db_xref="GeneID:3503482"
FT                   /locus_tag="TP01_0022"
FT                   /transcript_id="XM_760456.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(64848..65221,65284..66420,66495..67470,
FT                   67542..67607))
FT                   /locus_tag="TP01_0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031815"
FT                   /db_xref="GeneID:3503482"
FT                   /translation="MIAISISHLCKFPNFSLFFLNFFGLMDYRHLSTSAAPKNEMSNLK
FT                   DETQNPEKKEATLKDLLTIRNNELSEIRKKLHQCSEIINKSENLTYCSMDGLNSGLPLV
FT                   PDEQVIVNNAGESVPNDVVMQKFGQDFSPESVIPGFYTWFQGDGSVVRYVIDFVLYTSR
FT                   GDRFVPLEHLGRYESRILMFCKVKHIGLVHTVEDLLETNHPWTKSFKTKRRIDGVEGFI
FT                   KVARKQRYFAAKIVLVDWFFDVGTKEDSPPYLWVVSENDVFYRIDRPSGGYYNAFAPAK
FT                   LLFDMSTRIVKEMQSENDKSFKNVLMSMTNPKPPRNYGRSLSNYAPVNTVGTHFANNQP
FT                   NSHSQDTGTDNLAPASQLNGKTENSQVSAFEEKKEDLTQWGAPVNILGCMPIDVYRNLD
FT                   FIFTECRYYYYFTNSRKLETYLSELVDRLREQSPFHYFDNNFMRLDYLGKNTLANRYKS
FT                   QLYVKGTPIPSLAHLQAQQGLMKSVKRGPKNKRFNLEEYNNQYNMNDMKSRSGRVIRNK
FT                   AVSEIEPVVRKHVVQTESQKREEYRKAVELEAKCDGLLLPFDFEWSNYNTCSEASDTDK
FT                   SPPVLSNDVDIALNNAKYYPRDIPLRTLKFYGIDEIVDLLDLTRQFSVPSLSTPPLLPK
FT                   MTFVQLESNLVFNTSLAEYKPNEGFSFPLTEPICICNNKRFMNTFSNVNPANAAVNSVN
FT                   NGVVEDDKEEAMDDEEYDDGLQWIYYLNKNLINEVDIEYLEDLDEGSVGRLYVGLMQVF
FT                   RRNICNYGFDWFVQNLRESGELSDKKKEVQERELQVAISDSELALDFVNTNGGCLYKGR
FT                   FKRVGQDPDSVLPYVNSSRWNKRFKKFQRVVTVSSTYR"
FT                   /protein_id="XP_765549.1"
FT   gene            complement(<67792..>68490)
FT                   /db_xref="GeneID:3502622"
FT                   /locus_tag="TP01_0023"
FT   mRNA            complement(<67792..>68490)
FT                   /db_xref="GI:71031816"
FT                   /db_xref="GeneID:3502622"
FT                   /locus_tag="TP01_0023"
FT                   /transcript_id="XM_760457.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(67792..68490)
FT                   /locus_tag="TP01_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031817"
FT                   /db_xref="GeneID:3502622"
FT                   /translation="MCSECVYIVLFRIVVPLSNISGFLEKENDQQLTISESIAIAEKIY
FT                   QNEKRQIMNQGKRGNQDSKSTNYVESERLKCVEFDNPFEVNVIEQKNTLSRQESPNSII
FT                   TEGNCKKGPIEGKLSHICDVSDDTDGDDESIASKVWNMFMKATSSRSNGDPQVRNRGQS
FT                   NSKVVILTDSRMSAGNEIKNNKGEYNWRGIERDRGVRNERQWIKENYNVTSREALDIVE
FT                   GTIRKINNVL"
FT                   /protein_id="XP_765550.1"
FT   gene            complement(<69244..>70658)
FT                   /db_xref="GeneID:3502623"
FT                   /locus_tag="TP01_0024"
FT   mRNA            complement(join(<69244..69479,69548..>70658))
FT                   /db_xref="GI:71031818"
FT                   /db_xref="GeneID:3502623"
FT                   /locus_tag="TP01_0024"
FT                   /transcript_id="XM_760458.1"
FT                   /product="cysteine desulfurase"
FT   CDS_pept        complement(join(69244..69479,69548..70658))
FT                   /locus_tag="TP01_0024"
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine desulfurase"
FT                   /note="go_function: transaminase activity [goid 0008483];
FT                   go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:71031819"
FT                   /db_xref="GeneID:3502623"
FT                   /translation="MKFLHRNGLLKSVNYFSSRFYSISIDIQGQFKTGCGKTTYNRVYL
FT                   DNQATTCVDPRVLDAMMPYLTHAFGNPHSRTHSYGWEAEKAVETARADIANLINCESKN
FT                   VIFTSGATESNNLAIKGSKSFYGRLVESPGKSKKNHVITTQIEHKCVLQCCRQLENEGY
FT                   SVTYLKPDKYGMILPEEVRKNIRPETFLCSVIHVNNEIGVIQDIAEIGKVCKEHKVIFH
FT                   TDAAQSFGKLPIDLKNLEVDLLSISGHKIYGPKGVGALFVRTKPRIRLQPIIDGGGQER
FT                   GLRSGTLPTALVVGLGTAAKIAKMEMERDHRHMENLFFKLYNGLSSIDHVSVNGSIKPG
FT                   QRYFGNLNMSFEFIEGESLLMSLSNFALSSGSACTSASLEPSYVLRSLDVSEELAHTSI
FT                   RFGMGRFTIESEVDMALDSITKVVEKLRNLSPLYEMYLEKQDPKSMVWT"
FT                   /protein_id="XP_765551.1"
FT   gene            complement(<71213..>72540)
FT                   /db_xref="GeneID:3502624"
FT                   /locus_tag="TP01_0025"
FT   mRNA            complement(join(<71213..71417,71645..71712,71790..72284,
FT                   72316..>72540))
FT                   /db_xref="GI:71031820"
FT                   /db_xref="GeneID:3502624"
FT                   /locus_tag="TP01_0025"
FT                   /transcript_id="XM_760459.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(71213..71417,71645..71712,71790..72284,
FT                   72316..72540))
FT                   /locus_tag="TP01_0025"
FT                   /gene_family="HOG000135905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031821"
FT                   /db_xref="GeneID:3502624"
FT                   /translation="MKLIYFIYFFNIAHTTRHSQSINNFGLNCFCFLHSSTFYNNKKNI
FT                   ERRFSAFSKGGKELEDYESGLTEEDLNTINEYLADIKSGVYGLESKKELEKLEKDYEKN
FT                   HHETNFDLKDVLNTKNEKLEKEMNKIFDLSNLPSSENSKINWEDLENQISEGKKKCLDV
FT                   EEMKKTVHSIYREKGLLSETFKVLEISGLKLKWRQSLGNIEIYFTADQSTKKKDYEIKF
FT                   LPSTLTIINLEKVLLEKTLFGKVDCDGCFWTMYKDPSTGTKIKLLSTRIMLLTDLLRFL
FT                   FNVVKFLLAISPLLLIVLIFVKNKNPKPKHPGKALDSDDEDFFDDKKND"
FT                   /protein_id="XP_765552.1"
FT   gene            <73337..>75550
FT                   /db_xref="GeneID:3502625"
FT                   /locus_tag="TP01_0026"
FT   mRNA            join(<73337..74766,74812..>75550)
FT                   /db_xref="GI:71031822"
FT                   /db_xref="GeneID:3502625"
FT                   /locus_tag="TP01_0026"
FT                   /transcript_id="XM_760460.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(73337..74766,74812..75550)
FT                   /locus_tag="TP01_0026"
FT                   /gene_family="HOG000135904" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031823"
FT                   /db_xref="GeneID:3502625"
FT                   /translation="MSSGGFIKFLSNNLNTFDEIEITESLVLFFFLENLYHTILPNLKE
FT                   FSIVDNSTFESLTSNSIFVNSNCTYTSCILFSEGNLLLTGLQKEFIKVLLNSKLPRNEE
FT                   VLVLFDLLRIFYSSEDGNHYMLVSESVLSGIIKKFSSILENDELKSCSKDTLALAKFKK
FT                   YLNLVGTKRFLGEISRLNELRGSTYNLIIISICFFLLHINPSFSGVTKRIPKYLNKCNK
FT                   GDLFNCALIVNNLIRWNPKDSGLWEIKSILTEFWFRKFNIRRSRLLVSKGLFSPKSLES
FT                   GNILYKLLMKLIYKLFTDPLLLLNKSFIEEILFIKPFNNCVSTYLRHEYNSVVNNVVPI
FT                   FTERLEKININFVYYNKFREFKYMDVKTRYTITLSNSIFKLFSRFYIRLLRNFSFPNIF
FT                   ILLVNLIKERTYARLSSSVICFNDLFMSSFLYTRVDEDFEGVLRLCDEMITKDAENVWI
FT                   DNKSKLLFNLVDFKTLLRPLVLILNEYFSTWFTFTDLLDIFCDTSVLNRSVKINKRGNK
FT                   RKKSKTKLVDHEIDEYKSESIQIRKVINEEGFQNEFGHMDGYGFGNVRYIYLDSKRICK
FT                   MFSDLQIDLILNSYNQLLYILYHLFRNIRKLNKSLSYDLDLGSFKLLFEAILLASKYSR
FT                   CVPNLGTKVDVLVGVNMIKKMNRFYKLVFFKYGKLLSVNEHVPYYLDCAVAKLALLILS
FT                   PLFRFYTHWVISSQAKLELLYRQVLKLK"
FT                   /protein_id="XP_765553.1"
FT   gene            complement(<75618..>76050)
FT                   /db_xref="GeneID:3502626"
FT                   /locus_tag="TP01_0027"
FT   mRNA            complement(join(<75618..75669,75719..>76050))
FT                   /db_xref="GI:71031824"
FT                   /db_xref="GeneID:3502626"
FT                   /locus_tag="TP01_0027"
FT                   /transcript_id="XM_760461.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(75618..75669,75719..76050))
FT                   /locus_tag="TP01_0027"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031825"
FT                   /db_xref="GeneID:3502626"
FT                   /translation="MESSPNYDSGPPMVDNFCLLYYDLKDFPPNYQGKGPSVLSQEELY
FT                   RKDLYNTLTKISKLRDEIVNKNQARYLTEEKLKIQLNDSRNQTKHFGVIGSNQSALLQA
FT                   IDSNYKRRFTFLYARSWNAVHTT"
FT                   /protein_id="XP_765554.1"
FT   gene            <76313..>77854
FT                   /db_xref="GeneID:3502627"
FT                   /locus_tag="TP01_0028"
FT   mRNA            join(<76313..76745,76776..77503,77537..77654,77718..>77854)
FT                   /db_xref="GI:71031826"
FT                   /db_xref="GeneID:3502627"
FT                   /locus_tag="TP01_0028"
FT                   /transcript_id="XM_760462.1"
FT                   /product="tRNA-dihydrouridine synthase A"
FT   CDS_pept        join(76313..76745,76776..77503,77537..77654,77718..77854)
FT                   /locus_tag="TP01_0028"
FT                   /gene_family="HOG000259834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /db_xref="GI:71031827"
FT                   /db_xref="GeneID:3502627"
FT                   /translation="MQICFLIHIVLYTLLYHIVFNVFLIQKVNGIHQNKIYYPYFFLNP
FT                   ANSHFLTTKQQFKVREGFTNIHKTHLNTMRNGTVSHSKPSLQIAPMLDVTYLHFRYFMD
FT                   FKFDFRQFMRLLTRKTQLWTEMFVASSLINASNESVSRWLKFEENEHPIVAQLGIFYQH
FT                   KIVPGGNCPETLVEAGRILKKFGYDEINLNAGCPSPRVSGKGIYKFMLKLFNLGCFGAS
FT                   LMKEKELVRDIAHHMLRELEMPVTVKTRLGVDEFDSYEFVRDFVSTVSESGCDHFIIHS
FT                   RKAWLKGINPKQNRTIPPLQYEKVYRLQRDFPHLKFTINGGFKTMESILEALNSENLDS
FT                   NNNPHKLNGVMIGRLAYENPCLLSNVDKLIYGVENPDTCYTRRILLENYANYIDENQVD
FT                   TANLNISLIVKPILGVFHGEQGNKIFRQSLSNVYDYDDFIYHSGESRHSMFIHKVIDLM
FT                   DKINPEALDKPLY"
FT                   /protein_id="XP_765555.1"
FT   gene            <78013..>79077
FT                   /db_xref="GeneID:3502628"
FT                   /locus_tag="TP01_0029"
FT   mRNA            <78013..>79077
FT                   /db_xref="GI:71031828"
FT                   /db_xref="GeneID:3502628"
FT                   /locus_tag="TP01_0029"
FT                   /transcript_id="XM_760463.1"
FT                   /product="DNA-directed RNA polymerase II"
FT   CDS_pept        78013..79077
FT                   /locus_tag="TP01_0029"
FT                   /gene_family="HOG000230844" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase II"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA binding [goid 0003677]; go_function: DNA-directed RNA
FT                   polymerase activity [goid 0003899]; go_function: electron
FT                   transporter activity [goid 0005489]; go_process:
FT                   transcription [goid 0006350]; go_process: electron
FT                   transport [goid 0006118]"
FT                   /db_xref="GI:71031829"
FT                   /db_xref="GeneID:3502628"
FT                   /translation="MDWAPRQIKPSIEIVDLRKDRMDFILLNSDVSTANAIRRVILSEI
FT                   PSLAIEIVTVLENTSVLHDEYISHRLGLLPIDSTLASEFEFRDRCQCTDKCAKCTVDYT
FT                   LDVSCKDSDSRVVTHFDIVPDDTHSKSIYGKNLPMPIPRADVTNFNGATDGIPIVKLKR
FT                   GHSINMKLTASKGLGKFHAKWIVANVNYKMEPRFSFNSSLMEQLSSEEKAGIAASCPRN
FT                   VFKYTGVRSEAPSFLGPSDKTFKLDAAGLHVVDKLACIYCDECINYCRELGHKDLIRIQ
FT                   PDESKFHFTIESTGAIPPEKILEIALVVLEKKLQDLQSNFTEAQSRTLGTTATAQHREG
FT                   TRAPQPSTPYIDLD"
FT                   /protein_id="XP_765556.1"
FT   gene            79084..>80192
FT                   /db_xref="GeneID:3502794"
FT                   /locus_tag="TP01_0030"
FT   mRNA            join(79084..79456,79489..79568,79600..79821,79856..79992,
FT                   80150..>80192)
FT                   /db_xref="GI:71031830"
FT                   /db_xref="GeneID:3502794"
FT                   /locus_tag="TP01_0030"
FT                   /transcript_id="XM_760464.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(79159..79456,79489..79568,79600..79821,79856..79992,
FT                   80150..80192)
FT                   /locus_tag="TP01_0030"
FT                   /gene_family="HOG000135903" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031831"
FT                   /db_xref="GeneID:3502794"
FT                   /translation="MYDNIPVNGLSNAVFLCIRNTPYTKLNTNSFRRNLLSIVDNYINS
FT                   EGTDVDSDSNHTDSPDKFNNYILNAENYSVHFLLSTNLSENSELCSLYGFEDFTGVYAL
FT                   RNFLTEEQCLLLACETLRSYINPPNNSNLLVKDPNISSPIWPSKSFQNLRWSTIGHLYD
FT                   WGKRQYVGFTQFPEIVVKIVNQINTLLSDFYNPFTADSAIINFYSKSYFLRLHRDDAEE
FT                   TNDPVINISLGAPAIFCICKEDPKYKQVASLCKARFK"
FT                   /protein_id="XP_765557.1"
FT   gene            80614..82878
FT                   /db_xref="GeneID:3502795"
FT                   /locus_tag="TP01_0031"
FT   mRNA            join(80614..82595,82756..82878)
FT                   /db_xref="GI:71031832"
FT                   /db_xref="GeneID:3502795"
FT                   /locus_tag="TP01_0031"
FT                   /transcript_id="XM_760465.1"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT   CDS_pept        join(80671..82595,82756..82864)
FT                   /locus_tag="TP01_0031"
FT                   /gene_family="HOG000135900" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /db_xref="GI:71031833"
FT                   /db_xref="GeneID:3502795"
FT                   /translation="MYIYLSFASNILLFLLLKCFNYINCLHSRILMEQPLAFHSIVTTN
FT                   IPYISPNNITKDKYMNKSENFIVNSEPPDDLYDDFSSSGDDDSKCILTGIEAHVQLASP
FT                   YKAFCSCRSIASPLTTLNATNNPDLYKTLPADNRRKVYNGFKEVLEEISSNYKPSISAS
FT                   KTHYNPTAPLNFEQYAKFYYESTEFKDYGDVDEKTLNEMLSKENEYTCPVCKGEVGATP
FT                   YISPMSFLYAVGVCKVFNCKISNNVSFDRKCYEYFDLPKGYQITQTLNPLGRDGSIKLS
FT                   TGKVVTVSKVQFEEDTARRVDVHGTTKTLDFNRSGVALAEVVTAPLEMTRLEILETCRK
FT                   IYELVFLNGLSNGNRFRGNFRFDINLSRPDGTNRVEVKNLNSFVTINKAINDYDPEKDY
FT                   SFNFENFNNPSVLTKLVSEEQKNPENKSESILETIKNVFLSILKHIPDSDKYTPMGTTL
FT                   KWNKHKGLEPTRSKLPSDCYGNYFEPNIPVIYQSDDLIKRITDCLPKSVKGLQSLLEKY
FT                   PEVNKELLKEIYKYASWTEYYEKLCTYLDSRVAASHFVNLLLPVVKFSNKPLMSPERFS
FT                   ELLKLVLNYKLNLSDVEVELPRLLDYTGSFEDYFRSRNLLLYDLDKTKKLIDEYLKEHP
FT                   LDYSMSKNPGYVARLTTNLVRSLDSKVSYQFVKECITNMLKK"
FT                   /protein_id="XP_765558.1"
FT   gene            complement(<82853..>84853)
FT                   /db_xref="GeneID:3502796"
FT                   /locus_tag="TP01_0032"
FT   mRNA            complement(join(<82853..84485,84729..>84853))
FT                   /db_xref="GI:71031834"
FT                   /db_xref="GeneID:3502796"
FT                   /locus_tag="TP01_0032"
FT                   /transcript_id="XM_760466.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(82853..84485,84729..84853))
FT                   /locus_tag="TP01_0032"
FT                   /gene_family="HOG000135899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031835"
FT                   /db_xref="GeneID:3502796"
FT                   /translation="MVHITITLGLLKWFHHLKQKITLFKILELNWYTSPTSNGQNVICL
FT                   FYLIVTLNQTNWTLAFRPQNIKTELTHFHIYSNGSCKKKAFLLDSTDCDQENATTTLVE
FT                   DEITAEDYPKYNKYPSFCTGRFNFFELDLFKDKKLISKEIYPKFIAYLHLFTKLDFDLH
FT                   RYGSFSISYKDQDKNNANEAVNPKHFYNSNKINTLDDDFDETSLIKIHTYGKEQFKDEG
FT                   KEFLKQLDNQKIETYDVKDLITKTVPQKDVKLELRNSLQNQIINKYDLNSLYENIKPRE
FT                   WLYLPDKKILNINLFLEDISLPIHLSFRLYPGTRPLVIHKGCIFVPKQAPTNFNCDGSS
FT                   TEIDLVCFTKVRPVVNYSTKKILSNDLSRSKIKLITISGSLRQRFNILFKILELLNANS
FT                   PPYKLQDPIPLNNAVPSSCIKLPIHVKSLAVYLNSKFRFVIPLLTYFDNLTGMTHLCNH
FT                   GTTFDFKPDRVWFPIRTGYGSFNKYFVPIQYRKAGFFSSNQIDFKPEVIFNMLSSYLSF
FT                   WKLIEDHESKDLVDGNTCLKKTFEEVKESEKGDGENKEKRNYKVYYVGGKYKMIYKDED
FT                   GSIILNLLL"
FT                   /protein_id="XP_765559.1"
FT   gene            complement(<85001..>85723)
FT                   /db_xref="GeneID:3502797"
FT                   /locus_tag="TP01_0033"
FT   mRNA            complement(<85001..>85723)
FT                   /db_xref="GI:71031836"
FT                   /db_xref="GeneID:3502797"
FT                   /locus_tag="TP01_0033"
FT                   /transcript_id="XM_760467.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(85001..85723)
FT                   /locus_tag="TP01_0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031837"
FT                   /db_xref="GeneID:3502797"
FT                   /translation="MENFSKLIKIHNDRILNDRNFETINYVSLFNIINSFSKLGLPKNR
FT                   IFDIRNNSLYKHLRNMDKHDIQNQMFNSISKLVFSCDFYKINLQMATNCLYSLSLVGFD
FT                   KFSRLTVLKLIELSIKMLHKETGICRTNSVENKDASPIIDCVAQFDTLVELESDGNKEL
FT                   FSQLRIVTMMLHLMIKRNYFKSRVFKIYVKKMRRAILGQNKHLKTGRKQFSNDKELIEK
FT                   EVMNITQLNPMSGTNIFI"
FT                   /protein_id="XP_765560.1"
FT   gene            complement(<85772..>87684)
FT                   /db_xref="GeneID:3502798"
FT                   /locus_tag="TP01_0034"
FT   mRNA            complement(join(<85772..87358,87394..>87684))
FT                   /db_xref="GI:71031838"
FT                   /db_xref="GeneID:3502798"
FT                   /locus_tag="TP01_0034"
FT                   /transcript_id="XM_760468.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(85772..87358,87394..87684))
FT                   /locus_tag="TP01_0034"
FT                   /gene_family="HOG000135898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031839"
FT                   /db_xref="GeneID:3502798"
FT                   /translation="MPFLYIHGFTSNLPLRKIFYNRSCLIIPKIFKTNGQTRPFTNTHL
FT                   VVTKRESKTDVLTPVPKNLLDYQRKTDEINLMETHSLTMAMMRSSKSGFLKKSVWEKYI
FT                   ARAIELVDKFSVKNISILMISVAKSRMSNTDFYEQMSERLVIKCKNYINTYKMNPVKFF
FT                   EDDKRCEFTPFNIYTILSACSVSGYKNETLFRLLFKVSEIKLHYYNKLLDEWHSSKDGS
FT                   EHFSILESYTKDDKFTFEDLAGILYVYSWSNFQIKGILPKYSYIFKKMYKIVCKKEDKY
FT                   TPLVGELTSKSFAIAVNSLVKLGDGTIELYNIGLEYLQREVDYIPSRDTCMIFNSIVKN
FT                   RNTVPDFYDTKNTLQTLTNKIVDKLSGSSFDPELMVNLSSTFVNIFNSKTFKQEEIENI
FT                   KEKFNTFFTESTYNLVSERELDAPIVIQLLYNSSILGCMPASMILLCNDNLKSVGLTGT
FT                   QQNISEFLTSLVLIYNNSKSNNLNQLIHEHVVTALRQYSKRLDYVLYPNTLGLVKTKSR
FT                   PPDLYNILKLESKGLLDAPSEDINNDWRELTKDISEYTTDNLNLLATMLNTMGNFKQCK
FT                   DFVKFVVLSADYIKRFFKTYSHHLELKPLHIETISAIVHSLSKLEVLFL"
FT                   /protein_id="XP_765561.1"
FT   gene            complement(<87785..89345)
FT                   /db_xref="GeneID:3502799"
FT                   /locus_tag="TP01_0035"
FT   mRNA            complement(join(<87785..88061,88131..88297,88328..89345))
FT                   /db_xref="GI:71031840"
FT                   /db_xref="GeneID:3502799"
FT                   /locus_tag="TP01_0035"
FT                   /transcript_id="XM_760469.1"
FT                   /product="chaperone protein DnaJ"
FT   CDS_pept        complement(join(87785..88061,88131..88297,88328..89035))
FT                   /locus_tag="TP01_0035"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DnaJ"
FT                   /note="go_function: chaperone activity [goid 0003754];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:71031841"
FT                   /db_xref="GeneID:3502799"
FT                   /translation="MVSYKFGLLVSILFYYPLQSIKYAQSFHFTFNNDFFDFQAPQEET
FT                   HDDKRCPYEVLGVSKTSTHKEIRKAFLGLSKKYHPDLSTDPDASDKFKEINEAYEILSN
FT                   NDKREAYDNHGFAGLDRMERMGGMPEEYDMDDIFSNFFSSGFQGPKEKKAEPLVYPLSV
FT                   PLDFLYTGKEFELTLELSRLCKNYDECETKRSDCHGPGLKVVTQQRGYGMFIQHQMRDD
FT                   SCIGRGKGWLPNCKECPNGPVYTEEVQVTVNVEPGHKNKQNIVMEGRGQEKPGMKRGDL
FT                   VFVVTEKPHDVFRREGNDLHCKVDISLKESLTKFEREIDIFGQTSITVSQNGVTPHNHV
FT                   IKIQGKGMPVYGSDKFGNLYVTINVVFPKKLTPAQIKLIEQAL"
FT                   /protein_id="XP_765562.1"
FT   gene            <90398..>91645
FT                   /db_xref="GeneID:3502800"
FT                   /locus_tag="TP01_0036"
FT   mRNA            join(<90398..90497,90527..90594,90622..90900,91084..91196,
FT                   91226..91378,91410..91539,91571..>91645)
FT                   /db_xref="GI:71031842"
FT                   /db_xref="GeneID:3502800"
FT                   /locus_tag="TP01_0036"
FT                   /transcript_id="XM_760470.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(90398..90497,90527..90594,90622..90900,91084..91196,
FT                   91226..91378,91410..91539,91571..91645)
FT                   /locus_tag="TP01_0036"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031843"
FT                   /db_xref="GeneID:3502800"
FT                   /translation="MKPRSGPFVDTSEVERVMFSYPIDLKMANLLRTAFEKSSLEAYIK
FT                   LVNQFSSRCFKINREYVKPMTFWKTWILNGFHLIFYGNGSNSNLLNAFSKIALRFVNSK
FT                   HMWFSDSPNITINAYAIKGSDSYLWNYLSDKILDTKTVSKSEGLKVKVIGSMNHQNSGP
FT                   IFNDFDRVLGKYRIVHTNTFHEFGQELISIWQNTPPNFFMNKKVQKSAAQIQTILEALS
FT                   KNHQKLFSLIAQIQLETTRDTKKFIGIEKNSILHDSRAITICHNETKLDNLLTEFTTHD
FT                   VIEQTRGPGGRLFLRIPFEKYVSS"
FT                   /protein_id="XP_765563.1"
FT   gene            91820..91902
FT                   /db_xref="GeneID:3503304"
FT                   /locus_tag="TP01_1237"
FT   tRNA            91820..91902
FT                   /db_xref="GeneID:3503304"
FT                   /locus_tag="TP01_1237"
FT                   /product="tRNA-Tyr"
FT   gene            complement(92054..93879)
FT                   /db_xref="GeneID:3503305"
FT                   /locus_tag="TP01_0037"
FT   mRNA            complement(join(92054..92346,92377..92490,92518..92757,
FT                   92788..93879))
FT                   /db_xref="GI:71031844"
FT                   /db_xref="GeneID:3503305"
FT                   /locus_tag="TP01_0037"
FT                   /transcript_id="XM_760471.1"
FT                   /product="poly(A) polymerase"
FT   CDS_pept        complement(join(92095..92346,92377..92490,92518..92757,
FT                   92788..93705))
FT                   /locus_tag="TP01_0037"
FT                   /gene_family="HOG000204376" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71031845"
FT                   /db_xref="GeneID:3503305"
FT                   /translation="MVISVQSIQLNQYGITDPVSHEGPTNNDLKASRELLNLLKSHNLY
FT                   ETEEGKKRREDILESLNRLLQQFVRRQAKITRGLTDQEASQVSGKLLTFGSYRLGIVAP
FT                   DSDIDVLCLCPRSVTRESFFSDFYNTLNKVDGISKLQAVPDAYTPVIKLYFYDISIDIL
FT                   FANLDAPTVSPHINVLDDNILRNMNDSTVRSINGCRVASYILDSVPNKNYFRTTLRFIK
FT                   LWASRRKIYSTVVGYLGGVAWAILTARVCQLYPNCAPNQLIEKFFRVYSVWQWECPVTL
FT                   CKIKEPPNIPGLMSFKVWDPRVNPQDRHHLMPIITPAFPSMNSTHNVTATTKRVITEEL
FT                   MRALEIFKTSNLTNVELWEKVLEEEDVFSNYKHFLVIEVYGSNEHVAHNKWEGWIGSRM
FT                   RFLISRLENLGNTYIRPIPGFFKFEDDNWDYASSAFFAFKVISGVVETSKTLDIRSSVQ
FT                   SFKDIINNWSDMEKYRDQISFNIKHLKNNQLPDYVLSNKSKKRPINEIS"
FT                   /protein_id="XP_765564.1"
FT   gene            <94270..>95646
FT                   /db_xref="GeneID:3503306"
FT                   /locus_tag="TP01_0038"
FT   mRNA            <94270..>95646
FT                   /db_xref="GI:71031846"
FT                   /db_xref="GeneID:3503306"
FT                   /locus_tag="TP01_0038"
FT                   /transcript_id="XM_760472.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        94270..95646
FT                   /locus_tag="TP01_0038"
FT                   /gene_family="HOG000135897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031847"
FT                   /db_xref="GeneID:3503306"
FT                   /translation="MIKPNKNSNSGESKFGLSVLDTLLNRDIYDVSINETTSEIRGFYS
FT                   DSDNNSHLVSSSSSHILSENGIPNSTLESPLFTETKTPTNRSEQLPILLARNYYTAPPC
FT                   LLRFVNSTSTIRSYKENKRDSDGTVLDNEYDPIIDCNVDTNDEMDDYDLNENDVETFSI
FT                   GTMTNRTSLMSDQQFPDSDELAYMNMDPLELNLVLQNASSKRDPHFDKGCSPFVIEKST
FT                   DSNTNSKVTVDIGTSPLIMDETELFDKWVSTDKLDEDTEVKVEDIEIKLEPTTMDSYPP
FT                   ELESNDLNTTDVDVEPSEFPINDDAPDSKEYSTLESGDFSIKNQELPQENQIPVYCRSL
FT                   LYRIRVPLSKRLKNINEDALNNSLSSPLNSPTKVNLSCDRLFSSKTKSPNSIDYSYSLL
FT                   SVRDLEPNRSDSSNLLPNTNYDFSKNKGTKSNKIKRNLTSSLGSQGRNKIRKRSRPLKR
FT                   "
FT                   /protein_id="XP_765565.1"
FT   gene            complement(<95680..>96650)
FT                   /db_xref="GeneID:3503307"
FT                   /locus_tag="TP01_0039"
FT   mRNA            complement(join(<95680..96012,96044..96159,96191..>96650))
FT                   /db_xref="GI:71031848"
FT                   /db_xref="GeneID:3503307"
FT                   /locus_tag="TP01_0039"
FT                   /transcript_id="XM_760473.1"
FT                   /product="U3 small nuclear ribonucleoprotein"
FT   CDS_pept        complement(join(95680..96012,96044..96159,96191..96650))
FT                   /locus_tag="TP01_0039"
FT                   /gene_family="HOG000172063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="U3 small nuclear ribonucleoprotein"
FT                   /db_xref="GI:71031849"
FT                   /db_xref="GeneID:3503307"
FT                   /translation="MLRKTLRQRREYIFLKSRENKDKYSLKKARELNEALKNNKPIPTE
FT                   LRNQSGVVQASLDLLDAKRREEYSHVDNEYAFCGMLHYFTKNLGFKDPKILITTSRNPS
FT                   SRLTQFAKELCLIIPNSERLNRGSYILKDLVEFCRSKDVSDMVLIYETRGNPNSMIITH
FT                   LPHGPTAYFQLSDVVLRHDLTEKLPTMSQAYPHLMFHNFTSPLGERIKDIIRYMFPPPN
FT                   TNETRIMSFINEKDKIIFRHHVWTEKKIGAEDKKVALKEIGPRFVLKPFKIELGTVDMR
FT                   DLETEWVLRPYFNTHKPILAS"
FT                   /protein_id="XP_765566.1"
FT   gene            complement(<96907..>98024)
FT                   /db_xref="GeneID:3503308"
FT                   /locus_tag="TP01_0040"
FT   mRNA            complement(join(<96907..96987,97022..97342,97374..>98024))
FT                   /db_xref="GI:71031850"
FT                   /db_xref="GeneID:3503308"
FT                   /locus_tag="TP01_0040"
FT                   /transcript_id="XM_760474.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(96907..96987,97022..97342,97374..98024))
FT                   /locus_tag="TP01_0040"
FT                   /gene_family="HOG000281983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031851"
FT                   /db_xref="GeneID:3503308"
FT                   /translation="MTGVVKDDKKKRKFKIVYNKTEKSGDDSSKLTENDNPLEFDHLID
FT                   DIEDYLKDSIQSQNTQNGSLPPVLKFNKNWTLSVTELSSQLWCEKQLELSLLTGRKRVT
FT                   EEMLKGIERHEELELEDHEIIEVEVETNEDNLGIRMLNTINLLEQLMSEGKCRELWLFW
FT                   NLGSYTFCGIIDQLTISKDRLTKQKSVIISDTKTRKSKKLPSVQQVQGASLQVQVYCMM
FT                   LEDTKNGVVNFEKLYDSFNCDKFAEFTTPELKKEKCLHELEKKYLRAFKKLPKISCEMN
FT                   LEYEFEGEIFSNSKINLNRDNAVMTVGYLCNFWDGLREADYVAKNEAWKCKMCEFKDEC
FT                   PVCPLVSDNS"
FT                   /protein_id="XP_765567.1"
FT   gene            98229..99410
FT                   /db_xref="GeneID:3503309"
FT                   /locus_tag="TP01_0041"
FT   mRNA            join(98229..98441,98475..98588,98623..98749,98779..98866,
FT                   98901..98978,99011..99146,99178..99410)
FT                   /db_xref="GI:71031852"
FT                   /db_xref="GeneID:3503309"
FT                   /locus_tag="TP01_0041"
FT                   /transcript_id="XM_760475.1"
FT                   /product="ribonuclease H1 large subunit"
FT   CDS_pept        join(98363..98441,98475..98588,98623..98749,98779..98866,
FT                   98901..98978,99011..99146,99178..99389)
FT                   /locus_tag="TP01_0041"
FT                   /gene_family="HOG000100290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease H1 large subunit"
FT                   /note="go_function: ribonuclease H activity [goid 0004523];
FT                   go_function: RNA binding [goid 0003723]"
FT                   /db_xref="GI:71031853"
FT                   /db_xref="GeneID:3503309"
FT                   /translation="MEGENPLKCFRIHRFGNISKSDEVILGIDEAGRGPVLGPMVYGGF
FT                   FCIKGDDCKSILKNKIRVDDSKKLTETMRENKFYQLNDPNYPFGVVAEVITPQYISYKM
FT                   LQRDKYNLNEISHDTAISIIRHVLDHGYNLKEVYIDAVGTVNKYEAKLSKLFPKIHFSV
FT                   REKADSIYPTVSAASIVAKVIRDNIIKNWKFDFEVENIGSGYPGDPYTKDFLTNNMDKI
FT                   FGFPDIVRYSWSTASHLLNGPDGVEVEWYDEEIVHSKKNDLPSPLCYTIKNVTKF"
FT                   /protein_id="XP_765568.1"
FT   gene            complement(<99410..>100874)
FT                   /db_xref="GeneID:3502989"
FT                   /locus_tag="TP01_0042"
FT   mRNA            complement(join(<99410..100347,100378..100710,
FT                   100748..>100874))
FT                   /db_xref="GI:71031854"
FT                   /db_xref="GeneID:3502989"
FT                   /locus_tag="TP01_0042"
FT                   /transcript_id="XM_760476.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(99410..100347,100378..100710,
FT                   100748..100874))
FT                   /locus_tag="TP01_0042"
FT                   /gene_family="HOG000135896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031855"
FT                   /db_xref="GeneID:3502989"
FT                   /translation="MNDFARGEFKFDTKTVQVENFNKNPNVTFRIPIPLGNLDLNQESQ
FT                   PESLPYKPPDSLFSQNQHSVNVRTPFKTLIEKKIPDIEKLFEVRMSLQDVDGDLKLISS
FT                   GEKAEPSINEIIDICRKSNVYNFYLCFPVRGDQFHKSFSEFQKLVKNKLGGNVTFEKRP
FT                   HITLALVNLVTDSDIYKVVRAFQITSLTITSVLKQQSQNYHSQYNVDLEGLDFIKYKGK
FT                   LAKRSVLFTNVVMSEALTDIASEFQNTLNKTVNTFMNKPKRRKINKSNRISNLTESQLA
FT                   PKGIYLSRGGAVEITFTDVPLVDPNYMKTTSENSEKDTHYEENLVSEVNEPETQEQETE
FT                   TETVKKESESDEEESYEYDTSVKNKFHVTLMRHQQVNILSNLKFSGKTQVVCAELRPRR
FT                   GETCNFNSYNSTELTSFVGTSYDNEENEDIATTRICSSRPKDIPNDHLVDMNTDNNNKA
FT                   ERFLFWI"
FT                   /protein_id="XP_765569.1"
FT   gene            <101238..>102781
FT                   /db_xref="GeneID:3502990"
FT                   /locus_tag="TP01_0043"
FT   mRNA            join(<101238..101258,101282..>102781)
FT                   /db_xref="GI:71031856"
FT                   /db_xref="GeneID:3502990"
FT                   /locus_tag="TP01_0043"
FT                   /transcript_id="XM_760477.1"
FT                   /product="hexokinase"
FT   CDS_pept        join(101238..101258,101282..102781)
FT                   /locus_tag="TP01_0043"
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hexokinase"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: hexokinase activity [goid 0004396];
FT                   go_process: glycolysis [goid 0006096]"
FT                   /db_xref="GI:71031857"
FT                   /db_xref="GeneID:3502990"
FT                   /translation="MILIYFYVHKRFTNNKYNHIKMSSVSTLIREAVEIYRGDSAVPTS
FT                   LASDPEVRLQQIVDQLTVSLNDLKDVSHNFYSELMHGLKAHRRHRNLWLPNECSFKMLD
FT                   SFIPNIPTGKEKGSYFALDFGGSNFRAVRIMIEGDGKMERNQSTFSLRYSSALGPKGLL
FT                   DQKATATELFDHFAKKIEHVMKESGVDPNPSKPHKVGFTFSFPCTMLSPCNAILLDWTK
FT                   DFETGRATNDQVEGKDVAILMNQAFKRNNMNAEVSIVLNDTVGTLLSCAYQKPKDYPPC
FT                   RVGVILGTGFNICYEEDEYERFGYVGRVINIECGNFDNELPQTPVDYEIDFYTSNRGRG
FT                   KLEKLVAGAYLGEIIRRFMILYLREQAPPKMWEIGTFTSVDASEILNDNSEDLVISKQV
FT                   AKRSWDVELPKESLIALRKISEAAFGRSAGFAAASICATARKAKAYVTSKTTVAIDGSL
FT                   YVKNEWYRNKLQYYIDNVTRPDLVGNVVLLSSDDGSGKGAAIAAAMFD"
FT                   /protein_id="XP_765570.1"
FT   gene            <102847..>103709
FT                   /db_xref="GeneID:3502991"
FT                   /locus_tag="TP01_0044"
FT   mRNA            join(<102847..103108,103144..103402,103433..>103709)
FT                   /db_xref="GI:71031858"
FT                   /db_xref="GeneID:3502991"
FT                   /locus_tag="TP01_0044"
FT                   /transcript_id="XM_760478.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(102847..103108,103144..103402,103433..103709)
FT                   /locus_tag="TP01_0044"
FT                   /gene_family="HOG000281595" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031859"
FT                   /db_xref="GeneID:3502991"
FT                   /translation="MPRGGHKGLLFPTSGVNLNFFGRRRRRGLYHHCTNEIFRPSWGPI
FT                   KQPTISHYLNLLKWKNGTISESEMLPPQNVYGKDVRSAWPVPPNEFISRMYDKNELRYF
FT                   KPVLMSNSDRIRNYIYNVLDSTNSRYNGFIGLNQNPEHTISSQHISKIVNLENDSSLPK
FT                   INLHIARCERRFKRLEHLIKESDSWRTITHHHQSSTNPFPHVNEGASLIRNLPISEVLY
FT                   TKGNHRLGRRAHPKWYTARYRKFMKKRELNEKLSQLHLEASTE"
FT                   /protein_id="XP_765571.1"
FT   gene            <104160..>105617
FT                   /db_xref="GeneID:3502992"
FT                   /locus_tag="TP01_0045"
FT   mRNA            <104160..>105617
FT                   /db_xref="GI:71031860"
FT                   /db_xref="GeneID:3502992"
FT                   /locus_tag="TP01_0045"
FT                   /transcript_id="XM_760479.1"
FT                   /product="hexokinase"
FT   CDS_pept        104160..105617
FT                   /locus_tag="TP01_0045"
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hexokinase"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: hexokinase activity [goid 0004396];
FT                   go_process: glycolysis [goid 0006096]"
FT                   /db_xref="GI:71031861"
FT                   /db_xref="GeneID:3502992"
FT                   /translation="MSYITSYIVDRNEFYHTDQTSQETLSSNPQIRLQQIVDQLTISLE
FT                   DLKDVSHNFYSELMHGLKAHRRHRNLWLPNECSFKMLDSFIPNIPTGKEKGSYFALDFG
FT                   GSNFRAVRIMIEGDGKMERNQSTFSLRYSSALGPKGLLDQKATATELFDHFAKKIEHVM
FT                   KESGVDPNPSKPHKVGFTFSFPCTMLSPCNAILLDWTKDFETGRATNDQVEGKDVAILM
FT                   NQAFKRNNMNAEVSIVLNDTVGTLLSCAYQKPKDYPPCRVGVILGTGFNICYVEDEYER
FT                   FGYVGRVVNIECGNFDTELPLNPVDCEIDFYTSNRGRGKLEKLVAGAYLGEIIRRFMIL
FT                   YLREQAPPKMWEIGTFTSVDASEILNDNSEDLVISKQVAKRSWDVELPKESLIALRKIS
FT                   EAAFGRSAGFAAASICATARKAKAYVTSKTTVAIDGSLYVKNEWYRNKLQYYIDNVTRP
FT                   DLVGNVVLLSSDDGSGKGAAIAAAMFI"
FT                   /protein_id="XP_765572.1"
FT   gene            complement(<105737..>106140)
FT                   /db_xref="GeneID:3502993"
FT                   /locus_tag="TP01_0046"
FT   mRNA            complement(join(<105737..106000,106033..>106140))
FT                   /db_xref="GI:71031862"
FT                   /db_xref="GeneID:3502993"
FT                   /locus_tag="TP01_0046"
FT                   /transcript_id="XM_760480.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(105737..106000,106033..106140))
FT                   /locus_tag="TP01_0046"
FT                   /gene_family="HOG000135895" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: RNA binding [goid 0003723]; go_process:
FT                   RNA processing [goid 0006396]"
FT                   /db_xref="GI:71031863"
FT                   /db_xref="GeneID:3502993"
FT                   /translation="MKFNIPEEVKKQIPAGCKIDLKTYLIIEYVAKVVSQEGSSFEFRL
FT                   KIHLLNHKLPFLDSNHELHKLYKFLQNNPGYYLYNNDKQEIPCLLHELYEHIFVDDKDG
FT                   IDKKVKSDENVIEGYSDSD"
FT                   /protein_id="XP_765573.1"
FT   gene            <106758..>107128
FT                   /db_xref="GeneID:3502994"
FT                   /locus_tag="TP01_0047"
FT   mRNA            join(<106758..106861,107032..>107128)
FT                   /db_xref="GI:71031864"
FT                   /db_xref="GeneID:3502994"
FT                   /locus_tag="TP01_0047"
FT                   /transcript_id="XM_760481.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(106758..106861,107032..107128)
FT                   /locus_tag="TP01_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031865"
FT                   /db_xref="GeneID:3502994"
FT                   /translation="MFSASIFVSIDAQELKKIDDKIRKEEAEEAKDHGRGMNYKGSCDS
FT                   RQSFKWFSVDQKRDIVSLIVV"
FT                   /protein_id="XP_765574.1"
FT   gene            complement(<108033..>109170)
FT                   /db_xref="GeneID:3502995"
FT                   /locus_tag="TP01_0048"
FT   mRNA            complement(join(<108033..108176,108208..108302,
FT                   108440..108476,108508..108827,108859..109054,
FT                   109087..>109170))
FT                   /db_xref="GI:71031866"
FT                   /db_xref="GeneID:3502995"
FT                   /locus_tag="TP01_0048"
FT                   /transcript_id="XM_760482.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(108033..108176,108208..108302,
FT                   108440..108476,108508..108827,108859..109054,
FT                   109087..109170))
FT                   /locus_tag="TP01_0048"
FT                   /gene_family="HOG000133179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031867"
FT                   /db_xref="GeneID:3502995"
FT                   /translation="MVLKNILKIILLLSSLIRTCDSNLIKTNHNLGLGLSLSSLENLCK
FT                   KLDDPKITKKCNIVSCIGANNWKQRFFVENNFGLDPTKSSTISGPLKPRNNLWEHSVQD
FT                   GYNLLLDSEIPNFENEIKSAVNNKSIVNLSALSKCILIYLNEDNFDLNNEEITLNQNVK
FT                   MFFEQLSKRLDLELGRNDKNSKDIYIVLPDFNSFQKKVKPNKSQIKSLENVVDVLKSFN
FT                   TPNNSTQMLVDYVRTKCFENFTKFVDDSLERSLKGEKIDKFAAKYHTQLFDSKVSFYTL
FT                   VMDQLVRREF"
FT                   /protein_id="XP_765575.1"
FT   gene            <109630..>110109
FT                   /db_xref="GeneID:3502616"
FT                   /locus_tag="TP01_0049"
FT   mRNA            join(<109630..109732,109771..109848,109886..>110109)
FT                   /db_xref="GI:71031868"
FT                   /db_xref="GeneID:3502616"
FT                   /locus_tag="TP01_0049"
FT                   /transcript_id="XM_760483.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(109630..109732,109771..109848,109886..110109)
FT                   /locus_tag="TP01_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031869"
FT                   /db_xref="GeneID:3502616"
FT                   /translation="MIKFTHLIILLLLAHCVKLVTSNVKWTRLKSGQFRNKILKFAATS
FT                   GNNSQYMFGGEIDGEGRYTNNLFVLNDPNLEWSILSANGSFPSRRSGSTLTKIGSSLYV
FT                   IGGHNDNGTLNTIYRFGLLILTLMCITQIH"
FT                   /protein_id="XP_765576.1"
FT   gene            <110221..>111175
FT                   /db_xref="GeneID:3502617"
FT                   /locus_tag="TP01_0050"
FT   mRNA            join(<110221..110225,110395..110516,110598..110778,
FT                   110808..110911,110943..111056,111105..>111175)
FT                   /db_xref="GI:71031870"
FT                   /db_xref="GeneID:3502617"
FT                   /locus_tag="TP01_0050"
FT                   /transcript_id="XM_760484.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(110221..110225,110395..110516,110598..110778,
FT                   110808..110911,110943..111056,111105..111175)
FT                   /locus_tag="TP01_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031871"
FT                   /db_xref="GeneID:3502617"
FT                   /translation="MIKKYFEPFAKRVILPNLRRFTPHKFFQADSKLYLFGGYSYTGGF
FT                   LTCQQTGGTNQNLMSYHLPEKVRFTLFIFLGYTGIRMGRAILYFGGCNYTYNAHRCYNN
FT                   VWNYDTIGDKWTIVPSSFEKPLERGHSFLFYSQNSIILYGGSKLDNVIYNDMWKLSMLL
FT                   PCTDPKYSCFGNGECSGSSCTCFTGFLGHDCGTEQ"
FT                   /protein_id="XP_765577.1"
FT   gene            complement(<111412..>113295)
FT                   /db_xref="GeneID:3502618"
FT                   /locus_tag="TP01_0051"
FT   mRNA            complement(<111412..>113295)
FT                   /db_xref="GI:71031872"
FT                   /db_xref="GeneID:3502618"
FT                   /locus_tag="TP01_0051"
FT                   /transcript_id="XM_760485.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(111412..113295)
FT                   /locus_tag="TP01_0051"
FT                   /gene_family="HOG000135894" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031873"
FT                   /db_xref="GeneID:3502618"
FT                   /translation="MAQYFGGFEEEEDDPVLFELDVYLSNPTLSDILGYFDKLPEHIPF
FT                   LNELSSNPFNRLLLLQYPLETCKYINGESSDDIPRNKINSNASDKLHLKSVEIGEQTEN
FT                   NDLSNKKIYSSRAKKPNRHYNSPLVRLNYDLGPNYSLNVKTSPIKKSHKSTYLFKEEYD
FT                   PMSSPEFGPSKPFGESSNVLTFESSVSTSEHVMDCLGLLKIENTEHGLKRELHLVPVRA
FT                   ILQLRPKLDSFNQTFLSSDDSFLGLFYNRNITWKKVDRIFYPESFESKELIDQFTKYGK
FT                   DVKAYDNPKINFDQDREMYINSLCVPLNGTTSKFHSCSKDQDGIDNSGITHIYTKTHDF
FT                   CPNFRFMKRLTVEMQLKLLLSHRSIDSFYSLKRDIVHNNLEDEDLIRLLGKFSKNISGN
FT                   WVLSSVHAIENYTEDDECNPEEMEYLVSCREFLLCLLNRQSSEPKLKDSSSVCKLATEI
FT                   FRNATGLPFKLANDLLCGVAKPQGKIWVLKLDKDDEFSEKHTQVFDLFNQYWRERLKKI
FT                   ADIVSSYKKSPQINQMLRNIFIKGELASFIKNKIYAHYKIIEHMESLGYGDQQKTINAI
FT                   LPQVATRIYGEFWTCKKTNAWLTECKNAIIGKGNQTQIPNFVIRAIKKFTD"
FT                   /protein_id="XP_765578.1"
FT   gene            <113679..>116981
FT                   /db_xref="GeneID:3502619"
FT                   /locus_tag="TP01_0052"
FT   mRNA            join(<113679..113720,113754..114024,114056..114414,
FT                   114445..114739,114832..114934,114983..115008,
FT                   115228..>116981)
FT                   /db_xref="GI:71031874"
FT                   /db_xref="GeneID:3502619"
FT                   /locus_tag="TP01_0052"
FT                   /transcript_id="XM_760486.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(113679..113720,113754..114024,114056..114414,
FT                   114445..114739,114832..114934,114983..115008,
FT                   115228..116981)
FT                   /locus_tag="TP01_0052"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031875"
FT                   /db_xref="GeneID:3502619"
FT                   /translation="MIDFGKDSKPPESDGRNQEDDTLDNFTSSILSQYASGLNPPICKV
FT                   SSSTQDAPFQPEKLPFDFSNSSNDDSNSVNSDDLSTFNNCINKIEILYTMSTKLEKQWN
FT                   DWFHLIKERSNYNRYDLSLKKPSIWKQNHNLNDLHLESISRWIEISSNILCSLAYTLNI
FT                   DSNLFDLNGSKLLQESIDEAYSKFNTDISKVWEQPNVTSQQLKNDFKNDYLKMIKFNTR
FT                   LQSNYERILEKLRNERDEAISKAEQKTVLEKEVLFNFKSFNYQICSLKNRISKLEQELV
FT                   NKDKEIEDLNKSLESSNRIHLQVIKKNEELVSTNQKLMMDKKQRRRKERRYSPTFGENV
FT                   RYKHEIQKVRSITTRKSIPIGFYTSISCGMSPQGSAPFSSILYLTKRKRLSEHLYEQRD
FT                   ETNHSNHQYCYENVFYPSQRPEKYGNSGLYRNLVYLSEDRLKFETSDGVALDVDDGLNR
FT                   GLNYLSQHSHLMNLGEIEEFLRMQRYKTQVHEKVHGKVEDIANLLDLNDMKNTEVSYSD
FT                   PFERDLELSDRYVGPLNASEVAHLIALALKLQENEKLDSDLGKKLEISASSWKNFKVPN
FT                   TVPDEHISSLFMNKPYQCETCGLRFSLSDTKSRHELTHKQKVDRFWHPLDGWVHMTSKG
FT                   TTSSTYTRSMVTLETFRNLFRAIPLEDENVNWLKGLLFPNDHASKDVVMTDEFQQTNVE
FT                   FEEEEVSGTSDHLSDETTLWSWGIMDNLDEPISISSTHQQPEDEDFDLALFNLMLKSVS
FT                   FNLLMLNSKKPVFGTFGDLSKFFCVLCQDILNCQFDVKYNKFAYVDTISFQLDPNVISK
FT                   VFKEHVLISNILSLDDLDKLSVFDLLKKMASIKVVSPDTKSKLDFAITDWSFKYTKDLL
FT                   GINSSIPKMDDVKYSNKLVKGWKNPFKENDGSSARSLLISHTSCLKLFFNSHLRLVKVK
FT                   ASYVKNEEVRKKLKLLNLV"
FT                   /protein_id="XP_765579.1"
FT   gene            complement(<117138..>117698)
FT                   /db_xref="GeneID:3502620"
FT                   /locus_tag="TP01_0053"
FT   mRNA            complement(join(<117138..117218,117270..>117698))
FT                   /db_xref="GI:71031876"
FT                   /db_xref="GeneID:3502620"
FT                   /locus_tag="TP01_0053"
FT                   /transcript_id="XM_760487.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(117138..117218,117270..117698))
FT                   /locus_tag="TP01_0053"
FT                   /gene_family="HOG000281976" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031877"
FT                   /db_xref="GeneID:3502620"
FT                   /translation="MFPAYKVLCVFIRQISKPFANYLKRRAAHNERFRNICIYFGNKSF
FT                   AFERSISRRFYNSEVTECDKVTLSPEKSVNIGSELLGECFIFTVAAGLITAEYVRGALK
FT                   ESRKEYRLKQRLDNIDSRQGELQKLINQEVTRQLEARFPKRLKIYQIQFIKLSECGQTL
FT                   LSRAHF"
FT                   /protein_id="XP_765580.1"
FT   gene            complement(<118696..>119593)
FT                   /db_xref="GeneID:3502621"
FT                   /locus_tag="TP01_0054"
FT   mRNA            complement(join(<118696..118740,118973..119311,
FT                   119342..119407,119561..>119593))
FT                   /db_xref="GI:71031878"
FT                   /db_xref="GeneID:3502621"
FT                   /locus_tag="TP01_0054"
FT                   /transcript_id="XM_760488.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(118696..118740,118973..119311,
FT                   119342..119407,119561..119593))
FT                   /locus_tag="TP01_0054"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031879"
FT                   /db_xref="GeneID:3502621"
FT                   /translation="MCVLMFLTNQEAEFGRFSTKKRRVICQRCYKLQYYKRLDTKNEVE
FT                   SSREMLVKEFLDTENLKRNSVKRVISSNLNSKQFPVLMTQLESETNIAHNSVKISSTSE
FT                   IISNMATRIKNNSLILFVLDLTNLEISVIPELYIALRNRALDELGSINSKIGSRNT"
FT                   /protein_id="XP_765581.1"
FT   gene            complement(119966..121867)
FT                   /db_xref="GeneID:3502610"
FT                   /locus_tag="TP01_0055"
FT   mRNA            complement(join(119966..120048,120078..120193,
FT                   120227..120464,120498..120679,120710..120898,
FT                   120932..121017,121049..121163,121198..121297,
FT                   121330..121491,121532..121589,121623..121867))
FT                   /db_xref="GI:71031880"
FT                   /db_xref="GeneID:3502610"
FT                   /locus_tag="TP01_0055"
FT                   /transcript_id="XM_760489.1"
FT                   /product="DEAD box RNA helicase"
FT   CDS_pept        complement(join(119979..120048,120078..120193,
FT                   120227..120464,120498..120679,120710..120898,
FT                   120932..121017,121049..121163,121198..121297,
FT                   121330..121491,121532..121589,121623..121812))
FT                   /locus_tag="TP01_0055"
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DEAD box RNA helicase"
FT                   /note="go_function: nucleic acid binding [goid 0003676];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_function: ATP binding [goid 0005524];
FT                   go_function: helicase activity [goid 0004386]"
FT                   /db_xref="GI:71031881"
FT                   /db_xref="GeneID:3502610"
FT                   /translation="MDSDSIFKQFLARDDNKELRQLCSQSMEFLNNPPSQNQFNTNLNN
FT                   QDLGTMHTERQMNLNLDYGAPTSNDFMRPKHVMLDEISDALLVDGTQFNENINMQWSQL
FT                   PLSPDLLKGIQNMGFAKPSKIQQCALPLILGSCTNIIAQAKNGSGKTATFALAMLSKVN
FT                   VNVPLVQALCICPTRELATQNVQVIQKLGQFTQIKCFLGVPQCPRYEDNDQYHLYVGTP
FT                   GKTMDFLKKRIMNVTNVVMLVLDEADELINQQNNMGPQVLQIRNFFRGPVQIVLFSATF
FT                   SDNVYNFATKIAPRAHVIQVKREQLTLDCIDQRYMICNDDEDKFNKLSEIYSSMIVGQS
FT                   VIFVNSRETAFKLSQRMRDQGHAVSLLCGTLGPSSGPNSMTPEIRDRIMKEFKDGETKV
FT                   LICTDVLARGIDVPQVTLVINYELPMSYSGAKTAELKSVCMETYLHRIGRTGRFGVRGM
FT                   AINMITVNEMALIESIKQFYKCNVDLLECDPEELENMVRNFRV"
FT                   /protein_id="XP_765582.1"
FT   gene            122521..123539
FT                   /db_xref="GeneID:3502611"
FT                   /locus_tag="TP01_0056"
FT   mRNA            122521..123539
FT                   /db_xref="GI:71031882"
FT                   /db_xref="GeneID:3502611"
FT                   /locus_tag="TP01_0056"
FT                   /transcript_id="XM_760490.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        122649..123173
FT                   /locus_tag="TP01_0056"
FT                   /gene_family="HOG000135893" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031883"
FT                   /db_xref="GeneID:3502611"
FT                   /translation="MKLAARLISLYFIIYILHSPVLGGNCSHEELKKLGMLEGDGFDRD
FT                   ALFKSSHGMGKVGKRYGLKTTPKVDKVLADLETLFGKHGLGGISKDCLKCFAQSLVCVL
FT                   MKCRGACLKGPCTDDCQNCFDRNCKSALLECIGKTSIPNPCKWKEDYLKYKFPETDEDE
FT                   STKKGEASGTS"
FT                   /protein_id="XP_765583.1"
FT   gene            <124239..>125016
FT                   /db_xref="GeneID:3502612"
FT                   /locus_tag="TP01_0057"
FT   mRNA            join(<124239..124688,124723..>125016)
FT                   /db_xref="GI:71031884"
FT                   /db_xref="GeneID:3502612"
FT                   /locus_tag="TP01_0057"
FT                   /transcript_id="XM_760491.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(124239..124688,124723..125016)
FT                   /locus_tag="TP01_0057"
FT                   /gene_family="HOG000135892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031885"
FT                   /db_xref="GeneID:3502612"
FT                   /translation="MYIIFSYYSPFPFFLINLFFCKCLLLNNIFGVSNKFKDRNFNLFF
FT                   LNHTRNLSQTYNLKEVQKCTLPSKSKKLNSQLNSVHTDTHTIDDDVARILFGLDDPLEI
FT                   GRTYINSEGKIINKKKSLYSIGDLSHVDDFFEGKFRVEWTVRGVKEKLQYRYRDSHTLP
FT                   LTTSRFSLAGIKGFVLRLWLDGHKGSKKGFVTFIVIDFRHIAMSLVQQEHWTSLDSPIC
FT                   LFAGKIVKGPFFYRSPEYTQVSLTL"
FT                   /protein_id="XP_765584.1"
FT   gene            complement(<125246..126273)
FT                   /db_xref="GeneID:3502613"
FT                   /locus_tag="TP01_0058"
FT   mRNA            complement(<125246..126273)
FT                   /db_xref="GI:71031886"
FT                   /db_xref="GeneID:3502613"
FT                   /locus_tag="TP01_0058"
FT                   /transcript_id="XM_760492.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(125246..126265)
FT                   /locus_tag="TP01_0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031887"
FT                   /db_xref="GeneID:3502613"
FT                   /translation="MFRTIPVSTYDPYANTLLASLIIRKSYKLPQTIGAQQIFPKEAMQ
FT                   YAKVALKRPSACNFYAANCIAVLLALNKNLKASYESFLLLLESLSVTSHMKLLVNKNMG
FT                   IVSAAITLANMATDKKFDRNKLNKLKVAKTQQYFQTAISNGKMDKNLYICYIRFLFDVQ
FT                   KFEECISMLETAKLIFQDDVFAYNQIIVTDSMICTYLRDAEKTNSVVEMNNMLSGCRFV
FT                   TTTGDYFLAMNQRGHGFITPESCNKLKQILSRVKTKVMPHITSTLPHLEKACENKQKAR
FT                   EKRLQLQLTIQQAQEAKKRQLEEERIRAAEADEALSAQLLKEASEIASEIIMGKAPQP"
FT                   /protein_id="XP_765585.1"
FT   gene            complement(<126387..>128015)
FT                   /db_xref="GeneID:3502614"
FT                   /locus_tag="TP01_0059"
FT   mRNA            complement(<126387..>128015)
FT                   /db_xref="GI:71031888"
FT                   /db_xref="GeneID:3502614"
FT                   /locus_tag="TP01_0059"
FT                   /transcript_id="XM_760493.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(126387..128015)
FT                   /locus_tag="TP01_0059"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031889"
FT                   /db_xref="GeneID:3502614"
FT                   /translation="MAINLNTTRIIPVILSGNIMTMVTNYQIASVYYMKALLMTTYYLS
FT                   MVDNYFKIADDSKEIMLELSLAQSQLVWLKALLLFALSSCQFYLGDIDSAKVLIDKSIS
FT                   VMPMSFSYRLSSVIIAHKLTHFKEDFDENDPEIPRLFKEYANAALLCHAMDKSNPLSQL
FT                   QICEFLFHKGEVEESKKRLQDLQKLNLPYNLRSELEYQLGRVEHFKENYSGALGHYLNA
FT                   ISLKSDFMVARLQLVKVSAGSSDLGLAREHCDFLLQCLHKVPIVLKVSAYVYLSSAREA
FT                   LETNKWEMLKLESVNKSQNQLDISCMFHTVQQGMGRLIDERLFKALSLLDDLMTMNNSN
FT                   EKEEEQDDSLKLGNRGDFKMLNKGKNDFSDPLVLEYYIRSMEMLVSRGREYFCPNLKSY
FT                   YSEYFKLYKNESPQFINNFGVILMYTRNYTKACKVLQDLNEKLSGTPNHTTDLNVMNTE
FT                   SKESGNLLNEELVKKTMALTVRFNYALALEFSGQFSKANKIYSALTREYPRYTPPWLRK
FT                   SIMAFRKVFCNNYLNIIFYLVRLRE"
FT                   /protein_id="XP_765586.1"
FT   gene            complement(<128148..>128616)
FT                   /db_xref="GeneID:3502615"
FT                   /locus_tag="TP01_0060"
FT   mRNA            complement(join(<128148..128278,128349..>128616))
FT                   /db_xref="GI:71031890"
FT                   /db_xref="GeneID:3502615"
FT                   /locus_tag="TP01_0060"
FT                   /transcript_id="XM_760494.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(128148..128278,128349..128616))
FT                   /locus_tag="TP01_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031891"
FT                   /db_xref="GeneID:3502615"
FT                   /translation="MVDIGFGIPLQSNLNKFNHELEGPDRRCVWLSQEDLVPGNLEAIK
FT                   DMLKAEKTPLRYWLFLASSYKSLGHSESSDSLLKESETMFPNDQSGPLYSSLAYHNLTQ
FT                   AFQFKNDEERHTKYMDWTTHYARKTEGE"
FT                   /protein_id="XP_765587.1"
FT   gene            <128812..>130390
FT                   /db_xref="GeneID:3502575"
FT                   /locus_tag="TP01_0061"
FT   mRNA            join(<128812..129014,129097..129145,129302..129403,
FT                   129434..129636,129666..129903,129932..>130390)
FT                   /db_xref="GI:71031892"
FT                   /db_xref="GeneID:3502575"
FT                   /locus_tag="TP01_0061"
FT                   /transcript_id="XM_760495.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(128812..129014,129097..129145,129302..129403,
FT                   129434..129636,129666..129903,129932..130390)
FT                   /locus_tag="TP01_0061"
FT                   /gene_family="HOG000282944" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031893"
FT                   /db_xref="GeneID:3502575"
FT                   /translation="MIRLRPHLRSLQSHVSSGQIPTREYLESFEPKSLRRLKVFNQTPP
FT                   EDIRKTFFEKLTSHYSNPRSILSALFLSTWQLIFFQLFLPRHVPRMIFALSALEYRSWP
FT                   LLTHLLELVQKHLKDWRISTISVMIGCLVKLGLDNIPNNSNLLPNVTSLLLNEVESRDP
FT                   SYSSPFDWAILSYSLVLTNRYEWPNYENASLPVFLNRACKGLNLENLPLSGWTQYYLYI
FT                   SLYCTDVEKPRNEIQIKESVPPEIQQSLHTRWLNEILIHSQPQGSEMLQKDVDTVLEGL
FT                   GNTEGLINCSVGRGDDEQHCLFTGHLFPNRKLCFEYNYLMPMPDGTPVESGLVSFRRRL
FT                   FNKFGYNTVVIHRHQWEKLTILEKEEQLLQILSKFPIIESNLYESKPEAKTFEGSNYKY
FT                   LKHLRPKITTWPPDKITL"
FT                   /protein_id="XP_765588.1"
FT   gene            complement(<130441..>130928)
FT                   /db_xref="GeneID:3502576"
FT                   /locus_tag="TP01_0062"
FT   mRNA            complement(join(<130441..130572,130608..>130928))
FT                   /db_xref="GI:71031894"
FT                   /db_xref="GeneID:3502576"
FT                   /locus_tag="TP01_0062"
FT                   /transcript_id="XM_760496.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(130441..130572,130608..130928))
FT                   /locus_tag="TP01_0062"
FT                   /gene_family="HOG000135891" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031895"
FT                   /db_xref="GeneID:3502576"
FT                   /translation="MYNFILFIFIIFGGKYSFPWTLKLAPNLSYTIHKIRWKGFNLNSE
FT                   PTDSLEYKPNDGKQLEYDEEGWLMDLNTKNVEDVLDLIRPQLSSDGGGISLCKIVDNEV
FT                   HVKFTGSCVGCPYRSTTLKELIENNLVKFIKSPNENPITVKLVQDN"
FT                   /protein_id="XP_765589.1"
FT   gene            <131429..>132721
FT                   /db_xref="GeneID:3502577"
FT                   /locus_tag="TP01_0063"
FT   mRNA            join(<131429..131541,131577..131731,131768..131847,
FT                   131883..132185,132218..132450,132688..>132721)
FT                   /db_xref="GI:71031896"
FT                   /db_xref="GeneID:3502577"
FT                   /locus_tag="TP01_0063"
FT                   /transcript_id="XM_760497.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(131429..131541,131577..131731,131768..131847,
FT                   131883..132185,132218..132450,132688..132721)
FT                   /locus_tag="TP01_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031897"
FT                   /db_xref="GeneID:3502577"
FT                   /translation="MRTLKNFNLSSKNFVKYNDYIMKNLSKFDTNIHLLVHRYSILGYS
FT                   PSLISIYDNQLKNNIGNLDNKSLCLISWSYAKNNVFIEELFDSIATVVLNRNSKLNLTD
FT                   ISLLLWTFAKINRKEPEEVLKLKNEFISIIKSIQNTLNNKETDENTQEYLDKEGWCVLI
FT                   HEIIGYFYTNVVHDICMACKSLSILLPGDMGTISQVFKILFNITSASKLSITSQGITSL
FT                   WEALEHSNLKDEDITEKLCEASRYLRLDHSFNSNMLNSIVTSIHKLRIKDPRIIYQIVH
FT                   WLEKRSVQMHATQMKGKRTHIWNT"
FT                   /protein_id="XP_765590.1"
FT   gene            <132774..>134131
FT                   /db_xref="GeneID:3502578"
FT                   /locus_tag="TP01_0064"
FT   mRNA            join(<132774..132785,132845..132959,133022..133148,
FT                   133216..133541,133605..133737,133791..133944,
FT                   133985..>134131)
FT                   /db_xref="GI:71031898"
FT                   /db_xref="GeneID:3502578"
FT                   /locus_tag="TP01_0064"
FT                   /transcript_id="XM_760498.1"
FT                   /product="protein phosphatase 2C"
FT   CDS_pept        join(132774..132785,132845..132959,133022..133148,
FT                   133216..133541,133605..133737,133791..133944,
FT                   133985..134131)
FT                   /locus_tag="TP01_0064"
FT                   /gene_family="HOG000280971" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein phosphatase 2C"
FT                   /note="go_function: catalytic activity [goid 0003824]"
FT                   /db_xref="GI:71031899"
FT                   /db_xref="GeneID:3502578"
FT                   /translation="MGDSVLKFMSKLFLKALGLSDKTLSQSVLNLLQNVNTTTIELDDG
FT                   FVLVDHYGDKGVRKTMEDECLVCDSLRSKFPDLPEEYDFGVCGLFDGHGGRKTVVFVKE
FT                   NLLSEIASQLISHLNMKNESGNEEEFEITFKKAVNDACRRLDSRIANEVPGCTDGCTAL
FT                   VLFFGKKTVCILNLGDSAAYLCKKVDSILHAIPLNDIHKPWSQREKARILHYQGTIEGG
FT                   RVNGLLEVTRSFGDLQLKKYGVLCVGTFRKVDLDFSKDELILLACDGFWGLFDPIDACR
FT                   KILDMVVKEEMRASVTPHLPFPQLKKVCKDLVDVAINVRRSQDNVTVMVLRFKRKN"
FT                   /protein_id="XP_765591.1"
FT   gene            complement(<134287..>135794)
FT                   /db_xref="GeneID:3502579"
FT                   /locus_tag="TP01_0065"
FT   mRNA            complement(join(<134287..134463,134495..134553,
FT                   134619..134721,134752..134816,134892..134961,
FT                   134993..135103,135145..135459,135512..135598,
FT                   135629..135753,135788..>135794))
FT                   /db_xref="GI:71031900"
FT                   /db_xref="GeneID:3502579"
FT                   /locus_tag="TP01_0065"
FT                   /transcript_id="XM_760499.1"
FT                   /product="ABC1 protein"
FT   CDS_pept        complement(join(134287..134463,134495..134553,
FT                   134619..134721,134752..134816,134892..134961,
FT                   134993..135103,135145..135459,135512..135598,
FT                   135629..135753,135788..135794))
FT                   /locus_tag="TP01_0065"
FT                   /gene_family="HOG000201140" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC1 protein"
FT                   /db_xref="GI:71031901"
FT                   /db_xref="GeneID:3502579"
FT                   /translation="MRGTALKFGQLLSLQSDILPENFRQALISSRHEADIMPKSQVDQI
FT                   LSREFGENWMDNFLEFDYEPIASASLGQAHKAKLKDGTEVAVKVQFPGILDSIDSDIEN
FT                   LVWICTYTKLVPDSFFIREYAKEMKTEVIAECDYLNEAKFYEIFRKLQLEGFYVPKVIK
FT                   ELTTKTVITTEYVHGKPLEDLGNLSQEARNSVGRRILKLSLSEIFVYELMNTDPNPSNY
FT                   LYNEETDLIGLVDFGSCRIYHRKFVKPYLQLVYATIREDLDEILRLSVEVGFLHPEESQ
FT                   IVIDAHLDSVKASADPFKYDIEYDFKNSKTFTTCMERSNIIFNYRKRPPPPEIYSLHRK
FT                   LAGAFLICKIISAKFNSKKLFEEVMEMSDVLN"
FT                   /protein_id="XP_765592.1"
FT   gene            <136704..>137038
FT                   /db_xref="GeneID:3502693"
FT                   /locus_tag="TP01_0066"
FT   mRNA            join(<136704..136749,136842..>137038)
FT                   /db_xref="GI:71031902"
FT                   /db_xref="GeneID:3502693"
FT                   /locus_tag="TP01_0066"
FT                   /transcript_id="XM_760500.1"
FT                   /product="50S ribosomal protein L33"
FT   CDS_pept        join(136704..136749,136842..137038)
FT                   /locus_tag="TP01_0066"
FT                   /gene_family="HOG000004838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L33"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71031903"
FT                   /db_xref="GeneID:3502693"
FT                   /translation="MNIVFTLVFVLATNLCIGPLYAKKKVGRVLVTLECSISRKLGVPP
FT                   SRYYTTKNKVNTPQRLELMKYNKYLRKHTLHKEIR"
FT                   /protein_id="XP_765593.1"
FT   gene            <137230..>137496
FT                   /db_xref="GeneID:3502694"
FT                   /locus_tag="TP01_0067"
FT   mRNA            <137230..>137496
FT                   /db_xref="GI:71031904"
FT                   /db_xref="GeneID:3502694"
FT                   /locus_tag="TP01_0067"
FT                   /transcript_id="XM_760501.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        137230..137496
FT                   /locus_tag="TP01_0067"
FT                   /gene_family="HOG000261845" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: acyl-CoA binding [goid 0000062]"
FT                   /db_xref="GI:71031905"
FT                   /db_xref="GeneID:3502694"
FT                   /translation="MSDESFDLAVKYVTDTTSMTATDEQKLLFYKYFKQATVGDCNTSK
FT                   PGMMDFKGKAKWESWNSAKGMSKEDAKKAYVDLLGQLQPNWKS"
FT                   /protein_id="XP_765594.1"
FT   gene            <138850..>141345
FT                   /db_xref="GeneID:3502695"
FT                   /locus_tag="TP01_0068"
FT   mRNA            <138850..>141345
FT                   /db_xref="GI:71031906"
FT                   /db_xref="GeneID:3502695"
FT                   /locus_tag="TP01_0068"
FT                   /transcript_id="XM_760502.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        138850..141345
FT                   /locus_tag="TP01_0068"
FT                   /gene_family="HOG000135889" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031907"
FT                   /db_xref="GeneID:3502695"
FT                   /translation="MNNDTTVDYSSGYKNLENSVENGAHSLKENTNVNDVDTLLSCINL
FT                   WQKENKENSKLQKLDTFRNIPTIPFNSTNSLLKHDINKINGSINEGFMNLLALKPDLEE
FT                   GKIAEEDLYKHSSGLYTNTLLNFDHKSIISNLNYPIDYYYDKLELAGENARDNASTNEN
FT                   SSDGTMGNEQSEFTSRLRTQTQNPNNPKLSENCEFSNANQFKSVAATESVKSNPKHVEY
FT                   NSINTNSNTNYVNYKSANYENNSLQDQANVDDNYIDEFKGMIGKFINGENYHASNHLTN
FT                   VPNRGFQHDNILTSDNVLIDRDFDEDLENEENPILSMWNRQDAIITERDILVYGKSDSN
FT                   LELLTNSSNDNKTPQNNMDMIKDVSVNCQIDQILNIKEEPEPEKIRGVCFCKSDNSWTA
FT                   WWTEKGKSRKKAFKLSLYGYEEARKKAIEHRLYIEEILPELKEKKFKTAKRKASTMSTP
FT                   TTSINSVSTTNVTPRTDKDEAPAKEEGIFRGTRNRSREKNEENGVYFKDNVWYATWIDP
FT                   FGLRKVNAFPVTKEVPFLAARNKAISAYNMNNFVTNAKNNPQNTYVQSNLNHQNFITPN
FT                   NHFNNSDRVNSPTLNTMNNGTDRPNNYNGLNSNLIYEMSKRRKVNMDSSVGSKTDGCEY
FT                   FKNMEKKIDGDLERGKARATQYSGTENEPATSTQTSQNPQIFLQNVQEYRLPESENVQQ
FT                   PPGTNKRAEAKLNSHHCQIKLERSILDEIEKAINKSLAQNSNQPSESQKINGNGNGSSE
FT                   NNIEKVNEEVQSPDNHRQEGDETLTNDQEEKSGKFFENVNALCISHAGLDKQFSVSIIP
FT                   TYIQGPHQTQLLTFVILNS"
FT                   /protein_id="XP_765595.1"
FT   gene            <142921..>143930
FT                   /db_xref="GeneID:3502696"
FT                   /locus_tag="TP01_0069"
FT   mRNA            join(<142921..142995,143018..143035,143129..143404,
FT                   143448..143562,143601..143686,143772..>143930)
FT                   /db_xref="GI:71031908"
FT                   /db_xref="GeneID:3502696"
FT                   /locus_tag="TP01_0069"
FT                   /transcript_id="XM_760503.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(142921..142995,143018..143035,143129..143404,
FT                   143448..143562,143601..143686,143772..143930)
FT                   /locus_tag="TP01_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031909"
FT                   /db_xref="GeneID:3502696"
FT                   /translation="MFFITSIAPSVPKTVLRSAKYPVCTTRYYNNKKSVDFSRTKMALI
FT                   EKPKSPLLQSSLDNISISQRPLLSFSSETSKNVDSNLIYTTSGSRRSLRKIKKPNFFKI
FT                   THDHRPDPELQAALKRSKLDTSNQDIDYSSITPVPVVYATKEEFSNPIKLWNKYSSLGE
FT                   EFGAIKVIPPEDYTTRLPIDLENFRFKGFSHPSDLWNCDKMIKYDNFLKKQIMGSDDPS
FT                   LESVEKEYWTMVRNADPRGK"
FT                   /protein_id="XP_765596.1"
FT   gene            <144288..>145856
FT                   /db_xref="GeneID:3502697"
FT                   /locus_tag="TP01_0070"
FT   mRNA            join(<144288..144472,144545..144679,144749..144960,
FT                   145032..145169,145199..145353,145467..>145856)
FT                   /db_xref="GI:71031910"
FT                   /db_xref="GeneID:3502697"
FT                   /locus_tag="TP01_0070"
FT                   /transcript_id="XM_760504.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(144288..144472,144545..144679,144749..144960,
FT                   145032..145169,145199..145353,145467..145856)
FT                   /locus_tag="TP01_0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031911"
FT                   /db_xref="GeneID:3502697"
FT                   /translation="MESVLKNYSSLEGEEFALYGLRVQIPPDVLISNGITLYRLVQQVN
FT                   EFVMVWPRTFHCGFNAGFNCNEACNIAPGNWIKMGYKSLVNYKYARKTCIPFFRIILSS
FT                   IPNVMELDATHIKSIVECLSLLISEGSFSFINDFVEFQLRSRLNYPKYQMFFDREVVRN
FT                   LKDLTNYLSHIDRSDFDLELFIESMHNSDTTNNYQFLVSCKEMASFCIKDCDLCDTPTF
FT                   GSSVLCNHINTVVCISCLNYHECDCKTRVVLYRYPLYTLYNIILILKKVYYSMTNENLK
FT                   VDSEYDIPKEDLLIKLDSSSSFAFKDFKRTNHSEAPAHENLKYKCNKIGLIRQNFEDIT
FT                   QICRKLTNSRLKGRKKKLDKIVINDDFIKHSEVSGSSEALAYVTKLSLKYTILALEEDT
FT                   RESQA"
FT                   /protein_id="XP_765597.1"
FT   gene            complement(<145930..>146258)
FT                   /db_xref="GeneID:3502698"
FT                   /locus_tag="TP01_0071"
FT   mRNA            complement(join(<145930..146057,146087..>146258))
FT                   /db_xref="GI:71031912"
FT                   /db_xref="GeneID:3502698"
FT                   /locus_tag="TP01_0071"
FT                   /transcript_id="XM_760505.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(145930..146057,146087..146258))
FT                   /locus_tag="TP01_0071"
FT                   /gene_family="HOG000284152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031913"
FT                   /db_xref="GeneID:3502698"
FT                   /translation="MIPIFLRLSFANLTLLLDVPQLPAIFASNCFHNYRTLSREFKFVT
FT                   NETDDLVYPFNRLNKQDKNTNRMGRPRKYNDSKYINIHPLNINLASTFPFGNPF"
FT                   /protein_id="XP_765598.1"
FT   gene            <147550..>150345
FT                   /db_xref="GeneID:3502699"
FT                   /locus_tag="TP01_0072"
FT   mRNA            join(<147550..149050,149158..150109,150177..>150345)
FT                   /db_xref="GI:71031914"
FT                   /db_xref="GeneID:3502699"
FT                   /locus_tag="TP01_0072"
FT                   /transcript_id="XM_760506.1"
FT                   /product="importin beta"
FT   CDS_pept        join(147550..149050,149158..150109,150177..150345)
FT                   /locus_tag="TP01_0072"
FT                   /gene_family="HOG000135888" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="importin beta"
FT                   /note="go_component: cytoplasm [goid 0005737];
FT                   go_component: nucleus [goid 0005634]; go_component: nuclear
FT                   pore [goid 0005643]; go_function: protein transporter
FT                   activity [goid 0008565]; go_process: protein-nucleus
FT                   import, docking [goid 0000059]"
FT                   /db_xref="GI:71031915"
FT                   /db_xref="GeneID:3502699"
FT                   /translation="MESSFITVLESSLDPESKYFMEAQRKLQLAKESNLPEFINALSEV
FT                   IANHEAGSGPRYLAGILLKNCFEFKTEEEKMNFYKNTSADVLYYLKVRMINVMKTGAES
FT                   QAVLAACTVVARIAQIELSTKSWPEFFDIILTMVDSNDFNQTRSSLICLSYLIEDLSNI
FT                   YENQNVNLLSDLEVNRLLTSVIKGVYIEDPQSCKMALRSLQNLLFFIENNMEVDAERDV
FT                   IVEAICRRCSENNDLEIRTAAFDCLVQLVSEYYSRLIPSLQVIVPFLWQAIDSHVEQIA
FT                   IPAFEFWNTICEIEIQSAANATDRTSSTVRSESTGKSNRDAVEGSIIKQVIPYLLPKIL
FT                   FTMTLHKFEDMDVDTWTLPMAAGICLSLCSQTVKNDIVHSVLEFVTENFKSTEWNKREA
FT                   AVLAYGYIMEGPDSETLKILVSESFDNLCDVLSDTSIAVRDTAAWTIGRIATFHCEVVL
FT                   NHLGSPDVPNSNLSKIVRALFDVPRVAVNICYFINELAEHINDYNKGPTNLLDCMFARL
FT                   CEMLVNRSTMADTLDRNLYVSIYSSLCALIAGVSNNCLTELMALLDHFVVLVSQMITSD
FT                   FSYEQKLKIQSVLGAIQVLVSRVGFVKNLNLLMNSIFEFLSVELDEEALLTLSALVNVI
FT                   EFAQILPFIPKIVDVVLTGLQSEVGICKISIGLTSDVSRCLESPFSTYLDRFMTILINI
FT                   LQDVNGDKTLKPLIIVAIGDIAMAVGGTFSSYVQNTMTLLLQAATTTYEMGPIDNEDWI
FT                   YFVNQLQESSLQCFTGIVYGLKEGGALHLLRPYVSSLLQFAQQVVETPDPFFDTNLYKL
FT                   AVSLIGDLSSSFGSDLSRHLVDSNLIRGIESRLKQLELAQDPGIKDCRDRVGWLHSTLA
FT                   IN"
FT                   /protein_id="XP_765599.1"
FT   gene            complement(<150403..>151096)
FT                   /db_xref="GeneID:3502844"
FT                   /locus_tag="TP01_0073"
FT   mRNA            complement(join(<150403..150497,150536..150812,
FT                   150851..>151096))
FT                   /db_xref="GI:71031916"
FT                   /db_xref="GeneID:3502844"
FT                   /locus_tag="TP01_0073"
FT                   /transcript_id="XM_760507.1"
FT                   /product="orotate phosphoribosyltransferase"
FT   CDS_pept        complement(join(150403..150497,150536..150812,
FT                   150851..151096))
FT                   /locus_tag="TP01_0073"
FT                   /gene_family="HOG000135887" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="go_process: nucleoside metabolism [goid 0009116]"
FT                   /db_xref="GI:71031917"
FT                   /db_xref="GeneID:3502844"
FT                   /translation="MGSESLLLRVPEMKKRFLELCHKYEAYKYGDFVLRSGLKSNIFFN
FT                   SGVLTDCESFDLMTDLMIAKLLESNVEFDAFHGCPYKAIPLVSTLCLKYYKLTGKKVYF
FT                   GYHRKEVKDHGEGKLFVGSPKVFGENSRLVVVDDILTKGTSVSESLSLLKNTPAKVVCV
FT                   LILLNREPNYGEFAKKLDDMGVKFLEVMKLDDLLDPKMYYTQ"
FT                   /protein_id="XP_765600.1"
FT   gene            <151358..>154090
FT                   /db_xref="GeneID:3502845"
FT                   /locus_tag="TP01_0074"
FT   mRNA            join(<151358..152184,152236..>154090)
FT                   /db_xref="GI:71031918"
FT                   /db_xref="GeneID:3502845"
FT                   /locus_tag="TP01_0074"
FT                   /transcript_id="XM_760508.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(151358..152184,152236..154090)
FT                   /locus_tag="TP01_0074"
FT                   /gene_family="HOG000135886" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031919"
FT                   /db_xref="GeneID:3502845"
FT                   /translation="MDISDNHEFPSLDETLLDKIHGFIYPSERYLFNLSNLDEESEFLE
FT                   ELTKNDFKIHLINKEFELSKGKLGSFYKRIESLSFLNSSLDKFLTESNESRYGKFMDTT
FT                   FYTNFSNEFEKTVSENLPKMRKYFNEYKNSTLQNYTKILTGYKRLNSLKGYVSFLQHFE
FT                   EMHIISEYSKKVYVPVIYRILSCVWGINKAKKVSESDPRVLETFFFNFLRDQFSRNTDK
FT                   ILTNIFVKNQYSYDPCDKLLILLILGQSSEKSCGYVIKFLKNELLSITSLTIQKKNDVS
FT                   TQASLICPNLYLVVICKILSEYMSFFQNLTSNLNYESKIMRPSSSKGVNTHISRLNVLL
FT                   KSFDKVDYYLYYRKSLDLFVSKLSLLGDYTFEILSKVLSSFNFNSIHESNDVLKILLLI
FT                   LYYKVLQTDLKVSTNKMEDASMYKHVGLDSELSEILDEFCTKNLAFAKEYGCKDSASGF
FT                   EELERVISTIVSDYSGKLTSESLDNISISLANDKLERIVIDPFKLKNFKMDYFCKIFKS
FT                   FINNGNFISFGNFKFTSQNPYLGWTPNLNFATVNISQLNNLSGYFPGDENKPRLFKNYG
FT                   GVYTVTSKVLLTSYEKYLKLLFLNQRSCLDIAVNLTRVMDEFIRKNVYSCGLDHCVIEN
FT                   LKKFNKVLNSTGEMTERLNRSSVCDTFRQENSEPYGISSSSRTLSESTKSPSDLTRLSQ
FT                   VVNSVESSYTILESLIPLISQNSDKFPEFCKYLTEYYNERNEVISELRVMLYHISMYNL
FT                   LRPKIPSIKLLQALTDNVPLHTDLRKTFGDFNNHLMCLKEFIESADSGSFPIMVRVFIW
FT                   DSVINVIKDSFKPIFNLLNNCSNSDLEKAITGKYSENLKLSTLIRARYVDQIITDYNEH
FT                   RDEIASMSTYYSLVNKLISGLK"
FT                   /protein_id="XP_765601.1"
FT   gene            <154231..>154718
FT                   /db_xref="GeneID:3502846"
FT                   /locus_tag="TP01_0075"
FT   mRNA            join(<154231..154398,154707..>154718)
FT                   /db_xref="GI:71031920"
FT                   /db_xref="GeneID:3502846"
FT                   /locus_tag="TP01_0075"
FT                   /transcript_id="XM_760509.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(154231..154398,154707..154718)
FT                   /locus_tag="TP01_0075"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031921"
FT                   /db_xref="GeneID:3502846"
FT                   /translation="MTATEGLEPEVYQSPLHKNDLVNETLEELRKQKLQSNDTTEFDLK
FT                   PVVDLFTRINEITS"
FT                   /protein_id="XP_765602.1"
FT   gene            complement(<154971..>157269)
FT                   /db_xref="GeneID:3502847"
FT                   /locus_tag="TP01_0076"
FT   mRNA            complement(join(<154971..155638,155693..155984,
FT                   156056..156118,156172..156359,156412..156513,
FT                   156550..156627,156657..>157269))
FT                   /db_xref="GI:71031922"
FT                   /db_xref="GeneID:3502847"
FT                   /locus_tag="TP01_0076"
FT                   /transcript_id="XM_760510.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(154971..155638,155693..155984,
FT                   156056..156118,156172..156359,156412..156513,
FT                   156550..156627,156657..157269))
FT                   /locus_tag="TP01_0076"
FT                   /gene_family="HOG000135885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031923"
FT                   /db_xref="GeneID:3502847"
FT                   /translation="MSENLNHLEGSVQNHDTKGQKSTRLSWKSRCREMQGARWGKKSQN
FT                   SNQRENGRTRFVEGTLFNKEFETYYKDQNICKEDEWETFEEYSRIPLPVSFRLNTSSYL
FT                   WTLTREKLKQMCDTEDLHLEPCVDYCLEYLKNEVDYNIFYQMKTSKSSLRKNEKFAQFH
FT                   QFLMNEDNRGSLCRQETVSMLPVLFLDPRPNENILDFCAAPGMKYLQIVDMVETRLKSQ
FT                   NLDSLKNKGIIVGNDVSQTRVSTLAHHLKTIDSPSTAITNYDATRFPNLYNKNGQLILF
FT                   DKILADMPCSCDGTMRKSIDIWTSWKATNGLHLHKVQLTILKRGIELLKPGGILIYSTC
FT                   SLNPLENEAIASYCASLEDVELIDLEPIKGFKSEKGLLDWLVPNPNGGYFSDFSQVDDN
FT                   MRERVKETMFKNSKWNEEMAKKVMRVLPHYNNTGGFFIFKIRKIPKELNNHELETGIVV
FT                   EEEKKDRKKTRGSKLLHEYTTFEGPERDRLVEFYGITENLNFLVKVTSEKTIHLVSDDF
FT                   KAFKRNKISKLEPCKYASFGSRIFTKLDTKENWDCEFRVTQEGTKLMHKYFSKRKLVSN
FT                   LVFLKELLQGSMPCEKVIEHVKGGNLITIGSTDDSGNLKNGPLLIVAVMNDKVVAREYE
FT                   GQEYITMAAVVTGNKIHLYVKEEMINCLKVLL"
FT                   /protein_id="XP_765603.1"
FT   gene            <157477..>158365
FT                   /db_xref="GeneID:3502848"
FT                   /locus_tag="TP01_0077"
FT   mRNA            join(<157477..157741,157814..157951,157983..158135,
FT                   158178..>158365)
FT                   /db_xref="GI:71031924"
FT                   /db_xref="GeneID:3502848"
FT                   /locus_tag="TP01_0077"
FT                   /transcript_id="XM_760511.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(157477..157741,157814..157951,157983..158135,
FT                   158178..158365)
FT                   /locus_tag="TP01_0077"
FT                   /gene_family="HOG000135884" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031925"
FT                   /db_xref="GeneID:3502848"
FT                   /translation="MPRDDFRGKNFDSPHRWRDDSYSRSNNKFKRKLNIPEGDRSRRPV
FT                   PPFPMPLPDFSGLVPPKDGNMPVLLPGMQLPPPILMNMPLPPPDSDPEEIKKALKLIMS
FT                   NFPGFPKDAKLPFPPVPRQAPYRKKKRRDIPVERAPPTAEDLYELEIDKKLAEAERLQE
FT                   SPVSMFLKVPGLLSKRHLKGSTIDQIERAADRRKLKVRYLEHFDQFKSDREKAHSDLIE
FT                   RVYKEYKSLGLGKIEGVLPLLDGLD"
FT                   /protein_id="XP_765604.1"
FT   gene            complement(158176..>163830)
FT                   /db_xref="GeneID:3502849"
FT                   /locus_tag="TP01_0078"
FT   mRNA            complement(join(158176..158480,158533..158828,
FT                   158869..158978,159101..161991,162076..163661,
FT                   163699..>163830))
FT                   /db_xref="GI:71031926"
FT                   /db_xref="GeneID:3502849"
FT                   /locus_tag="TP01_0078"
FT                   /transcript_id="XM_760512.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(158318..158480,158533..158828,
FT                   158869..158978,159101..161991,162076..163661,
FT                   163699..163830))
FT                   /locus_tag="TP01_0078"
FT                   /gene_family="HOG000135883" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_function: ubiquitin-protein ligase activity [goid
FT                   0004842]; go_process: ubiquitin cycle [goid 0006512];
FT                   go_process: protein modification [goid 0006464]"
FT                   /db_xref="GI:71031927"
FT                   /db_xref="GeneID:3502849"
FT                   /translation="MDDSNDSIAYSDYDQAPVKIAKGLNTGKWLSILSILKNGNNTEQV
FT                   VSLTELSNLLSYSNEDYLLGFPSMAYIKVLFHILENPDVKYSKRYPQNTEKTSESQDDN
FT                   VNLQLPYYHFLSSVYKDDKFLMDKVFTEQGFEDDDKELPEDTKENYSDSGMDLDEEEYF
FT                   EPDSAVFMNKMILSATCLNTILDIVPYTSRYFALNNNLTVLCNKLSDLEYIDLAERILL
FT                   IFEKLSNEIPLSLLRKSVLYHMLQYIDFFPIDIQISSFNSVLNVVRLVDNKDYFIEYLI
FT                   PILNTLSTFIQNDNKKLVDVIISIWKELLAIVIREEDEELVSEFVAKLSENNFLEKILQ
FT                   LILSPNMGRNAILEHVSILSSLVQISTEMVKQLFKYDQLLNIKLLCYSQNDSLQYAFLH
FT                   LANNILSNPSKDYEEVDDFDQHSQVDEPNKPDQTESNETMYVDSTVSESENKTKDLVKE
FT                   QDRDSFFCENPQYFSIIFELLPITDLCDLCYLLSSDRHKASVIGLIYNILRVSNKIEKF
FT                   SQIVHSTLSVSKTTELVSTCLLQVDLGSEDTLNNLLGILEVLINMFGNNVIVTFQRSEI
FT                   VDLIVNNQPDQELNTQNSYNLDSTQDDSDLLFEIRTNFDVWTPYELVKNVPITRLNFFE
FT                   NQESLHKFITTLVSQSFTSTHLHILWKAFLKIFQYPNLYNSSYSPISQGTPTSSNSNNV
FT                   NTNFSNSSSLKTPPLDSEQAPTKLDENSVTKENNTGKADNSENSTDTQTKKSDGVTKSC
FT                   KADQFSKQNEGIHIFGNLDKKYKTGLDGVIKKYVSSYSSHPFNILHTELKLRLRPIFLG
FT                   TKSNVSPTSTPDSSKTPDKLEGKPGSDQQSPVERDSDRLLPISVYVPCLVRLSKVENYV
FT                   KRYIEKKINSKVLDVFIFLNGVCLGSNVTMYEALCRFGGFSPKKRRQIVAHTHLLKYTY
FT                   TLNPDQSTSVDSQNTPKLTEETKNESSLNGNNVKFSEQGLRVYTLYKGNKYNFDSLMED
FT                   FNEFMNIDKVNTVTSLDEVNKFNGAEEEFKLNEQENMLKDDSTMANTARAEEYNNESTE
FT                   VDTNYLEAERLMDIYERNNKMDDLYTKSTTEYLNSLCKQRELEYKNNVSVDESMTNDSS
FT                   SPYNLGLSNPIIYTKLSSETVLDETKTDHLKYLIKLAEFDQDRISFIMGEDNDFRDFLL
FT                   DCAFPIFLGKFPYDKKVLLRTLSIFENLTNKLNPESDLGVLVSDNSQIEQLNGDKTEFN
FT                   GSISGTQDDQSGVGLVVSSPLTMKLLSACSDLSRSLCFGCEYWVQCALSCPSIFSLRSR
FT                   TILFRMNTVGLNRNLSHFHNKLRNLSHDGITEPFDDYLFEYVSNNRVRFIDEDVKIPKM
FT                   KISVDRENLLEDAMLTFEQVQNNPKLEIEYKNEVGIGSGPTLEFFTLISEEFAKFQKPK
FT                   LLECIDGYYFPTPHSTDSLDMDSFTKYLSKSQESESFVSEPFTPLDGSNDGNLPLLLFR
FT                   LFSFLGKVCAYVMLDDKMFDLFFHPLFWDLVKFPNKPQNLTLETLAKIDPELANSLQQI
FT                   KDHPDPSQLHLVHEFKGYELLKGGSNVFVNRENVDEYVRLIVDFKLLEGIKLQIWAFRY
FT                   GFSCVLPLYSLWFFTDSELSEVIFGNKKNQSKFWTMEHLKNYIVPDHGYDTNSKVYNDL
FT                   ITILHNFDDDKRRLFLKFTTGSPLLPREGFKSLVPLMRVVKKGNADELPSVMTCTNYLK
FT                   MPEYTSIEEMKIKLIKAIQEGQNAFNLS"
FT                   /protein_id="XP_765605.1"
FT   gene            <164326..>164622
FT                   /db_xref="GeneID:3503021"
FT                   /locus_tag="TP01_0079"
FT   mRNA            join(<164326..164403,164554..>164622)
FT                   /db_xref="GI:71031928"
FT                   /db_xref="GeneID:3503021"
FT                   /locus_tag="TP01_0079"
FT                   /transcript_id="XM_760513.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(164326..164403,164554..164622)
FT                   /locus_tag="TP01_0079"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031929"
FT                   /db_xref="GeneID:3503021"
FT                   /translation="MLNNRPPPSLDTWIIIASYVRKFPFQVALVLVPFFLVLLMAIRTS
FT                   GRR"
FT                   /protein_id="XP_765606.1"
FT   gene            <165032..>165665
FT                   /db_xref="GeneID:3503022"
FT                   /locus_tag="TP01_0080"
FT   mRNA            join(<165032..165113,165150..165239,165275..165433,
FT                   165658..>165665)
FT                   /db_xref="GI:71031930"
FT                   /db_xref="GeneID:3503022"
FT                   /locus_tag="TP01_0080"
FT                   /transcript_id="XM_760514.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(165032..165113,165150..165239,165275..165433,
FT                   165658..165665)
FT                   /locus_tag="TP01_0080"
FT                   /gene_family="HOG000135882" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031931"
FT                   /db_xref="GeneID:3503022"
FT                   /translation="MINIIICTFKMEPLEQLKGQDSYKYLGVLVSVTMTTGDVLKGELY
FT                   CLDTHKGQTLVIKSEGDDENFTFHILRLSSIINFEVLGRLNDTAGELTRMTYDDFAHFK
FT                   SMVSRNVS"
FT                   /protein_id="XP_765607.1"
FT   gene            complement(<165738..>166647)
FT                   /db_xref="GeneID:3503023"
FT                   /locus_tag="TP01_0081"
FT   mRNA            complement(join(<165738..165785,165838..>166647))
FT                   /db_xref="GI:71031932"
FT                   /db_xref="GeneID:3503023"
FT                   /locus_tag="TP01_0081"
FT                   /transcript_id="XM_760515.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(165738..165785,165838..166647))
FT                   /locus_tag="TP01_0081"
FT                   /gene_family="HOG000135881" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031933"
FT                   /db_xref="GeneID:3503023"
FT                   /translation="MPEHDGDSYLYIQGDYSLDSDFNKSPSSKYNSTNNKLEQSFNRST
FT                   PRLIYSGSINSPQNNKYLSSIHSTSSAFIHQSPNSDISPFSRSDFRIPPYPREDISPSQ
FT                   YSNQDSKITRERSYVFPSVGRSGRSSTCNVTIPLEFDYCTSNSPFNSHNHFVNTTELNT
FT                   NKINNTNKDSNIIKELESQTMEDKTDEDNLLYEAGRDLLLAPEFASDERTRRFLSLSRE
FT                   LYVAMIGVQLVYILTALLFGNVALSIIVTLLMIQSCFCHADGRPVAYIHRMYRDWNPLE
FT                   LSQY"
FT                   /protein_id="XP_765608.1"
FT   gene            <167299..>167881
FT                   /db_xref="GeneID:3503024"
FT                   /locus_tag="TP01_0082"
FT   mRNA            join(<167299..167545,167583..167804,167835..>167881)
FT                   /db_xref="GI:71031934"
FT                   /db_xref="GeneID:3503024"
FT                   /locus_tag="TP01_0082"
FT                   /transcript_id="XM_760516.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(167299..167545,167583..167804,167835..167881)
FT                   /locus_tag="TP01_0082"
FT                   /gene_family="HOG000135880" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031935"
FT                   /db_xref="GeneID:3503024"
FT                   /translation="MTGSGGEFSISEFQKLCEYVSSSDESGELEPNPSASEIPEQLNLN
FT                   PTESSSSDEEIDVNFNDLQSLITESKPKPKQNNIKDIDALFAKSKLNLKKENELKMKNK
FT                   QKAAQLMRHFSKYKDKKGILHPVVSLTIFLEEVVEEVTFKEWHVPLMEIPTREQEPKPK
FT                   RRKQKDND"
FT                   /protein_id="XP_765609.1"
FT   gene            complement(<167930..>168761)
FT                   /db_xref="GeneID:3503025"
FT                   /locus_tag="TP01_0083"
FT   mRNA            complement(join(<167930..168076,168154..168297,
FT                   168354..>168761))
FT                   /db_xref="GI:71031936"
FT                   /db_xref="GeneID:3503025"
FT                   /locus_tag="TP01_0083"
FT                   /transcript_id="XM_760517.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(167930..168076,168154..168297,
FT                   168354..168761))
FT                   /locus_tag="TP01_0083"
FT                   /gene_family="HOG000135878" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031937"
FT                   /db_xref="GeneID:3503025"
FT                   /translation="MAESVTKEYSKKFENSGGSEMSKDHELDSAHDAFTGAKMKSKEDL
FT                   EDPKYKSYTHTVVVKKTPTKGFDNFQLMESEAPVCHLVYEAVDNGSFYLQWKENSKEQV
FT                   EKSVMMMVPTKTVPKFKLTNDGGRSLLSYKVAPDKNKFYSYICQFLKLAKDYNSKFQLM
FT                   PGWNSLLPYKCDLYLHYEDNKVSKVECEHPSIENVNCVAVVGTSTKLSTKMTKEQVVAA
FT                   VRNKGYALSF"
FT                   /protein_id="XP_765610.1"
FT   gene            complement(<168873..>171219)
FT                   /db_xref="GeneID:3503026"
FT                   /locus_tag="TP01_0084"
FT   mRNA            complement(join(<168873..168963,169123..170351,
FT                   170416..>171219))
FT                   /db_xref="GI:71031938"
FT                   /db_xref="GeneID:3503026"
FT                   /locus_tag="TP01_0084"
FT                   /transcript_id="XM_760518.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(168873..168963,169123..170351,
FT                   170416..171219))
FT                   /locus_tag="TP01_0084"
FT                   /gene_family="HOG000135877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: protein phosphatase type 2A complex
FT                   [goid 0000159]; go_function: protein phosphatase type 2A
FT                   regulator activity [goid 0008601]; go_process: signal
FT                   transduction [goid 0007165]"
FT                   /db_xref="GI:71031939"
FT                   /db_xref="GeneID:3503026"
FT                   /translation="MGHMFSRSPTRKNDHAQYRAGTPSSTGRLSDDTPASVKSERRGWF
FT                   SRLSDSSSMRCESVTSKSMGSNSPKSCGESYLVDSSVGSLSLSPLSLRGFEDEVQDHME
FT                   PHQLRPYNPQWDKYRNERPFRSDSKDTIMLNDDIIEVGYRYHTVPFASSSDESDFEVKH
FT                   ASGINLSQATYDNNIWFYDEDSNKEQKRVVKERNFFSIRNKLNNMHKASQSKSFKLMGQ
FT                   KGQKSPPQRLEDAKPQESPNLEPFSPKPKPSITSREHTVIKLSNQSVEENVIYDVDPEY
FT                   NKSIEEVFSMPLLRDTPSANRPELFQKKLIACQTVVDFDPKKQMQKAIELKRQVLLEIV
FT                   DYISTTRNSINERILQDVIDLLSANVFRSLPQNPKKRNIYDYEDDEPTLEKSWPHLQIV
FT                   YDIFLRVIVSNDVTSKMARNAIDKTFVLKLLATLNSEDQRERDYLKTILHRIYGKIVPL
FT                   RNFIRKAIENVFIHFVYDTEVHYGITELLEILGSIINGFAIPLKEEHKHYLRKALAPLH
FT                   KPNSLRTYHAALTYCMIQYINKDRTLSATILTCILNYWPSTNTQKEILFLNELEEVLSL
FT                   TELPEFNLVLNQLLKRLKLCLSCTHFQIAERTLYMWNNERIMRLFNMSKATVYPALVPI
FT                   LNENSNTHWNSVVRTLSFNICKLLNETDSQLYQKSMESNPLDICSDEHSGLWDKLESSF
FT                   MNRGNTDHSTLVN"
FT                   /protein_id="XP_765611.1"
FT   gene            171777..171849
FT                   /db_xref="GeneID:3503415"
FT                   /locus_tag="TP01_1238"
FT   tRNA            171777..171849
FT                   /db_xref="GeneID:3503415"
FT                   /locus_tag="TP01_1238"
FT                   /product="tRNA-Phe"
FT   gene            172144..172215
FT                   /db_xref="GeneID:3503416"
FT                   /locus_tag="TP01_1239"
FT   tRNA            172144..172215
FT                   /db_xref="GeneID:3503416"
FT                   /locus_tag="TP01_1239"
FT                   /product="tRNA-His"
FT   gene            <172385..>173258
FT                   /db_xref="GeneID:3503417"
FT                   /locus_tag="TP01_0085"
FT   mRNA            join(<172385..172478,172518..172579,172609..172674,
FT                   172742..172829,172859..172944,172986..>173258)
FT                   /db_xref="GI:71031940"
FT                   /db_xref="GeneID:3503417"
FT                   /locus_tag="TP01_0085"
FT                   /transcript_id="XM_760519.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(172385..172478,172518..172579,172609..172674,
FT                   172742..172829,172859..172944,172986..173258)
FT                   /locus_tag="TP01_0085"
FT                   /gene_family="HOG000135876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031941"
FT                   /db_xref="GeneID:3503417"
FT                   /translation="MGDLYNQYNSQIQVTLESIKDKVKLCKDNPNSANIGVYLAELDNL
FT                   LKSSEQTLMQMELEARSYSDSSGFERLEQVKEIKNFLKEASDCSRSFHTELQRRELLGE
FT                   VSSFGNTREFKTFSKNREMLSKGLMFIKTSCDVANEAERLGYDASKNLSQQRNVIDSVS
FT                   SELTRAKFSLSGADEYLCCLLKQGRLNRVILKTVQIAIAVTVLIILAIRLIKFLMLKPK
FT                   "
FT                   /protein_id="XP_765612.1"
FT   gene            complement(173333..174532)
FT                   /db_xref="GeneID:3503418"
FT                   /locus_tag="TP01_0086"
FT   mRNA            complement(join(173333..173479,173530..173654,
FT                   173744..174040,174147..174532))
FT                   /db_xref="GI:71031942"
FT                   /db_xref="GeneID:3503418"
FT                   /locus_tag="TP01_0086"
FT                   /transcript_id="XM_760520.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(173342..173479,173530..173654,
FT                   173744..174040,174147..174429))
FT                   /locus_tag="TP01_0086"
FT                   /gene_family="HOG000135875" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031943"
FT                   /db_xref="GeneID:3503418"
FT                   /translation="MNDINQANHSSQPKPYYTFDDPLNEKKLRVWVGSIPGFVETDDLL
FT                   MALQVAGVPPVSEIVFKKCPIRSWGFLTFKTFEDASECIQLIHGKKLFEQSDYTIEARF
FT                   ANPHESGQKNENYRNHSSGFLSDAHRTSLINSLTEESYDLLQDAGRTTLWHVYKDENGV
FT                   PYYYNSITGHTQWERPIPPLLAVEASTSFMSDRNRLNAPPGSNLFIFHIPNVWDDAELS
FT                   MHFTPFGNLVSAKCKLLAGFGFVTYDNPISASAAVHLMNGFATHSKILKVQHKSNNNE"
FT                   /protein_id="XP_765613.1"
FT   gene            <174794..>177538
FT                   /db_xref="GeneID:3503419"
FT                   /locus_tag="TP01_0087"
FT   mRNA            join(<174794..175665,175736..175913,175974..177254,
FT                   177350..>177538)
FT                   /db_xref="GI:71031944"
FT                   /db_xref="GeneID:3503419"
FT                   /locus_tag="TP01_0087"
FT                   /transcript_id="XM_760521.1"
FT                   /product="adapter protein"
FT   CDS_pept        join(174794..175665,175736..175913,175974..177254,
FT                   177350..177538)
FT                   /locus_tag="TP01_0087"
FT                   /gene_family="HOG000176133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adapter protein"
FT                   /db_xref="GI:71031945"
FT                   /db_xref="GeneID:3503419"
FT                   /translation="MAKLERSLKIPPGTDAKLGNNYLNNHNGGDSDDFRSNEDEIMDLA
FT                   TLYDKQFHEVIGRDPYRCKPWIEHVNLLKSLRPPRKTRQLYRISDIWKLNRVDQAPEQG
FT                   KTAVLLGDVSYENINNKIFKAYEKAVKYIPLSYKVWYNYVKDLVEDLSEPFVSNPQAYE
FT                   RVNSVFESCLIHNFAYPTFYLLYGAFLRFQHRITKVRRLYDKALLNIAITQHHLIWDEY
FT                   LRFVNEVDLLPLGKAVYRRYIQLKPSYREVLYEFLKRHGSYDDAAQVLYKLLNDHTFAS
FT                   ESGKSSYDLWIELCELIRDHSDAITSIPVETLIKEGIGKYTDQVATLWIILADIYIVRG
FT                   QLNIARDTYEEALDRVTTVQDFSIIFDVYAKFLENYAKQSNKLGYVLINNLHLHYIRTD
FT                   HLETLMTVERLESLVNNRALLLASVKLKQNIHNVYNWINYIQLFKDDPNRMVEIYAEAV
FT                   QTIDVSKSVGRVTELWSRFATFYEEREDLENADKIYEKASNSDFKYVDDLATLWCCWVE
FT                   MYLRHKQFKKALEISRRSVSGNGKTSISRRLHSSVKLWTLALDMEQNFGTIETTRATFN
FT                   KMVELKVVTPQVALSFAGYLEQNKYFEASFNAFEKCVVLFKWPQLYYLYLPYLTKFVRR
FT                   YKGTKLERAREIFDQCLYNRELKVPPKFVKYLFYLYASMEEEYGMVKKFLSILNDACKL
FT                   ADKEDQLTLIKFYVAKTCEFFGVTQTRQIYQQCLEYVNDDVARELCSMYIHMERGLGEI
FT                   DRARAIYIYASQISDPSTYTDFWKGWREFEVLHGNEDSFREMLRIKRSVQAQYSKVYYN
FT                   VEEVGQDDDDEELEENPLTELEKLSKT"
FT                   /protein_id="XP_765614.1"
FT   gene            complement(<177557..>179500)
FT                   /db_xref="GeneID:3503420"
FT                   /locus_tag="TP01_0088"
FT   mRNA            complement(<177557..>179500)
FT                   /db_xref="GI:71031946"
FT                   /db_xref="GeneID:3503420"
FT                   /locus_tag="TP01_0088"
FT                   /transcript_id="XM_760522.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(177557..179500)
FT                   /locus_tag="TP01_0088"
FT                   /gene_family="HOG000134865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031947"
FT                   /db_xref="GeneID:3503420"
FT                   /translation="MTPITDDKNHPTDVPPENCELVTLNLNIKETTDKLEYFSRNSCRE
FT                   YSSYPGYIFNKVLEDDTPIWEANNINEFSKNLLVYEDSCDKYILIIPHDSNLVLLHQLK
FT                   NNTWESVNTSINLNKMKMIERTGHEFVLEYYITEDCQGHKGHKLVRFDHHYYDLNNHNF
FT                   KIIFNNLCDRVFYDNKVVWNYRDDPFRPYPEYLNFNLVDKTVTALLRDGSSIPLYLNDT
FT                   VLKRPRDDSELENSQKRMKIDNSEQLNVCVYDYEKINSGYKMPLKLIPLDTDFIMSTNE
FT                   FITICNRTGRFYGSRKGFVFNKLIENGKVFFETDDPEACTPCFSAEYVKKSNKYESGDK
FT                   TSKKRRLEFFKYTRPNVDMLKFYTKNDSELSPDDYTVEYTSFMYKVTFLKDLYKIIHDG
FT                   KVYWSYDNDKSYGFPTSVYFTDVDTDMKLTFSNGVEEVVDFTLELLKMYKNDEFGNKVE
FT                   MDSGDYKVTKPERDQRLFTLKQGVRCIDVSYDRETIWRYNPNKGYPKSIFCDYSDCEII
FT                   LRFDKFFILFEQNENSEWELSLCSIPRHLKLYTKDKNSNYVLMNEDHYKLETNLARTTL
FT                   YKLKRGIMCSLVKYGDQVVWEHKEYEPYPEKVSCVLGLNSIRICSGDKYIAFESKRGLW
FT                   SVKHYMFRLNKK"
FT                   /protein_id="XP_765615.1"
FT   gene            complement(<180050..>181333)
FT                   /db_xref="GeneID:3503421"
FT                   /locus_tag="TP01_0089"
FT   mRNA            complement(<180050..>181333)
FT                   /db_xref="GI:71031948"
FT                   /db_xref="GeneID:3503421"
FT                   /locus_tag="TP01_0089"
FT                   /transcript_id="XM_760523.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(180050..181333)
FT                   /locus_tag="TP01_0089"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031949"
FT                   /db_xref="GeneID:3503421"
FT                   /translation="MLVPQLISLGDTMHAELTHINIPFNIHRHYYKTLCEDYAKIFVSI
FT                   AAKKIIPVSKTSFLNCIKALPTLETSPPAVSTELNQATHMLMNLPVNNELWSVVSDFLE
FT                   KSKMCPSLFKQICSIVSSALETVFGNISQIKSFKGTKLSLSAGGSKITLVKPNDCQVLN
FT                   AKLFQYVFTIVDGIESNLGSLITPDSNLSKVLEYGKAIELVSSWSDDASDTIWHILSYI
FT                   SVDNMEFNWTCQQVSISTNNIIKILNFLKDSYFDPLLPVGKTNLLLKFCSATVASFLVY
FT                   SITTWPLNDDEKLTMINFTTELEFTLSDVLHQKLGHPESYHISFLKRLVYLSDHELFSV
FT                   FSQGQTPLTKDVLLLHITVRILRDNSVNTSLYKHLNYNSVHFMLASFRNSLLQGHESEN
FT                   FEKLGQFLTTLSINSPLYSDLIPYLTGF"
FT                   /protein_id="XP_765616.1"
FT   gene            complement(<181403..>182677)
FT                   /db_xref="GeneID:3503397"
FT                   /locus_tag="TP01_0090"
FT   mRNA            complement(<181403..>182677)
FT                   /db_xref="GI:71031950"
FT                   /db_xref="GeneID:3503397"
FT                   /locus_tag="TP01_0090"
FT                   /transcript_id="XM_760524.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(181403..182677)
FT                   /locus_tag="TP01_0090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031951"
FT                   /db_xref="GeneID:3503397"
FT                   /translation="MDLSPPPFFDIQLEGLSLDSEVFNTCQRILHSYSTGAESHIGDRG
FT                   DKSTYKLQDEEPLRPSPSYISSLIKTGPEAIKKELEKLSHCLSTLDSLMNKVLLNHTTE
FT                   IVQSFEEVNDYTATLDSLNLDLNHLNEGVICNYRGILSFFNTVEADTTSLERLRSLYLY
FT                   SLECRRIILFLEDLHERSKRLKSSVKDFLEMLLISSKCMMCLDKILTLEKTEGILKIMQ
FT                   YCEDLKNYIVKFVYNYAYSPLFELSGAQDGSTLNQMNLVEPDKDIEKIVVISHVIYREL
FT                   SVSSKGMLELVENLVYDCSSCIDMAEVMSESNYEEWQGIFMSQVSQFFLKYVRNQKSLY
FT                   FICKCTKHSLLEKLDKNERETISHYLETYVHEDQKEPFSLLELYTKRSIAFLQSTLSKL
FT                   YSNDRYLSHAIHLLYCQLVTTKYII"
FT                   /protein_id="XP_765617.1"
FT   gene            182905..>184249
FT                   /db_xref="GeneID:3503398"
FT                   /locus_tag="TP01_0091"
FT   mRNA            join(182905..183018,183049..183266,183312..183382,
FT                   183413..183439,183512..183539,183570..183598,
FT                   183628..183978,184056..>184249)
FT                   /db_xref="GI:71031952"
FT                   /db_xref="GeneID:3503398"
FT                   /locus_tag="TP01_0091"
FT                   /transcript_id="XM_760525.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(182935..183018,183049..183266,183312..183382,
FT                   183413..183439,183512..183539,183570..183598,
FT                   183628..183978,184056..184249)
FT                   /locus_tag="TP01_0091"
FT                   /gene_family="HOG000135874" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031953"
FT                   /db_xref="GeneID:3503398"
FT                   /translation="MSGSFSEPYGNSCDSEEGWFKLPEGWRMHRTVLYRSYKDPKPSTS
FT                   FAIYDMDNTLMITPSYFVEELKKGVQIQISKPLIPNDFVLFAPNVKEKLHYELNQGRGI
FT                   LIISNQRGMLENIPSAYLILERIELLLRELDVPLYILLATDHDIYRKPAPGMLLFFERN
FT                   LNGGLPVDRDNSFFVGDAAGRRLDYKSSSLMMRNILSVLKSTDYSTRRYYNVDENGTIV
FT                   YINPYEIIKRLTISKMKNRFSKDFSDCDFKFAINNSLTFLTPDEYFYGVPEYNIKLDFD
FT                   PLLVGSKPFFPVVLSGLIILIGNLASGKTHISRIFRNFTPMSQVLKTIFKNM"
FT                   /protein_id="XP_765618.1"
FT   gene            complement(<184822..>193265)
FT                   /db_xref="GeneID:3503399"
FT                   /locus_tag="TP01_0092"
FT   mRNA            complement(join(<184822..185306,185379..185834,
FT                   186026..186646,186741..187233,187403..190290,
FT                   190385..>193265))
FT                   /db_xref="GI:71031954"
FT                   /db_xref="GeneID:3503399"
FT                   /locus_tag="TP01_0092"
FT                   /transcript_id="XM_760526.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(184822..185306,185379..185834,
FT                   186026..186646,186741..187233,187403..190290,
FT                   190385..193265))
FT                   /locus_tag="TP01_0092"
FT                   /gene_family="HOG000135873" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031955"
FT                   /db_xref="GeneID:3503399"
FT                   /translation="MAVGKMRRAPDSGVSNAVSTIIEHQKFKKMLVFGLRSLSDLCNPS
FT                   NQLYVENALYALERNVVKGILTAVENFGDDEDLVLCSTVIMSTMSKGCLEYREDSGLLK
FT                   KLVTDGGVDVVQKALERAPQDEDVLDNCIKFLENVSNLEGLGNRGSEFVPHVCKSMEVV
FT                   KSYPVANRLVLCLSNLTNQSESCFALKNNQGIQPLLDLCMKFLTNDKSATLVENCFKTL
FT                   LALSQLKLMEESNLQAVMNLVESCKDSKVVLSRASEVIKSVVDTAKLQNSLKVLEKNDY
FT                   DSPEYKVAVNTLRSLSYISTMSEELAKKGVIPILLKLLSDSSEKLGAGEAKLGASGEQL
FT                   SEVVFGASRMLASISSSSSEYGQQVLSNNGLDVLVRALSQSIQYPRSVVGLSSVLVQLL
FT                   KYEPKSFGNAVSVALPILYQLAEDEAVSHALVEFLLASSQYSELENVFIQNKVLEILST
FT                   CCQYHTSNLAYQFNVVSILNRFSRFIDNLKLIHEYGGLQGITFALDQNYKDLKYCLEVL
FT                   NFVSALASTSNAQKYLTTGDYLIADVILELMLHYRDNEPVIDLSVKILELVLEEKDVEK
FT                   YAKRLNSAMPNSVKDPDGTFKALTALTGVHKISRLRPLLSKYNPLNGVLTAVTEWLDHN
FT                   GGPEWVKQRTNLTRAALSLVVVCQTNEEIRETLLTVSELACVYQVKKVIDLEQSDDNFL
FT                   LHCTGAMVVLCAMDRTYDESEVQEAVECVSKVMKRHQDVRQAQASLLEALNKLMEQSDR
FT                   FFLSAILNTGCLALIVKYLSTVPMYLNLQILGIGLIYKCSQLDPQVVEFLKSSNCFQLL
FT                   RAVNRTHTKNKKLRAIVGSLLSLLMPADALESELDQLLKDLVNYVTDKDAEGVNTCLVS
FT                   INQLLVSKEAVKAAVMLNIASPVNKALDWTLANPKLYTGEENLFEPTLAEFSLVGLNVL
FT                   AFRTGLVYATKNSVTKFFLKLFTSLTSNSQVMMEDGVVSTLDGLSMLFRHDVANIDEAL
FT                   RDDLLSKLSSCFTRILNSSSVVSSVCRCLGSMCASPGKLDKLLNNSNFSKFCNYLVDNL
FT                   SSPQTTGSMDKEKVVENTLVALNELLGTKYQALIDYFDKNTKIVASLVGLLEEYYKNPE
FT                   IVVPASNLLSYFDKKVVLSRLPNLSSFLETVSKTLVYNKADVSAVVALLSLLVHLLDDS
FT                   NKEECKKTSVVESISTVMLMHLENEEISRLGGILFSLLGAECQISALMRNVIQIVEAKE
FT                   ENMGQKVDKLCLILAMYLGSELKERSEALKHTEPFLSSLNQCVSFLADNSNLLSSTCCV
FT                   SRRLCDSAFEDHEDPFGAWSVASSSNLAQISSLVKSEYGYSNLKFLVNAFRVFTACVYN
FT                   GYTVDTMLAEAPGLMVRTVQVLERYKENSELVFNVLEYCMYLANATGSDPATTTPGVQV
FT                   LLENFGNPVDLITSALTVNKNNESLLVTGFNLLAELVSSTKNLDSNQVFNSVETCLKLA
FT                   KAVSSKGNTVDKKLPQNSSQMGKNALDSYVHYFNSAYMNGYLNDYMSGDVVSNMVMMFE
FT                   GNNFEGLSPVQFALFVLNSATAGEMAQLERLGVVQKLLGLFEGLLQSDKTLTKEELLQL
FT                   LSGLSEAVNRDAIKAVLVFKELFPKIKSNEVLNTDPEVVSLLLNSLIQATGVKGVGSLL
FT                   HSVEPFMKYLDVVSKVCPDLVNKLMTLIKKDLPKKKTCETVYQNLTELTNSGSSDESVT
FT                   PDYSTVTLENALMMEDFRFVSDLLLKYNGKVQKPGDTECKDFGFGFKCVDVWSRCEGNA
FT                   SMMAKSGLSALLVSALAKQSDLVLMDALLVSLCSCCKQKDLLLSFVSNKELVPNADSFL
FT                   AKAYQKRLVTTGADRNVNIDSAYENVLFNSMLLIDLTAVNRKVYLKSNVIPSLMEVWSL
FT                   HDQNKYSSTKILRQVFRTLRKIVSDQNVQLMVKCKLVPRTNKVFSQLTTIKEEICSVQL
FT                   LEKIIAVLDRYVKSGSSSAIVTNCCLALANICVDFKTASDKFCTLHGPRLNLEVFVNFK
FT                   SNFEVVNGSSILLCNLLYKNDKLKELYGKNGTPSALVECLMNFVASSEPTSLRCLESLF
FT                   KAISNLGLYTKNLQYFMEAHIESPFKKWFNKVVHTKEYDVGLVKVGLNCLSNLVVENNG
FT                   DYMKRFGVILEDLVSMLNSEFADGKVVFLVLDVLNNLCRYKDNAGRFVELEGVFAVVKN
FT                   MRRLSYDVEVLVTGIHLFRHMAHGTGAVKLLEVDIFSLLLDILVQANELNDVLISSLRC
FT                   LRRLIHSPEMVYLLCSQDGLDTVIKCSSRMKDQSSVLVESIRLILGMLYYTDPYTGGHT
FT                   PTKQSDSDESTGVSDAESDYGWENIGMTATTIVEVIKFSCYVASQESCLKMSRLQSSVV
FT                   SLCVYFMSCGLCGEELAMNGFSLILENFISNFCLTAPNLALLAVAALESSFNYPPDLRS
FT                   SILTKPIQKKLRDLTLVITDKQTKAKLTKLLEHFSNNTQPSVIGKFDLGLSEWNVDPYP
FT                   NGVHDLPESMKEMLRNGGKFHLVTEGDEEVKRRLKRGKEFEYSWRASQDLLTLEWTHDA
FT                   LQEKNKIAFMRVRNIARGLKHDLLAKANQKDYKRVSNVNTLVLLGSCTEEFPQGFALPM
FT                   VFKNNHEREAVAEAFIQWRDASSFN"
FT                   /protein_id="XP_765619.1"
FT   gene            complement(<193898..>194686)
FT                   /db_xref="GeneID:3503400"
FT                   /locus_tag="TP01_0093"
FT   mRNA            complement(<193898..>194686)
FT                   /db_xref="GI:71031956"
FT                   /db_xref="GeneID:3503400"
FT                   /locus_tag="TP01_0093"
FT                   /transcript_id="XM_760527.1"
FT                   /product="cytochrome c oxidase subunit II precursor"
FT   CDS_pept        complement(193898..194686)
FT                   /locus_tag="TP01_0093"
FT                   /gene_family="HOG000135872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c oxidase subunit II precursor"
FT                   /EC_number="1.9.3.1"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   copper ion binding [goid 0005507]; go_function:
FT                   cytochrome-c oxidase activity [goid 0004129]; go_process:
FT                   electron transport [goid 0006118]"
FT                   /db_xref="GI:71031957"
FT                   /db_xref="GeneID:3503400"
FT                   /translation="MLTYSGITRRLFQSSLLKNTKFQTPQSHFGILYPNHEISQRHIFT
FT                   SRLLLFTTKKEPEANNSTSDESSSVNMKNQKQFTHVSETFGPGKYRGTGLPKPVGQPED
FT                   LPSIEFGKPTGMYNFVRHQHGDPRDHLREDGRFKEKYATDGFHWYDAYTDVPKQRRTIV
FT                   NGEAMVLGVETRPMEELFGVEQTNVPFYHRRRLNLWGDHKNALRAEFCFFWIPTFIIFS
FT                   LAIPCYTMLYMLDESVYTTMTVKVIGHQWYWVYEVESPPV"
FT                   /protein_id="XP_765620.1"
FT   gene            <194904..>195681
FT                   /db_xref="GeneID:3503401"
FT                   /locus_tag="TP01_0094"
FT   mRNA            join(<194904..194940,195368..>195681)
FT                   /db_xref="GI:71031958"
FT                   /db_xref="GeneID:3503401"
FT                   /locus_tag="TP01_0094"
FT                   /transcript_id="XM_760528.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(194904..194940,195368..195681)
FT                   /locus_tag="TP01_0094"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031959"
FT                   /db_xref="GeneID:3503401"
FT                   /translation="MCIPNPYKTMKYGIFDSHLASKIQPQCVGVPFSFKSKNNFSTSSE
FT                   GRVTWEDHEEIAELLYTEFKSTNPLTLRFTDLHEMVEAVVRKHHFCEISGECSEGALEQ
FT                   IQMTWLELYEQD"
FT                   /protein_id="XP_765621.1"
FT   gene            complement(<195835..>196596)
FT                   /db_xref="GeneID:3503402"
FT                   /locus_tag="TP01_0095"
FT   mRNA            complement(<195835..>196596)
FT                   /db_xref="GI:71031960"
FT                   /db_xref="GeneID:3503402"
FT                   /locus_tag="TP01_0095"
FT                   /transcript_id="XM_760529.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(195835..196596)
FT                   /locus_tag="TP01_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031961"
FT                   /db_xref="GeneID:3503402"
FT                   /translation="MKSLIFGFLFLKLSLCSTSGFELDVSTKYHDPNAVVTTELKLEAE
FT                   TRAGPSVKTVVLYASMYDDGFDKVKDGQKPIWEPETGFKSDYVKVFYKGLAPEALKVGL
FT                   LDKNTLTYNAEDHYARFYLKKDQDWAKVDADEYFEFLEKNEYKNLVHKEFEKDEKFEKP
FT                   DDECIIQVGRKYTPDEVQAFKKLSDSKGLVKVDPLVKPSESEDTNLRRRQGGSDSSPAP
FT                   TEPGSPDKKGSSFLTASLLLPIVLLSCTLFN"
FT                   /protein_id="XP_765622.1"
FT   gene            complement(196823..197844)
FT                   /db_xref="GeneID:3503191"
FT                   /locus_tag="TP01_0096"
FT   mRNA            complement(join(196823..197016,197099..197152,
FT                   197221..197531,197562..197619,197653..197844))
FT                   /db_xref="GI:71031962"
FT                   /db_xref="GeneID:3503191"
FT                   /locus_tag="TP01_0096"
FT                   /transcript_id="XM_760530.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(196840..197016,197099..197152,
FT                   197221..197531,197562..197619,197653..197772))
FT                   /locus_tag="TP01_0096"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031963"
FT                   /db_xref="GeneID:3503191"
FT                   /translation="MQGNRAFLADLANFLEFVEQGIMNKTVDLTDLVQTTNLNQCFKMM
FT                   DSMLKECETGVSAQELSELRNRINVARETVEMIGSSGTLKNTDQIYGDMYLIDQNNSER
FT                   ENYERYGANLGMTNEEFDKLIEDWAEDLDTSQKGPRRRRANKPENFQEQIQGEIAELAN
FT                   EMKSKVARYRDIIVKDNKALLNFTGEQEKQLDTVTHIAKESNKLTKSANISLRQFIIMV
FT                   VTMFALTLAMFFLFLLS"
FT                   /protein_id="XP_765623.1"
FT   gene            complement(<197894..198852)
FT                   /db_xref="GeneID:3503192"
FT                   /locus_tag="TP01_0097"
FT   mRNA            complement(join(<197894..198002,198040..198127,
FT                   198203..198247,198370..198414,198444..198506,
FT                   198600..198663,198695..198852))
FT                   /db_xref="GI:71031964"
FT                   /db_xref="GeneID:3503192"
FT                   /locus_tag="TP01_0097"
FT                   /transcript_id="XM_760531.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(197894..198002,198040..198127,
FT                   198203..198247,198370..198414,198444..198506,
FT                   198600..198663,198695..198790))
FT                   /locus_tag="TP01_0097"
FT                   /gene_family="HOG000135871" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031965"
FT                   /db_xref="GeneID:3503192"
FT                   /translation="MKRRILINEFNFNGVTITWSVSVLLSLSHLITSLKLTNLHCERYL
FT                   VVFNATCAATILVFGSLVSLAVSLRIPATILGQILQKIGFEYIKRVIAFASLASFKPLT
FT                   GFFKAISASKCKDLKSIYYYSTVALNCLDLFFMSCVTWSMMRRRYYKSFSNTPEYNKIK
FT                   SRLKKN"
FT                   /protein_id="XP_765624.1"
FT   gene            complement(<198859..>201270)
FT                   /db_xref="GeneID:3503193"
FT                   /locus_tag="TP01_0098"
FT   mRNA            complement(<198859..>201270)
FT                   /db_xref="GI:71031966"
FT                   /db_xref="GeneID:3503193"
FT                   /locus_tag="TP01_0098"
FT                   /transcript_id="XM_760532.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(198859..201270)
FT                   /locus_tag="TP01_0098"
FT                   /gene_family="HOG000135870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031967"
FT                   /db_xref="GeneID:3503193"
FT                   /translation="MKQEEPRKRELRKTSAHGLMTRGKYHKLQEKVPPKVVQPEGMDEE
FT                   SFTAKIKETINQGDSEKYANMTGTWFPQQMWPPGQVMGLPDGQKMIPKQPNFFIPPLHP
FT                   QLAHQIHPQMGHMGPQIQHPQMYPGPMGHPMPNMGPMPMQHHNQMTQKVGNQIPIQQIN
FT                   PKMPPMGQMVMPGMRGVQFSPKSSQPGPQIMPKNIPTMQNMPPLPQMGGIGGMSTMPGM
FT                   QNMFNMNNSMYAPMYPRIGPKSPSYIKNQVIRNRYSKPPAPSPKNMDAFLSETLEPDEK
FT                   TDWKVVLREEITKMLKSELTRFNDLHDVSDIFPGSNLGDKTYFTSKQDKTDNKKDKKND
FT                   KDKKDETDKPFNYVDLEKIVDVLIDKFKPVMEEMWKESKRYHQYALDQFYYLLTQGSNT
FT                   LNITNQGNIQIMAPYRNKSNNEEENFKKEWSIEEELESKDKNSDGSELVVLRDLTGLKS
FT                   LFQKRDEIEKLLTSYRTISRSSFGNSYFTFSNFTPGPIPSETVPNLSNDKREDEFLKQA
FT                   IEYADVASNQKLLVNNVTALDLRSALSGDNMQNYLPNPYRSGLLETVNLIHFDLGTPPQ
FT                   SPKFSKREPEQDTVLNKVYETLQSFQNAEANTIKPPSNNISFAKFMASYTPYSREDRLK
FT                   ELLSSQGPINKGFNLQPTMKMYPNLPTNMGLLHPSMNTIPTSMANSGGNIPGMGPNIGN
FT                   FPPPMSSMQMNMDQIPNMPPNMNGIPGNMNSMGGNMNSMGGNMNSMSSNMNSMSGNMNG
FT                   MGGSMGNIPVHQGHPQNFNIPSGGVPQQMQMPMPNVPPHIQAGNNQFYNK"
FT                   /protein_id="XP_765625.1"
FT   gene            complement(<201664..>205011)
FT                   /db_xref="GeneID:3503194"
FT                   /locus_tag="TP01_0099"
FT   mRNA            complement(join(<201664..202055,202126..202596,
FT                   202686..202946,203015..203321,203385..203453,
FT                   203502..203696,203801..204150,204211..204447,
FT                   204497..204670,204739..204795,204825..>205011))
FT                   /db_xref="GI:71031968"
FT                   /db_xref="GeneID:3503194"
FT                   /locus_tag="TP01_0099"
FT                   /transcript_id="XM_760533.1"
FT                   /product="vesicle transport protein"
FT   CDS_pept        complement(join(201664..202055,202126..202596,
FT                   202686..202946,203015..203321,203385..203453,
FT                   203502..203696,203801..204150,204211..204447,
FT                   204497..204670,204739..204795,204825..205011))
FT                   /locus_tag="TP01_0099"
FT                   /gene_family="HOG000135869" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vesicle transport protein"
FT                   /db_xref="GI:71031969"
FT                   /db_xref="GeneID:3503194"
FT                   /translation="MASNWPNPKQGLTSRTSNPFPNVQNPVHQTPFANPVHPPTHPPVN
FT                   PPPTAGGYAHNLPQTFPGQQFPPGPGVPPVYNPNQSGLVNRSGLGNAAYANPPSVHFTS
FT                   SLEYSSQVPPAFSEPPPAPVPPPKLEELNKAQSGQGVTTVRPTSKSHTGQVFHDNFSAT
FT                   STVGYKSDEEVLESVVLANTTKNFVSLSVGTLPSTDQLHQKSGITLSYTITPLNSVETV
FT                   PLVNHGNESITRCKQCRAYINPFVRTDPSKRFWICNLCDTSNELQNRYLSSFNQYPGSN
FT                   QQNELELSCGVVEFMASADYTVRPPQPPSYLFLIDVSSNAVNSRMLEVVCKTIKELIMG
FT                   NEFACDNRTLVGLMTFDSTVHFYQISKGPQNYQLLIVSDLEDLFLPLPGEVLLNLQESS
FT                   QDFLRMLDLLPSLWKNTTTTGSALGSAIRSAHYSMKHVGGKLIVFAASPCTFGDFSITS
FT                   AQKAESAPQSSNVLNMNKKPTSKIHPLEKCKDFSCMMCQTQTTLDLFVCTPQALNLDKL
FT                   QYMSTLTSGNIYYYPYKNHAENYKLVNELKHLVRRTTVWESVMRIRLSKGWKVTNWHGN
FT                   CFVRGSDLMVLPTTSEDHSYTITFVPDTSNSSNTSSAGKKVMYIQTALLHTNSSGERRI
FT                   RVFNTAVGISNDLGTVLNSVNVESLVFNMLLGAIKVYQTSGKMVDARNHLTTHCSRVIS
FT                   SMSILGSTVDLSRVLSLYVLGLLKTTLFTDDHNQDYRVYLSTKFRSCKIDQVILYAYPQ
FT                   LYNLSNELNSHELLLQGLPLSFESLLQECFYLLFNGEYLLLWVGMNVPNNLLQSTFDVP
FT                   SFEQLNATLVPLALEQSTSSNAHKVKVCLETLRARLPPYVPLMVLKQGEGDALFYASLV
FT                   QDKTQGMMVTFQEFYQSMQPTSTLGIKR"
FT                   /protein_id="XP_765626.1"
FT   gene            <205644..>207752
FT                   /db_xref="GeneID:3503195"
FT                   /locus_tag="TP01_0100"
FT   mRNA            <205644..>207752
FT                   /db_xref="GI:71031970"
FT                   /db_xref="GeneID:3503195"
FT                   /locus_tag="TP01_0100"
FT                   /transcript_id="XM_760534.1"
FT                   /product="kinase binding protein"
FT   CDS_pept        205644..207752
FT                   /locus_tag="TP01_0100"
FT                   /gene_family="HOG000135868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinase binding protein"
FT                   /db_xref="GI:71031971"
FT                   /db_xref="GeneID:3503195"
FT                   /translation="MPKIESSGALRNPLLFGWKIDDPNNDNLLGCVKLIESLGISFLVL
FT                   DLNTLSAKLGSNGAFQHLNHVDNSEFCHSEEFKLLIGFSPLGKSDLALPNELWSQRIVS
FT                   FIQTSDFKVLKTQIEWSCYVSSRFIMIDLESVLSNSPIDMVNSVPGKTSNSPNHSNLES
FT                   DSYELMDKLVLFCQILSSYLTQPNLPTVCISLDCCKDSLNTWNMIYELCGYSDKVKVCL
FT                   KLQPVETDIEMWLSEPVKCVVLSEDTFLSNKRVMLNKSVSNQLSVLMKNNVKIVLDSNL
FT                   NYNSLISNDCFIQNNNDSGNFVEEVVMRDFESEIDVKDVLKAVKRCYSRIGPLTINELY
FT                   GRGYEDLLQVPLQPLRDNLDSSTYNEFEKCSFKYNCYDQAISSFITTKHGELNQPNNLN
FT                   SNINYSVYVLGAGRGPLVEVVMDVFRRNHIPTSDFVVYALDKNPYTMLTLDHKAQSNRW
FT                   ANVRLICKDMRELNKSMFQSNGNSGSKPVHLVVSELLGPFGDNELAPECLHGFERSFNL
FT                   LFNNRVRLEFIPSSYTSYVMPLHCPQIWAKIKSFGNTKNFHMPYTVYLKAYYNVGTMHM
FT                   DCFKFEHPDTQPPKREQIRDLERYKVMKFIARSDCYVHGFGAYFKCTLFDKVEISILPR
FT                   DSENVKSWFPMFFPIEIPFPVKKSQVITLHIWRKVNDLKVWYEWAFTTPYTTAIHNVNG
FT                   HSYSISKC"
FT                   /protein_id="XP_765627.1"
FT   gene            208177..209395
FT                   /db_xref="GeneID:3503196"
FT                   /locus_tag="TP01_0101"
FT   mRNA            208177..209395
FT                   /db_xref="GI:71031972"
FT                   /db_xref="GeneID:3503196"
FT                   /locus_tag="TP01_0101"
FT                   /transcript_id="XM_760535.1"
FT                   /product="fructose-bisphosphate aldolase"
FT   CDS_pept        208223..209356
FT                   /locus_tag="TP01_0101"
FT                   /gene_family="HOG000220876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /note="go_function: fructose-bisphosphate aldolase activity
FT                   [goid 0004332]; go_process: glycolysis [goid 0006096];
FT                   go_process: gluconeogenesis [goid 0006094]"
FT                   /db_xref="GI:71031973"
FT                   /db_xref="GeneID:3503196"
FT                   /translation="MEYAKELVETANKLVADGKGILAADESDNTIKKRFDAIGLENTEE
FT                   NRAKYRSLLFTTPDLNKYVSGVILFEETMYQKDPNSDKTLLELLKENGLLVGIKVDKGL
FT                   FTLPLLGETTTKGFDDLYDRSTKFYKMGARFAKWRNVLTIDRSKNLPSQLALEENAQNL
FT                   ARYALVCQSAGLVPIVEPEVLMDGSHSAEECEKVTTKVLVEVFKALNDYNVLLEGMLLK
FT                   VNMVVPGAQYSSSGSVANVAELTVRCLLRTVPAVVPGVVFLSGGQSELEATKNLNDINE
FT                   RLLTLTNYSNSETSDNRSSRLWKLSFSYGRALQSSCLKVWSGKDENVKNAQKVLHQMAK
FT                   NNSLAAQGKLTKKDLEEVEKLTKDMVKSTLYEKDYKY"
FT                   /protein_id="XP_765628.1"
FT   gene            209466..210283
FT                   /db_xref="GeneID:3503185"
FT                   /locus_tag="TP01_0102"
FT   mRNA            join(209466..209599,209685..209826,209919..210012,
FT                   210078..210283)
FT                   /db_xref="GI:71031974"
FT                   /db_xref="GeneID:3503185"
FT                   /locus_tag="TP01_0102"
FT                   /transcript_id="XM_760536.1"
FT                   /product="prefoldin subunit 5"
FT   CDS_pept        join(209489..209599,209685..209826,209919..210012,
FT                   210078..210225)
FT                   /locus_tag="TP01_0102"
FT                   /gene_family="HOG000207562" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prefoldin subunit 5"
FT                   /db_xref="GI:71031975"
FT                   /db_xref="GeneID:3503185"
FT                   /translation="MTTPSDDPEKLNSDADARRLENFSIQELNMLILKLEEEVNELQSL
FT                   VNALTIAMERFQESKKALTELEKKNKQIQVPLTSLVYVPGELTNPDKVLVSVGTGYYVE
FT                   MDLKKAEDYYERRIRTVEEQMCKLQAILSGKAKQINLSYSYLDQKLAILRNTQLAAQTT
FT                   S"
FT                   /protein_id="XP_765629.1"
FT   gene            210384..213272
FT                   /db_xref="GeneID:3503186"
FT                   /locus_tag="TP01_0103"
FT   mRNA            join(210384..210842,210978..211421,211481..211908,
FT                   211968..212270,212364..212830,212925..213068,
FT                   213168..213272)
FT                   /db_xref="GI:71031976"
FT                   /db_xref="GeneID:3503186"
FT                   /locus_tag="TP01_0103"
FT                   /transcript_id="XM_760537.1"
FT                   /product="RNA helicase"
FT   CDS_pept        join(210590..210842,210978..211421,211481..211908,
FT                   211968..212270,212364..212830,212925..213068,
FT                   213168..213237)
FT                   /locus_tag="TP01_0103"
FT                   /gene_family="HOG000135867" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA helicase"
FT                   /note="go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_function: ATP binding [goid 0005524]"
FT                   /db_xref="GI:71031977"
FT                   /db_xref="GeneID:3503186"
FT                   /translation="MERVIEKYKNEIVHSVEEYNVLVLSGYPDSYMNSFVPFYLFNRGF
FT                   ADQVKQSPNPPKICTVFNNKQDVLYFSDLCSALVNDKTRVTTVFDGNSNYDKKSEIVYT
FT                   TDEYILRKLLVDPLLSEFSVFILCNVQERALNLDLLLALFKRLLNVRKRLRLVLLYQST
FT                   NVNYILEYFKRESPNGPNVPDDIPTPDFFFGEFPLKDVHYIYVENEFSFYKVSYLSKPT
FT                   SNYMESLISTVYDICKNESSDNILIFVPTREHAHILKAELEELANQFSSDKGAINVMCL
FT                   RGNIYMENKEDVLRNIFICTDVNDYNFGMGEITYLVDSCLTRRLSSEYLNTGMSENITA
FT                   STREEMMIKSSLIHNIRRGICYRLLTQNDYNSIIQEFIVPEIMTKDLTLTVLLLKSLGI
FT                   SKLNDFDFLTKPPAESLKHSLFTLYMLGAIDTSGELVYPIGNLMAELRVTPYLSSFLYR
FT                   SVESGCSEEALIIYSMLQVKEILWKKSSKIYRNDTSYSNDRLESAKLAFAALEGDLVSY
FT                   FNMFQLSQYYKDEDDKWLSTHMVNERAIQTAQRIKNKTSKLLEKYNLETTSCDGNVELL
FT                   IKTIFSSFFLNVACKEHLIVNFQNSNQIIQHLKANQPLNASDPKREDQQPYVLVKSYEK
FT                   FNYKPLYIHPSSFIVNEQPDWVVFNESNTIDGKLYMHDITTIRPEYLQELAPHYFGDYD
FT                   VKPYLETC"
FT                   /protein_id="XP_765630.1"
FT   gene            <213402..>214459
FT                   /db_xref="GeneID:3503187"
FT                   /locus_tag="TP01_0104"
FT   mRNA            join(<213402..213834,213909..214061,214091..214183,
FT                   214215..214280,214347..>214459)
FT                   /db_xref="GI:71031978"
FT                   /db_xref="GeneID:3503187"
FT                   /locus_tag="TP01_0104"
FT                   /transcript_id="XM_760538.1"
FT                   /product="cytochrome c oxidase assembly protein"
FT   CDS_pept        join(213402..213834,213909..214061,214091..214183,
FT                   214215..214280,214347..214459)
FT                   /locus_tag="TP01_0104"
FT                   /gene_family="HOG000264965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /db_xref="GI:71031979"
FT                   /db_xref="GeneID:3503187"
FT                   /translation="MLSVLAPLVARSLARGTGISSTRLLLFQNTINRCSICLNSTSRIP
FT                   VHDSRKLSETEGHTEDNSIKHNKNVERKMINSLNYNAKFADFIRKDTKPDDGMGYGLVA
FT                   LFIAMFGISFACVPLYEYFCQQSGYLGTTKKTKTYTPPPENLNLRKFEIDFVTHSNLNW
FT                   EFKPCQKRVVVRPGETTLSFYTAKNLSKEPVIGVAAYHVIPDEAGLYFNKIQCFCFEEQ
FT                   LLNPGEEVDLPVLFFLDPEIVKDKKLHGVDKITLSYIFFEANSEIPPEYKSLFNQTSEP
FT                   IKNS"
FT                   /protein_id="XP_765631.1"
FT   gene            complement(<214551..>215839)
FT                   /db_xref="GeneID:3503188"
FT                   /locus_tag="TP01_0105"
FT   mRNA            complement(join(<214551..214634,214695..214748,
FT                   214801..214926,215015..215152,215270..215397,
FT                   215455..215506,215568..215663,215768..>215839))
FT                   /db_xref="GI:71031980"
FT                   /db_xref="GeneID:3503188"
FT                   /locus_tag="TP01_0105"
FT                   /transcript_id="XM_760539.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(214551..214634,214695..214748,
FT                   214801..214926,215015..215152,215270..215397,
FT                   215455..215506,215568..215663,215768..215839))
FT                   /locus_tag="TP01_0105"
FT                   /gene_family="HOG000135866" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031981"
FT                   /db_xref="GeneID:3503188"
FT                   /translation="MTILPSRIDLVILVENSFKEIIFYYDNLIYMAFVNIEQAREVVSY
FT                   PIRIPIIYEKIITEAKDRIFESLRKGKTDVSDIVLEGATLYFLSYDNDTMGAYLLTLGE
FT                   NYPRRFANAILNDLIKLVLSSGYENDSPVLGLQSTLQEKLKDIFYKYDSVVEKDHVTLI
FT                   KVKAEHAKNHIKESMFHVLESTANVELLRDTSEVLKGKAIEAFEASKNASKVYARPRNI
FT                   VIIVSVVLGIAAIVAIALIIYFCTKKS"
FT                   /protein_id="XP_765632.1"
FT   gene            complement(<216016..>217803)
FT                   /db_xref="GeneID:3503189"
FT                   /locus_tag="TP01_0106"
FT   mRNA            complement(join(<216016..217015,217060..217562,
FT                   217594..>217803))
FT                   /db_xref="GI:71031982"
FT                   /db_xref="GeneID:3503189"
FT                   /locus_tag="TP01_0106"
FT                   /transcript_id="XM_760540.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(216016..217015,217060..217562,
FT                   217594..217803))
FT                   /locus_tag="TP01_0106"
FT                   /gene_family="HOG000135865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031983"
FT                   /db_xref="GeneID:3503189"
FT                   /translation="MSSNVSTVTGQISSIANFYCNKRLNILLRIKSFARRVRFRCKLHN
FT                   QILYPNIINGNNSNNLINKEFNEKKLIEDPIDYQKITEFMVEDLVSKCSFLSNHDLILI
FT                   LDLLTRIKKPLGKICYYQVENSSHSYSHNDKLEPVVKTNLKTNGIISKGQRTLLKYLFQ
FT                   SEENKTLTDNERYYMIIALSRECRLIPFSSWLKLFENVLHSLITKQPESLYGHKPFQIA
FT                   NLLLIYDQISRYTHKKQSSLFKNVNYSSNDAEVEISKGQLKTLETDLQIGNTERRISNP
FT                   FKLDLINTSIYRLESCLAGLKPEKLIKILYLINSRQSYSNNFFQNSLIHLESGDLIRSL
FT                   KTSQIHTLFTIFSSAYKFHFPSLIESLNYEIQFLTDRPSISPFSSKEISTSNLISDSLC
FT                   EKSVLNVRDQGDKLCETNDFNEALNKYKKLESICLCVMILTLEYITRLKDPNSHSLSNL
FT                   KNLTFTTQQIFGEEHEWNDLLLILGKKTRNLEASLTHSEITKEMTNEFHSKLENLIEYN
FT                   QFLVKIFKIEPKYENYMQRVQFFVDFFSCVKPHTSESLNLNKNLLQTDSCLLN"
FT                   /protein_id="XP_765633.1"
FT   gene            <218190..>219608
FT                   /db_xref="GeneID:3503190"
FT                   /locus_tag="TP01_0107"
FT   mRNA            join(<218190..218315,218375..218496,218549..218985,
FT                   219051..219291,219350..219422,219471..>219608)
FT                   /db_xref="GI:71031984"
FT                   /db_xref="GeneID:3503190"
FT                   /locus_tag="TP01_0107"
FT                   /transcript_id="XM_760541.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(218190..218315,218375..218496,218549..218985,
FT                   219051..219291,219350..219422,219471..219608)
FT                   /locus_tag="TP01_0107"
FT                   /gene_family="HOG000178663" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031985"
FT                   /db_xref="GeneID:3503190"
FT                   /translation="MPRAEVGTHKWLANKMKSKGLQKLKWYCQMCEKQCRDENGFKCHR
FT                   LSEGHQRMMQVFCQNSGRFMDGFSRTFENEFMKLMRTRYCKTKILANSVYQELISDKQH
FT                   VHMNATIWVTLSEFVLYLGRSGKCKVEHTPKGWYIEYIDQEKLKREEDERAKMKREITL
FT                   EQMHQRLIQKLVEEAKESGAFEHEEEYTPLMKDPDQKIVINTNLTTTNSEESNKGLNVF
FT                   KQFYRKNKSTIGKQEPETPKTEGSKRKSALESIMESNKKLKSHHDKGLTDKNGTAQETW
FT                   LCNDILVKIILKTHEMYKQKFKVIKVSNNTATLDTGNGTLQIQDKYLETVLPSVNGRVK
FT                   LLNGRNRGLIGTLVSTDPDNLKAKVSVQGSLVHCTKLN"
FT                   /protein_id="XP_765634.1"
FT   gene            complement(221143..222248)
FT                   /db_xref="GeneID:3502749"
FT                   /locus_tag="TP01_0108"
FT   mRNA            complement(join(221143..221414,221530..221604,
FT                   221714..221769,221887..222248))
FT                   /db_xref="GI:71031986"
FT                   /db_xref="GeneID:3502749"
FT                   /locus_tag="TP01_0108"
FT                   /transcript_id="XM_760542.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(221205..221414,221530..221604,
FT                   221714..221769,221887..221989))
FT                   /locus_tag="TP01_0108"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031987"
FT                   /db_xref="GeneID:3502749"
FT                   /translation="MSVKTSFNNFFGLFNSCCAHGNSTKQETFDEDLEEQNFKEKLQDY
FT                   LDVIVLLEDGTKLSCTLHVNCETSLVRIACDKQVREIDFASVKKILHTKDELSRIQTTG
FT                   NSMNYNTTVAFHLLENGNCIPVSFSNTREKRMFLNILSPFIPT"
FT                   /protein_id="XP_765635.1"
FT   gene            complement(<222218..>223493)
FT                   /db_xref="GeneID:3502750"
FT                   /locus_tag="TP01_0109"
FT   mRNA            complement(join(<222218..222286,222338..222607,
FT                   222641..222730,222807..223056,223125..223207,
FT                   223247..223351,223389..>223493))
FT                   /db_xref="GI:71031988"
FT                   /db_xref="GeneID:3502750"
FT                   /locus_tag="TP01_0109"
FT                   /transcript_id="XM_760543.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(222218..222286,222338..222607,
FT                   222641..222730,222807..223056,223125..223207,
FT                   223247..223351,223389..223493))
FT                   /locus_tag="TP01_0109"
FT                   /gene_family="HOG000135864" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031989"
FT                   /db_xref="GeneID:3502750"
FT                   /translation="MDSDFKDVDVVSELNKLSSENNYKEIVNLLRENFYQFNDDPNKLI
FT                   AILTIRIYYNLHLKVIFFFYTHLLYNFNEVDSDFDLIQSIFTDKLKSQFSYTKDSVCPF
FT                   STFLIHAYYPHMKGSSFQSLTRMCNLFHKLSDDLNSQRSYEKRDESESSKEREVIVKRI
FT                   MKTVLLLSDVLITLLRPQEAIKLLKEVNLKYDKEDVSTNMILSLIYRKLGYTEESERYL
FT                   KAILGKADERKLPYTGFLKMFSKDYKGASEEFKSVLSLDKKSLSPQESVLLNNLAVSTL
FT                   YAGSSQEAKNLFFNFEILTHGFQAHRGIMSNADVLVELSIYE"
FT                   /protein_id="XP_765636.1"
FT   gene            <223962..>227024
FT                   /db_xref="GeneID:3502751"
FT                   /locus_tag="TP01_0110"
FT   mRNA            join(<223962..224034,224113..>227024)
FT                   /db_xref="GI:71031990"
FT                   /db_xref="GeneID:3502751"
FT                   /locus_tag="TP01_0110"
FT                   /transcript_id="XM_760544.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(223962..224034,224113..227024)
FT                   /locus_tag="TP01_0110"
FT                   /gene_family="HOG000135863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71031991"
FT                   /db_xref="GeneID:3502751"
FT                   /translation="MPPRKGRTSVKKGIFNYSEHHFIPILKVENPDELKSDDLEEMELD
FT                   PLTQDMSSLKSSDLTHENLNTDSTSDNLELNNSVDVQLSANTELENTNNTMDTTVDTTH
FT                   SVDNIHSVDNIHSVDNIELVDNFHLVDTANAGGTVVTVGNVDMDVDMEGYVQDLSMCDI
FT                   PPPPDSDGYGLEDQMSSEEISEYISEIMESLMDLSKQLEDQDDEEEEGAIKEDEVPFER
FT                   VPEEVNGGNVLLFLNLPPEFDPKRLSEVFTKYPSLVSNVSFLDKTRLKVFFTSYKGAQE
FT                   TKMKLDSVKLYNRRLQVIYAPDKYTLNAPKYLNIPLNLSNRHPVVNHHHNFVNQHSHTS
FT                   HPNHFRGFGNNANIPPPPSAPYTGPPQERFKISFNRYKLVNTTMSQILTQIYTEANFEP
FT                   GSRSLQWDDSSPFYQNQLKYDRLFEKFGITTRYVMIGRLNYSVFENSSTVHDFLSSFTN
FT                   SSYTYEIVNLPSSYPSSPSVTAETTSLNSVNVDSFNGSDGEKWLYVIFDKNRDGLNFYN
FT                   KVYSYVSASSSEDSSEVKHKYLVRYACPLSPQDSLWIGNVCEFCGYFRTEDEVYSFFNN
FT                   LGQLKHFKLVYESNCIFLTFHSKQTSIKVYNLLNALSPRMVIRLLTANNANGSSNRSSL
FT                   VDRFCSLTMDVDESMGLMKEDLVTVDFTVSKSENSFALGQKLLNAIKRRTDSQELIEKL
FT                   LNTSDASNILSDNSMSNRRSHGGYPSYNSYGPRRREPRPRYDRRPYRDDYSREPYRDRD
FT                   RSNREHNKYRQRYPISKEPRVDRFGRTIRPYDKSRRDEPWKYNQHQADSDSFQDKLDHE
FT                   VRKRSQERGMDTNYPEPPKTAHPSERYLSEQPLMDQVEMEIDHSDTASSSSGKAERPGR
FT                   RLEYCQLLKRGKFICKVGCEFIRGDKAHRLPELLDVNQRANPERLKNYLTKTPELSLWQ
FT                   LSADGKEDNQKYDNLCEYLISKNRVALVQQGPYEIYIVPPQEQYIQMLNTPDTQFMYAY
FT                   VLSKS"
FT                   /protein_id="XP_765637.1"
FT   gene            complement(<227324..>230380)
FT                   /db_xref="GeneID:3502752"
FT                   /locus_tag="TP01_0111"
FT   mRNA            complement(<227324..>230380)
FT                   /db_xref="GI:71031992"
FT                   /db_xref="GeneID:3502752"
FT                   /locus_tag="TP01_0111"
FT                   /transcript_id="XM_760545.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(227324..230380)
FT                   /locus_tag="TP01_0111"
FT                   /gene_family="HOG000135862" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031993"
FT                   /db_xref="GeneID:3502752"
FT                   /translation="MTLSGMKQVVETFDVSESTSSSKSWSSENIANKEKELLEDNNLYD
FT                   VESITSDSSVYEEFDDFDPSNFRLTPQNTISPKREAVNTTNSSSADEAMSSEFKSVDSY
FT                   ESFYVLSLENQNEPSNKITNTNNSVSTNHNVDISYKDKVPVDVDEESMVVDVEDPELDV
FT                   EMELDNVMTEIDAGNVSFDAAGSSAFVNTTNTYTNTNNDTNNNTDNVCGTMVNTVNHDS
FT                   VENDVVMESEDELDSLKLQKYLKSQKITEICKRLKADLKGTKYTDEKYACFSERVYNYI
FT                   SDLKSYSSISSQDPTTTTSTLTSVDLKPLSTDSTNSLDDSAYDLVSAREALVFDTQPPN
FT                   RDQPPSTQPTDNTTNIDNTNNTINNADNAVFRSEFEVEFQDFINKHRHLINQSFDSSAD
FT                   TVDTVDNRKSNQKEIQEVFKNKETTANVEDSDKIDLETESYHGLESVMSSSCINLVFSC
FT                   LRSIKIAVGDNLHEHNVYTGTKKFMSKFLEILRKLNVLEKKLKNDFLALENNDYNLELT
FT                   RNGFLTLMKVNNRLLTLYNNYKDHENLQRDSIRLKIDGISLLRSEILSKLEQTQMNTKV
FT                   SDVKETLLARENRLEDIYNETGFFVLPLNYHNSYQNILYLFNFNYYTKVSKSYQISPPN
FT                   TATLNNNINTPKNTNALDKTNKSVNNNTLYKDELFPDVTKEMLDKLRVLDHLPFKPVKL
FT                   VPDLELKLFLWFQNSNTSSSNALNNTVFNNFLSPIAISSSSSTSSNNLNLSPYANSVNH
FT                   NPATSNLFNNTHSSNNGQQYQKNNSLETVINLDVDENNYIDLFTVRNDLKLVLYCPMHK
FT                   DVPYYRFKSDLVQYYNHFLNSKMVEFAEDVIENVQLVELLNHVMELTRDINHKFVSNLN
FT                   MFHSLTQLSTNYYYLSQWSGDSSNSSLSNGTVNQQNSLFVKERVLKLMLTFKNNMPCLW
FT                   CLVYFNFNTGKSKNPSPNNPKFTNRYFAEKNLLVSGIKFEFVHKLNKSLSAKYQAGLDQ
FT                   INRLISTPGTPKDIIEHITGTLNSQEYYM"
FT                   /protein_id="XP_765638.1"
FT   gene            complement(230653..>231229)
FT                   /db_xref="GeneID:3502753"
FT                   /locus_tag="TP01_0112"
FT   mRNA            complement(join(230653..230845,230880..230952,
FT                   231023..>231229))
FT                   /db_xref="GI:71031994"
FT                   /db_xref="GeneID:3502753"
FT                   /locus_tag="TP01_0112"
FT                   /transcript_id="XM_760546.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(230709..230845,230880..230952,
FT                   231023..231229))
FT                   /locus_tag="TP01_0112"
FT                   /gene_family="HOG000135861" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71031995"
FT                   /db_xref="GeneID:3502753"
FT                   /translation="MKLSGDYATQLKEVVKYFLMEIFRRQFSVSNINLNFIAVVFTKST
FT                   YFWVGDNNYTCKDLHCSFPLKNIKDGDCSGTTLLGDLDSISSEIANTLARIYKRGIFMS
FT                   VNIEELDSSLLEEFQEKLFGLIFELFPRKKNENM"
FT                   /protein_id="XP_765639.1"
FT   gene            <231330..>232673
FT                   /db_xref="GeneID:3502754"
FT                   /locus_tag="TP01_0113"
FT   mRNA            join(<231330..231671,231702..232103,232143..232238,
FT                   232293..232406,232458..>232673)
FT                   /db_xref="GI:71031996"
FT                   /db_xref="GeneID:3502754"
FT                   /locus_tag="TP01_0113"
FT                   /transcript_id="XM_760547.1"
FT                   /product="S-adenosyl-methyltransferase mraW"
FT   CDS_pept        join(231330..231671,231702..232103,232143..232238,
FT                   232293..232406,232458..232673)
FT                   /locus_tag="TP01_0113"
FT                   /gene_family="HOG000049777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S-adenosyl-methyltransferase mraW"
FT                   /note="go_function: methyltransferase activity [goid
FT                   0008168]"
FT                   /db_xref="GI:71031997"
FT                   /db_xref="GeneID:3502754"
FT                   /translation="MIPPFLVFFIFHLVLVSFKPSFEYIGNTPFSKTRYTLYTPRNETF
FT                   SSNSKTSKFTLGSNQNEPEGEDFQYYEHIPVMLKESMEYLITDPKGLYLDVTLGYGGHT
FT                   EEILRRLNPKGKLISIDRDPESVYFNRKRLKSYIEESRLSVEIGKFSGIIDLLKSHKLP
FT                   TEGYTGFFLPILLFKLVISTLYLLYKEFRIVADLGLSTHQLENSKRGFSYMKNGPLDMR
FT                   MSSPLNDPFNPNFKIDVKSSENTAYQLVNKSDESTLRKIFKEFGQEPRAASIAKKIIEK
FT                   RRILGEIDSTEKLKSVVMDSLPMFHRSKMRTLSRIFQALRIKVNDELNELSSFLNFIPQ
FT                   LLKYNGRFVCISYHALEDRLVKNSFINLRNFKTPTVKFNILTKVCFNDY"
FT                   /protein_id="XP_765640.1"
FT   gene            complement(<232861..>233211)
FT                   /db_xref="GeneID:3502441"
FT                   /locus_tag="TP01_0114"
FT   mRNA            complement(<232861..>233211)
FT                   /db_xref="GI:71031998"
FT                   /db_xref="GeneID:3502441"
FT                   /locus_tag="TP01_0114"
FT                   /transcript_id="XM_760548.1"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT   CDS_pept        complement(232861..233211)
FT                   /locus_tag="TP01_0114"
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="go_function: isomerase activity [goid 0016853]"
FT                   /db_xref="GI:71031999"
FT                   /db_xref="GeneID:3502441"
FT                   /translation="MDKVRCAHLLLKHTGSRNPVNRNTGMAVTRTKEEAVNEMKGYLEM
FT                   LRKSENLDQEFRRLATAKSECSSARKGGDLGFFDRNTMQKPFTEASFNLKVNEISDLVE
FT                   TDSGIHLIYRIA"
FT                   /protein_id="XP_765641.1"
FT   gene            233543..235112
FT                   /db_xref="GeneID:3502442"
FT                   /locus_tag="TP01_0115"
FT   mRNA            join(233543..233762,233818..234095,234139..234381,
FT                   234411..234570,234604..234792,234822..234876,
FT                   234906..234966,234995..235112)
FT                   /db_xref="GI:71032000"
FT                   /db_xref="GeneID:3502442"
FT                   /locus_tag="TP01_0115"
FT                   /transcript_id="XM_760549.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(233570..233762,233818..234095,234139..234381,
FT                   234411..234570,234604..234707)
FT                   /locus_tag="TP01_0115"
FT                   /gene_family="HOG000135860" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032001"
FT                   /db_xref="GeneID:3502442"
FT                   /translation="MESLDSSSDFYLFDRLFNRSFSEYWKLFWTDYDFSKYNSVRKELT
FT                   ECLDFLQTHSLPQYFQHESESPKGDSTKEEPEFQKNIERERLNKLRVVEELQQSFELLS
FT                   MGCIHFDLISKNEQFEDVHTENIKYLMLPYLTAHVLVEKPDMQNRFSILKKVQIYLIEF
FT                   MNTLSQMDLLRPDELQLWETKFAKSSEHSGINERGRKSEDIRNLRIKQASFERDLKKSL
FT                   SETFLSSGSVERFLQFRLAEDSDREEFYRNTLLSILRLFSIQSLNHLNSIEMELPFIER
FT                   RELNKLAFSDEPKIDVKSSSSKPWFLHIDKNSKVLSHLSHLTQL"
FT                   /protein_id="XP_765642.1"
FT   gene            complement(<235277..>235516)
FT                   /db_xref="GeneID:3502443"
FT                   /locus_tag="TP01_0116"
FT   mRNA            complement(join(<235277..235348,235454..>235516))
FT                   /db_xref="GI:71032002"
FT                   /db_xref="GeneID:3502443"
FT                   /locus_tag="TP01_0116"
FT                   /transcript_id="XM_760550.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(235277..235348,235454..235516))
FT                   /locus_tag="TP01_0116"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032003"
FT                   /db_xref="GeneID:3502443"
FT                   /translation="MAGRFAGEIKAKKLILTHFSNRYPGDEKLQNLLTMIRIENEARY"
FT                   /protein_id="XP_765643.1"
FT   gene            complement(<235628..>238615)
FT                   /db_xref="GeneID:3502444"
FT                   /locus_tag="TP01_0117"
FT   mRNA            complement(<235628..>238615)
FT                   /db_xref="GI:71032004"
FT                   /db_xref="GeneID:3502444"
FT                   /locus_tag="TP01_0117"
FT                   /transcript_id="XM_760551.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(235628..238615)
FT                   /locus_tag="TP01_0117"
FT                   /gene_family="HOG000135859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032005"
FT                   /db_xref="GeneID:3502444"
FT                   /translation="MKNILIFLIHFSIISNLKECLTISSHLSHRRPSNISCFVTFYNLY
FT                   NNTNQVGFLKNKSHKIGLNDSNSYRDQTVHLKDERILVESHKPPLNVTDSSPNSPGPPA
FT                   GSTNAVLKSIVDKGSIKSSPIRHEILDKESLLDELIVYNDDVKGVFEFSGDKNLNFLSD
FT                   DFSVFRKTVDKKEQVISPSDKLLKRRSKDTIYTRLQNYVKSSETYLARLGVLEEIKSFV
FT                   HLLHWNVWHSQPRDGIRECNWTSDQFLRFGKLIEKIDQIVKEQFNSMVETITNTDDDML
FT                   SELFGERSKLLYSTHYVYNKIKDTVELGEFDIYRARMTNFHFLKYKLFSILKKIVDPIL
FT                   SDFIQYGIINPARQRFLSLKYSFIRFKKGVMRILTKVKSFIKISKPPNSDEQISESGLD
FT                   NVEINKLKNEESVKYEKIELSHLLKHLSHSYISPQSLKNVHEIGRKQLYKFKNTGDWII
FT                   HFVGSGSRQPTSTRLTSTMAFQRISDPQSNMPNKNMNSAQNVKTRSTYRRNLANSMIWL
FT                   FDCGEGTKNGLESIGLDPLNVDRIFLTHLHGDHCYGVFSFLYLREREKPLEIYGPPGSR
FT                   KLINSIHQNTSAMSNNHNLFIVHELIPTQPPTINSTNTLNTINTINSTNTLNSNTLNTG
FT                   NSVNNVNGGANVVGDIYINKDGYYKVYEDNDIEVLAAGLEHTMPTVGYVIQQKEKSGQR
FT                   NQKVKKIAICQDTSESSKMKKIANDADLLIHEATLSSSTSLVSGILLDLFKENFGLILP
FT                   YGSIQGLCKFLSNIETKLCCFNFTLSAVSSFVKCERYYLLQKLSIFKNFISNLNPYRTP
FT                   DFTTNSNSNSNSNSNSNTNNNKDTNNLGNNSVNKTKREIDKELKDTWLNKVFVFMDRLN
FT                   ALNELSNYENYVKRLQNRCNLMEKLSKVMPSLDLLKVIETSSKKILFSDIVPDFNAINR
FT                   AYEKFDITNLYNEKYTVNVLKYLNTISNDIFNYWNDILQLNIPFDASQSIFHFPKLHIY
FT                   ILIFTY"
FT                   /protein_id="XP_765644.1"
FT   gene            complement(<238780..240824)
FT                   /db_xref="GeneID:3502445"
FT                   /locus_tag="TP01_0118"
FT   mRNA            complement(join(<238780..238890,238920..238986,
FT                   239052..239092,239122..239223,239274..239387,
FT                   239419..239475,239503..239570,239599..239757,
FT                   239788..239848,239878..239928,239958..240088,
FT                   240117..240824))
FT                   /db_xref="GI:71032006"
FT                   /db_xref="GeneID:3502445"
FT                   /locus_tag="TP01_0118"
FT                   /transcript_id="XM_760552.1"
FT                   /product="N-acetylglucosamine-1-phosphate transferase"
FT   CDS_pept        complement(join(238780..238890,238920..238986,
FT                   239052..239092,239122..239223,239274..239387,
FT                   239419..239475,239503..239570,239599..239757,
FT                   239788..239848,239878..239928,239958..240088,
FT                   240117..240345))
FT                   /locus_tag="TP01_0118"
FT                   /gene_family="HOG000163915" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-acetylglucosamine-1-phosphate transferase"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   catalytic activity [goid 0003824]; go_process: lipid
FT                   metabolism [goid 0006629]"
FT                   /db_xref="GI:71032007"
FT                   /db_xref="GeneID:3502445"
FT                   /translation="MIPKLRRSLSSVCEPSINFFSLFPIIFSFSSLVSTYSLKNLSYIF
FT                   YYFVYFQLFVVVLAFLTYFGTFFLIKLLKLRGLVSNNLNNETDEKVPEPGALVGCVLYI
FT                   LSMIFVQLLLGDKCGKYFKVNPGLASIVLMTLLGLIDDVLLLNWFSKIAGPVLASLPLC
FT                   LAYCGTKIGILEYLPKPINSGSYVKLLSCFYIAILTVFCANSINIYAGINGLELGQSLV
FT                   MSLFILISNSLDIYKSSGVKYGEFGMNLEKKIYVLYLTMPFIAINIALICFNWYPAKLF
FT                   VGNVYTLFSGTFFSVVLIMSNMCEMAPFIFLPQLINFLLSIPQLLGFIPCPRHRVPRFN
FT                   GRTKKLENSKNLTLLNLFLLVFGPMEEEKLSLFLIAFQIFCGVLGLIVKYGIIKLV"
FT                   /protein_id="XP_765645.1"
FT   gene            <240948..243909
FT                   /db_xref="GeneID:3502464"
FT                   /locus_tag="TP01_0119"
FT   mRNA            join(<240948..241014,241044..241119,241151..241265,
FT                   241295..241529,241558..241739,241954..242271,
FT                   242301..242510,242791..243462,243668..243909)
FT                   /db_xref="GI:71032008"
FT                   /db_xref="GeneID:3502464"
FT                   /locus_tag="TP01_0119"
FT                   /transcript_id="XM_760553.1"
FT                   /product="long-chain fatty acid CoA ligase"
FT   CDS_pept        join(240948..241014,241044..241119,241151..241265,
FT                   241295..241529,241558..241739,241954..242271,
FT                   242301..242510,242791..243462,243668..243868)
FT                   /locus_tag="TP01_0119"
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="long-chain fatty acid CoA ligase"
FT                   /note="go_component: host cell cytoplasm [goid 0030430];
FT                   go_function: catalytic activity [goid 0003824];
FT                   go_function: long-chain-fatty-acid-CoA ligase activity
FT                   [goid 0004467]; go_process: metabolism [goid 0008152];
FT                   go_process: fatty acid metabolism [goid 0006631]"
FT                   /db_xref="GI:71032009"
FT                   /db_xref="GeneID:3502464"
FT                   /translation="MVKNEADSPGFYSVPIPGTEEEGFSPVYRHPKHEKILGASDFGDF
FT                   KTSWDLFQAGLRRNPDAECVGKRKRLPDGKLGDFEFNTYSEFFKTTKAVGSSLVHHNLV
FT                   KEQRISQSSFQGTCKLVGLFLPSCEEWLLLEQACYGYGYTLVPIYTTLGTESILFVLTN
FT                   TGLELLFCTEENAEKLFEVLSLSKTKLPLRNLVLVNSSSVSEKLVNNPYNLKFMLWSDF
FT                   LQKGMDTELDPTPGDPDSLNIISYTSGTTGSPKGVMITHKNFIDTVLVTIEGGELLFPV
FT                   LIINLVCRPMGMDEQHFSCHLSYLPMAHMFEKDFVNAVFYLGGKIGIYSGDVKLIMDDL
FT                   QTLKPTLFISVPRLFQRIHDKILSGVQTKSALARHLFSRGLESKINRIRNNGVYTHKFY
FT                   DKLIFDKVNKLMGGNLKWLFVGSSCLSEMVIDRVRAMIGKPLFWGYGLTECCAGAFVQN
FT                   IHDRNPLNLGGPSPGFQFRIRSIPELNYFVDKKPIRGELVMKGTNVSMGYFKMEEMTKE
FT                   VFRDGWLYTGDVVELMDNGSVKVIDRIKQVFKLSQGEYVAPEFVESALNSCIYIAQSYV
FT                   VGNSDENYPVAIIVPDEEALQSWKKTHGLTKANLTQLAKDPLLKQFLFNELESVMTSSN
FT                   VKGYNRVKEIYIHDELFSVENNLLTVTFKLKRNFLRQKFENEITQMYASLRNSNTK"
FT                   /protein_id="XP_765646.1"
FT   gene            243985..244808
FT                   /db_xref="GeneID:3502465"
FT                   /locus_tag="TP01_0120"
FT   mRNA            join(243985..244106,244177..244293,244330..244450,
FT                   244558..244644,244675..244808)
FT                   /db_xref="GI:71032010"
FT                   /db_xref="GeneID:3502465"
FT                   /locus_tag="TP01_0120"
FT                   /transcript_id="XM_760554.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(244025..244106,244177..244293,244330..244450,
FT                   244558..244644,244675..244807)
FT                   /locus_tag="TP01_0120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032011"
FT                   /db_xref="GeneID:3502465"
FT                   /translation="MHLNSTPKRRRLNPSEPGIQPGRSIPPEFENTSGKIIKVTLFNFL
FT                   NHAHLTFSCSPYLNLIFGRNGQGKSAIVQAIALCFGATGHSVGRDTNLNRYIKDYHLKN
FT                   GPNCAKIELYISNSGPNSYEPEVYGDVIILSRTIYKNGSTYYLASSLIKKSPVDRKTLN
FT                   QYLRQIKINVLNYYYS"
FT                   /protein_id="XP_765647.1"
FT   gene            <244978..>245397
FT                   /db_xref="GeneID:3502466"
FT                   /locus_tag="TP01_0121"
FT   mRNA            <244978..>245397
FT                   /db_xref="GI:71032012"
FT                   /db_xref="GeneID:3502466"
FT                   /locus_tag="TP01_0121"
FT                   /transcript_id="XM_760555.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        244978..245397
FT                   /locus_tag="TP01_0121"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032013"
FT                   /db_xref="GeneID:3502466"
FT                   /translation="MEEKINSEKKNLEDCKAELRIRKKVLEPDKQKLEQLSKQIESFEE
FT                   KLNEWKSAKESYKLALYRESVEDYETAKTKYEKQKHNNPTEQIKEKEELISELNTQLSQ
FT                   LKTEINNLTTSSMELKDKIRTASDSVSICEDSIKE"
FT                   /protein_id="XP_765648.1"
FT   gene            <245704..>248016
FT                   /db_xref="GeneID:3502467"
FT                   /locus_tag="TP01_0122"
FT   mRNA            join(<245704..245802,245832..245939,245981..246056,
FT                   246116..246237,246405..247034,247111..247305,
FT                   247426..247560,247590..247742,247828..>248016)
FT                   /db_xref="GI:71032014"
FT                   /db_xref="GeneID:3502467"
FT                   /locus_tag="TP01_0122"
FT                   /transcript_id="XM_760556.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(245704..245802,245832..245939,245981..246056,
FT                   246116..246237,246405..247034,247111..247305,
FT                   247426..247560,247590..247742,247828..248016)
FT                   /locus_tag="TP01_0122"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032015"
FT                   /db_xref="GeneID:3502467"
FT                   /translation="MSDEYERLEEDHQSLMSELTSYEEANNEIDSQMKQIDADLEELRR
FT                   DYETVKSNDTNTFLTSRFMLYKYNPEHVRETIQKMKSSSLFRYEPIGPVGEYLRVVQSV
FT                   PWKVLPIVERHLKKFLFNWVVHTEQDRIALQKILVDSGCDSNSIYITKTNLFTRETDSI
FT                   EKAQREVSEVGFNSVILNFLDVNEIPKVLLSIMIDSFNISKTAICKDETEMLSVLKDEK
FT                   MKITAAYSINNVDFGKRVNGALFLTPAYDKNPFHYRFVRYSCQDADTLYDLKQRMSDLK
FT                   ARETTIKRYSKELHTKLMSNKRKIISTNNKINSINNRKTELITEKTKLEADLNSQIEIN
FT                   QLLNNNEGVDEVANLRTKYAEQLDSLKKQMTEFEDKLDVVFKDKMSHEENMRTLNTSLE
FT                   SILENISNKRMESNKTQTSINNCKNEIKQFLRESINYNNVLNDCLNSMNEAEKQLKKCE
FT                   SDLRESGIDYSGELPPKKSQEYLRIMNTSREILSSIVNSSTGIENYLETLRVKYSEAEE
FT                   SLNDKMSKLLETQNNYSRHKTNYASRLKLFDEYRLRMERLVFILEFNKILG"
FT                   /protein_id="XP_765649.1"
FT   gene            <248264..248684
FT                   /db_xref="GeneID:3502468"
FT                   /locus_tag="TP01_0123"
FT   mRNA            join(<248264..248284,248394..248464,248505..248596,
FT                   248625..248684)
FT                   /db_xref="GI:71032016"
FT                   /db_xref="GeneID:3502468"
FT                   /locus_tag="TP01_0123"
FT                   /transcript_id="XM_760557.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(248264..248284,248394..248464,248505..248596,
FT                   248625..248671)
FT                   /locus_tag="TP01_0123"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032017"
FT                   /db_xref="GeneID:3502468"
FT                   /translation="MIHSLASLSYSPLHMFDEIDVYMDESTRIKNVNAIVAFANDNRDR
FT                   QFFLLTPHMEFARHVSESHPHITKLFNVSKT"
FT                   /protein_id="XP_765650.1"
FT   gene            complement(<248809..>249951)
FT                   /db_xref="GeneID:3502469"
FT                   /locus_tag="TP01_0124"
FT   mRNA            complement(join(<248809..249462,249539..249690,
FT                   249720..>249951))
FT                   /db_xref="GI:71032018"
FT                   /db_xref="GeneID:3502469"
FT                   /locus_tag="TP01_0124"
FT                   /transcript_id="XM_760558.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(248809..249462,249539..249690,
FT                   249720..249951))
FT                   /locus_tag="TP01_0124"
FT                   /gene_family="HOG000135857" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA binding [goid 0003677]; go_process: regulation of
FT                   transcription, DNA-dependent [goid 0006355]"
FT                   /db_xref="GI:71032019"
FT                   /db_xref="GeneID:3502469"
FT                   /translation="MELLNQGYPRKESVYISSKDFDSDQKFKCLRNGLREIVDIIETNE
FT                   DYKYPCLAEACSLFQNFLITLTKLKDKLLPDRSGFFSSKWVDIAIEFQLTCEYVFLSYV
FT                   KEEYLLSFLPLVPNQLEYTSAKLRSIHQMTQFEFEEFRNLFTLIAMGFIGKLKLLTFCL
FT                   SLTIISSEKLGIDLSDAENFRDNLTGSTSASSTGRSFTDFAYSSTPCEGFYSDKYANYE
FT                   FKTEQEENRNQMLNEMIMNVYNDPVYASNCCYPCGDCFESTLVPGSELLRVKLEMNSGT
FT                   DVSGLENAMYGQNDDLMNLSVYQTRNPDFDRTQMEDMGSSCSQADSSVPIKEPKKRVRP
FT                   RKTIS"
FT                   /protein_id="XP_765651.1"
FT   gene            complement(250449..250520)
FT                   /db_xref="GeneID:3502477"
FT                   /locus_tag="TP01_1240"
FT   tRNA            complement(250449..250520)
FT                   /db_xref="GeneID:3502477"
FT                   /locus_tag="TP01_1240"
FT                   /product="tRNA-Asp"
FT   gene            complement(251037..251108)
FT                   /db_xref="GeneID:3502478"
FT                   /locus_tag="TP01_1241"
FT   tRNA            complement(251037..251108)
FT                   /db_xref="GeneID:3502478"
FT                   /locus_tag="TP01_1241"
FT                   /product="tRNA-Asp"
FT   gene            complement(251148..>253723)
FT                   /db_xref="GeneID:3502479"
FT                   /locus_tag="TP01_0125"
FT   mRNA            complement(join(251148..251216,251247..251350,
FT                   251381..251438,251815..251924,251953..252093,
FT                   252124..252239,252270..252372,252430..252798,
FT                   252863..>253723))
FT                   /db_xref="GI:71032020"
FT                   /db_xref="GeneID:3502479"
FT                   /locus_tag="TP01_0125"
FT                   /transcript_id="XM_760559.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(251177..251216,251247..251350,
FT                   251381..251438,251815..251924,251953..252093,
FT                   252124..252239,252270..252372,252430..252798,
FT                   252863..253723))
FT                   /locus_tag="TP01_0125"
FT                   /gene_family="HOG000135856" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032021"
FT                   /db_xref="GeneID:3502479"
FT                   /translation="MIPGRERITIIFSDENGCDSQKLASEIALEYLNVKRTPKCISLNS
FT                   LLNFGNRTTEDSADFSASDGSFSEFANVLNGNSHSDEGNVIIFIFESHSSGITKLENAL
FT                   NDWLSDFRVDKSIFLNLNFIFVIQHSHPPDTQQSVDNEHNERVGNEDVDGLRELLSNLG
FT                   SRMLFRRNFYLKSGDVGQILSLIDLISEATSHTAYPNNHTDPHTNLHTPHISHSTNISH
FT                   STDNSDSTEGTDETEGTEDIEVDIESLGKLGGMTTVTQRNQLIKQGYKLIGDHSAVKLC
FT                   RWTKSRVRGHGGCYKHTFYGISSSQCMEMTPSLACANKCVFCWRHHTNPVGTRWKWDQD
FT                   DPKFIVSESITAHLKLIKELRGIFDTKQKRFNEALRIRHCALSLVGEPIMYPQINQLIN
FT                   ELHNHQISSFLVTNAQFPEEMEALVPVTQLYVSIDASDRASLRNIDRPLFRDFWDRFLR
FT                   CIELLKYRRERTVFRLTLVRNFNMTEQKNEIEGYSNLIRLGEPDFVEVKAVTFCGNVEG
FT                   NAITMKNVPWHDEVIEYCKALVSTDEHVKKNYSLVCEHRHTCCALIAKNDYCVNGKWLT
FT                   WINYDKFNELVTSGVEFSGLDYSCETPDWALFGSPEQGFDPEDTRIYTKGRHKLNSV"
FT                   /protein_id="XP_765652.1"
FT   gene            <253902..>257038
FT                   /db_xref="GeneID:3502480"
FT                   /locus_tag="TP01_0126"
FT   mRNA            join(<253902..254373,254408..254523,254616..254868,
FT                   254976..255310,255487..255700,255782..255944,
FT                   256043..256221,256346..256539,256696..256881,
FT                   256910..>257038)
FT                   /db_xref="GI:71032022"
FT                   /db_xref="GeneID:3502480"
FT                   /locus_tag="TP01_0126"
FT                   /transcript_id="XM_760560.1"
FT                   /product="DNA-directed RNA polymerase, subunit alpha"
FT   CDS_pept        join(253902..254373,254408..254523,254616..254868,
FT                   254976..255310,255487..255700,255782..255944,
FT                   256043..256221,256346..256539,256696..256881,
FT                   256910..257038)
FT                   /locus_tag="TP01_0126"
FT                   /gene_family="HOG000135855" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase, subunit alpha"
FT                   /note="go_function: DNA binding [goid 0003677];
FT                   go_function: DNA-directed RNA polymerase activity [goid
FT                   0003899]; go_process: transcription [goid 0006350]"
FT                   /db_xref="GI:71032023"
FT                   /db_xref="GeneID:3502480"
FT                   /translation="MQNVLIFNFIIVLYIFKSNATYRNKNFIRRFKPDSQFLPYLYITN
FT                   SHTIANSHSISNFQTISNSHTISNFQNIPTFNNISSVKIDKFDILRGVKNVKFGVRTFT
FT                   VLTALNPENAELHPAVLSPVESKLTPEELENLKKKGLIDGNTNTWRNWHIISKGEWPDI
FT                   GPRVLPGMEKNLKITEPYALRKPLKYWGFMRGIESNVLSYPILYEYYKDMGNIPVHEHG
FT                   GNNPLFNPLLFQPTYTMEKDRCGLFYDDARLFEGWINANHDTPTKVKEASDLIRIPDTG
FT                   RLYQKFYMGPYPVTMGWTIGSLLKVMTQSRCPGHAVVAVKIHNMNKDTTVNGVADDLLN
FT                   IALNLKMVSYTHFYTIYTHFTHLHIYTFTHLHIYTFTHLHTYTFLQIFTQFIVSLQTLE
FT                   YGKEARVRTVIKGPAMLCAGALEWPSFVKLCNPECYITKLEEGAELDLEIKIEWGRGFW
FT                   MADSKGLYRLEEGANSLCHKRRDIKEVKEEGFYPTSCVFGGCRMIRLAVHKLMGQRWCS
FT                   LTYTCPDPMDQLVVEIWTDVSTTPKHVLEFGLSEVIAWLTEFKRQVSHDVDFEHEDEQL
FT                   KDIWEKIDKYGSMKHRQELMGGPPVVPLHETDAIPNLRQEDCQYVNPGDHTKIPQANFS
FT                   LPNSGPHSPELDSLQWLAEELQAEEYNEKSEINAKNFEKFIPKPVEDTFENKDIDLLPV
FT                   NSDIISSLRMSGFNVMADLMDYSVEELSHFPNLSIESAKIIKNFLTEHKSSS"
FT                   /protein_id="XP_765653.1"
FT   gene            complement(<257838..>260456)
FT                   /db_xref="GeneID:3502481"
FT                   /locus_tag="TP01_0127"
FT   mRNA            complement(join(<257838..258248,258415..259217,
FT                   259746..260143,260219..260227,260446..>260456))
FT                   /db_xref="GI:71032024"
FT                   /db_xref="GeneID:3502481"
FT                   /locus_tag="TP01_0127"
FT                   /transcript_id="XM_760561.1"
FT                   /product="ubiquitin-protein ligase"
FT   CDS_pept        complement(join(257838..258248,258415..259217,
FT                   259746..260143,260219..260227,260446..260456))
FT                   /locus_tag="TP01_0127"
FT                   /gene_family="HOG000216514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-protein ligase"
FT                   /note="go_function: catalytic activity [goid 0003824];
FT                   go_function: ubiquitin activating enzyme activity [goid
FT                   0004839]; go_process: ubiquitin cycle [goid 0006512];
FT                   go_process: protein modification [goid 0006464]"
FT                   /db_xref="GI:71032025"
FT                   /db_xref="GeneID:3502481"
FT                   /translation="MKSKFAKVRIKGDNEMLSEYYEYLSDVSVLLVGAGGIGCELIKTL
FT                   LLTGVKKLTIVDMDTVDVSNLNRQFLYLPEHVNKYKAEVARIRALELNPKTEVKSLVCD
FT                   VNSWEPSDLTPFDVVLNALDNIKARSHINYCCIQSRVPLIESGSTGYNGQVYPIVKDMT
FT                   KCYECDPLPKTSSIPVCSIRQIPEKPTHCIAWARMLYQLLFGTPDNNNLLTDLSVPTLP
FT                   DLSNLDDKAVVDYLNKIFDFLFNSEVKSLQKMEEVWANRDPPKPIKHQFTLKRKASQID
FT                   KNSEYDLNSEDTRGRNKFVVLGMEELLDQFSTSVEAILNNPETLGSLVFSKNDQVCMDF
FT                   VSSAANLRMINFGIKPLSTWDVQSIAGAIVPAIAATNAIVASFQVVQLLHLLKFLKSNN
FT                   TLDSHCKKVWIKSSVMGSNPLVRGKLSQPELLEPPNPKCTTCQQKSYKVKIKSLDLTLH
FT                   EFVKSVLSESMGLEMVSVDFNLSNIYDGEEFEDDPEYAESVKKNSLAFYGLANNSILTV
FT                   TDLNGDSQFELVLKLDNTLKSNFLVL"
FT                   /protein_id="XP_765654.1"
FT   gene            <260734..>263452
FT                   /db_xref="GeneID:3502411"
FT                   /locus_tag="TP01_0128"
FT   mRNA            join(<260734..260906,261419..261657,261719..261786,
FT                   261959..262126,262247..>263452)
FT                   /db_xref="GI:71032026"
FT                   /db_xref="GeneID:3502411"
FT                   /locus_tag="TP01_0128"
FT                   /transcript_id="XM_760562.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(260734..260906,261419..261657,261719..261786,
FT                   261959..262126,262247..263452)
FT                   /locus_tag="TP01_0128"
FT                   /gene_family="HOG000135854" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA binding [goid 0003677]; go_function: zinc ion binding
FT                   [goid 0008270]"
FT                   /db_xref="GI:71032027"
FT                   /db_xref="GeneID:3502411"
FT                   /translation="MVDHTKSSVAHSLNSSDAISSSDRFSKTRTRHKNSDTANHAEAKS
FT                   FSNHSAKDNHNSTLRSDSISVIDFDPTLVSVDFYCNYCNQSLSVGGCRIRCAECLDYDL
FT                   CISCACNHKCTEPHNLTHNYVPIGPNSFELFSEGWTADEELILLEGIGKYGFGNWKQVA
FT                   EMVNKVNSKQKTPGECENHYYDVYISSGTSPHPNVKNLRTPIVSHIQLYSIIPKCVKTR
FT                   ESVYKYYDEVAKSHRRFENPDSESIVSSEESGSHSTFIPPAVNLLHSDPAKVKFFQNFT
FT                   GYNIYRDDLENEYHPDAELILKDVEFEPWDSPPEIQFKIQLIDIYNAFLDERIYRKRVL
FT                   MHRFWNDFMTRESAMANMTELEKMLYWRLSPLIRFHSEEDHISLTKLLIAKIELEKRLE
FT                   IVQQWKSLGLRTLKDIQEFDPLKNSAKTAAPKHLNHFSRVPSLSAKILRDGVVHKDELS
FT                   EYMNEINEKFCNEFYITKSHLDDILNSVSNAQTDTDFNYERPITHVWDLHFEDFNIENN
FT                   EPTPDIKRFPHPSDVPDNSNIRVILDPEKKEIDLSDMKFDNFKFGSVRHNAQQSNMQLH
FT                   AQSLFYLTRFYHERVKVQKNLQKPKIEQFPAKRRLSQRRFI"
FT                   /protein_id="XP_765655.1"
FT   gene            complement(<263881..>266103)
FT                   /db_xref="GeneID:3502412"
FT                   /locus_tag="TP01_0129"
FT   mRNA            complement(join(<263881..264069,264200..264335,
FT                   264443..264621,264823..265275,265362..265730,
FT                   265815..265970,266020..>266103))
FT                   /db_xref="GI:71032028"
FT                   /db_xref="GeneID:3502412"
FT                   /locus_tag="TP01_0129"
FT                   /transcript_id="XM_760563.1"
FT                   /product="protein disulfide isomerase"
FT   CDS_pept        complement(join(263881..264069,264200..264335,
FT                   264443..264621,264823..265275,265362..265730,
FT                   265815..265970,266020..266103))
FT                   /locus_tag="TP01_0129"
FT                   /gene_family="HOG000135853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein disulfide isomerase"
FT                   /note="go_component: endoplasmic reticulum lumen [goid
FT                   0005788]; go_function: protein disulfide isomerase activity
FT                   [goid 0003756]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:71032029"
FT                   /db_xref="GeneID:3502412"
FT                   /translation="MTKLSRKLIIFLIVIKLYTKSALAGLVLEVPEVAQSDFEDYVKKA
FT                   KRIPVVLNYPTLFIFSTGAINDFRNVSTLLSHDQKCEFITVESSTAFDGNITSLEPVLT
FT                   YVKDGETKKYDGPINPGYIMSWLSNQNVCEMRVKDLSNFKSFQKSLPSGHVQVLVLFAE
FT                   HDPKLVETVRSFIAEKDLAVPVLFSPEQTLSDQIVKSLSQEGIKYPTLLIMRNMSLLPK
FT                   ITFYTNDVRNKKELYEFLKEELIPPIHSTNSYMLPMFLVMKKTIVYIYTRDKELKKYLS
FT                   ESWINTVPRKHSEKLVFLHSKGSDLVENKMNTILAIDSDYEEIVVRAFVINLDTLEFYK
FT                   FKPLTIEDGTISEQGMNRFIDDLENDRLSHYVKSELPIPENIDRGPVKTIVGEDFHRRV
FT                   IESKDDILVLFLSSWCGHCHKAKRVFRDMGRRLKGSNGPILATFDAYNNEVEDMEISKH
FT                   IFPTIALFQSGNKSDPVFYNGPDNLEDISLFLEKNCKRNKVNAENILQKHVSQEQIFEF
FT                   HTEL"
FT                   /protein_id="XP_765656.1"
FT   gene            <266408..>270004
FT                   /db_xref="GeneID:3502413"
FT                   /locus_tag="TP01_0130"
FT   mRNA            join(<266408..266596,266860..267016,267046..267131,
FT                   267384..267509,267539..267682,267787..267933,
FT                   268021..268291,268422..268877,268953..>270004)
FT                   /db_xref="GI:71032030"
FT                   /db_xref="GeneID:3502413"
FT                   /locus_tag="TP01_0130"
FT                   /transcript_id="XM_760564.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(266408..266596,266860..267016,267046..267131,
FT                   267384..267509,267539..267682,267787..267933,
FT                   268021..268291,268422..268877,268953..270004)
FT                   /locus_tag="TP01_0130"
FT                   /gene_family="HOG000135852" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032031"
FT                   /db_xref="GeneID:3502413"
FT                   /translation="MAPRDSDLSNKFIVTKKIFISVLPDSNALIPEKFQTIAESDLPSN
FT                   IFLLDTPEDDNSWFKHIKVCRSTELLEEACSLYPKYWKVYYRHALYYIYKNDTHRASQV
FT                   FTEALKVLNDYDLHLKFLLFLYHTASIHEYIHSLINAIEMSGLDYRSDIIWREWALILV
FT                   KIYNCNLLSLNMTSGLLPDLFSMDPNVLKTPLIPSDTEQIAFRSPANFDKDKRTYLTLY
FT                   GEVNALRNLFHKWLRTPTNNMRSLWDAYSIFENTIDSSGTLSTKLLGDNKNIINLSMRA
FT                   YERITELYSKVYPIKAASYEGTVSSNSGVQVAIDNWMDIIKYEETNPLETDRQSLIERV
FT                   IFNFERALCPLVFSREMWYKYFQFLLFSDRRSQEKLRFVLALYLDESGEPERAHEHFAM
FT                   LVLPGLRGKTDLDQDLTGELKLRKLLQCKDFMSHEKSELGGIIHYLNFIRREKHVSEWR
FT                   EEVQLILSKSDLSSWDLYWYAASTEMRCFKDYDRAIQILKQAQTKISFNFNYTLLFLNT
FT                   MLNIGKHNDVRVLLSELIVGSLDKSSKITETDRGHLWNFWLNMEYLYGTAEQFNKVKSL
FT                   YVSSMISAKLSLDTFTEKFTQGSRPTVFALYSDITEAFEKASNSKRKMAQDLGAIVESR
FT                   RKLFCSGIDFEHLDNIFKFNITFGTSYSVDHNPTNIHTNHVSNTVSNTVSETSNVNVEQ
FT                   DQQDSVDLDNVDLVDNADLSDVDEASKLPKRINPNLQDNPKLKEFTHEPREYMTVIKYG
FT                   TKICRPNVSRLSEIEPKMTTSLESLVQLHGSKRPILPPKFRPLDSTGTPCKALFDFIRL
FT                   LPSSKDNKFSNLYVNTESIDYLIRTVENMDLGNIEIDQYQPLPTNLSNQLKQTVTTFYL
FT                   FLLL"
FT                   /protein_id="XP_765657.1"
FT   gene            complement(<270395..>271864)
FT                   /db_xref="GeneID:3502414"
FT                   /locus_tag="TP01_0131"
FT   mRNA            complement(<270395..>271864)
FT                   /db_xref="GI:71032032"
FT                   /db_xref="GeneID:3502414"
FT                   /locus_tag="TP01_0131"
FT                   /transcript_id="XM_760565.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(270395..271864)
FT                   /locus_tag="TP01_0131"
FT                   /gene_family="HOG000135851" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032033"
FT                   /db_xref="GeneID:3502414"
FT                   /translation="MIFGITPKWRRAPVIILLCYIFAYFNNLVHCIHLIPSYKLSFVGY
FT                   KFINKPRIPSEIRNFEPLISLPKHTENSFSLSSSFTLNSSFRLNSFFTDNLFNRPFSPK
FT                   NLFKSFFSNIFPSKFFSSSNLFNKSFFTSDSAKSCKNKSPLANFWSSLKSYLTSKFSSV
FT                   KGTKVSAAPKRFTRSEPYPRNDLSEHHTRNDLSEHHTRNDLTEPHTRNGELSDPYPRNN
FT                   DLRHLSFFEFFDNPPDKVGDYKIRKEFNESMTQESPYMELVRTGPSGIIKKFLKIAPSM
FT                   VKDAISLTVSTLIGSFYRYSAETTIITTTDRLAALILNLQITGYIYCNAEQRYRLSTLY
FT                   NLNPSTSPISSLNSQTNIGQPNVNQTNTNQPNVNQVNIGQCEQKEDFEGLSVGDELLSY
FT                   VRRLPRSYINGIFDNMNPEILYAMRYSTENAIQLLTVLNHNYLDVKDHQKLIIQQTGSF
FT                   AMQLCFWKLALGYCMRHQETKIELTKSLNSH"
FT                   /protein_id="XP_765658.1"
FT   gene            <272546..>274214
FT                   /db_xref="GeneID:3502415"
FT                   /locus_tag="TP01_0132"
FT   mRNA            join(<272546..272764,272823..273366,273411..273525,
FT                   273560..273612,273642..274084,274116..>274214)
FT                   /db_xref="GI:71032034"
FT                   /db_xref="GeneID:3502415"
FT                   /locus_tag="TP01_0132"
FT                   /transcript_id="XM_760566.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(272546..272764,272823..273366,273411..273525,
FT                   273560..273612,273642..274084,274116..274214)
FT                   /locus_tag="TP01_0132"
FT                   /gene_family="HOG000135850" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032035"
FT                   /db_xref="GeneID:3502415"
FT                   /translation="MVKRKYLLYLILLKCVFVHTKNRRIYSISPSLSQLSSFKIPENTL
FT                   FMHAKHKNSIKNSSRSRNNLTLHEDPPDDNYQQNDNYTHDNNDTHDDNYTHDNNDAYNN
FT                   NADSNNDTYNNNDVDDDKKEQDNTFINETQNQRDEPENYNRSDEPENQGDLKNTFVDDF
FT                   NQNVDTNMKEDSRENNSLANEYEPEKAQEHPDDNKEIVNDIAKEEQMKNMNTDAGDMIN
FT                   SAKQAKEHADELLNQYKEGEFNTETNKHTLPKDDAGNIIITNTTTTPMTKQEEKADPLK
FT                   SIRDATISLYERARHKNLPVPDPGDLSSPEKIYTSLNALEYIIDGYRYTKIDVNDKTEQ
FT                   SDSLNENSQPAETKEPEQMDESEVDLMEPDRFLQLKKSSDDDDEPDSEQNDDNEDDFHT
FT                   TEYDNEMNESDNEMNGSDEESYESDNGMNESDEESYESESEKSKGGTISAHEAMEDLRA
FT                   VLNQLSSVLEKVVQDNIGVRHVITKQIITSQY"
FT                   /protein_id="XP_765659.1"
FT   gene            complement(<274403..>275623)
FT                   /db_xref="GeneID:3502512"
FT                   /locus_tag="TP01_0133"
FT   mRNA            complement(<274403..>275623)
FT                   /db_xref="GI:71032036"
FT                   /db_xref="GeneID:3502512"
FT                   /locus_tag="TP01_0133"
FT                   /transcript_id="XM_760567.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(274403..275623)
FT                   /locus_tag="TP01_0133"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032037"
FT                   /db_xref="GeneID:3502512"
FT                   /translation="MSIENEFLDLFDSEVIKLTPVTLDIDTENSSDQFTLSIGPPGRLY
FT                   TCLKGYLINKILLNDTTIWETNEKSKYVIHVFVHEINGTIAWIELIKNHGFVYVLYNLN
FT                   YFDETNKITIDFSKREDEFQEDYMVFGSDFDLYYLERNGEVIKYTNLCDKRYIARRVKP
FT                   INKIIDFPSIIPCDNESISNSEVQDMANLKISEVQDMANLKISEVQDMANLKNSEKVVI
FT                   WKAEKESECAWAVSVCIRSIKERYFAILHKNTSYSLYQWNNSSDKWENKTEAKFNLADY
FT                   KFYFHYEKYARDIEDLLESCQTTLVGMEYHVLLNFHRKYKDVYGRDLANAIVFDTVNKT
FT                   LRIDFQNNKSVSLDVKNTNIKLIYNYQPIKKKPRFSMANDSYHKNIPITKHRSCLSLCP
FT                   IFEDSLL"
FT                   /protein_id="XP_765660.1"
FT   gene            <276006..>276365
FT                   /db_xref="GeneID:3502513"
FT                   /locus_tag="TP01_0134"
FT   mRNA            join(<276006..276210,276253..>276365)
FT                   /db_xref="GI:71032038"
FT                   /db_xref="GeneID:3502513"
FT                   /locus_tag="TP01_0134"
FT                   /transcript_id="XM_760568.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(276006..276210,276253..276365)
FT                   /locus_tag="TP01_0134"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032039"
FT                   /db_xref="GeneID:3502513"
FT                   /translation="MTYIVVCTKSIWDSPSPSNTKPILVGIFTDVHFQPLPKSSSSTIL
FT                   SPSSTVLSSCSTILSPSSTVLSSSGKFSDDLDPSPGCLELSLLELIASVFLRLFCSTNV
FT                   I"
FT                   /protein_id="XP_765661.1"
FT   gene            complement(<276893..>277540)
FT                   /db_xref="GeneID:3502514"
FT                   /locus_tag="TP01_0135"
FT   mRNA            complement(<276893..>277540)
FT                   /db_xref="GI:71032040"
FT                   /db_xref="GeneID:3502514"
FT                   /locus_tag="TP01_0135"
FT                   /transcript_id="XM_760569.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(276893..277540)
FT                   /locus_tag="TP01_0135"
FT                   /gene_family="HOG000135849" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032041"
FT                   /db_xref="GeneID:3502514"
FT                   /translation="MELFYTPSKSLYSKKSDVIAGQSLEDLTKDWHFSESFKSDFFHTS
FT                   NSSGGSNFTYTESKGYGSNSPSIYGSLMCNDMPWQSKWYLRFEPPKTAGELGIGQYWSY
FT                   EAPRLSEFAEGSKFDLSAAQTSGISHLGKTSLSNLKNMATIVLSGTTHESLKREAYRKE
FT                   SFKADSDADRASIVSSHLKMPASESGHEKLSILENFKINVAKTHKIKQNKKK"
FT                   /protein_id="XP_765662.1"
FT   gene            <277901..>279187
FT                   /db_xref="GeneID:3502515"
FT                   /locus_tag="TP01_0136"
FT   mRNA            join(<277901..278110,278283..278496,278538..278619,
FT                   278651..278996,279101..>279187)
FT                   /db_xref="GI:71032042"
FT                   /db_xref="GeneID:3502515"
FT                   /locus_tag="TP01_0136"
FT                   /transcript_id="XM_760570.1"
FT                   /product="ADP-ribosylation factor GTPase-activating
FT                   protein"
FT   CDS_pept        join(277901..278110,278283..278496,278538..278619,
FT                   278651..278996,279101..279187)
FT                   /locus_tag="TP01_0136"
FT                   /gene_family="HOG000135848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ADP-ribosylation factor GTPase-activating
FT                   protein"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA binding [goid 0003677]"
FT                   /db_xref="GI:71032043"
FT                   /db_xref="GeneID:3502515"
FT                   /translation="MASTDFISKVCSIDGNNFCADCGSRAPRWASVNLGVLLCINCSGI
FT                   HRTLGVHLSQVKSLTLDNLKPDWIKSLLSIGNNVANAYYLYKLPPEVSRYYASASPRLV
FT                   KMQLNLLSDMEIWIRNKYEKKLYAMDGLDEPFILLSKGYNPRESVLNRTLHNQPVPQYK
FT                   HSPKQPVADLLSIDETFGTRSNYEQIKSNLNDGLNPSYVDDFNPFSIDNTQRTNDIFWP
FT                   NDNQTRSYKDEPRETLGVPDIPEPEDSDKIRDAKIDAAKNSIAKLFQNPTQIGFKNSSY
FT                   NSIKPNCVSGDGLDFDSTNLKDNLQSLNRNL"
FT                   /protein_id="XP_765663.1"
FT   gene            complement(<279278..>279955)
FT                   /db_xref="GeneID:3502516"
FT                   /locus_tag="TP01_0137"
FT   mRNA            complement(join(<279278..279670,279806..>279955))
FT                   /db_xref="GI:71032044"
FT                   /db_xref="GeneID:3502516"
FT                   /locus_tag="TP01_0137"
FT                   /transcript_id="XM_760571.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(279278..279670,279806..279955))
FT                   /locus_tag="TP01_0137"
FT                   /gene_family="HOG000135846" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032045"
FT                   /db_xref="GeneID:3502516"
FT                   /translation="MFDCCSGANFLEAEETFLNHKTVLEEAGVNTNELNGLDATHYQIL
FT                   EPITQTRVIEVEKEYVEEKIVEVPEVQVVDKYVDVDVPVVKYKPVYKKKEVVVERVKHV
FT                   PKIIYEDKIVEVPQVQYVEKEVDVPQYVTKERIVKEPKVMVVERVIPILKVNKAKHAKE
FT                   VEGEGHEYLEDSYEGDY"
FT                   /protein_id="XP_765664.1"
FT   gene            complement(<280475..>280968)
FT                   /db_xref="GeneID:3502517"
FT                   /locus_tag="TP01_0138"
FT   mRNA            complement(join(<280475..280519,280618..>280968))
FT                   /db_xref="GI:71032046"
FT                   /db_xref="GeneID:3502517"
FT                   /locus_tag="TP01_0138"
FT                   /transcript_id="XM_760572.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(280475..280519,280618..280968))
FT                   /locus_tag="TP01_0138"
FT                   /gene_family="HOG000135845" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032047"
FT                   /db_xref="GeneID:3502517"
FT                   /translation="MQIFGLLLFLKLYYSFDFMINLTTRSLSHINLTNDFKDKRTGKLI
FT                   FFVESLNISRHQNSKKRINSCYTYVSVPSPFISLTYRNGTRLFAVPKKKPSKRRTKIRK
FT                   TAWMKRFPKNYKPDNSRKLAKFAKHRT"
FT                   /protein_id="XP_765665.1"
FT   gene            <281331..>282440
FT                   /db_xref="GeneID:3502518"
FT                   /locus_tag="TP01_0139"
FT   mRNA            join(<281331..281472,281505..282111,282160..282292,
FT                   282375..>282440)
FT                   /db_xref="GI:71032048"
FT                   /db_xref="GeneID:3502518"
FT                   /locus_tag="TP01_0139"
FT                   /transcript_id="XM_760573.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(281331..281472,281505..282111,282160..282292,
FT                   282375..282440)
FT                   /locus_tag="TP01_0139"
FT                   /gene_family="HOG000135844" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032049"
FT                   /db_xref="GeneID:3502518"
FT                   /translation="MKFGSKANFHFLLGNTKFLSKNAISPCEIQRFNPNLSQIYNFTIF
FT                   SKEQIKSKITIKIPHWLDISDSSSDLSFNPVSSNPESNKFDNGYDPEVLTDKPIVSEEK
FT                   GLKLINKQPLKKIRPFKLNELSVFNTDPYKLIKPIRKNPVLRHIWKLRVSSAYRRGIQK
FT                   RLVVGSNIIRHILTHTEARFDTILTTNKELIDFVLSNPLLNCRYSRIQLVDRYTLQYCL
FT                   RGTTHSYLSSDAIADAAIPTPNTNITPRFVVAIDNLKYARNIGSIIRTSLAFGVDLLFY
FT                   LNGTTDPFNWKVSSVTGGLQYSIPYRFGTPHITI"
FT                   /protein_id="XP_765666.1"
FT   gene            <282953..284351
FT                   /db_xref="GeneID:3502635"
FT                   /locus_tag="TP01_0140"
FT   mRNA            join(<282953..283042,283128..283283,283409..284188,
FT                   284284..284351)
FT                   /db_xref="GI:71032050"
FT                   /db_xref="GeneID:3502635"
FT                   /locus_tag="TP01_0140"
FT                   /transcript_id="XM_760574.1"
FT                   /product="mRNA export protein"
FT   CDS_pept        join(282953..283042,283128..283283,283409..284188,
FT                   284284..284337)
FT                   /locus_tag="TP01_0140"
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mRNA export protein"
FT                   /db_xref="GI:71032051"
FT                   /db_xref="GeneID:3502635"
FT                   /translation="MSFSRTTFDEQPQKFMLNNLPNDSISHLRWSTTTNPLLLTAGSWD
FT                   KTLRIWKVTTGLGNAVNTDMVYTFKQDAPVLCSAFSTDSMRLFGGGCTNNVLAYDLNNP
FT                   SSTGVVIARHQKPVSGVHWIPQFNLLLSTSWDGGVSLWDGRQENPVWSENLGAKVFASD
FT                   VKDNLMCVADSNRKLSVWSLEKLQHSNSKITIDSSLKLQIRALSLFPDTKVRSGVAYSS
FT                   IGGRCVVNYFTEEEKKNNFSFKCHRQDQPGKGTFTYSVNAIDFHAVYGTFVSGGGDGTF
FT                   TIWDKDNKSRVKAFSNLGAPVVDVKFMSEGNLLAFATSYDWYKGLNHSLITNTSKSIGI
FT                   VKLKEEDIKSKPRPFGSRR"
FT                   /protein_id="XP_765667.1"
FT   gene            <284648..>285310
FT                   /db_xref="GeneID:3502636"
FT                   /locus_tag="TP01_0141"
FT   mRNA            join(<284648..284760,284792..284891,284933..285060,
FT                   285244..>285310)
FT                   /db_xref="GI:71032052"
FT                   /db_xref="GeneID:3502636"
FT                   /locus_tag="TP01_0141"
FT                   /transcript_id="XM_760575.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(284648..284760,284792..284891,284933..285060,
FT                   285244..285310)
FT                   /locus_tag="TP01_0141"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032053"
FT                   /db_xref="GeneID:3502636"
FT                   /translation="MEERNNWIVNTRVLYDFISCIKLPQQPLSVEFTQTTVHQDYTDEI
FT                   SFQQIACGLQYETKDDVSIYIIDVFLPLKEELKRYCKCLDYEGFPLPTNTQFPMYQCVA
FT                   QIKLNDDVNRILSKNKDGNVLLAAKSTDGKE"
FT                   /protein_id="XP_765668.1"
FT   gene            <285547..>286458
FT                   /db_xref="GeneID:3502637"
FT                   /locus_tag="TP01_0142"
FT   mRNA            join(<285547..285568,285618..285729,285760..285793,
FT                   285974..286273,286337..286384,286414..>286458)
FT                   /db_xref="GI:71032054"
FT                   /db_xref="GeneID:3502637"
FT                   /locus_tag="TP01_0142"
FT                   /transcript_id="XM_760576.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(285547..285568,285618..285729,285760..285793,
FT                   285974..286273,286337..286384,286414..286458)
FT                   /locus_tag="TP01_0142"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032055"
FT                   /db_xref="GeneID:3502637"
FT                   /translation="MFIYDLSKNEPVYNYKHSGGLNCIDYSKTNESNCFVATEDGHVLL
FT                   VDTRQKTSHLKEIHLWDQRNLSEPLHSISVHKGPIVRLHFNQLNKSLISSGSEDLTICI
FT                   LDLESAGKDVDSSEYDEEDEEDDAPPELIFTHTGHQDKVYDFVWSKNQETENLIASVGE
FT                   DYSLQMWQMTSQLLEESSDFEMD"
FT                   /protein_id="XP_765669.1"
FT   gene            complement(<286532..>289021)
FT                   /db_xref="GeneID:3502638"
FT                   /locus_tag="TP01_0143"
FT   mRNA            complement(<286532..>289021)
FT                   /db_xref="GI:71032056"
FT                   /db_xref="GeneID:3502638"
FT                   /locus_tag="TP01_0143"
FT                   /transcript_id="XM_760577.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(286532..289021)
FT                   /locus_tag="TP01_0143"
FT                   /gene_family="HOG000135843" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032057"
FT                   /db_xref="GeneID:3502638"
FT                   /translation="MKILNVVFLIYLFFNKLIFLTKIATFVQSLSIYDEILPLNLTGTR
FT                   SYAVFDLFHDSDDYYPLGLSVKTINSTDKEFSVDDLIVFGKDVRIVFGDRCVSLSSFAK
FT                   NITMSLSRDNLKYTVKINYDLQGSKITKRYKQTSATLPGDVKCFKFVEVIQGESDSDVL
FT                   GKPALESFKALDVEHESETDEATGAGADRQSVFTTRPITAGTGRSITLYGPTPPATPST
FT                   QLEATPSTQREVTPAVQTPEPTTHRRSAGTSRPTFASSGSRAISLYSHHQLVSSTSDDT
FT                   AASSEITVAPSSEISVTPSSEISVTPSKAIVTTSEPKTKSAQFIEVTKDDLSGTEGYVD
FT                   AEVVKAGPLDFRCVLFKNTNNLYDKLSFNQYKLDLPKGAESFEICYTRSVPKTESISRA
FT                   SKNYRIVVSSQISSITVEQFYICKKEFFDSGLYPFHDYNFFQKLKTYPERRVKSDSNPA
FT                   SSSEFILNMDNFQPSDDSFLEKVNCGKCVVYRYIDGLEIDNRMGTVTALKFGNFNFKIP
FT                   EGKRFIMASLCTQFLTTKHVTVMMRELFLYENRVFYSVDGSKYQERKFLEDEERLQLIN
FT                   LTSKVWHKRESNGKMGPIDNPVDDEVQVLCLNQFVKTNTPKIHKACKKLDKLDNFKLLF
FT                   TDGNFTNLAFKKRAAKSSIIIGNVMFDLKTDNDEDQFIYISHPPNEPVNVLVLGPKSET
FT                   HSVGEKDPGSNLFGPMTDSLAKVQPGSSKKHLNIGAYNTTMYDITWNFSDFLKKHYLYP
FT                   SQFPQYCLGDIVFNNLRILSHKDEGYKHISATDRKQLTTVTVTTILGDSRLVLLVKVDA
FT                   ERNTVVEVLEQPTGQSD"
FT                   /protein_id="XP_765670.1"
FT   gene            complement(<289429..>293085)
FT                   /db_xref="GeneID:3502639"
FT                   /locus_tag="TP01_0144"
FT   mRNA            complement(<289429..>293085)
FT                   /db_xref="GI:71032058"
FT                   /db_xref="GeneID:3502639"
FT                   /locus_tag="TP01_0144"
FT                   /transcript_id="XM_760578.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(289429..293085)
FT                   /locus_tag="TP01_0144"
FT                   /gene_family="HOG000135842" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032059"
FT                   /db_xref="GeneID:3502639"
FT                   /translation="MRNLRKSLLLILLSFSILIQNYKPVSGLLCLGTTALSTICLAPLM
FT                   WRGMKQIGYFFGSVGYLFQVKCGNYKKYCTTDDIVAGKYVKLDLASKEHGRFITVTDLD
FT                   DDKTNMRTKIKLYEVKSTEKEDYSKYTIGCVNFYCRKLQCDLKYTYRTVLTYVDEKNRK
FT                   CIQIESFNQDGNRIMRRIFRERSCAWWYDRILNEKETFLKSFINFNWSKFNQDKTIFKL
FT                   NIYLLSLPPFISRVRFSKGYYYYLKAENGKITNLSEVIFSDTPFTISKGFNDLIVWHYC
FT                   TETDGKINTSYVVICQLIGTGWTCSYNKCISQDRKEFKSYESFGIPFDQNVSIGTPGSD
FT                   SPPVSSRNYNKFRLNFDLHNKNVPDNIDKLSLHLYTQSDHYTLRPRELNTTNLMEYVQI
FT                   HHAKGNTILKHEPIDSFQLLSVKKYGDEYFLSFSALGYETIGFHTINMEKPNSTKSEYN
FT                   DTIEWFYETNTRSFMENFLSPHYMIFSFLKDNQSSGEGSNEEKYPNLEFMELDLKQLDK
FT                   GHILVAKYNDHVTVYSSLYSKYNVFKKLKLDSQTLDIPFDFNSQVFYCEGQNSKFVVIS
FT                   HINKDLTIFKQKASHEFEITPTNKMGEDISNVNLIEVLNLNINNEWINLTLNLNDSYVS
FT                   DDIEVLIPSYNVVVFKTQYGKRIEKVLTKNKIFEIKSGWPLVSKIMYMEHTFLLIDTVL
FT                   KNEIRRELYKINHKNDEVLLMSNAKIEYSINELNLESMAKKLYDSLHDLYPNTLPVKMN
FT                   FDYPKIDVCEFDVDNMTVYYSDNDLILNPGELTAYDNDYKVLTKHKWMQIFRLKDQNND
FT                   YLYKIFMLSHKGIYSFYCHKDDSGYKEFRRDNYEDSSESSQTPEIPLLIESVYLPGISV
FT                   TKTKVGANIIKIYKSSTKVLNPIIFGRHEIKLIGSFSKVDVTRSINGNLVSISIEAMFS
FT                   DNKKGTLIFTQISPNSDEYKLAEDPKIPFIDNSVDMFERTMNQSEQEVLDFNEGKYPLD
FT                   LRYMILNDDYYYFTGYTRSKKFEIKFGEQTHTINCQKTRYHIWVRYPYSNVKTCVFLMT
FT                   YKSAGSLKTVSQKHDNSDSTYEIKRPGVRINWGILSNLESSVVNRNLLSMIGYIEEIFP
FT                   IDLVIDGTGIDSSILKLEIDKNTTVYTTISKSKRVINNVKYKTVIIKGVPKQLAKQVFV
FT                   SKNESELLIVIATKTVNKSLVKAYKLMSDTFEMLDLKDIDYKSHKGLEIFKK"
FT                   /protein_id="XP_765671.1"
FT   gene            complement(<293446..>296477)
FT                   /db_xref="GeneID:3502640"
FT                   /locus_tag="TP01_0145"
FT   mRNA            complement(join(<293446..293645,293703..295347,
FT                   295399..295544,295587..295722,295773..>296477))
FT                   /db_xref="GI:71032060"
FT                   /db_xref="GeneID:3502640"
FT                   /locus_tag="TP01_0145"
FT                   /transcript_id="XM_760579.1"
FT                   /product="histidyl-tRNA synthetase"
FT   CDS_pept        complement(join(293446..293645,293703..295347,
FT                   295399..295544,295587..295722,295773..296477))
FT                   /locus_tag="TP01_0145"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histidyl-tRNA synthetase"
FT                   /note="go_function: phenylalanine-tRNA ligase activity
FT                   [goid 0004826]; go_function: ATP binding [goid 0005524];
FT                   go_function: tRNA ligase activity [goid 0004812];
FT                   go_process: phenylalanyl-tRNA aminoacylation [goid
FT                   0006432]; go_process: tRNA aminoacylation for protein
FT                   translation [goid 0006418]"
FT                   /db_xref="GI:71032061"
FT                   /db_xref="GeneID:3502640"
FT                   /translation="MTYLTLDCNKLLSIDDLCLVGLSKVYISIEPELAKKINLNLEEIN
FT                   STPKCNNSTDFDLSFVDREYLKSRMICCNILQQALRWKPKPNSLFITKLVKALNTNSNF
FT                   KRFPSDKTLYNGDLSYTQSPGIPRMLSTVTSPKSDLNNPSEILQKEVGLSSDELNSLVN
FT                   SQTEFLSNVSVLGSLLKTMSNLSDLNMGLLCESISVPYDFLLLPELQKIPNVMETVRNI
FT                   LWLTEDSKLIPKKGGDKNLKSLISTQLVHTSELRSLSQSILKEVSKMFSSLCSNLVQPE
FT                   LQNVVDKAWSASLDSQLNALLYSLKNVVVLYNEILPLVFSKYSESYNNGVENCVDGLSV
FT                   ESLEKSLNKYNELFSSFKEKWNNLPKPTLTSLEYLADLYNDYSSLSLCVSVNMLNLKEL
FT                   NDQKAYEKKAKSSKQVQKSVLGHGNELYKDFLDKEVCKGVKYCDSGVWDTLSRTLSGSS
FT                   LLSLCNKFEALLVPQNQKTRLPKLPKGTMDFCPNEVLTRRVVISSIKDIFRQHGAVEIE
FT                   TPVFELKETLLGKYGEDQKLIFDLKDQGGEQLSLRYDLTVPFARFVAMNKMEKIKRFHI
FT                   GKVYRRDEPQLARGRYREFYQCDLDCAGEYPKMVPDAEIIFILVRVLRLLKGGSFAVRV
FT                   NHRAILDAVLLHCGVEVSMHRTICSSIDKLDKLPWDKVKLEMTSEKGLPEYIADKIKEF
FT                   IEINGTFTEVLEKLRDKNVTTLTKDSSVTSVKDKSDGNVLDEMALLWSYLEAFGVKESE
FT                   VMFDMSLARGLDYYTGVIFEAFLKDEEVGSVGAGGRYDGLIGMFSGKNVPAVGMSVGIE
FT                   RLFRTMPKQNSGDLTDVFVCSVGSPQMFFERMKLVGMLWSHGIRAEFLYNINANLRKQL
FT                   DAATDKGVSLMVLVGDSELETDTVKIKRLSYNEEERLEDLTVKRSELVNTLKSLLSDNT
FT                   KYDKLVKTLFNPK"
FT                   /protein_id="XP_765672.1"
FT   gene            <296612..298957
FT                   /db_xref="GeneID:3502801"
FT                   /locus_tag="TP01_0146"
FT   mRNA            join(<296612..296947,297119..297547,297604..297813,
FT                   297875..297987,298017..298157,298222..298379,
FT                   298437..298559,298630..298682,298722..298868,
FT                   298898..298957)
FT                   /db_xref="GI:71032062"
FT                   /db_xref="GeneID:3502801"
FT                   /locus_tag="TP01_0146"
FT                   /transcript_id="XM_760580.1"
FT                   /product="ATP-dependent RNA helicase"
FT   CDS_pept        join(296612..296947,297119..297547,297604..297813,
FT                   297875..297987,298017..298157,298222..298379,
FT                   298437..298559,298630..298682,298722..298868,
FT                   298898..298927)
FT                   /locus_tag="TP01_0146"
FT                   /gene_family="HOG000135841" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent RNA helicase"
FT                   /note="go_function: nucleic acid binding [goid 0003676];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_function: ATP binding [goid 0005524];
FT                   go_function: helicase activity [goid 0004386]"
FT                   /db_xref="GI:71032063"
FT                   /db_xref="GeneID:3502801"
FT                   /translation="MDFLDKNPDNNTSISQHLDNSNLKWKDVDIPGDLFSEGLISLEVL
FT                   DNAQNHQDSKTNSVKPISKVRNHKQKPENDKIPQQKEVTIDYEEVNKKTKPWINVLGQD
FT                   YTIPQQILGSGKTLCFVLPIVISLLSQKTENKIEALVILPTRELAVQVKKIFFMILEGV
FT                   DIRVLSIIGGISVQKQERLLKKDPSIVVATPGRLHDFVNDGKLRGLFQLRYLVLDEVDK
FT                   FFEDNSYKDVQLIVKYVKNSKIQYFLSSATILNMKEDLNGLFKLLSITNPTVCICSKDN
FT                   QLSIPYDKLTNKVLYKKLYARSLTKVLMPENLTFQLLESEDKYKEVRLVGYLVDYLCNF
FT                   ESKKCIIFVNTITYVYRLESLLSLIFWKDLHELRLKRKYCATFDLDTKLDYVAGIHSRL
FT                   RQKQRLNRLEKFSSNKKSILICTDVASRGLDIPNIDIVIHFYPPKNKSLFLHRSGRTAR
FT                   LKSDGVSVCFCTPNDRELWKKLFTAINKNVDKIDKIEEIPRDKFMKLKDLLQLAEVIEK
FT                   SEFKMSKEKSIQSWFQNAARRAEIILSDDESEEETKRQRSYKAMKSEKRKLLKIRSEFG
FT                   IDN"
FT                   /protein_id="XP_765673.1"
FT   gene            <298722..>299864
FT                   /db_xref="GeneID:3502802"
FT                   /locus_tag="TP01_0147"
FT   mRNA            join(<298722..298868,299052..>299864)
FT                   /db_xref="GI:71032064"
FT                   /db_xref="GeneID:3502802"
FT                   /locus_tag="TP01_0147"
FT                   /transcript_id="XM_760581.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(298722..298868,299052..299864)
FT                   /locus_tag="TP01_0147"
FT                   /gene_family="HOG000135840" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032065"
FT                   /db_xref="GeneID:3502802"
FT                   /translation="MSKEKSIQSWFQNAARRAEIILSDDESEEETKRQRSYKAMKSEKR
FT                   KLLKNISTALSYPITCKIDKLKSKFINSRFREINVEMKLNVMFLHGLMQTTEMLSESFS
FT                   NLNKSLSRMLNVTYLKAPFELTEFPAFCKMSSEKTDEEVRKLEKSIRANYYSRKGRKNT
FT                   YGGTWFFTDFDGNYSPQLRNVKIIGLEESLDFVLNECKRTNCDGLLGFSQGSLISTILA
FT                   KKTLNDPSLGWKAKFCILFSSPMPYATSLSTFLASGDKIQTPSLHILGKSDIMVPNHRS
FT                   LLLSECFVNPIVHYHEGGHDVPHFDDISVYENFLSKFL"
FT                   /protein_id="XP_765674.1"
FT   gene            <299909..>301598
FT                   /db_xref="GeneID:3502803"
FT                   /locus_tag="TP01_0148"
FT   mRNA            join(<299909..300254,300324..300493,300525..300656,
FT                   300706..300774,300947..301196,301234..301374,
FT                   301450..>301598)
FT                   /db_xref="GI:71032066"
FT                   /db_xref="GeneID:3502803"
FT                   /locus_tag="TP01_0148"
FT                   /transcript_id="XM_760582.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(299909..300254,300324..300493,300525..300656,
FT                   300706..300774,300947..301196,301234..301374,
FT                   301450..301598)
FT                   /locus_tag="TP01_0148"
FT                   /gene_family="HOG000135839" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032067"
FT                   /db_xref="GeneID:3502803"
FT                   /translation="MSRRLANFKLPNIVTPKPRTGARRTSREKKEDESQDKYTSAYSLL
FT                   QTSYKISEEDYRKYGVEHGLLPPYLSNPDSFKVDSRNLYTSFDNCNIYNVGSVVKLDTN
FT                   DLFNELPEGLCGDMLKDISLLPESEPLGLLNRKPAVEIISQLKQYSQGSSESLRSRGIL
FT                   LDGKRGSGKSFILNHVSLWARRNGWMVIHEPCASKYSTEVGTIKRSNAGVYIQLEFART
FT                   FLERLLMKNEQHLSEIPELECTREKLKLWHSYRKQFRIPVLSLDFNIYILLNYSDRLQN
FT                   PLKLVDIANFGVNNETFANQAVYEIFNQLKHQTKFPLLFIIDEYNECFTASEYLSIKYE
FT                   NTKFNGWIPSYHLTMPRLFHKFDGDHYRNATSWSKRKRKKFRPEYLGILLVLGFNILLA
FT                   PMKLGLSVTSLPGSLQTIS"
FT                   /protein_id="XP_765675.1"
FT   gene            complement(301779..303840)
FT                   /db_xref="GeneID:3502804"
FT                   /locus_tag="TP01_0149"
FT   mRNA            complement(join(301779..301948,302013..302073,
FT                   302130..302227,302263..302378,302469..302601,
FT                   302691..303840))
FT                   /db_xref="GI:71032068"
FT                   /db_xref="GeneID:3502804"
FT                   /locus_tag="TP01_0149"
FT                   /transcript_id="XM_760583.1"
FT                   /product="serine/threonine protein kinase"
FT   CDS_pept        complement(join(301814..301948,302013..302073,
FT                   302130..302227,302263..302378,302469..302601,
FT                   302691..303827))
FT                   /locus_tag="TP01_0149"
FT                   /gene_family="HOG000135838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_function:
FT                   protein serine/threonine kinase activity [goid 0004674];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71032069"
FT                   /db_xref="GeneID:3502804"
FT                   /translation="MTHYDDENKMYDNEKLNSEDGYYRKRDSSRINDRRRSSRRKYSSR
FT                   RMYHSSNYRHKRRKHSRHKSYSSSPSYSRSSTHNTTEPSDSIHRSRSKSSKDSSESDTR
FT                   SYSDRNHRRYSGSSSLDRRRYRNHNKYSHRHRDRSRDRYRYRDRRYSRRSHRPSRRYSH
FT                   RRDYSRSYRRRYRRSYSPSHRHKYSHRDRYSHRHRYSGRDKYADRAKSPTDEIIHFKWD
FT                   KGMNLSEYVVLNKVSDGTFGRVLLCEKEGKQFAVKVVRDVDKYTQSAKIEADILLDIKS
FT                   SDVNSESHCVVLHDNFMYRNRNMCLVFEKLGPSLYDFLEKNDFKGFFISDIQNMAYQLL
FT                   KGLSFLKKKRLVHTDIKPENILLVCGKDDFIEVPFPRSHTGMTTKRPAMSDIKLIDFGS
FT                   AIYEDEYHSSIINTRQYRAPEVILDIGWSYSSDLWSLGCTLMELYTGHLLFRTHSHMEH
FT                   LAMMEKTLGKFPEEVINSAKNTQGKNYISPNEPRLNWPEGAKSKSSVHRVEECKTIMDL
FT                   VKPEHRLFGEFIRYILNLDSNKRPTPEEAMQHEFFTLKLPEN"
FT                   /protein_id="XP_765676.1"
FT   gene            303901..305454
FT                   /db_xref="GeneID:3502805"
FT                   /locus_tag="TP01_0150"
FT   mRNA            join(303901..304017,304057..304142,304171..304296,
FT                   304335..304484,304572..304660,304692..304748,
FT                   304782..304865,304905..304979,305010..305080,
FT                   305110..305235,305335..305454)
FT                   /db_xref="GI:71032070"
FT                   /db_xref="GeneID:3502805"
FT                   /locus_tag="TP01_0150"
FT                   /transcript_id="XM_760584.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(303917..304017,304057..304142,304171..304296,
FT                   304335..304484,304572..304660,304692..304748,
FT                   304782..304865,304905..304979,305010..305080,
FT                   305110..305235,305335..305413)
FT                   /locus_tag="TP01_0150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032071"
FT                   /db_xref="GeneID:3502805"
FT                   /translation="MSLTWSESDVNNLIKFAKQSFNNNDRANLEKCVRNGSCSEYSPHS
FT                   DSLKLDKNQNNNFKRGEDDLVGQLLDDLWSSYGKISLFLEEVIESASATYRNIVNKGVK
FT                   QGLSLPSDSDYNIAFLSWKNQLNKYLKRYVIQQLQSESIKMSRQGSLFSLKNEYNNFDG
FT                   ETISNLMFNSFTVVNNFTGQSSNGTFSELEFMEYNGLFKRVEKSTDLFYDNCFVLWLNS
FT                   SQLDKTKHKNTKMVLEKLCEIPYELTNKCKILLQVISSVCVTYMEAGKSSIMPHVDGEN
FT                   NGVQFTCLYVPKSPPDSSIDITINQNTHTVNFQNDQLIILGKNVKYEIKKVKEKCFIFM
FT                   AWLTGPD"
FT                   /protein_id="XP_765677.1"
FT   gene            <306760..309053
FT                   /db_xref="GeneID:3502885"
FT                   /locus_tag="TP01_0151"
FT   mRNA            join(<306760..306976,307011..307162,307226..307317,
FT                   307390..307570,307601..307636,307741..307920,
FT                   308045..308252,308340..308533,308659..308868,
FT                   308948..309053)
FT                   /db_xref="GI:71032072"
FT                   /db_xref="GeneID:3502885"
FT                   /locus_tag="TP01_0151"
FT                   /transcript_id="XM_760585.1"
FT                   /product="biquinol-cytochrome C reductase complex core
FT                   protein I, mitochondrial precursor,  putative"
FT   CDS_pept        join(306760..306976,307011..307162,307226..307317,
FT                   307390..307570,307601..307636,307741..307920,
FT                   308045..308252,308340..308533,308659..308868,
FT                   308948..309034)
FT                   /locus_tag="TP01_0151"
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="biquinol-cytochrome C reductase complex core
FT                   protein I"
FT                   /EC_number="1.10.2.2"
FT                   /note="go_function: metalloendopeptidase activity [goid
FT                   0004222]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:71032073"
FT                   /db_xref="GeneID:3502885"
FT                   /translation="MGVFSKIGRVSPDVSTLIVNKCARRTLFTNRHNYVSNPRFNLTLK
FT                   RNVTTSLATDLFKDSKLHPNALNQPPCHVTTLKNGLRVATVWMPGSSSTVGVWIDSGSR
FT                   FETPETNGSAHFLEHMIFKGTKSRSRHQLEEQIEHKGAHLNAYTSREQTAYYARCFNND
FT                   IPWCTELLSDILQNSLIDPDHMENEKHVILREMEEVEKSHDEVVFDRLHMTAFRDCSLG
FT                   FTILGPVENIKNMQREYLLDYINRNYTADRMVFYTPIIISQVLCAVGNFEHDKFVSLAE
FT                   KHFSTIPKAVTKVELEKPYFVGSELLERNDEMGPYAHIAVALEGVPWNSPDSVAFMLMQ
FT                   SIIGTYNKSNEGVVPGKVSGNKTIHAVANRMTVGCAEFFSAFNTCYKDTGLFGFYAKAD
FT                   EVAVDHCVGELLFGITSLSYSVTDEEVERAKRQLMLQFLSMTESTSSVAEEVARQILVY
FT                   GRRMPVAEFLLRLEKIDAEEVKRVAWKYLHDSEVAVSAMGPLHGMPSLVDLRQKTYWLR
FT                   Y"
FT                   /protein_id="XP_765678.1"
FT   gene            complement(<309189..>311801)
FT                   /db_xref="GeneID:3502886"
FT                   /locus_tag="TP01_0152"
FT   mRNA            complement(<309189..>311801)
FT                   /db_xref="GI:71032074"
FT                   /db_xref="GeneID:3502886"
FT                   /locus_tag="TP01_0152"
FT                   /transcript_id="XM_760586.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(309189..311801)
FT                   /locus_tag="TP01_0152"
FT                   /gene_family="HOG000135837" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032075"
FT                   /db_xref="GeneID:3502886"
FT                   /translation="MYDSSESLAKEFLKLIEYLSNNSRSAYNGISISKIPDFSAEIPNQ
FT                   TQIASKLEAELVTLLDEFDISEPLNFNLYDVLRDYDRYFNSKNKIPFEYVNEIVMSVTL
FT                   GSKDFSSVLQLLFLLRDKACFLDGQFTNNPLPDVPSNDFQINKEKSEELMLDEFLSSQL
FT                   RQLYYSPLILESDTAFTPTNINLPSYNNNQTVDNKRSDTNVLDDSNIPSDKNDLSYVVN
FT                   GTEMSESDSPYSLVSVDDNVLAEGDLVLDMLYLLKGVDGKYFKRMRTYYSLVNPTLKIS
FT                   SDFKFVISKIIFVADLYNTVKLYLNQLNSSNPTNSHSLQSQYNLKNSNNLQKLYNNLSG
FT                   IKNADPILNCLLQAIVEELTGYAKLLDLLLLNFGDYLTLLQLYSLLHKPYRKIRIIYSL
FT                   VTCDHVSPNALYRLTFTGNYEHRGLYLRLLKKSLVPFFEVIFRWLYSGELSSVASNMGF
FT                   FINFSDGCFTFDSSKLFHFFPKTLAEDIFEKGLLFNQLKRLKKSNLPTPTLNSFLQLLN
FT                   LQSALSQLQNNATHTNGNTNTTSVNTVNTVDEVKDNEEWSLEYTLTTLKNIVSGLRYSE
FT                   DIASTLIKDYQLLDFINNSLLYSIIPNPCPKKDYTSNYTNNILNKAMDSSKLVEGLGNL
FT                   RDNLELIRSFPYSLLFDDSYDFINSLMSLSSLFNAAVDSLNRIFLDYIWFYRLSTGILD
FT                   LSSFFNKINFYRSEMISFMFSVQPFHDVKFHFNIFKEDVQRSKDLSNLRDSLSKFKKNI
FT                   KSHLFPSLTDCFKNILDFSSSISRIFTSLNKIQSTSNCTSGINGANNFRNYLDKLMDDM
FT                   DPVSVVKYIEDQLMDESISSCCLQYGLDFRKNVTKLSRGPLALPLMDFNNYYIINKCN"
FT                   /protein_id="XP_765679.1"
FT   gene            complement(<312143..>314968)
FT                   /db_xref="GeneID:3502887"
FT                   /locus_tag="TP01_0153"
FT   mRNA            complement(join(<312143..314646,314761..>314968))
FT                   /db_xref="GI:71032076"
FT                   /db_xref="GeneID:3502887"
FT                   /locus_tag="TP01_0153"
FT                   /transcript_id="XM_760587.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(312143..314646,314761..314968))
FT                   /locus_tag="TP01_0153"
FT                   /gene_family="HOG000135835" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032077"
FT                   /db_xref="GeneID:3502887"
FT                   /translation="MKLLISIYRDALGKDLRGPIGRANGYNLQQILYNNNRIFGNLHKF
FT                   ENFRNVFGSAPVSSESVTFIIFWKGIEDVLSGKHPSVSLAMPEILYKCCFVDDEYVISL
FT                   RFFRDEILKTESSFSKTELLESIRKAQKNSNLHDFWSKVFENSVKMFDSELVSVSDIST
FT                   MLFGFLVKKYSYDVYLVSESEPSTTFSTDYDHISSGNASDTNNTTSETVSNTPISDESN
FT                   PLSDSVIFTSKHFESTWSNVDTSVNTNYTSNNSTNNAKSNVNSMNVNSAKDNVKNAKDR
FT                   AMELCEADDSWDYEYKYRKLLSDLEGCLPRFYTYYSEAKCELTTSKEEIRRLLELNEEL
FT                   NEKLTKEKNSFVEKNSLLNSEMESITQQNQQLNDFIINKDKEIETLKQQLEELSAKFDS
FT                   SDYGKATRELQVYIAKSEGLLKSNEALKDKIFNLEAALNQLQNNTTHTTTTNSTSVNTV
FT                   NMMDEVDKDSQLSVQKDEITKLTNELNKLTNQVCQLTDELSQSKIEITGLKEANSNLEG
FT                   DNLRLKEYNSKLESEMKHETSLLRNDNLSLTNSNSELRNTNGELLNTNNELIINNNELK
FT                   ITNDELINSNMELTHNVELLKRENQLLEAEFDKVKCENVSLTSELNELNEKLKLIATKN
FT                   PNQEDFSSDYNKAKLDIIDLETRLEELSRKNEYLMELYEQASAENLKLVSKLEILNNPS
FT                   PTDAKNKLVDLVKNYQKFDDLQSPLSYESESTDCDHSPNCSTASGEGSTNTLSNNFHSN
FT                   TLNSHSININPQSNLEPTVQHYVNEDVKNERIKISPELASIRQMNTINALKRGLVNLNS
FT                   GNRAENFHSHGSKKLVQRRINGFKRTDSMNQNSIGSSFRNNQSLINYDKLSLNKSDESL
FT                   NAYDELGIEEQQEPDIIKNTFSFIYKKLNLSQ"
FT                   /protein_id="XP_765680.1"
FT   gene            <315515..>315951
FT                   /db_xref="GeneID:3502888"
FT                   /locus_tag="TP01_0154"
FT   mRNA            join(<315515..315929,315947..>315951)
FT                   /db_xref="GI:71032078"
FT                   /db_xref="GeneID:3502888"
FT                   /locus_tag="TP01_0154"
FT                   /transcript_id="XM_760588.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(315515..315929,315947..315951)
FT                   /locus_tag="TP01_0154"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032079"
FT                   /db_xref="GeneID:3502888"
FT                   /translation="MSNVGVNFGRFIRIRSLSDPSIQLLHFKRTLGFLRAAKSGGAHML
FT                   VLGTKHQKSLNYQQLLSQKFDNPTKVTPEIITNAPLNYDVILCFDPIRYAKLLYNINLP
FT                   CVAISKVEDFYHHRDIPDAFDYLLPLTEDFLDISI"
FT                   /protein_id="XP_765681.1"
FT   gene            complement(<316633..320126)
FT                   /db_xref="GeneID:3502889"
FT                   /locus_tag="TP01_0155"
FT   mRNA            complement(join(<316633..316986,317097..317934,
FT                   318002..318683,318866..319090,319212..319307,
FT                   319318..319665,319878..320126))
FT                   /db_xref="GI:71032080"
FT                   /db_xref="GeneID:3502889"
FT                   /locus_tag="TP01_0155"
FT                   /transcript_id="XM_760589.1"
FT                   /product="DNA repair protein Rad3"
FT   CDS_pept        complement(join(316633..316986,317097..317934,
FT                   318002..318683,318866..319090,319212..319307,
FT                   319318..319665,319878..320019))
FT                   /locus_tag="TP01_0155"
FT                   /gene_family="HOG000205390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair protein Rad3"
FT                   /db_xref="GI:71032081"
FT                   /db_xref="GeneID:3502889"
FT                   /translation="MVRFWIDGIEVFFPYPKIYPEQIAYMKSLKTALDSKGHAVLEMPT
FT                   GTGKTVALFSFVSSYQLARPELGKLVYCTRTIHEMEKALLELSEVISYRNSQLNIHHSS
FT                   SYGGSSSYKTNTNENPNSKDINSVKNINSVKEVKEEKKVKVKMELDVDGPKNGKIFDLK
FT                   NYFLAVGLCSRRNLCIHPEVSSHADRTKIDEKCCDLTSVWRRMQFEDLEDKKRNEYTLD
FT                   YEGSRPIRRRPSASAVQEIPDIEEFNSMGLCGYYETMERIWNPTFIPSGVYTLEGLKEY
FT                   CLKYKDSRTGRASPICPYFAARRAIDNANIVVLNYQYLIDPKVSDAVFYHLCTENYLKE
FT                   KREDKDSKPKLPIVVVFDEAHNIDNVCIEALSVELSTETLDNAYSDLSRLEDNVRELRL
FT                   RDQELLLEEYRRLVETTDFGSIDIEGYMNPVLRQDIVDRAIPGSIRKAEHFISFLKVVI
FT                   GYLKKYIKVKEAKSEGPLMFLYRFESQCKFKHLHNLHTIKFEHETGINSDVMEHTYNRM
FT                   KSLLNTLKMTAVGDLTSLHLVVDFCTLVGTYYNGFIVIVDPFPKATSYDPLLQFSCLDA
FT                   SIAMKSVIDNFQSVILTSGTISPLEFYPKILNFTPVLMQSLPMSLDRDCLCPIIVSKGA
FT                   NQVHMSTKFDLRTDITVLRNYGSLVIDLCKHIPDGVVCFFPSYAYMELILSHWYETGIL
FT                   ASIMEHKLVFMETKDSVTTTLALYNYRRACDVGRGALFLSICRGKVAEGIDFNSHYGRC
FT                   VILVGIPFQYTLSKVLKARLDFMRCNYGILENEFITFDAIRQSAQCVGRVIRNKADFGL
FT                   MVFADARYTRIDKKSKLPPWILKNMDPSNLFLTTETAVSVAKAFFRNMSQEYVPSKHTR
FT                   MGQEILNDEQRCWATVQRVLNLK"
FT                   /protein_id="XP_765682.1"
FT   gene            complement(<320342..322034)
FT                   /db_xref="GeneID:3502890"
FT                   /locus_tag="TP01_0156"
FT   mRNA            complement(join(<320342..321064,321182..321295,
FT                   321397..322034))
FT                   /db_xref="GI:71032082"
FT                   /db_xref="GeneID:3502890"
FT                   /locus_tag="TP01_0156"
FT                   /transcript_id="XM_760590.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(320342..321064,321182..321295,
FT                   321397..321582))
FT                   /locus_tag="TP01_0156"
FT                   /gene_family="HOG000135834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032083"
FT                   /db_xref="GeneID:3502890"
FT                   /translation="MFLYDIFSNFINFVLVPIYEALLAMFRRVSSLLTLTPTHLIEEYE
FT                   SKYGSIHPKIFLGSFEEARRVSLHSGKMIVLYIHSEFNDHVCRNLFTNQLIIEVIDTNY
FT                   IFYMEYYKGASMRKMMDLVNCMTVPHLSVLSFQGLNRCTVVNRLEGSVEHDALVSMLLG
FT                   SVEYQPPPERAESSREVIREQDEEFRRAVEIDSVKFKERDIKRRDEAQRRRTQELIKRQ
FT                   KKEEREKILEHRKELAKVYTNVFDKFERKEVKIRVRLPNGNRIEGEFAKNDKVEKIYEW
FT                   VEASQFLENKNYKIPYNFNLSIPYPSTTLSDRNVTLENANLVPSSSLLLTSLDDTSDED
FT                   "
FT                   /protein_id="XP_765683.1"
FT   gene            <322688..>325408
FT                   /db_xref="GeneID:3502903"
FT                   /locus_tag="TP01_0157"
FT   mRNA            join(<322688..323055,323191..>325408)
FT                   /db_xref="GI:71032084"
FT                   /db_xref="GeneID:3502903"
FT                   /locus_tag="TP01_0157"
FT                   /transcript_id="XM_760591.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(322688..323055,323191..325408)
FT                   /locus_tag="TP01_0157"
FT                   /gene_family="HOG000135833" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032085"
FT                   /db_xref="GeneID:3502903"
FT                   /translation="MDEEEFYENLKNFHGPEKYLELSQTNLFGAKLDLFRFYKCIRRFG
FT                   NLTESMIITHWREICSEIGVLNPSDSVPPDEAQKASRYFCDLFFNFNYPNYSATHVTKY
FT                   DEATNSSSSSEYINTISNSDDENGISYKNVVWMANHFLNQQKSSIHHTTGTPNTHSTDT
FT                   NTTAHTTPNTKNTDTNSTPNTHNTVNTFHNTTNTLDSNNSVNSVDINPVNSVSDEQWKL
FT                   SIYENNAPLTYESQTKVGNEYSIVEESNDSESEEDEDLVYDIIYELSKYIIGRIELEYS
FT                   LKILLKTLIISNLPDIPNLISTLSLINFQYTSELTKSQQTESNIKIIITVNNILILIVR
FT                   NSFINYEDSSTGDTIDNGINDKLTLYDQATVCLNSLQHSTITLFKLFTSNKNRVNVLDM
FT                   YSESDILRLSDTLNSILLLIKYLIIISTSQWQFDLLHLFINQVLSSLINNINSSGAGSA
FT                   VIGTCNTVGNTSDGATEVVNEHVLESLQVFMKGCNELCKKLKSKFSLKTIVDLYTLSVR
FT                   ILKSEALSNSLKKEIFELLLTIHTYFHFSNHHMHNNIQFVLQCFIHNLVNPTHTTVNTG
FT                   SAVNSSNSANTSNCVNSSNGVKSDNRVSGDNYDSIFKRRKRSRDENMKCVFNNPDNTNT
FT                   TTNASNNTSNHTNTGATNISTNRDGMDNKADVNVNMECSVKSEENDGNTPEGDDSVVGT
FT                   IGNNSSDANGKKSVDVGEGNCVENNEGVRENEQLTLEDSISFLQFYYKTVFGIFANQSA
FT                   TLPILDNTNDNDNNKANNTNKDKDKMNDVDVDENEMNEIICKCIEKLLEYSFCSEMLEK
FT                   NYEKLLECAFKEHSKSLWSLIHKLLSKCSHFTLNCSNTNYHITHFKQIL"
FT                   /protein_id="XP_765684.1"
FT   gene            complement(<325862..>327380)
FT                   /db_xref="GeneID:3502904"
FT                   /locus_tag="TP01_0158"
FT   mRNA            complement(join(<325862..325974,326122..326300,
FT                   326386..326482,326641..326931,327092..>327380))
FT                   /db_xref="GI:71032086"
FT                   /db_xref="GeneID:3502904"
FT                   /locus_tag="TP01_0158"
FT                   /transcript_id="XM_760592.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(325862..325974,326122..326300,
FT                   326386..326482,326641..326931,327092..327380))
FT                   /locus_tag="TP01_0158"
FT                   /gene_family="HOG000139712" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032087"
FT                   /db_xref="GeneID:3502904"
FT                   /translation="MASVKSKASDITFVSDQSTSSAKNTYAGQVFDGLFHGSGTFYYND
FT                   FERYEGDFVLGKREGRGKFYYADGSVYEGEWLNDKINGHGIAYFSSGNYYEGNWENGRI
FT                   NGYGTLKYANGDVYEGDWLEGAMHGHGTYQYSEGDVYVGQWRQDKRHGKGTITYVDKLG
FT                   NPCEKYEGDWVDNIMNGKGMYKYADGSYYDGDWYNGKMHGTGKYVYADGNKYEGEWVED
FT                   TKQGFGILSYANGEKYEGFWQNDKCHGSGILFYATNDKYNGEWVNGRKHGPGEIIYVNG
FT                   DRFRGNWEDDHANGNGIYEYSNGNRYEGLSYYLYIYFILHR"
FT                   /protein_id="XP_765685.1"
FT   gene            327866..328554
FT                   /db_xref="GeneID:3502905"
FT                   /locus_tag="TP01_0159"
FT   mRNA            join(327866..328046,328125..328146,328184..328222,
FT                   328252..328389,328469..328554)
FT                   /db_xref="GI:71032088"
FT                   /db_xref="GeneID:3502905"
FT                   /locus_tag="TP01_0159"
FT                   /transcript_id="XM_760593.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(327928..328046,328125..328146,328184..328222,
FT                   328252..328389,328469..328540)
FT                   /locus_tag="TP01_0159"
FT                   /gene_family="HOG000135832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032089"
FT                   /db_xref="GeneID:3502905"
FT                   /translation="MKLSESERIFIKSIFNSLQVNRKLFCNYLKNYSNQNFNFKDLESE
FT                   NEKMISLMDEILMESVNDLVKIKPFLNRLDVYSTDDKITLKDMYNNWKNDIVLRIIILK
FT                   HLKRFDSVDLQRALFITLDSPYINI"
FT                   /protein_id="XP_765686.1"
FT   gene            complement(<328589..330467)
FT                   /db_xref="GeneID:3502906"
FT                   /locus_tag="TP01_0160"
FT   mRNA            complement(<328589..330467)
FT                   /db_xref="GI:71032090"
FT                   /db_xref="GeneID:3502906"
FT                   /locus_tag="TP01_0160"
FT                   /transcript_id="XM_760594.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(328589..330319)
FT                   /locus_tag="TP01_0160"
FT                   /gene_family="HOG000135831" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032091"
FT                   /db_xref="GeneID:3502906"
FT                   /translation="MVDLSDNNLTESPWLLFTDLSVSNEFLRKNLNLNLFHLLRLKLFK
FT                   KYLAEETAKKRSRKSSAVRRSQGYSNSHATKLVNSAQSLDLQQLWQFIAGNLDLNVTYF
FT                   SDKIDKILLNNTLTVCKHSNDSNNTNNIDNANDTVDNTPISPLDTVDSDDDSKSLDNTL
FT                   DNNDVNHLEGSENNVEDGFFKFEDMERFADEDYIEDEEFDYFDSLGEESDDSTPACDMM
FT                   YSDFFDNPSTNNINSNINTNADDMDGDTEGTDDEDDVYRDDIDLTTLYDDDNSPNVDKN
FT                   SLNDKNPVNGVNREKNSIDKIEEELVKEKDWSMMGEAWGYSRPRNSLLSLDLQLPYYNS
FT                   TLQNTTETTDDADNSTATTDNNVGVEIIIMERIKSGIFDNIEYKRDFHPIEESKPDPAE
FT                   ELDFSKDKRGLGEIYEDKYKQLFSSNNSKLDAQKQLLTQMFSKLMYKLDSLSNCSFVPK
FT                   IPKITTNNVSTISVETPINVIISENNTNTNKKVDSNLISVSTNRNRKKRKFKSKMKRLV
FT                   KSGKMSAQEVEMLNKKMRETNKKRREELKNKKLTGLPGKDIKSRTRINTTQLLSNITQQ
FT                   "
FT                   /protein_id="XP_765687.1"
FT   gene            <330550..>332421
FT                   /db_xref="GeneID:3502907"
FT                   /locus_tag="TP01_0161"
FT   mRNA            join(<330550..330709,330743..332164,332246..>332421)
FT                   /db_xref="GI:71032092"
FT                   /db_xref="GeneID:3502907"
FT                   /locus_tag="TP01_0161"
FT                   /transcript_id="XM_760595.1"
FT                   /product="seryl-tRNA synthetase"
FT   CDS_pept        join(330550..330709,330743..332164,332246..332421)
FT                   /locus_tag="TP01_0161"
FT                   /gene_family="HOG000135830" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: tRNA ligase activity [goid 0004812];
FT                   go_function: serine-tRNA ligase activity [goid 0004828];
FT                   go_process: tRNA aminoacylation for protein translation
FT                   [goid 0006418]; go_process: seryl-tRNA aminoacylation [goid
FT                   0006434]"
FT                   /db_xref="GI:71032093"
FT                   /db_xref="GeneID:3502907"
FT                   /translation="MFLCLILLTLCLKFVFFTDSFILYNKLLFNSAPTRFGPSFKHTNL
FT                   TLQLYNTPVKKSLNNLHNTTLHNSTATVNTVENPVITSTPLINKVDTNNNSLLDDSLEL
FT                   NKTEGLYTDSEQYKLLSKYFSVEESVTEKEYLPLKDRFITKVEGPEVYFPVEYTLECIS
FT                   VVPELFQSNFLLRGEDHWSELIQIRSLFRRKTEILNQISKLTAEKSDSSKTFFIKNCVN
FT                   SLLRSVIIGARNKIRELKSELNTVEQELTALRLKLPNLLHPEVTDNNTVLKPAKYSNNA
FT                   VLKSKLDHVDVINRLCPRYIERAVSISGKGFSSYCTPLATLSRALVNYFLDTLTRLFDY
FT                   TEVVVPLIVTKSTLELTGHLPYFEDNLYKLDDSNVFNGETGYLIPTSEVSLLGLFKGGK
FT                   FKANSLPKFFTAYSECFRKEIQDYGANARGLIRQHQFGKVELLCFCPPDSSEYAHSLML
FT                   SHIEFLLNQLELPYQQVLLSAKETGHTCSKTIDCEVPLPSKNFFLELSSCSNTKDFQTN
FT                   PLNITTDTLNRVHSVNGSGLAIGRTITALLEYNTIKRENGLIQVKIPKPLQQYLNNSTL
FT                   ILENPVETI"
FT                   /protein_id="XP_765688.1"
FT   gene            <332423..>333582
FT                   /db_xref="GeneID:3502908"
FT                   /locus_tag="TP01_0162"
FT   mRNA            join(<332423..332654,332821..333015,333260..333368,
FT                   333428..333471,333521..>333582)
FT                   /db_xref="GI:71032094"
FT                   /db_xref="GeneID:3502908"
FT                   /locus_tag="TP01_0162"
FT                   /transcript_id="XM_760596.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(332423..332654,332821..333015,333260..333368,
FT                   333428..333471,333521..333582)
FT                   /locus_tag="TP01_0162"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032095"
FT                   /db_xref="GeneID:3502908"
FT                   /translation="MWKIRSLTRNFVRYYSTSNKLLLDKADSEVKNELEKRLLEVLPQN
FT                   WYKDKVIKIQKIISNSFLILLFTGGFLANFFDDRNKELSRMIITSEIHLMSSYLAFTVS
FT                   YSGYSYTVISVVIVNSAVNWIVWNTIGITALFKLWNCSSNSDVSSKRVLSILLMSYLGI
FT                   LGNEYLFAKLKLSPQWMKLHSKKKAISITMGILLLLMCESQVINGKTPEL"
FT                   /protein_id="XP_765689.1"
FT   gene            333600..334390
FT                   /db_xref="GeneID:3502937"
FT                   /locus_tag="TP01_0163"
FT   mRNA            join(333600..333909,334125..334212,334243..334390)
FT                   /db_xref="GI:71032096"
FT                   /db_xref="GeneID:3502937"
FT                   /locus_tag="TP01_0163"
FT                   /transcript_id="XM_760597.1"
FT                   /product="signal recognition particle"
FT   CDS_pept        join(333730..333909,334125..334212,334243..334364)
FT                   /locus_tag="TP01_0163"
FT                   /gene_family="HOG000237221" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal recognition particle"
FT                   /note="go_component: signal recognition particle (sensu
FT                   Eukaryota) [goid 0005786]; go_function: 7S RNA binding
FT                   [goid 0008312]; go_function: RNA binding [goid 0003723];
FT                   go_process: protein targeting [goid 0006605]"
FT                   /db_xref="GI:71032097"
FT                   /db_xref="GeneID:3502937"
FT                   /translation="MDSAEVDSSNWNIIYPTYLDKDCTSSQGRKINLSVAVSKPTIEEI
FT                   KIVCEKLNIPHVVEEKKRYPRNWMVPGRVRVCLRDSETNEKTRTKKQVMCEIATLISQL
FT                   KTRQQPKQTAQSTPTSKKKPNKKRR"
FT                   /protein_id="XP_765690.1"
FT   gene            complement(<334420..>339031)
FT                   /db_xref="GeneID:3502938"
FT                   /locus_tag="TP01_0164"
FT   mRNA            complement(join(<334420..334589,334684..334792,
FT                   334942..335139,335269..335553,335676..336503,
FT                   336612..337777,337874..337951,338065..338382,
FT                   338505..338690,338821..>339031))
FT                   /db_xref="GI:71032098"
FT                   /db_xref="GeneID:3502938"
FT                   /locus_tag="TP01_0164"
FT                   /transcript_id="XM_760598.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(334420..334589,334684..334792,
FT                   334942..335139,335269..335553,335676..336503,
FT                   336612..337777,337874..337951,338065..338382,
FT                   338505..338690,338821..339031))
FT                   /locus_tag="TP01_0164"
FT                   /gene_family="HOG000135829" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032099"
FT                   /db_xref="GeneID:3502938"
FT                   /translation="MKLTIAFNILVIKVLLKVCEAILWESRKKKAQEPPKRSLGDYSEE
FT                   NLREFLDDKRKHKLYNKRYLPHHKQNGRRDSASFLERGSKGKNDKEMARMRQKLAKNRF
FT                   KQNLPIYSDRQSDRVHNEFSNNTKDYNIDGKILGRPIHYEKHYDDKKNDYHDDEDIDEE
FT                   YDEEEEKEDEFNEDFDNYVIEDDEDYEDYDDYDDYEGYEDEIRRRKTRRGRPHTRSYIQ
FT                   LSDRDQSYESIPRPRKSTRGGGLLNTIMSTPVRRHKNPIHQSNVSDDDISHLTEEELTQ
FT                   DDLQKTHPELENPEIYNLFPADDDEEDESIKIPGRDGPGPKAQDFSESVTKKLEDKHKQ
FT                   KQQDHRRRNDDDDEDDYSPIEPPKNNRKHRTDDEDDYSPVEPQKNNHKHRTEDEDDYSP
FT                   VEHHRNSPLHPNHPDHPKNRKANNPNNPNQQKPPLHPNHPDHPNNRKANNPNNPNQQKP
FT                   PLHPNHPDHPNNHRPNNPNRPGIGNNNGRHDEPDPTAIDQKPLRRKKFKDKWTEDMGSI
FT                   NVNVDTEPLKKMKGLTGDYDDEIPDVEGNLNRNSEHTHEIEGETAKRVTTRIDPRDPQM
FT                   DWNNSGLAASMRYLGSGYDIIFGNPLGDPVVMMDQGYRNPVIRLNWEDEYLNKDGANLK
FT                   EPRGSWIRPEYSCRQSETIDHVNTVDDFKKELSVDAQASYGIPYFFSFSASTGYKNFVK
FT                   STATNKVRTYITKTYCLRYVGGIVDYHSLDTTDEFKKAVEALPDKFDSHSCTIETFKSN
FT                   EDDSICAETVLPWMQFIKMFGTHFTTIVHLGGKITHQVQIDKSDVLHMQQNGINVDAAV
FT                   KASISPVMVDSLQGGFASTSEKASLSQSNNLKYDKQVLVIGGDGLVDSKNANSLNNWAK
FT                   ELYKRPMPIKIKLESIKSLLGKKRELFDEALKFYSETYGVSPDEIYKKFGKEFGIASVI
FT                   EKGHQIVYSGNKSGSAICPNKTVIIMGFSLSILKKKNIVGKNEFTLHITQCPVGEEKCI
FT                   VSSDNPMSESRIWAVCGEDTIPLLNQQTSSEIDEPATATCPVGYSIAYGFALSVPKGNV
FT                   ALNTDSYACRSGTQSCTHESTDKTATNAVWIACVENGAPQLSEISNHVVSTSSRHCSKK
FT                   TKDNAYDDNSCPINSKLIAGWSLDFSEGDENFNKIDKCSKGTFGCKVDQLMKTENKCRS
FT                   HYSWISCLHEQKADSL"
FT                   /protein_id="XP_765691.1"
FT   gene            <339674..>341711
FT                   /db_xref="GeneID:3502939"
FT                   /locus_tag="TP01_0165"
FT   mRNA            join(<339674..339686,340399..>341711)
FT                   /db_xref="GI:71032100"
FT                   /db_xref="GeneID:3502939"
FT                   /locus_tag="TP01_0165"
FT                   /transcript_id="XM_760599.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(339674..339686,340399..341711)
FT                   /locus_tag="TP01_0165"
FT                   /gene_family="HOG000135828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032101"
FT                   /db_xref="GeneID:3502939"
FT                   /translation="MLVSLFRLFFLVFVQLYVFYILLFRYGHLFKDLLDLSYKSLKHVN
FT                   WKSPINFFRSFYLFVHYVISLFLYYNSLVSVRLRLILYSSLVFVISIMSFKVGIGTKHF
FT                   VNTTPIIIGLTTYLSILLTFTNTICHYLTLLNTVLIPIWALTIYLRSHSNINNTAGNSM
FT                   DSVGSVDGSVVTSKHVKRTRQKKHANTNNFVESSESLENMNNNPNTRLFYELNNCLDLY
FT                   LIIIVVRICKSIPFVGKLLQLNVYLSHIALFFTISIVVHCGIIYITGIKVNSTPLSGVR
FT                   NLVLFTLNWLIFHIFGINNYFSKDSRSTLNTTLTSVTTRAKQILNIILGKYLEPLSQHK
FT                   TVMVLLTVLRTLPQLCLLLLPPVFSRLYFEYSTVLVPISTFLIHENTFKHKLYCMGFFV
FT                   LADVTRSLFNFMGWISFKTTLRILLVYTMNFLLLKLNQYAIQ"
FT                   /protein_id="XP_765692.1"
FT   gene            complement(<342150..344960)
FT                   /db_xref="GeneID:3502940"
FT                   /locus_tag="TP01_0166"
FT   mRNA            complement(join(<342150..342882,343025..343204,
FT                   343331..343704,343817..343936,344016..344319,
FT                   344445..344584,344647..344784,344863..344960))
FT                   /db_xref="GI:71032102"
FT                   /db_xref="GeneID:3502940"
FT                   /locus_tag="TP01_0166"
FT                   /transcript_id="XM_760600.1"
FT                   /product="prolyl-tRNA synthetase"
FT   CDS_pept        complement(join(342150..342882,343025..343204,
FT                   343331..343704,343817..343936,344016..344319,
FT                   344445..344584,344647..344784,344863..344925))
FT                   /locus_tag="TP01_0166"
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="go_function: proline-tRNA ligase activity [goid
FT                   0004827]; go_function: ATP binding [goid 0005524];
FT                   go_function: tRNA ligase activity [goid 0004812];
FT                   go_process: prolyl-tRNA aminoacylation [goid 0006433];
FT                   go_process: tRNA aminoacylation for protein translation
FT                   [goid 0006418]"
FT                   /db_xref="GI:71032103"
FT                   /db_xref="GeneID:3502940"
FT                   /translation="MSETQVDKLFKLFHTLGLRYKVIKHPNLVTVKDMLEEPSLAGFRD
FT                   DCIRNLFMLDSSKRYYLISALYDTEVNWKVLRKSLNVNKLHMGDESDMLSLLGVGRGNL
FT                   TPFSAMNDTENKVHVLFDIRLKNKVDVVAHPLTNDQSVVMKMEDMLKFLTQINHFPTFL
FT                   PLNDLDSTTHATDKTVNSVTTVNSVNNVKKGEVNILGITVKKYENFPEWYSQVIVRSEM
FT                   IEYYDISGCYIFLPASYFIWEIFNEWFNKQIKQRGVDNCYFPMFVTKERLEAEKTHLEG
FT                   FSPEVAWVTRNGDVDFPDPIAIRPTSETIMYPEFSKWIRSYRDLPLKLNQWNSVVRWEF
FT                   KQPTPFIRSREFLWQEGHTAHSTEKEALDTVYEMLDLYSKFYEEYLSVPVIKGVKSENE
FT                   KFAGSKMTTSLEAFVPANGRGVQAATSHLLGTTFSDMFDIKYEDEEGEKRKVHQTSWGF
FT                   TTRSIGIMIMVHGDDRGLVVPPRVAKTQVVIVPILTKTADQVISRVNELYKLLTESGFR
FT                   VKLDDRRGYTPGFKFNHWELRGVPLRLEVGAKDVENNTVRLVRRDNFAKADVPLENLTT
FT                   TIQQLLDQIQNTLLTSAREKMEQSIVKAYDFEEVMVALNNDKLIMAPWYSISFTLFLLS
FT                   PGELSYPLQGLPTPPWGTVLLILFIFYLVYAIYSVLHMLYVIKYSLTT"
FT                   /protein_id="XP_765693.1"
FT   gene            complement(<345166..>347222)
FT                   /db_xref="GeneID:3502941"
FT                   /locus_tag="TP01_0167"
FT   mRNA            complement(join(<345166..346663,346702..346823,
FT                   346893..>347222))
FT                   /db_xref="GI:71032104"
FT                   /db_xref="GeneID:3502941"
FT                   /locus_tag="TP01_0167"
FT                   /transcript_id="XM_760601.1"
FT                   /product="translation initiation factor eIF-2B epsilon
FT                   subunit"
FT   CDS_pept        complement(join(345166..346663,346702..346823,
FT                   346893..347222))
FT                   /locus_tag="TP01_0167"
FT                   /gene_family="HOG000135827" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor eIF-2B epsilon
FT                   subunit"
FT                   /db_xref="GI:71032105"
FT                   /db_xref="GeneID:3502941"
FT                   /translation="MEGIILHECDTITFEPLTSYADVKDLYIGDSTIFMESLTNIYHSG
FT                   IKKVYFLVESYKLNKYMALEKSYSIGKRDSQLVIEVVAVNVTKMDVGPALREFFTTHTN
FT                   IQQFLLMYSNTLLSVPISDALEFHDNLMKTNSKYTMTMLYTQHNSKLYSDMENDGVVIS
FT                   NERTGELLLTSQTDLISFDYNLFSRTGFNPLSVRYDLLESSVYLCSSLIIESVMEQFDK
FT                   NRMSQLVNAILTDEIKISEIYCYTLQNDAAFPDFPAALKINSPRLYHTIYMQYIQRFLT
FT                   SHSTDSSIDSGSSVRGKKGMDDVNRGIGPRISETSYFNRENIVASASNTMMNSVKKSVL
FT                   GHNVRVGSNVTVVNSIVFDNVTIHNNCNIVDTIVMDNCVINEGVNLVSGSVIGKNCEIS
FT                   PKLVNNRGKSVFCAMDQTKFYDLTEDLVVEGDGKVFLWNLEPFTNDFSLYKIGDDFFNH
FT                   TTFTIEFDNLTDDSTHSTEFSGDSDDDFDNLDGDLDEDEHEFENLELEMMIIESLEEPK
FT                   LVENKLLEIRSLRLAHNITETEMTFNTHKFAIKWLIQQAQEDEIEETMEKSQLQQLLNT
FT                   FKTKLDNNLENKLFEEILRLCVENGKDELYFCKLMEAFYHSEVLNFEEFPNWAKIKQFK
FT                   EPRLISFANWLEED"
FT                   /protein_id="XP_765694.1"
FT   gene            complement(<347304..>347803)
FT                   /db_xref="GeneID:3502971"
FT                   /locus_tag="TP01_0168"
FT   mRNA            complement(join(<347304..347466,347568..>347803))
FT                   /db_xref="GI:71032106"
FT                   /db_xref="GeneID:3502971"
FT                   /locus_tag="TP01_0168"
FT                   /transcript_id="XM_760602.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(347304..347466,347568..347803))
FT                   /locus_tag="TP01_0168"
FT                   /gene_family="HOG000135826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032107"
FT                   /db_xref="GeneID:3502971"
FT                   /translation="MSSYSRFGTFFTKLPSTTKMTLSLIGIAALSHFFGDRANKRLKEN
FT                   NLKNNINILSGTKADWSCFYLAKQYHEECDDLNRGNEYMEGLCTDLETKLNKCKDDLYN
FT                   DISSFNSYYMEPPVKLIDAPSWFENKHN"
FT                   /protein_id="XP_765695.1"
FT   gene            <347976..>349134
FT                   /db_xref="GeneID:3502972"
FT                   /locus_tag="TP01_0169"
FT   mRNA            join(<347976..348298,348405..348705,348809..348896,
FT                   348995..>349134)
FT                   /db_xref="GI:71032108"
FT                   /db_xref="GeneID:3502972"
FT                   /locus_tag="TP01_0169"
FT                   /transcript_id="XM_760603.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(347976..348298,348405..348705,348809..348896,
FT                   348995..349134)
FT                   /locus_tag="TP01_0169"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032109"
FT                   /db_xref="GeneID:3502972"
FT                   /translation="MTNKYGNTSFVILVVFVFIAAILDFIGTFSYHLNFEGKNLFVPYF
FT                   SDRNVVPFPVLFREFDLSNADSIRSGVKRYRGSNERCSRRLLKEYDSYRYNFQHIFQNV
FT                   PNQSFVAKWDTPPGWLSYTPVDKLCLNLLDAYRFDYVVQDPLLDQNSHTVRNIYTNKMS
FT                   NFYDLFDGLDFAHDIRLFKLISSYPTLTIYAVKGIMSGDMANVGMISDNRKPSDLKLDH
FT                   SLFQFHNNGLKSNLIGDVTCYDLAPGSFDVHITNKHKNTVNDIYNADQMVYDNYTKYIP
FT                   RY"
FT                   /protein_id="XP_765696.1"
FT   gene            <349204..>352338
FT                   /db_xref="GeneID:3502973"
FT                   /locus_tag="TP01_0170"
FT   mRNA            join(<349204..349461,349557..351958,352075..352147,
FT                   352237..>352338)
FT                   /db_xref="GI:71032110"
FT                   /db_xref="GeneID:3502973"
FT                   /locus_tag="TP01_0170"
FT                   /transcript_id="XM_760604.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(349204..349461,349557..351958,352075..352147,
FT                   352237..352338)
FT                   /locus_tag="TP01_0170"
FT                   /gene_family="HOG000135824" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032111"
FT                   /db_xref="GeneID:3502973"
FT                   /translation="MCIISLVRNLICCRSDVLILHLVGADHLSHCGGRNTREMSNIMSN
FT                   YNTFVKDLMDQYEKYKNYMIFFFGDHGQKESGSHGDDSLEEMETFLMVRSDMRLRSVAR
FT                   DFCPISETPQAYRLHHSALNGNAQLSFEYERHFTQDICTTSSFLTNVPVPFHSVGSVIP
FT                   NSIPLIRDNNGNIDYGLSDKYLVQLYHVNVHHILRILDLLTQNEDFKLDQKMFDRVFKN
FT                   RLQLVNLYTLLRLFDANKTNTSDGLKTNGENKLKSKIYNTISSNKGNLYNEYIKMCKII
FT                   IEESAEIIRLSARSFTFHYLYISIIIKYVSIVILVYSIAASHYFIVNNRDFVRKILLKL
FT                   ITNLLLTSVVSCVFGVKLDKKIDLHYVKFRLVWPLGVIKPLFTKSQTFTRFISNFFVIE
FT                   DFDLYLHFSILFMVTLTVIFLIHLVTFFISYIRLRSDTVSVDIADTEDTEDNSQYSSEH
FT                   TTDATDNTSGSNVDARMNELSRFMYNIGKINFKSIILVFYGIIFVLVIVSECALYSHDT
FT                   ISRHEFVIFMLIETLPFLLQNYNTPRCKMVVKHLVVLFVFLKLSSLFHDYRLFFYSSDL
FT                   PSANWLRKEYFLGLFEVGAISLTVYYLMLLRVLKKFTSPDKIGLEKFDYTISECVKVFK
FT                   PIKLMKLVFTFNYVLILVNYGLTTQRSLLGLDKFIHNLHNAYNMKLFISTLLAWAVLII
FT                   FLVTTVLMMVNPRNKFFEPGDYRFSSFLLYSIFNISYLLLLICGQKKAFQTVLSLIILY
FT                   NCCKILVNTTSGFHLSHSLLLQSLADAAYFAVGNIDTFLNLNFQTGFVFVNTYHQLISD
FT                   SSVLFEVMSIHMLFSIVLMFIFYSFNNLQFTDPLVLMDTERLDSMESGLKFTGQDHEVD
FT                   SKKIYTLKNIIHIITMYILLVSALGVSVLVVIMKLHQVPCIAFRSFPKALFVLGKSTAM
FT                   IVTQLLLFLLGAIY"
FT                   /protein_id="XP_765697.1"
FT   gene            complement(<352445..>353844)
FT                   /db_xref="GeneID:3502974"
FT                   /locus_tag="TP01_0171"
FT   mRNA            complement(join(<352445..352793,352913..>353844))
FT                   /db_xref="GI:71032112"
FT                   /db_xref="GeneID:3502974"
FT                   /locus_tag="TP01_0171"
FT                   /transcript_id="XM_760605.1"
FT                   /product="geranylgeranyl transferase type 2 beta subunit"
FT   CDS_pept        complement(join(352445..352793,352913..353844))
FT                   /locus_tag="TP01_0171"
FT                   /gene_family="HOG000135823" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="geranylgeranyl transferase type 2 beta subunit"
FT                   /note="go_function: catalytic activity [goid 0003824]"
FT                   /db_xref="GI:71032113"
FT                   /db_xref="GeneID:3502974"
FT                   /translation="MKDLNKLRDYLNNFLIGGINLFSAPEGVNNNKFNGKKLLFEKSLI
FT                   CGSFWSISALTILSQPISQSNLNSLLNILNSCFTNINTFPYTSVNSNNTNIVPNTNSNT
FT                   THNATGNDTENTSDSVDSSVVTTEQFEEGVKGFMEYNNNLYNNNIQSTLYAIEINYLLR
FT                   NFPLYNQFHSGINHSLLSSSDLISIINYIKSLYNPDEGYFFNSLNSFNTHSNTDYTDVR
FT                   STMSALCAFNLTHKLLNFSESQITDQLNKSFDLDRIYRFLRSHFNSDGGISLSKNGQSH
FT                   VAGAFCSIGSLVLINRINSLSHNRIHLLVTWLLERISINGGMNGRVGKSNDICYIWWSL
FT                   ATMFMLVKYYKKSVKLFNQTVIARITRFIGESQNSDGGFSANKSHENSDPYHSFTALLA
FT                   TALLNQFHNQYNIHEIEPLFAIPINPT"
FT                   /protein_id="XP_765698.1"
FT   gene            <354251..>354780
FT                   /db_xref="GeneID:3502975"
FT                   /locus_tag="TP01_0172"
FT   mRNA            join(<354251..354291,354323..354384,354459..354585,
FT                   354684..>354780)
FT                   /db_xref="GI:71032114"
FT                   /db_xref="GeneID:3502975"
FT                   /locus_tag="TP01_0172"
FT                   /transcript_id="XM_760606.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(354251..354291,354323..354384,354459..354585,
FT                   354684..354780)
FT                   /locus_tag="TP01_0172"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032115"
FT                   /db_xref="GeneID:3502975"
FT                   /translation="MNLKMYTKSPNQHWRMNPSSQVKRPKLINSQRLFHTEDVYERIIS
FT                   EIEERSPEEMIMDIIGKINKLEALKAQLGTEERIARLKLSGKNATYANSIPVSHPIAVN
FT                   PTTT"
FT                   /protein_id="XP_765699.1"
FT   gene            complement(<354865..>355714)
FT                   /db_xref="GeneID:3502976"
FT                   /locus_tag="TP01_0173"
FT   mRNA            complement(join(<354865..354979,355087..355216,
FT                   355409..355512,355611..>355714))
FT                   /db_xref="GI:71032116"
FT                   /db_xref="GeneID:3502976"
FT                   /locus_tag="TP01_0173"
FT                   /transcript_id="XM_760607.1"
FT                   /product="adrenodoxin-type ferredoxin"
FT   CDS_pept        complement(join(354865..354979,355087..355216,
FT                   355409..355512,355611..355714))
FT                   /locus_tag="TP01_0173"
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adrenodoxin-type ferredoxin"
FT                   /note="go_function: electron transporter activity [goid
FT                   0005489]; go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:71032117"
FT                   /db_xref="GeneID:3502976"
FT                   /translation="MKLLCNIFNNSINKILRPNLYIFHKNFYNHFSTQNIKITFVQYED
FT                   EITVSVPVGISILEAAHKHNIEIEGACDGCMACSTCHVILEEDVYDALPEPSETELDML
FT                   DLAPCLTNTSRLGCQVILGKEHDNIRITLPRITRNFYVDGHTPTPH"
FT                   /protein_id="XP_765700.1"
FT   gene            355817..356543
FT                   /db_xref="GeneID:3503052"
FT                   /locus_tag="TP01_0174"
FT   mRNA            join(355817..356044,356117..356189,356261..356543)
FT                   /db_xref="GI:71032118"
FT                   /db_xref="GeneID:3503052"
FT                   /locus_tag="TP01_0174"
FT                   /transcript_id="XM_760608.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(355889..356044,356117..356189,356261..356487)
FT                   /locus_tag="TP01_0174"
FT                   /gene_family="HOG000281001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032119"
FT                   /db_xref="GeneID:3503052"
FT                   /translation="MSIFTVSFFNRSLSFVTSFMCVYAFANPDLERIWEFHPAFDQKDY
FT                   AFLSFYKVNENDYNEFEKGIRGLTRYLQRKPGYGYTRLVRLVDMDDKSDILSDYDYVGV
FT                   QTWFTPASMKRAMDSSFSQKIISNLKMKNDFNSQLFKIVVDDSSYTP"
FT                   /protein_id="XP_765701.1"
FT   gene            <356546..>357217
FT                   /db_xref="GeneID:3503053"
FT                   /locus_tag="TP01_0175"
FT   mRNA            join(<356546..356749,356971..357008,357157..>357217)
FT                   /db_xref="GI:71032120"
FT                   /db_xref="GeneID:3503053"
FT                   /locus_tag="TP01_0175"
FT                   /transcript_id="XM_760609.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(356546..356749,356971..357008,357157..357217)
FT                   /locus_tag="TP01_0175"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032121"
FT                   /db_xref="GeneID:3503053"
FT                   /translation="MYIIIFYILIYINYIYCHSHFDANLLKHSHTVGHTVNNNINNKII
FT                   SNVNNKLKSKGEDDEEEDDVDTTRRRRRQYATKCRRKIQSQNLLILNSINPTITM"
FT                   /protein_id="XP_765702.1"
FT   gene            <357576..358818
FT                   /db_xref="GeneID:3503054"
FT                   /locus_tag="TP01_0176"
FT   mRNA            join(<357576..357773,357846..357959,358095..358298,
FT                   358449..358607,358724..358818)
FT                   /db_xref="GI:71032122"
FT                   /db_xref="GeneID:3503054"
FT                   /locus_tag="TP01_0176"
FT                   /transcript_id="XM_760610.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(357576..357773,357846..357959,358095..358298,
FT                   358449..358607,358724..358804)
FT                   /locus_tag="TP01_0176"
FT                   /gene_family="HOG000281003" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032123"
FT                   /db_xref="GeneID:3503054"
FT                   /translation="MKSNILLSGAKTLKNYDWFDHELPLSKLPLMPSVLSTTVGAGIGA
FT                   LCSIIVNCALVELSTSSFFTLYFGFTFIIIGLAILWRLSASSELNDQNQTKNLKIFGFM
FT                   IVFSGVLCFFLRKNWFISLPTSLKTVVYTLLGVSTSFALTFTIVDIINYFMATLETTVS
FT                   KPLVESKSQVHLILSIALLMGAIFGFTFGLMDVEDEAAYHVQLALMKEEKYTYPIGILL
FT                   GGAAGFGNEYLRQQESWRFNRDNAYDVEI"
FT                   /protein_id="XP_765703.1"
FT   gene            358942..359799
FT                   /db_xref="GeneID:3503055"
FT                   /locus_tag="TP01_0177"
FT   mRNA            358942..359799
FT                   /db_xref="GI:71032124"
FT                   /db_xref="GeneID:3503055"
FT                   /locus_tag="TP01_0177"
FT                   /transcript_id="XM_760611.1"
FT                   /product="2-Cys peroxiredoxin"
FT   CDS_pept        358981..359781
FT                   /locus_tag="TP01_0177"
FT                   /gene_family="HOG000022343" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-Cys peroxiredoxin"
FT                   /note="go_function: thioredoxin peroxidase activity [goid
FT                   0008379]; go_process: response to oxidative stress [goid
FT                   0006979]"
FT                   /db_xref="GI:71032125"
FT                   /db_xref="GeneID:3503055"
FT                   /translation="MLMKLTGISLITSFSYIRNSVPLKNTFTAFHTLNTRNGIKSAKTP
FT                   DRISSLKSVNGVRNYSSSEGLNNTVTSSLIGKLMPSFKGTALLGDDLVQFNSSDYFKDS
FT                   YGLLVFYPLDFTFVCPSELLGFSERLKEFEERHVKVLGVSVDSPFSHKAWKELDVRQGG
FT                   VSPLKFPLFSDLSREVSSSFGLLRDEGFSHRASVLVDKAGVVKHVAMYELGLGRSVDET
FT                   LRLFDAVQFAEKTGNVCPVNWKQGDQAMKPDSQSVKQYLSNRFN"
FT                   /protein_id="XP_765704.1"
FT   gene            <360578..>362950
FT                   /db_xref="GeneID:3503056"
FT                   /locus_tag="TP01_0178"
FT   mRNA            <360578..>362950
FT                   /db_xref="GI:71032126"
FT                   /db_xref="GeneID:3503056"
FT                   /locus_tag="TP01_0178"
FT                   /transcript_id="XM_760612.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        360578..362950
FT                   /locus_tag="TP01_0178"
FT                   /gene_family="HOG000135822" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032127"
FT                   /db_xref="GeneID:3503056"
FT                   /translation="MNCFYILLFIFSLFKTAFSQTKPPGLPCVLNISGNNDRTKIDIDD
FT                   KDSSVTIFTPTNGTEVLEVVYGSQVLWKRTKLTKFLRLLTYKRGNSLYYLQLFFSRGGK
FT                   IYAQTMSTDGEKWINSTTFRLTKRNSMELFGDLNLTSGSSEDENPYENPDQVRQEGAEN
FT                   EPNYADSVILQPKKGESDEDTSESDSSSTKSEPSLKSESDASTTKSEPSDKNKLKSFGK
FT                   YLKNLARKGPKKKGESTSNTDSEGESSGESTPINKEAKKPPQSKYRVEYEDLANLGPKP
FT                   SETETGPKLPKRSPPVPPVRTVSLENKQVEAGTRPSSPTRLSPIPEPRTLFPNKTTSET
FT                   ETGSKLPKRPPEPPVRTVSLQNKQVGNSASYVSSSDSENSETDEKPKNRKRRRINFFRR
FT                   GRNNNNTEKSVKEDPIYSTIDLQPGQQSDQTSDESTPDELSEPSIEESNKTKMRPKRGT
FT                   SNSLNRVRKLFSRRKKSKTQMNEVELDLAGDLEGIARVKHVTEIDIPVTEMIIFGGNLV
FT                   KKITDRFQTVWKHERKSLPLRQVLLFAKPGYQSLLHLNTKPSLFEGNPRMYEDIEGQWL
FT                   EITLERFLTKLGMSAFNEVDTYYENKKITSDTFEIPEEFTKPDPNGSSGLEPGSRRSST
FT                   SSTGSESNYSVRSIEPHDSPTSEQIGPVETDDTESVSGGASPQAPAESIYTTVTPPPKP
FT                   PRLYIYTPKSSNGDIIPEQESGPATVTPYESSTGKTLGESGGDVHSTLGSKSSDSQSSG
FT                   SSFERISTPDLENLPPDSSIRPLLMDEGLNLYSSDGF"
FT                   /protein_id="XP_765705.1"
FT   gene            <363137..>365725
FT                   /db_xref="GeneID:3503057"
FT                   /locus_tag="TP01_0179"
FT   mRNA            join(<363137..363695,363844..364033,364067..364500,
FT                   364619..365511,365660..>365725)
FT                   /db_xref="GI:71032128"
FT                   /db_xref="GeneID:3503057"
FT                   /locus_tag="TP01_0179"
FT                   /transcript_id="XM_760613.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(363137..363695,363844..364033,364067..364500,
FT                   364619..365511,365660..365725)
FT                   /locus_tag="TP01_0179"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032129"
FT                   /db_xref="GeneID:3503057"
FT                   /translation="MEINDLYFYPLASVYPKRIPSKYSNKGLKPKVLDLSKELDPIECS
FT                   LSRNCDILSYFGLFHKVYNKIILSNHKLIKKFSNGNIPEDTKDEEVVWESNQPEDYVIC
FT                   VEARIIGTYWNNRRITLVSVDNSIKYLKYQDGKWVESREIVLDINSLNTGKRYKIFKRN
FT                   NLTNFQANDKLHFSEIVEKNSENNEIVTIWRGDSDHRYCKVVSLFEMSNGNKVMAMLFL
FT                   GNNLLIYYFDGIWKLKADSLKNNDLKPRLDHLSFPHVSIDEVFEFSSIVINLFNKITNP
FT                   FSQNDSNKTIDKESVTLENNPKESLNEIENNYMRPFYGLEVTLRDMYLIYRIYFTTSGH
FT                   YADKSYKYAFINLIYPSTVLNDKDSFREVDPRSNFYQNTPLYYSFYEDIDSTNTGNTDV
FT                   NTKNSNATSSESNNGLDQEYEYFNAVSGEIIDRKTDSVTVNDVKIRFFSTHDDTVIIDN
FT                   TTNDNYNEDEVVDFGSLHNKNCISDNSCCCFDRRSAYIKYLRKINDKREKLLGVTSVAL
FT                   DINSTEPTKEYFITKSCENFEFKCYSRYKFNKIFHKSEEFGEKILWEDKLDTEYANQVF
FT                   LLHHNDKLCLFILSETLNCRLLILDHDYNPAFNTLDDGIKIDLNKFRFCDMDNKTIDIF
FT                   GMDKRDSCSSFYFRYSFPNKCYFIYYEDKLVWSHPDSLESLTNEEKDEKNLLHIHLMIS
FT                   SALNSYQTLSQVLKFEIKL"
FT                   /protein_id="XP_765706.1"
FT   gene            complement(<365878..>366585)
FT                   /db_xref="GeneID:3503058"
FT                   /locus_tag="TP01_0180"
FT   mRNA            complement(<365878..>366585)
FT                   /db_xref="GI:71032130"
FT                   /db_xref="GeneID:3503058"
FT                   /locus_tag="TP01_0180"
FT                   /transcript_id="XM_760614.1"
FT                   /product="40S ribosomal protein S11"
FT   CDS_pept        complement(365878..366585)
FT                   /locus_tag="TP01_0180"
FT                   /gene_family="HOG000282021" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S11"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032131"
FT                   /db_xref="GeneID:3503058"
FT                   /translation="MYKCVSLGRKIGNSLFDQVNRILTRNVVNFNDFSILRDLWRFGGI
FT                   KVGASSDLTRCVSFRSMTTGSEESREKPVLSKTLTKQELKNFQGNYQRYRRNFGLPEFH
FT                   NVDLDRNGLIIEPTDRFMLVLTTSKNNVHAQLVNRSKNYRTVFGSFAGNVGYRKKMQQT
FT                   DKCAYRIGENIARKCKRLGIFAVDVKFRRIARVENVLQAFHAIGLQVSQLIHEPRLPKT
FT                   GVNSVRPRRRRRV"
FT                   /protein_id="XP_765707.1"
FT   gene            complement(<366688..>367336)
FT                   /db_xref="GeneID:3503222"
FT                   /locus_tag="TP01_0181"
FT   mRNA            complement(join(<366688..367142,367327..>367336))
FT                   /db_xref="GI:71032132"
FT                   /db_xref="GeneID:3503222"
FT                   /locus_tag="TP01_0181"
FT                   /transcript_id="XM_760615.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(366688..367142,367327..367336))
FT                   /locus_tag="TP01_0181"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032133"
FT                   /db_xref="GeneID:3503222"
FT                   /translation="MDNQKRNKSCSVMLTQALLTSDRKLVEKLLSTRDNATIEDTVAEL
FT                   TPPLVLSLLEYITSSVIRTPNQLYSREGWINTLLRKHSAVFTGSKKGRNALIKLNKHIN
FT                   QRLTMNKALLKLKGKVDSVVYYSNLYKKQKQKDSIQIMNSQEPLLTFTEE"
FT                   /protein_id="XP_765708.1"
FT   gene            368034..369729
FT                   /db_xref="GeneID:3503223"
FT                   /locus_tag="TP01_0182"
FT   mRNA            join(368034..368152,368264..368397,368750..368856,
FT                   368989..369057,369131..369193,369224..369283,
FT                   369396..369495,369525..369586,369617..369729)
FT                   /db_xref="GI:71032134"
FT                   /db_xref="GeneID:3503223"
FT                   /locus_tag="TP01_0182"
FT                   /transcript_id="XM_760616.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(368076..368152,368264..368397,368750..368856,
FT                   368989..369057,369131..369193,369224..369283,
FT                   369396..369495,369525..369586,369617..369679)
FT                   /locus_tag="TP01_0182"
FT                   /gene_family="HOG000135821" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032135"
FT                   /db_xref="GeneID:3503223"
FT                   /translation="MTEESLFLYHSTTPSKNQMVMKNMDLDLCLNLMKGIEVSEKDLQG
FT                   VIANYLFINMYEDTYKFFIQETHFNDDGFKPTISERKFIRNSIMEGRIMDAINQINQID
FT                   RNILNENSNLLFVLMLYRLVDIILSGDLHTAIKFAKEEISSCIKKDPNLLTKLEEAMSL
FT                   LAFQNLNSPEALEIIKKIQKPDEISNLVDNSLIAYYNLDPKPILENIIKETLWVESQLE
FT                   SKPNSYSLKLSNISRCGFKLSS"
FT                   /protein_id="XP_765709.1"
FT   gene            complement(<369899..>370600)
FT                   /db_xref="GeneID:3503224"
FT                   /locus_tag="TP01_0183"
FT   mRNA            complement(<369899..>370600)
FT                   /db_xref="GI:71032136"
FT                   /db_xref="GeneID:3503224"
FT                   /locus_tag="TP01_0183"
FT                   /transcript_id="XM_760617.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(369899..370600)
FT                   /locus_tag="TP01_0183"
FT                   /gene_family="HOG000135820" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032137"
FT                   /db_xref="GeneID:3503224"
FT                   /translation="MGGLKHVVPRRVHLERSQPEHRKRRVGQYLEKKADYKKRSEHYHL
FT                   RERLIKELSLKGRYRNEDEFNYKMINSRIGDQGQVILPTEDTLREKKLTKKLKLKRNLD
FT                   KINTNLFVLNHITNTHKSNTTNVNTATNNKVRNKKGHIIFSDEDSLENCKIDSTPKPNL
FT                   VNGENVLNGVKQSSGKNSVKRVKHVKSELDKLRQELEEKRNVMVGKYKKRKIGKVKNSK
FT                   HIHHFAFERDK"
FT                   /protein_id="XP_765710.1"
FT   gene            complement(<370658..>371123)
FT                   /db_xref="GeneID:3503225"
FT                   /locus_tag="TP01_0184"
FT   mRNA            complement(join(<370658..370757,370859..370897,
FT                   370981..>371123))
FT                   /db_xref="GI:71032138"
FT                   /db_xref="GeneID:3503225"
FT                   /locus_tag="TP01_0184"
FT                   /transcript_id="XM_760618.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(370658..370757,370859..370897,
FT                   370981..371123))
FT                   /locus_tag="TP01_0184"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032139"
FT                   /db_xref="GeneID:3503225"
FT                   /translation="MELDYEEDIRKALEKYFSGLGYKTADGTNFGSDLVIYTKAGPNLS
FT                   HSKYLLFIIDSKVTWREVITYYRVSSQTAKIALVAFKQKVISKLLVIN"
FT                   /protein_id="XP_765711.1"
FT   gene            complement(<371416..>375938)
FT                   /db_xref="GeneID:3503226"
FT                   /locus_tag="TP01_0185"
FT   mRNA            complement(join(<371416..371794,371968..372080,
FT                   372186..372310,372471..373004,373131..375393,
FT                   375870..>375938))
FT                   /db_xref="GI:71032140"
FT                   /db_xref="GeneID:3503226"
FT                   /locus_tag="TP01_0185"
FT                   /transcript_id="XM_760619.1"
FT                   /product="DNA repair protein"
FT   CDS_pept        complement(join(371416..371794,371968..372080,
FT                   372186..372310,372471..373004,373131..375393,
FT                   375870..375938))
FT                   /locus_tag="TP01_0185"
FT                   /gene_family="HOG000135819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair protein"
FT                   /db_xref="GI:71032141"
FT                   /db_xref="GeneID:3503226"
FT                   /translation="MGFCVSFRKRRTMSQSRTSGSKNEESTMSIGELEEDDLPLIRKRT
FT                   LLFDDSNLLTGSQNLSHIMKKTTGNNSTTVDSLDSVNSNTTINDNTSATASTSDTMGNN
FT                   SVENVRNVKGELMDDERLIDRLLYAYEFDDKRPIDIDNVTVGREDKRDKEDTMDFHERE
FT                   LYLSCKASESSLGFRSYVENYYKYKGTFSFPPWLEPKNLRDSEGRKPLGDGYDSSTLWI
FT                   PPKGHRWAHEFRSGHYTECMQQWWDVKRTHFDSLVFFKMGKFYELFYQDACILQGLTGL
FT                   RWMGAETKPHVGFPEKSIHSYASACVNAGYRVVVVEQTETPQQLDKRNKASGTTARAVK
FT                   RDVCDIITPGTVAAPEMLTSQSRPLLIMSGTKSETQPQPAPSESEETKSETPSAVEIVC
FT                   LDVSMSKIRFGTVKYTDDLLQVKTVLIHFCPAEVVLDSVLYDNKELVKAIKALPYSADV
FT                   TLHVPQNKSKNLLNKVKDKWESEASECSTSLTLTESYLSLVLLNKLVDYCYFEPFNFSQ
FT                   LEVMGMDYSALVHLELFVTQEGTEKNSLFHYLNHTKTAFGERLLRYWLLNPLTDVDAIN
FT                   LRSEAVEFLVHNYPLVTTLNQELERFPDLERSLGKILNTASNYHKRAVYFDRGVYTKLY
FT                   DLYSLFDKFQKLEDIVVNFLNESINLFGNYKSELVKKVEEEFLRCSDDVILFKSMLKLT
FT                   GEKTCSSVEWPKSRALTAEIESVKAKLDRVLENIRQISPSACFVHCKFRYEVEMTESEF
FT                   QRYQRKSSLQHTASGSTTPVADNTPMVKKLDNVSGNAVGGGVSSMEITSTRSGFVRGRN
FT                   VKIVQILEELEEFEFKLKESEEEFYQEIVSKFHSNSYKFCKLIEIAAQFDCLTSLATVA
FT                   KNSPFPMCRPKLHPKSQNILRVKDSVYPIFSISGNKFVPNSVNIGEGFDGPILIITGPN
FT                   MGGKSTLLRQIALTVIMGQIGSFVSCVESEFSVVDSIFTRLGASDNILQGKSTFLVELQ
FT                   DISSILSKATSSSLALIDELGRGTSTFDGTAIAVATLEKISKIGCRCVFTTHFQDVCMF
FT                   AESLSNVSMFHMAAKVDEETRSVEFLYKLVPGVCPDSHGMHVAKLARVPEHIIQNAMEA
FT                   RMRLYNSEVFGEGESASNKLLEILTEEILEAHYNNDNDKLKEIYNKYSHLKFD"
FT                   /protein_id="XP_765712.1"
FT   gene            complement(<376047..>379267)
FT                   /db_xref="GeneID:3503227"
FT                   /locus_tag="TP01_0186"
FT   mRNA            complement(join(<376047..376120,376174..376302,
FT                   376418..376522,377114..377306,377440..377574,
FT                   377654..377744,377869..377928,378029..378191,
FT                   378306..379052,379156..>379267))
FT                   /db_xref="GI:71032142"
FT                   /db_xref="GeneID:3503227"
FT                   /locus_tag="TP01_0186"
FT                   /transcript_id="XM_760620.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(376047..376120,376174..376302,
FT                   376418..376522,377114..377306,377440..377574,
FT                   377654..377744,377869..377928,378029..378191,
FT                   378306..379052,379156..379267))
FT                   /locus_tag="TP01_0186"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032143"
FT                   /db_xref="GeneID:3503227"
FT                   /translation="MTILDNVDLSSVQSCLKQLQALLDEARYSEAAKFCHKCLKKWPGE
FT                   NSFYRVKAFCEIQLSRWHSCLQTIGWLHGFRPHPAATTSRKSDKNNSDDVKESLKEAVK
FT                   THYNNDLCCWLHFEQSYCYYKLGKYKPGLKTLLLCFNNLPPQDLLKSTHKHGSVNQVNK
FT                   ANEDELYEKTDMGTVNFNDKKLTLLLAQLCLRIGNFKEASDIYSKLKLKGAESLLSINR
FT                   LSVDLSLSSQHSKGNELLNSLAKKIDDHILNERHDPYELYFNYACAFVLLDDVTRAQDY
FT                   LDIANEMLEGELKQEGVDLDPEDQVEFANIFAFRAYLNFKRGNFELAKSINTNLIKTFD
FT                   NTSDVDQATVLVSLNNQLFFGVEPGEVTLMVRKIESLIKKEQISRKFSNSELRMIHGNC
FT                   VWACLSSGNLKEAQRYLENFNRALDQKDLLLYKAAVMCLEEKYTKSVSLLRQAISQFGE
FT                   QHFVLSLTKLLIKQSKFKDAFSLLQQHKQHYNQYNEHYREYHQLVNLRLEKEGKEETRN
FT                   LRIWLELQIQNVGYVKVKELHIRNKLRGGRICLEVILKAQLQVIPPNPQLAQLAPLLAT
FT                   LRVIYNIEVLMCDLGERRRNVENKTN"
FT                   /protein_id="XP_765713.1"
FT   gene            379591..380495
FT                   /db_xref="GeneID:3503249"
FT                   /locus_tag="TP01_0187"
FT   mRNA            join(379591..380098,380170..380495)
FT                   /db_xref="GI:71032144"
FT                   /db_xref="GeneID:3503249"
FT                   /locus_tag="TP01_0187"
FT                   /transcript_id="XM_760621.1"
FT                   /product="proteasome subunit beta type 2"
FT   CDS_pept        join(379772..380098,380170..380481)
FT                   /locus_tag="TP01_0187"
FT                   /gene_family="HOG000188743" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome subunit beta type 2"
FT                   /note="go_component: proteasome core complex (sensu
FT                   Eukaryota) [goid 0005839]; go_function: endopeptidase
FT                   activity [goid 0004175]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]"
FT                   /db_xref="GI:71032145"
FT                   /db_xref="GeneID:3503249"
FT                   /translation="MDTLIGICGRDFVAVATDTYEKHSIVTLKNDDDSKIMQIDDSKLL
FT                   LLAGPCCDRNQFGEYIRKSVHYHRYKTSFDMTTKSMAHFVRQQLAEYLRKSPYQVDLLV
FT                   AGFDNNGPKLYWIDYLASSTEVDRAVHGYGGHFLRGLLDKEYHENLTVEEAVSLLKKCR
FT                   HEVKNRFLLAQSNFRAKVIDKNGIHDVDIEDDNTPEVFRLQDPKAIKVD"
FT                   /protein_id="XP_765714.1"
FT   gene            complement(380610..381697)
FT                   /db_xref="GeneID:3503250"
FT                   /locus_tag="TP01_0188"
FT   mRNA            complement(join(380610..381364,381579..381697))
FT                   /db_xref="GI:71032146"
FT                   /db_xref="GeneID:3503250"
FT                   /locus_tag="TP01_0188"
FT                   /transcript_id="XM_760622.1"
FT                   /product="prohibitin"
FT   CDS_pept        complement(join(380640..381364,381579..381687))
FT                   /locus_tag="TP01_0188"
FT                   /gene_family="HOG000205692" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prohibitin"
FT                   /db_xref="GI:71032147"
FT                   /db_xref="GeneID:3503250"
FT                   /translation="MAQIPVDKFAKLVTGAGSALLLFGSGAWLVNSSLYDVGAGHRAVV
FT                   YNRITGISETTHGEGTHFIIPWLERPIIYDVRTRPRTLMSLTGSRDLQMVNITCRVLSR
FT                   PDERRLRDIYRHLGKDYDERVLPSIINEVLKSIVAQYNASQLITQRERVSKAVRDQLVN
FT                   RARDFNILLDDVSLTHLSFSPEYEKAVEAKQVAQQQAERSKYIVLKAQEEKKSTIIKAQ
FT                   GESEAARLIGSAIKDNPAFITLRRIETAKEVANILSKSQNKIMLNSNTLLLSTDK"
FT                   /protein_id="XP_765715.1"
FT   gene            complement(<381764..>382879)
FT                   /db_xref="GeneID:3503251"
FT                   /locus_tag="TP01_0189"
FT   mRNA            complement(join(<381764..382452,382485..382682,
FT                   382753..>382879))
FT                   /db_xref="GI:71032148"
FT                   /db_xref="GeneID:3503251"
FT                   /locus_tag="TP01_0189"
FT                   /transcript_id="XM_760623.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(381764..382452,382485..382682,
FT                   382753..382879))
FT                   /locus_tag="TP01_0189"
FT                   /gene_family="HOG000135818" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032149"
FT                   /db_xref="GeneID:3503251"
FT                   /translation="MFRTRAGFYKNLTKSQYTLDYNLFHSLDRFFTYSVRKFPILNRVF
FT                   LRSIGKWPKYKYKRSDDFSISEAPDDCVEVTYLGHRTVFIQMEGVRFLTDPVLSKRLFS
FT                   GGLGVKRTSGNWYKYWKFPPADFLLLSNNSYDCMDTWTMRKISDQGGALAIGGMNITKY
FT                   LNMFYDRYTYPLSWFEEVDFGSVKITFLPAKSETKRKYLSCGIDRNRVLWGGFLLRSDH
FT                   STIFYAGKTDFSDHFEKIGEYLRDLNCTIDIAILPIGPEFKRKINMSPEDAVNVHLTLK
FT                   PKHTIVVAHDTFPLGIEAFGELKSRLTKHIEGVNREILDEFVILQEKESFRFSPLI"
FT                   /protein_id="XP_765716.1"
FT   gene            <383102..>383484
FT                   /db_xref="GeneID:3503252"
FT                   /locus_tag="TP01_0190"
FT   mRNA            join(<383102..383104,383138..383263,383314..>383484)
FT                   /db_xref="GI:71032150"
FT                   /db_xref="GeneID:3503252"
FT                   /locus_tag="TP01_0190"
FT                   /transcript_id="XM_760624.1"
FT                   /product="chaperonin 10 kDa"
FT   CDS_pept        join(383102..383104,383138..383263,383314..383484)
FT                   /locus_tag="TP01_0190"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperonin 10 kDa"
FT                   /note="go_function: chaperone activity [goid 0003754]"
FT                   /db_xref="GI:71032151"
FT                   /db_xref="GeneID:3503252"
FT                   /translation="MTVAKRFVPLFDRVLVSKIKPEHKTKSGILLPDSANLTSRMAKVV
FT                   AVGKGRVNSKGEKVDPVLKVGDTVVIPEYGGMDLKFDGEVFTAYREDDIIGTYN"
FT                   /protein_id="XP_765717.1"
FT   gene            complement(<383753..>384581)
FT                   /db_xref="GeneID:3503253"
FT                   /locus_tag="TP01_0191"
FT   mRNA            complement(join(<383753..383791,383809..383986,
FT                   384115..384455,384489..>384581))
FT                   /db_xref="GI:71032152"
FT                   /db_xref="GeneID:3503253"
FT                   /locus_tag="TP01_0191"
FT                   /transcript_id="XM_760625.1"
FT                   /product="cyclophilin"
FT   CDS_pept        complement(join(383753..383791,383809..383986,
FT                   384115..384455,384489..384581))
FT                   /locus_tag="TP01_0191"
FT                   /gene_family="HOG000135817" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclophilin"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase activity [goid 0042027]; go_function: cyclosporin
FT                   A binding [goid 0016018]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:71032153"
FT                   /db_xref="GeneID:3503253"
FT                   /translation="MIRNTLLFPYHLFKFAYGKFSKLSYKSKIYMGLLAGGILLWPNYT
FT                   RTPAVRAENIHKRAITDYVYMDISMDNRYLGRILIGLYGRLLPLTVENFIHMCKGFPIK
FT                   DKIIGYYNTRFDKIVPGRAILGGRLFDQKSSLDSCTIYSKRIPEESFDTTFVQEGDVAM
FT                   VSDGPLGVSSRFLITLTSNPGFQQKAVVVGTVVKGMKLIRMFISAVYTSSLVN"
FT                   /protein_id="XP_765718.1"
FT   gene            complement(384712..385853)
FT                   /db_xref="GeneID:3503254"
FT                   /locus_tag="TP01_0192"
FT   mRNA            complement(join(384712..384851,384937..385339,
FT                   385378..385853))
FT                   /db_xref="GI:71032154"
FT                   /db_xref="GeneID:3503254"
FT                   /locus_tag="TP01_0192"
FT                   /transcript_id="XM_760626.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(384751..384851,384937..385339,
FT                   385378..385779))
FT                   /locus_tag="TP01_0192"
FT                   /gene_family="HOG000135816" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032155"
FT                   /db_xref="GeneID:3503254"
FT                   /translation="MVRVKNRWIVFKVELSDQSKSNSLDRILRPSIIKPEIDKSAEFLF
FT                   GLLQGNLISNNITVPFANSAENLVLLQCRKAFLKETLLIVKFIKKIQNIDISFAPVRVS
FT                   GTLHQARKFILSKILESLGQISILELSGTKNKFSNKFSSAIMTLSTRFIGLITRFNTVG
FT                   VCDLLNLGSLQLRRYSPEVKDHFNNPRNVGSFDKDDPSVGTAIVGKAACGDVIKLQVKI
FT                   KDQVIEDACFKTFGCGSAIASSSYVTEMVKGKTCEEALAIKNTDISDKLNLPPVKIHCS
FT                   LLAEDAVKHAINDYINKNKK"
FT                   /protein_id="XP_765719.1"
FT   gene            complement(385912..>387617)
FT                   /db_xref="GeneID:3503238"
FT                   /locus_tag="TP01_0193"
FT   mRNA            complement(join(385912..386022,386096..386231,
FT                   386261..386345,386536..386736,386769..386849,
FT                   386917..387280,387311..387355,387387..>387617))
FT                   /db_xref="GI:71032156"
FT                   /db_xref="GeneID:3503238"
FT                   /locus_tag="TP01_0193"
FT                   /transcript_id="XM_760627.1"
FT                   /product="6-phosphogluconate dehydrogenase"
FT   CDS_pept        complement(join(385915..386022,386096..386231,
FT                   386261..386345,386536..386736,386769..386849,
FT                   386917..387280,387311..387355,387387..387617))
FT                   /locus_tag="TP01_0193"
FT                   /gene_family="HOG000255147" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="GI:71032157"
FT                   /db_xref="GeneID:3503238"
FT                   /translation="MEDSNLSEFGIVGLGVMASAYARNLYSRGFRVSVWTRSRKEIDNF
FT                   NEKLNQQPKSSGLVPDSINLTNVKCYMDLDEFVSSLKTPKMILMLITAGEAVDSVLDKL
FT                   ILLLDKHDMVIDGGNEWYKNTERRILRCKQSGIRYSGMGISGGERGALTHPCLMFGGNL
FT                   EDYNELKRILSQVDTVSLIFIEFLGFLRWTWLLRPLRKNGPQRHGIRPNAIFNAWHSEN
FT                   YSYLLQITQMILQVKEGNEHLLDKILPCVSSNGTGKWTVQDAFDRAVPVPSIAISVDMR
FT                   CFSNLSQHSNIPNTNNVGERVEKYKIENAIISCDLLNEISKSFKETDRMLPFHSKFNGI
FT                   LKDSMKTWKDVVKRCLENDIPVPGIATSLQYIQILFNKHVIEGYNLIQAQRDCFGSHTF
FT                   RRVDMLGNHHYNWWNNE"
FT                   /protein_id="XP_765720.1"
FT   gene            complement(<387859..>389475)
FT                   /db_xref="GeneID:3503239"
FT                   /locus_tag="TP01_0194"
FT   mRNA            complement(<387859..>389475)
FT                   /db_xref="GI:71032158"
FT                   /db_xref="GeneID:3503239"
FT                   /locus_tag="TP01_0194"
FT                   /transcript_id="XM_760628.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(387859..389475)
FT                   /locus_tag="TP01_0194"
FT                   /gene_family="HOG000135815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: actin filament [goid 0005884];
FT                   go_function: structural constituent of cytoskeleton [goid
FT                   0005200]; go_function: microfilament motor activity [goid
FT                   0000146]; go_process: cytoskeleton organization and
FT                   biogenesis [goid 0007010]"
FT                   /db_xref="GI:71032159"
FT                   /db_xref="GeneID:3503239"
FT                   /translation="MNWKGPYVGALVLDVGHSTIRAGYSGESLPSQLWSSAVGIGSGAD
FT                   VFPVIPGSRYRIKNVEHVKYYDTENKGIVINRNAYSRAVRGTLSGRVYDKAMIEHLKES
FT                   CNGTDFDEVSLLVGAHKHDGECWDNFSNYMIAGANLDKIPGRELLTPANVVEFMHSFNS
FT                   VSSGLSEVSGSRPVFIVEGNETSRKNRMVETEVLFEDLGVPGVHFGHGGQLASYSVGLF
FT                   SSVVIDIGSSTTSVTFLADDEVAGWKEHSVGGDHVDSIILNLLAGTNETNLSYIMNHPE
FT                   YNLGVSTLSNISVNDAVEIGKRQFNKEMSLNVYNIHHDVRTLKESILRVSPVPLVVDSE
FT                   LNFTAQLPDGESFEISEEGSKLRPNSKVKGMLPEIPLDAKSINSLDKINPFQLVGISCE
FT                   VFFNPQIAYVPKYMDLGSFKGLVPICEDLLKDNSTYRRDIFGQIALVGGLSGASGLQER
FT                   LNIEMNRASAKTPQESPLSGTKCKFVAFNSKAASRHAGWIGASIISSLGSFHKCWISRL
FT                   EYNEHGPNIANRKGPAHNYNK"
FT                   /protein_id="XP_765721.1"
FT   gene            complement(<389872..>391657)
FT                   /db_xref="GeneID:3503240"
FT                   /locus_tag="TP01_0195"
FT   mRNA            complement(join(<389872..390172,390247..390477,
FT                   390508..390656,390686..391458,391507..>391657))
FT                   /db_xref="GI:71032160"
FT                   /db_xref="GeneID:3503240"
FT                   /locus_tag="TP01_0195"
FT                   /transcript_id="XM_760629.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(389872..390172,390247..390477,
FT                   390508..390656,390686..391458,391507..391657))
FT                   /locus_tag="TP01_0195"
FT                   /gene_family="HOG000135813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032161"
FT                   /db_xref="GeneID:3503240"
FT                   /translation="MSTLIIKLYNNFLIIYTLIFIFLIPNYSNSISLSTNKTYTLNLSF
FT                   IQNHDESFESTRNDWRLFEKPIYEIGPTPRSAIPKHIPLDYENLLRTHDPSKINFNTRL
FT                   CDFPGVQIGDIDDLYGKIYDRKVLMKQLRYFLERDDFNSIWRLMEYNRDVLNKMDCDLL
FT                   MKDFDHLMFARLKYEYPEPENLERTMPFLVSRYVLQHVLQQDLGSKRNYKWLEPGEIPE
FT                   KLPKYTEDYVEPKSSPENPIHVRDTAAYRSIMNHLEESEDHYRLCALRELFQRLIDCKR
FT                   KKLKKALWRFQRLKPFRSLSYRRKVANKIDIDRVSPFLSRPMRCTDEIVKLYTGHFEDA
FT                   VNKQDLATACRLINRFARRIIFIDNFPLIRKFMSLFAEIHACKKYNLQALKRLRATYWS
FT                   TVKKHKFLIRYNEPMMIMEAGKTLKDLYEEQLEEYRKKRDAKNDEKMRKLGVNMDEVRD
FT                   FSNVYGEDWIPILYPKEYEEGIKLHQQRLEKLRKKAEKVRNEEMRKRSYEDFEMPEEPE
FT                   SLEGLELPKEEELEEAL"
FT                   /protein_id="XP_765722.1"
FT   gene            <391881..>393883
FT                   /db_xref="GeneID:3503241"
FT                   /locus_tag="TP01_0196"
FT   mRNA            join(<391881..392022,392307..392386,392648..>393883)
FT                   /db_xref="GI:71032162"
FT                   /db_xref="GeneID:3503241"
FT                   /locus_tag="TP01_0196"
FT                   /transcript_id="XM_760630.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(391881..392022,392307..392386,392648..393883)
FT                   /locus_tag="TP01_0196"
FT                   /gene_family="HOG000135812" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032163"
FT                   /db_xref="GeneID:3503241"
FT                   /translation="MVNLEEFNLPPNSTFLTKNLGTHLSFAEISLLSHLFNPRLLIYIF
FT                   DNEVKIRTHDEEDEKKLEELGESLDDDKKYEPISEEGTEAEPRQLKSKRSRNNKSKSLR
FT                   RRKAAKKAKKPKRSKKTKKSRSKKRKNKKRKSLRSSPAVEPEPEPEPEPETPTPATDPE
FT                   PETTTEESKESVLEDSETSILPELKEEEDLEKVVENKLDKTKRYWDSDILEPEHVINEW
FT                   LAISDGKKYDPQTDVKFPFLTDDENDYDRYYISKKLKKRDSPLNKYKSGSKFKSDEGLS
FT                   TNYVIPIIIEDELLRATNPDTKEDELENMIINGKFKQNYRGRVVNQNSESDELETGDEN
FT                   YDLQEYPGSYSSESMGSYSKADTDGIINSYGESISTNEETTDYENNLSVDEYGDGVGPG
FT                   GKTDSDMSDMVSGQEEQVNAPDSMNEEGETAKDSEWEFGNMDLFDETGESGENVDNLSK
FT                   KDCKKELKNLKKKYETKLKKIKKLASR"
FT                   /protein_id="XP_765723.1"
FT   gene            complement(394760..395941)
FT                   /db_xref="GeneID:3503242"
FT                   /locus_tag="TP01_0197"
FT   mRNA            complement(join(394760..394972,395002..395131,
FT                   395167..395222,395252..395341,395371..395427,
FT                   395457..395549,395579..395607,395645..395677,
FT                   395713..395792,395825..395941))
FT                   /db_xref="GI:71032164"
FT                   /db_xref="GeneID:3503242"
FT                   /locus_tag="TP01_0197"
FT                   /transcript_id="XM_760631.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(394787..394972,395002..395131,
FT                   395167..395222,395252..395341,395371..395427,
FT                   395457..395549,395579..395607,395645..395677,
FT                   395713..395731))
FT                   /locus_tag="TP01_0197"
FT                   /gene_family="HOG000009833" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: GTP binding [goid 0005525];
FT                   go_function: protein-synthesizing GTPase activity [goid
FT                   0008547]; go_process: cell cycle [goid 0007049];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032165"
FT                   /db_xref="GeneID:3503242"
FT                   /translation="MDHRIQYRIFKNPVFKKYKAPLTKIPQIAFVGYSNVGKSSLINSI
FT                   LYGTDIPFFARKIVSNAKMLKNPKFAPVSKTPGRTRHLFTFDLGNNISLVDLPGYGCAK
FT                   VSDEVRNEWSLLVNKYLDRTDNLYRILSLVDSMKGPVKEDFKLWSMLNEIEIPFQVVLT
FT                   KCDRLKPEELHLKYSKLIHILKDYEIFDQYVYATSATRLLGIHELRLSISHIALKKKTE
FT                   SKLVDKFV"
FT                   /protein_id="XP_765724.1"
FT   gene            complement(<395990..>396508)
FT                   /db_xref="GeneID:3503232"
FT                   /locus_tag="TP01_0198"
FT   mRNA            complement(join(<395990..396336,396397..>396508))
FT                   /db_xref="GI:71032166"
FT                   /db_xref="GeneID:3503232"
FT                   /locus_tag="TP01_0198"
FT                   /transcript_id="XM_760632.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(395990..396336,396397..396508))
FT                   /locus_tag="TP01_0198"
FT                   /gene_family="HOG000135811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032167"
FT                   /db_xref="GeneID:3503232"
FT                   /translation="MGSENPLEILENECVNNETKDKVDKKSPDLKDFISDDESVESDDS
FT                   YDRKKVNRGSRGTKTDKFGRRIRYQVNKKVFGTKDLKSKLNASKKYELYQMRKKEYESD
FT                   KNRSKGVPECVSQYQLSAIDRMALRREQILKKHSENFINDVKKSKDND"
FT                   /protein_id="XP_765725.1"
FT   gene            complement(396559..397494)
FT                   /db_xref="GeneID:3503233"
FT                   /locus_tag="TP01_0199"
FT   mRNA            complement(join(396559..397192,397225..397263,
FT                   397406..397494))
FT                   /db_xref="GI:71032168"
FT                   /db_xref="GeneID:3503233"
FT                   /locus_tag="TP01_0199"
FT                   /transcript_id="XM_760633.1"
FT                   /product="60S ribosomal protein L13e"
FT   CDS_pept        complement(396575..397192)
FT                   /locus_tag="TP01_0199"
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L13e"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032169"
FT                   /db_xref="GeneID:3503233"
FT                   /translation="MVKHNNMLSDVHRVKCSHRFVKPVLNQAGKKKRRRLARQRKAAAS
FT                   GLTPTGYLRPLVHMPSRRYNYKLRFGRGFTLQELKVAGLGKKVARSVGVAVDHRRTNKC
FT                   AESLNLNVNRLKTYLSKLVLFPRKKHAKKGFAGLPSDTPREKLRTLALTKQSVKKVMPV
FT                   VQEFVKEPPREVTEKDTSVNVYHKLRVARKAAKAKKAATTET"
FT                   /protein_id="XP_765726.1"
FT   gene            397732..398240
FT                   /db_xref="GeneID:3503234"
FT                   /locus_tag="TP01_0200"
FT   mRNA            397732..398240
FT                   /db_xref="GI:71032170"
FT                   /db_xref="GeneID:3503234"
FT                   /locus_tag="TP01_0200"
FT                   /transcript_id="XM_760634.1"
FT                   /product="40S ribosomal protein S16"
FT   CDS_pept        397778..398221
FT                   /locus_tag="TP01_0200"
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S16"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032171"
FT                   /db_xref="GeneID:3503234"
FT                   /translation="MVSTSSKNQKVQTFGRKKRAVCVALCTSGTGVVRVNGRPLDLLEP
FT                   VTLRTKALESLYIVGKKRLSKLDLRLRVRGGGFTSQVYAIRQAMSKAVVAYYQKYVDEA
FT                   SKKKLVDELVSYDRSLLIADSRRCEPKKFGGPGARARYQKSYR"
FT                   /protein_id="XP_765727.1"
FT   gene            complement(398255..399593)
FT                   /db_xref="GeneID:3503235"
FT                   /locus_tag="TP01_0201"
FT   mRNA            complement(join(398255..398551,398581..398682,
FT                   398713..398942,398981..399056,399101..399193,
FT                   399227..399593))
FT                   /db_xref="GI:71032172"
FT                   /db_xref="GeneID:3503235"
FT                   /locus_tag="TP01_0201"
FT                   /transcript_id="XM_760635.1"
FT                   /product="ATP synthase F1 subunit gamma"
FT   CDS_pept        complement(join(398279..398551,398581..398682,
FT                   398713..398942,398981..399056,399101..399193,
FT                   399227..399397))
FT                   /locus_tag="TP01_0201"
FT                   /gene_family="HOG000215911" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP synthase F1 subunit gamma"
FT                   /note="go_component: membrane [goid 0016020]; go_process:
FT                   proton transport [goid 0015992]"
FT                   /db_xref="GI:71032173"
FT                   /db_xref="GeneID:3503235"
FT                   /translation="MSYFSKGLSTFRPISNTCFSYNKLGLNDLNCIQTRNFGSGDIQAV
FT                   AARIKSVKSIQKITKAMKMVAASKLRADQRRLEIGRPFSQPSQDVLNLLPISTTETGHK
FT                   DTALVIMASDKGLCGGINSSVAKATRNLLQNVDSQSSAYSLYIIGEKARSALQRNYQKM
FT                   FKNVFTELTKTPFNYAKAAYIAELLRNGNHDNIKIIYNHFKSVISYETKVLDVLTWKQY
FT                   SLMNKRELNVFETEPDIGKFYPDFYEFYLTSCIYGCMLDSLASEQSARMSAMDNASSNA
FT                   TDMLSKLTLKYNRARQSKITLELIEIISGANAL"
FT                   /protein_id="XP_765728.1"
FT   gene            399760..>401967
FT                   /db_xref="GeneID:3503236"
FT                   /locus_tag="TP01_0202"
FT   mRNA            join(399760..399873,399953..400163,400194..400422,
FT                   400454..400638,400669..400733,400763..400838,
FT                   400870..400965,400995..401052,401083..401152,
FT                   401186..401265,401297..401469,401500..401751,
FT                   401914..>401967)
FT                   /db_xref="GI:71032174"
FT                   /db_xref="GeneID:3503236"
FT                   /locus_tag="TP01_0202"
FT                   /transcript_id="XM_760636.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(399842..399873,399953..400163,400194..400422,
FT                   400454..400638,400669..400733,400763..400838,
FT                   400870..400965,400995..401052,401083..401152,
FT                   401186..401265,401297..401469,401500..401751,
FT                   401914..401967)
FT                   /locus_tag="TP01_0202"
FT                   /gene_family="HOG000264846" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032175"
FT                   /db_xref="GeneID:3503236"
FT                   /translation="MDRNIGVSSDDVVKLILQYLKENNLKKTLLMMQEETGVSLNSVSN
FT                   LEVLISDAQMGRWSQVLETIDTMKLSQDTLFKLYDQIVRELVDLKETKLALLLMENCAP
FT                   LVSMQKSDPDNYRRLLELCKNRPSDSKEIYAGISTDASHHHLTKERKRNIVAEALSKDI
FT                   EHVPQSRLLALLGMALKWQNHVGILPPGEKFDVFKNISKMSDEAPEYVKNISKIIKFAE
FT                   NSHPECVVFTPNGQYLISGSSDGFIEVWNWSLGVLDTELSYQANDHFMLHETLITCLAV
FT                   SRDSEVLASGDQKGNIKIWKIDTGECLKTMNNSHKGAVTCATFSRDSSCLLTGSFDSLA
FT                   RIHGLKSGKPLKEFRGHTSIVNTVVYSMDGTRVITGSSDGFVKVWDTRTCECLKSFAAF
FT                   IQRENDDRDGPLISKSVNTILNLSTAGQSEMFLVCSKSPVLKLFNMNGSCSREFTHEDI
FT                   ENVCFLDVSGTHHGYFICLVSKKFEWLYALGDDDQVYCFNFKSGSLDNVLKDSLMSCSP
FT                   YTHFVIFII"
FT                   /protein_id="XP_765729.1"
FT   gene            <402132..>402586
FT                   /db_xref="GeneID:3503237"
FT                   /locus_tag="TP01_0203"
FT   mRNA            join(<402132..402313,402346..>402586)
FT                   /db_xref="GI:71032176"
FT                   /db_xref="GeneID:3503237"
FT                   /locus_tag="TP01_0203"
FT                   /transcript_id="XM_760637.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(402132..402313,402346..402586)
FT                   /locus_tag="TP01_0203"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032177"
FT                   /db_xref="GeneID:3503237"
FT                   /translation="MMQQFLSQKSQNTKKLNTKKECVNFILHFLAWKGYNACSVNDLLR
FT                   SPPLKVLLDIWNFLFRLVDSNVRITKENMAVEVPKFYNDFGYPHIMTTSHLKTPTAERQ
FT                   WESNLMALSWLCKLLLYEHEVCKLLGKNFIEFSQGF"
FT                   /protein_id="XP_765730.1"
FT   gene            <402642..>403192
FT                   /db_xref="GeneID:3503097"
FT                   /locus_tag="TP01_0204"
FT   mRNA            join(<402642..402870,403167..>403192)
FT                   /db_xref="GI:71032178"
FT                   /db_xref="GeneID:3503097"
FT                   /locus_tag="TP01_0204"
FT                   /transcript_id="XM_760638.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(402642..402870,403167..403192)
FT                   /locus_tag="TP01_0204"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032179"
FT                   /db_xref="GeneID:3503097"
FT                   /translation="MNIKNPLTYKTVTEWATAHLQLYINVVEKRKSIPNDFEEELNSVL
FT                   SRLDSSVNSKMKQLNHLRSVSEELQKENQEFEWKKHKGN"
FT                   /protein_id="XP_765731.1"
FT   gene            <403273..>404182
FT                   /db_xref="GeneID:3503098"
FT                   /locus_tag="TP01_0205"
FT   mRNA            join(<403273..403314,403345..403386,403417..403536,
FT                   403568..403639,403772..403873,403966..404088,
FT                   404126..>404182)
FT                   /db_xref="GI:71032180"
FT                   /db_xref="GeneID:3503098"
FT                   /locus_tag="TP01_0205"
FT                   /transcript_id="XM_760639.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(403273..403314,403345..403386,403417..403536,
FT                   403568..403639,403772..403873,403966..404088,
FT                   404126..404182)
FT                   /locus_tag="TP01_0205"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032181"
FT                   /db_xref="GeneID:3503098"
FT                   /translation="MRELENDRLSLSSEITAKRHQLSKCLTTATKNYNLIVKSLSVAGI
FT                   DAENWNEFDKLIKKVDPHSLEDSKSFPDECLKLATDIVVNETLTLKHEIEDLRTMESEF
FT                   SNSTAFNKEKSHLISENEYLVSELTKREMENTKNDLDLANKRLVEARSQANSSLQKYIK
FT                   GLRDVVEQIENYKMKNCNAIRE"
FT                   /protein_id="XP_765732.1"
FT   gene            complement(404130..405724)
FT                   /db_xref="GeneID:3503099"
FT                   /locus_tag="TP01_0206"
FT   mRNA            complement(join(404130..404563,404611..404698,
FT                   404730..404905,404938..405196,405228..405724))
FT                   /db_xref="GI:71032182"
FT                   /db_xref="GeneID:3503099"
FT                   /locus_tag="TP01_0206"
FT                   /transcript_id="XM_760640.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(404310..404563,404611..404698,
FT                   404730..404905,404938..405196,405228..405599))
FT                   /locus_tag="TP01_0206"
FT                   /gene_family="HOG000135810" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032183"
FT                   /db_xref="GeneID:3503099"
FT                   /translation="MDTTKNKPLLNKDKKGLHTGSLKEEEILESSEKLSGLNHESKSML
FT                   FLLCLSTFNDLQNRFLEKYKGMLDSKKIKGTDPTPQELKLYKKLLKSKDAFLNTPLEED
FT                   AGPSQTSTPPSTEPSTQETSLLRTLWRRYRIEFYIKAMLIIFLLKLPYFCYIVTTVIYI
FT                   LYCLGFFDLMARLSQTLRNNQNAQTVVRYFLQFMDNIQPLLVIQLNQDNAQQQLGQQVP
FT                   VQDQTQSPQPQPQPQPQPDTVTNIPTPPTPERGQAVPPRSSTAPIISDQEETPRTVRQR
FT                   PATSRVQFPFLQDRLLRARAPNETSDQTPTRGSSRSLRDRIDLFRRGHQLSQRNQPVSQ
FT                   PGECENTREKPTYFEKFVYQVFFSFILSLLPWWEPNPIYLEE"
FT                   /protein_id="XP_765733.1"
FT   gene            405883..406502
FT                   /db_xref="GeneID:3503100"
FT                   /locus_tag="TP01_0207"
FT   mRNA            join(405883..406223,406290..406502)
FT                   /db_xref="GI:71032184"
FT                   /db_xref="GeneID:3503100"
FT                   /locus_tag="TP01_0207"
FT                   /transcript_id="XM_760641.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(405911..406223,406290..406489)
FT                   /locus_tag="TP01_0207"
FT                   /gene_family="HOG000135809" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032185"
FT                   /db_xref="GeneID:3503100"
FT                   /translation="MFMYNRSSSFIFKNLSFKRVNLFKNPKISCGNKSFYSNITDNRLK
FT                   SSLESIKFTSKIKSGLIFPRYDQINNFLNRYNIALVSQSLTFSTTSSNTIELTSDDEVP
FT                   ETTDEAIPVESKVCISETECSSKDNADVICNFKGHPQIGKEYGSVYTKHEPTMFGDWSH
FT                   MGRVTDF"
FT                   /protein_id="XP_765734.1"
FT   gene            complement(406533..407697)
FT                   /db_xref="GeneID:3503101"
FT                   /locus_tag="TP01_0208"
FT   mRNA            complement(join(406533..406665,406696..406786,
FT                   406817..406939,406970..407060,407092..407238,
FT                   407270..407697))
FT                   /db_xref="GI:71032186"
FT                   /db_xref="GeneID:3503101"
FT                   /locus_tag="TP01_0208"
FT                   /transcript_id="XM_760642.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(406534..406665,406696..406786,
FT                   406817..406939,406970..407060,407092..407238,
FT                   407270..407414))
FT                   /locus_tag="TP01_0208"
FT                   /gene_family="HOG000135808" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032187"
FT                   /db_xref="GeneID:3503101"
FT                   /translation="MGNEPEVNSDDELLSLLHVSGGKFSKHFTLDSGTLLNEYTKYGIF
FT                   KDEKPSDSQGEFNSSSLYFDFINTLKNLSDAHTSHEYVRYLFVKDKQQSSNNINFSRSE
FT                   FFDDTIKHYEVLVHIKPYNMIEKCTLREIEGVPGVTDPDNLTVKTVNSMLVHADIVDVI
FT                   PSLGFKLSKKQNVSSEVFHINYGSNNYVQISVMRHMEDKEDLFPSTFLVEIKCFGNLEL
FT                   EFYKNRINTTSKLLYKFVKF"
FT                   /protein_id="XP_765735.1"
FT   gene            <408170..>410248
FT                   /db_xref="GeneID:3503102"
FT                   /locus_tag="TP01_0209"
FT   mRNA            <408170..>410248
FT                   /db_xref="GI:71032188"
FT                   /db_xref="GeneID:3503102"
FT                   /locus_tag="TP01_0209"
FT                   /transcript_id="XM_760643.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        408170..410248
FT                   /locus_tag="TP01_0209"
FT                   /gene_family="HOG000135807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032189"
FT                   /db_xref="GeneID:3503102"
FT                   /translation="MSTESLVLPSLHRGEVLLTPEDAMKLNKDLEKSNYRFEVIFEVYN
FT                   PPKIPPKKPKSVELHLRSKSHSLGDEYTPSRSTKKRIISKQESSLRFDSFGNNSGEYFE
FT                   KRSSRPRKQTFSFTDDLYDEPSNFAYSEPYKPEKSKPNKTSSQKSSQKDNKPVKILYRT
FT                   VPISTKHLPKLPKNTWEYSCYRILQMIKYMDTDKWFWYPVDPVVDGVPDYLTVIKRPMD
FT                   FHTITERLHTKHYSSPYGWQTDMRQIFYNAFLFYPPENIICQAARTLSLALENKLKSSR
FT                   YINPDEFYLTLSMDPAKLREEIENLYAPRSRKAYDAWVAPVQTLEDRRSKKRFGRLGRL
FT                   DEDNYTDLDSIDTSGDFTDDDEYVNLNSKYSKKKTIRPDRGLRQDRSRAESGMRRRKPA
FT                   KFGATMFGSEEIPQYGLVPQPPTIQKMLNDKPLTLSQQKTLQANMFRLAPNQRKAALEL
FT                   VQDELGILADNHKDDPQFFFDTDLLSIERQKQFFTYVNQMAKTNVEHMIKSDKAKVAKQ
FT                   ASDVRIMSRPEKFRTPSGMFSDSSSTSSISDVASNLLSSDDFFSSSDSENEIVPEKPVR
FT                   TDSQKGMFALFKLKIYLDTGLPEYLPVDEFEGDKHHLSEGIMGNHADFLGKIETPSESD
FT                   VSLYRNLSLQNMSTSGKKTAWMDWKGQAIHHRDVAQQTGVPPRNEDEQIAESFDARI"
FT                   /protein_id="XP_765736.1"
FT   gene            complement(<410452..>411381)
FT                   /db_xref="GeneID:3503145"
FT                   /locus_tag="TP01_0210"
FT   mRNA            complement(join(<410452..410649,410697..410783,
FT                   410824..410886,410903..411157,411193..>411381))
FT                   /db_xref="GI:71032190"
FT                   /db_xref="GeneID:3503145"
FT                   /locus_tag="TP01_0210"
FT                   /transcript_id="XM_760644.1"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT   CDS_pept        complement(join(410452..410649,410697..410783,
FT                   410824..410886,410903..411157,411193..411381))
FT                   /locus_tag="TP01_0210"
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /note="go_function: electron transporter activity [goid
FT                   0005489]; go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:71032191"
FT                   /db_xref="GeneID:3503145"
FT                   /translation="MATSRFGVIFKTLPVLSPKNVNFSVFRYTPNSKEKPRMQTYTVDT
FT                   NECGPMILDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGENGLACLMDIEKQASMG
FT                   TVEIQPLPGMYVLKDLVPDLTNFYEQYRSVEPWLKRKTPKVLSEEGDKEYYQSREDRQK
FT                   LDGLYECILCACCSTSCPSYWWNPEHYLGPAALMQAYRWIADSRDEYTTERLVEVNDTM
FT                   KLYRCHGILNCTKVCPKGLDPAGSISKLKKLVEENVSDGMF"
FT                   /protein_id="XP_765737.1"
FT   gene            complement(<411670..>412899)
FT                   /db_xref="GeneID:3503146"
FT                   /locus_tag="TP01_0211"
FT   mRNA            complement(join(<411670..412136,412223..412715,
FT                   412747..412763,412881..>412899))
FT                   /db_xref="GI:71032192"
FT                   /db_xref="GeneID:3503146"
FT                   /locus_tag="TP01_0211"
FT                   /transcript_id="XM_760645.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(411670..412136,412223..412715,
FT                   412747..412763,412881..412899))
FT                   /locus_tag="TP01_0211"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032193"
FT                   /db_xref="GeneID:3503146"
FT                   /translation="MYYSSSVEGNQELSESANASRILLIWLKYVKNISNLLKINPLESY
FT                   SDDQVMEYIKSNLTEALDNFSLDSASGVTIMKVGESCKIRRWVCEVPSRHCGKIIVRDL
FT                   YNEDRKHNENKLYSRQMIFSSNPQVIQSEITYYEENSNPKFLFNHFNNEYHIAITLSMA
FT                   FLKSEEAILILGGEVVELDEAVLEVAEKYFGYSPENVLDLKDSLNSELLNNNSRVLHIK
FT                   GDALSYARNTPRKYSAVILDINNTEDSMEEKNLKSGTLMSPNPLFLEDEVLNKISELLT
FT                   ENHGILVLNMLTRCKETRKAVLERLEKVFKFIGIMKMETVSSRSKQKIII"
FT                   /protein_id="XP_765738.1"
FT   gene            complement(<413083..>416270)
FT                   /db_xref="GeneID:3503147"
FT                   /locus_tag="TP01_0212"
FT   mRNA            complement(join(<413083..413788,413968..414097,
FT                   414130..414334,414486..>416270))
FT                   /db_xref="GI:71032194"
FT                   /db_xref="GeneID:3503147"
FT                   /locus_tag="TP01_0212"
FT                   /transcript_id="XM_760646.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(413083..413788,413968..414097,
FT                   414130..414334,414486..416270))
FT                   /locus_tag="TP01_0212"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_function: ATP binding [goid 0005524];
FT                   go_function: helicase activity [goid 0004386]"
FT                   /db_xref="GI:71032195"
FT                   /db_xref="GeneID:3503147"
FT                   /translation="MIKEINASRRYFSEKNNPLMRKIEHSNQINSSKKIKKLAKRAEKN
FT                   SVKYFKEPPKVLEKNNKVEKIAKLPDSNSSDNLKKITPKKAPEVKKTDLEQDDVEKKIY
FT                   KRTKISEKELNLLPLKAPGIRALEPDAMKTVPVEEIDSLIKLGYDGIIDMNSLFTSKIG
FT                   GSETSDSEFVKVPFKSLGIYDEALIETLKLLGIDKPTYAQKKFIPKLTEILSTPTAEKP
FT                   KNLITRVIHASTGSGKTLMYMLPIFQSCLNQSVPLFSGWSTYNQKAILGSVKELINQDI
FT                   LVICPSLELCVQSCKVAKTIYEQYKAVKSEGNPEDFYPDFSKILAIPSKDKESDEISTI
FT                   NVETEIKPTLLIGNANVLYQKKNIKKITAEKAEEYEVAKTSIQKMAASRLLTKGSDPTS
FT                   NTMKRTVAMYFATPGRLYSLLFEHKLLNLKDFRYVVLDEYDSYLEMVGQTDKKIKNVRT
FT                   KELINKMFKNMSIGLESEKEEDLGRELKEYLVNLRRKYVMCVSASDNIRAMPDVLRKFF
FT                   VEEDEENKKNLENNKESRGSEQSEPKKNVKSKTAYQFPKNILHTMATYTVPDAKLSLLR
FT                   KILKSVPYNKSVLVFCDSNLLNSVQNRITRRKAFSNVIQTNIDNTNLYNINKKTTRLVK
FT                   DILISTRLNSRGIDFSGYTHVVNYDLPHDSDTYIHKSGRIGRAGNPGICISLVEAKNLP
FT                   VFKRAIVDRLPIKYTDIKNILPIFHKCILERDCLSKNVSKQNFKDSIVVNVGCGNSNLS
FT                   EVLIEDGFKTVYNLDFSQQVLDEMKAKSNGRGIFLNVDVSKKEYIDFGVMLNKKYPNIP
FT                   KIIVDKAFMDAFISIDDSESRELIRSRSKAYLENTLNMMNCDDVFIIISVSQDYVVTEL
FT                   IRNMLMKDLFIDIYPLFSESDRKAHMIQFMYSIYKFDKGDKIERKQCKMVDMPNMPCEY
FT                   FELGQLLSKKD"
FT                   /protein_id="XP_765739.1"
FT   gene            complement(<416569..>417256)
FT                   /db_xref="GeneID:3503148"
FT                   /locus_tag="TP01_0213"
FT   mRNA            complement(join(<416569..417068,417109..>417256))
FT                   /db_xref="GI:71032196"
FT                   /db_xref="GeneID:3503148"
FT                   /locus_tag="TP01_0213"
FT                   /transcript_id="XM_760647.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(416569..417068,417109..417256))
FT                   /locus_tag="TP01_0213"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: translation release factor activity
FT                   [goid 0003747]; go_process: translational termination [goid
FT                   0006415]"
FT                   /db_xref="GI:71032197"
FT                   /db_xref="GeneID:3503148"
FT                   /translation="MKLPVYGIVLLSFLTSNGFITNNHSRMLPFVRYSSPFSHRRAGIF
FT                   TYTLDLSYKHLNKSGRLYSHNSGYYDNTKDHKELELKALRNKVFEISEPNSKLEEKYIK
FT                   ASGPGGQKINKSAICVQLNYSNPSGSIKINIKTKKHRTLILNRIEATEILIAKLKEIKD
FT                   KEIMDEKREQFKESMRNRELSEKSKYRRMVYKKNRSFIKKMRSTAKIHESEY"
FT                   /protein_id="XP_765740.1"
FT   gene            417431..418518
FT                   /db_xref="GeneID:3503149"
FT                   /locus_tag="TP01_0214"
FT   mRNA            join(417431..417600,417674..418518)
FT                   /db_xref="GI:71032198"
FT                   /db_xref="GeneID:3503149"
FT                   /locus_tag="TP01_0214"
FT                   /transcript_id="XM_760648.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(417532..417600,417674..418465)
FT                   /locus_tag="TP01_0214"
FT                   /gene_family="HOG000135806" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032199"
FT                   /db_xref="GeneID:3503149"
FT                   /translation="MSDSDSDVDTKVKRRKTESSGDEDSSYGDVEADFLFNDPSPEDLD
FT                   GIFTLMQGTIKSLDWNLPKSLNKDLYLYLSELVSNQPNIGTLIKVEDEEDSYVMAVLSL
FT                   LNLKQYEGLDSFVEAVLKKAESHCDKNGLKSLKDVLSDKNNQVGLLINERMGNVPSQLL
FT                   GKLHECVKEDIKWSKENAEDEDEKKFYNFTHILGLSRLYTQNHNDKSKEDNLVYQKPEE
FT                   KYYFDNSFVKFMWPTGESNTVKFYEDDKNKKPTSKVLQEYMFVYCLKFDRYNFVVKEIA
FT                   KNFKE"
FT                   /protein_id="XP_765741.1"
FT   gene            <418645..>421238
FT                   /db_xref="GeneID:3503150"
FT                   /locus_tag="TP01_0215"
FT   mRNA            join(<418645..418718,418805..420566,420597..420677,
FT                   420887..420959,420994..>421238)
FT                   /db_xref="GI:71032200"
FT                   /db_xref="GeneID:3503150"
FT                   /locus_tag="TP01_0215"
FT                   /transcript_id="XM_760649.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(418645..418718,418805..420566,420597..420677,
FT                   420887..420959,420994..421238)
FT                   /locus_tag="TP01_0215"
FT                   /gene_family="HOG000135805" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032201"
FT                   /db_xref="GeneID:3503150"
FT                   /translation="MTFFNFIVHTSMPLSFIMSSLSFIREEQLDSKSDDSNNDDLHILK
FT                   DEESVDNINFPELSVESIASEELRNPVLNKISACDTIDSPIRLDTAEQKPYGFSSLKTE
FT                   TFDNNFKDIHRLKRKHELLALSKRTLYSKLYTPKLEALQRLVEPGKYLLNNHFYYKDKN
FT                   LSTSSFANYKRCLPNRLDSNNSESITKTEDIDPLYTFDSRSDTAFASSNRNFPPDFNSN
FT                   FDFLDFDKFSRESGDASLCDTESYNKPQLDSFPVETYTLNEHLPRSEYKDNYKSITKRQ
FT                   ESVEKSDVSDKPKQQAPNVLTLKSCDEYVNGKKKKRVQIPVNAYKSTLSGDGTIDKSHK
FT                   IVLKFVSHDSEEFHYEPKNLLELIEERLESIANSTELYGDKIINPEFIIDQLESLRPPN
FT                   MDRELFLLLCLKPIGMGYNEYFKNFSENDFTEVLNQLYSFNLLNTNAMGYVLDAEYEIL
FT                   KEFNRLGRIHQKLINEDMIYSKILATMQENFMSQAEDLLKTTRQDLRLEVGYSHLRWGR
FT                   IKNVLSWKPGDPILREKGFVQDMASTMKMKTLQRMEQAFGTQSASSAYSPSSQLPANEA
FT                   HYIYYIKTLQSLEETEQEMLQLQVSRDRMQTLSEFSVIGPYHKPENSLPWKCIGLSCNS
FT                   VVWKSQIIFSNSVKVHNNCVVEQIQFIKHSPFSLLLEKSSQFNSSERLRQTQVVIREVV
FT                   RMVNYMKDLKFILPLKSSRIYFNNGGVILSGGVPLVCFCKDNSVIVTSRK"
FT                   /protein_id="XP_765742.1"
FT   gene            <421418..>421711
FT                   /db_xref="GeneID:3503045"
FT                   /locus_tag="TP01_0216"
FT   mRNA            <421418..>421711
FT                   /db_xref="GI:71032202"
FT                   /db_xref="GeneID:3503045"
FT                   /locus_tag="TP01_0216"
FT                   /transcript_id="XM_760650.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        421418..421711
FT                   /locus_tag="TP01_0216"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032203"
FT                   /db_xref="GeneID:3503045"
FT                   /translation="MIGKLLYESICLSTTNKHELDYSKIELCEHEDTREFMKTCLEQNP
FT                   DDRPTIEALMTMPYLKKVKLNYGIYTFMISIKFRNFRSDGRTEGQMRSGIPR"
FT                   /protein_id="XP_765743.1"
FT   gene            <422096..>424185
FT                   /db_xref="GeneID:3503046"
FT                   /locus_tag="TP01_0217"
FT   mRNA            join(<422096..422233,422295..423942,424094..>424185)
FT                   /db_xref="GI:71032204"
FT                   /db_xref="GeneID:3503046"
FT                   /locus_tag="TP01_0217"
FT                   /transcript_id="XM_760651.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(422096..422233,422295..423942,424094..424185)
FT                   /locus_tag="TP01_0217"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032205"
FT                   /db_xref="GeneID:3503046"
FT                   /translation="MVIFNNNTVLRWMEESKITSVSWCHGRIFLGNNLGQIFSFKSPSI
FT                   STIVNTNEKNKITVSKRPIVHISSLEPREELLAQDSEGDLFIVNIFLKTKPVILCRKAS
FT                   CFTRQAIEGCEEVRSSDKILPITYMANICVGLKQKIQIYSAIGENVLHQRDISISDVPL
FT                   TICWLNNTIVIGSSTCYSMTNPEGTVYTELCRNDISTDRRLQKPNTTKNIITCTCIDND
FT                   VMIVCDNIGVFYNAEIMNLSNKNTIQWTGTLQSLGSCPPFIVGLTSKKKLEIHGIRDQL
FT                   LYKTLDLTTSAITYFMPDKCNFLCATSTIVTAVQPSSYYENISNFLENDKIKEALQLVN
FT                   LYFSQNDPRKKSEIAICHTIAGWIYFSKLNFPIAFLHFSYGNVDIVYLLSFWNQYYPLH
FT                   VPETYQFNKEMPQFLHHLIPKTSVIDKFIENKMNDPEFSKYNQIENTKKELLELANSSF
FT                   ALFLFKNSKVKELERDGEMVEFYKKLQTAIETVTFLLFSESDDLRYNHILRKDKNSSFV
FT                   DVDATKNHLIDMDKSDLYAKLLIRDGRLIEAMGVLSDLVTSRNVHSQHNLEETTNTPCI
FT                   ELASCINLVLDSVGKNKNSALNVLTKNHTTLPLNSDEILSMINEHCKKV"
FT                   /protein_id="XP_765744.1"
FT   gene            <424233..>425264
FT                   /db_xref="GeneID:3503047"
FT                   /locus_tag="TP01_0218"
FT   mRNA            <424233..>425264
FT                   /db_xref="GI:71032206"
FT                   /db_xref="GeneID:3503047"
FT                   /locus_tag="TP01_0218"
FT                   /transcript_id="XM_760652.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        424233..425264
FT                   /locus_tag="TP01_0218"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032207"
FT                   /db_xref="GeneID:3503047"
FT                   /translation="MPQLQIKYLEDLVLKNKSGGVHENTLLVKYYIQSRKFNKFNSLLV
FT                   SSTQGNFNVDSKKGFESQNDRKQTLFQLLEGNYTFDLPKIENMICSLDMPEARVILYSK
FT                   LGKHYQALETIYTKWNTNQVKLCEAYCLCFGDITKFDQLNKDNPYKRLFTYYDYWIEKA
FT                   EEWPLSDTNLYIINQESETSIDNLIMNLLKIIVSHTETENKTTITKHLISKYIHFCGHN
FT                   SALNGTSILEVIPGDWNFNEFANLFNHLQLRMLHSQRTKSVKKGLARSLHSKTSMSLYK
FT                   LTSLQPVRIDTNTLCMVCSEPIKIGTSIAIKIPPQKDASESNNSIRQPFVVHEYCIRKG
FT                   HMS"
FT                   /protein_id="XP_765745.1"
FT   gene            <425667..>428951
FT                   /db_xref="GeneID:3503048"
FT                   /locus_tag="TP01_0219"
FT   mRNA            join(<425667..425910,425994..426132,426164..426386,
FT                   426476..427234,427265..427408,427441..427598,
FT                   427628..427808,427882..428565,428645..428796,
FT                   428828..>428951)
FT                   /db_xref="GI:71032208"
FT                   /db_xref="GeneID:3503048"
FT                   /locus_tag="TP01_0219"
FT                   /transcript_id="XM_760653.1"
FT                   /product="serine/threonine protein phosphatase"
FT   CDS_pept        join(425667..425910,425994..426132,426164..426386,
FT                   426476..427234,427265..427408,427441..427598,
FT                   427628..427808,427882..428565,428645..428796,
FT                   428828..428951)
FT                   /locus_tag="TP01_0219"
FT                   /gene_family="HOG000281283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein phosphatase"
FT                   /note="go_function: calcium ion binding [goid 0005509];
FT                   go_function: protein serine/threonine phosphatase activity
FT                   [goid 0004722]; go_process: protein amino acid
FT                   dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:71032209"
FT                   /db_xref="GeneID:3503048"
FT                   /translation="MEDVNLNDQVMVYGFKGVVKYIGKKEYIKRPNGNVVNQLVGVELV
FT                   KKLPQCTNGNLNGTNLFKSNDETAIFIPLESLKPYDEKEAASIRIQATVRMFLARANYI
FT                   KTMSFLFWNHMENLQEFRTLESKKNVLLPIIERLKYHYSKKDSYLIKSGILRRRFSDQT
FT                   FEFERKNYPPSDYNGPKLGKVVTLKFAHELLDMYKSGANNNDEGVINHIDIPTHENSNL
FT                   IIVGDLHGQLNDLLWIFYKFGPPSRRNVYLFNGDIADRGTFASNIFLLLFAFKLAEPTS
FT                   VIINRGNHESDDMNETYGFTSEVKLKYDGHIYNLFQKIFWELPLVIIIEKRIIVVHGGL
FT                   FRETNVTLDELNRVNRKRTCPATPDKREDSLMFDLLWSDPQRAKGISSSSRGAGCIRFG
FT                   PDVTEKFLKLNNLEICIRSHQVPDTLRGIDILHNGKCVTLFSASNYCQTTHNTGAILIF
FT                   TQGLKFEAHEFISPSLESIHSLENSTNKVTQKLLESSVFGKMEIDEKNKKRKPISENCT
FT                   NDVMMKICELICEHKQKLWLNCYKHDKNKNGTISAEAWRNALDDLAKTTIPSLFSISQL
FT                   NAVDENTGLVHYNEVLKNIVIGFDPVRHDHQHLRRECISHIFDTMVKSDLNLRELLMIF
FT                   DRNLDGSVSYSELDDAIRKLSIGLSYPQIKILIRTIFSSCLDGTSQGKADIVEFLSKLK
FT                   VIYSASIKYHPTEEWMEKALPSIGRLILSNRVESALKYCNPNNKVENLEQERKEINRRR
FT                   SSAIRAFALFQKFQEYDKAGEGLLSYDDFVKALKSLDLSKAEEEIGVQLTDHHLTELAR
FT                   MIDFTNSQKINYLEFLQAFYVVDESKYSVVDEMWNHICATMYNHKNSLKRAFSHYDKEH
FT                   VGKVYVNEFKEVLYVLNEILGGQEAPLTVEQTEVLVECIDTNEEGMILYDEFLESFKPM
FT                   YTLKK"
FT                   /protein_id="XP_765746.1"
FT   gene            <429010..>429570
FT                   /db_xref="GeneID:3503049"
FT                   /locus_tag="TP01_0220"
FT   mRNA            join(<429010..429093,429196..>429570)
FT                   /db_xref="GI:71032210"
FT                   /db_xref="GeneID:3503049"
FT                   /locus_tag="TP01_0220"
FT                   /transcript_id="XM_760654.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(429010..429093,429196..429570)
FT                   /locus_tag="TP01_0220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032211"
FT                   /db_xref="GeneID:3503049"
FT                   /translation="MAQRSEKKRADRERKVGRYYTLVFLFSVILWVLKFARDLYYKKLP
FT                   YTKFGYFWRVSLIFLGYSFSLYSIFNNLKLGLEFSLSNDLFIVTTSATVLSVFFDHSYK
FT                   LFLTVPLYAVYKGSKAFYKWATTPSLEVPQTPQNQEPKKRVKYRTVRA"
FT                   /protein_id="XP_765747.1"
FT   gene            <429572..>430441
FT                   /db_xref="GeneID:3503050"
FT                   /locus_tag="TP01_0221"
FT   mRNA            <429572..>430441
FT                   /db_xref="GI:71032212"
FT                   /db_xref="GeneID:3503050"
FT                   /locus_tag="TP01_0221"
FT                   /transcript_id="XM_760655.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        429572..430441
FT                   /locus_tag="TP01_0221"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032213"
FT                   /db_xref="GeneID:3503050"
FT                   /translation="MSEDNSENSVGSPEGSKEMNSTENHKSAEWESQPDSQPRSNESQP
FT                   SNSDPDKSDSSDTPSVYDNKEKGNELFSKGDIDGAIEKWSKSINSLSYILNKSKAENNS
FT                   VTEDSLTEYTKMYVTLCSNLSLAFLKKEDFTKCKEYCQYVLMYDEKNLKAHLRIVQADI
FT                   KLKNLDNALSNCEKGLKLNPEDNELKGLKTVINDLLKKQKKVDAVFARKVFKKIEPDPR
FT                   TAPDPFEELKKTKFYRINYAIYMMYLRLFLIIKFGWDYFKRGVLFSFDYYSKVSSRLRR
FT                   FFSKSKQD"
FT                   /protein_id="XP_765748.1"
FT   gene            complement(<431136..>432831)
FT                   /db_xref="GeneID:3503051"
FT                   /locus_tag="TP01_0222"
FT   mRNA            complement(join(<431136..431615,431743..431820,
FT                   431850..431977,432011..432059,432100..432186,
FT                   432217..432504,432535..432700,432767..>432831))
FT                   /db_xref="GI:71032214"
FT                   /db_xref="GeneID:3503051"
FT                   /locus_tag="TP01_0222"
FT                   /transcript_id="XM_760656.1"
FT                   /product="glycerol-3-phosphate o-acyltransferase"
FT   CDS_pept        complement(join(431136..431615,431743..431820,
FT                   431850..431977,432011..432059,432100..432186,
FT                   432217..432504,432535..432700,432767..432831))
FT                   /locus_tag="TP01_0222"
FT                   /gene_family="HOG000280984" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycerol-3-phosphate o-acyltransferase"
FT                   /note="go_function: acyltransferase activity [goid
FT                   0008415]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:71032215"
FT                   /db_xref="GeneID:3503051"
FT                   /translation="MNISPYELRAFNCYLFIKWLCRVVISSIFTNITIIHEERLPLYGP
FT                   LIVVSNHNNQFVDAALLIYAIPRQMCFLVAAKTLKRRLIGTLCSLAGCISVYRPDDFKY
FT                   TGVGKIHWKKGTNLIHGKDTKFTLDLNLGDKLQFDLEKIVITEIISDTQLKLETPLQLE
FT                   CPDRNGVQFSVIPKMDQSETYEQVSASLKHGNAIVIFPEGGSHDRTNLLPLKPGVALMA
FT                   FFSILDGAEDVVILPVGLVYNNVKKDQSDATIYYGNVISISREECAEFERDRRSVVTKL
FT                   LGKIEQSLYPPERSKVPVNIAFDLRKFISKVFWKYGDSPETLELVDKLSLYKKRLDNGY
FT                   LHDDEIWLLKQSMYSAFLSFLEDTIRLICYSIIGLSFAPLWVPLYLLSNYLAERHRVKA
FT                   LKNSSVKLVGTDVFVSYKCLVLLVVVPLLNFSLGLFIGIYFYRLAKH"
FT                   /protein_id="XP_765749.1"
FT   gene            <433340..>435253
FT                   /db_xref="GeneID:3502863"
FT                   /locus_tag="TP01_0223"
FT   mRNA            join(<433340..433694,433748..433914,433944..434039,
FT                   434072..434267,434341..434396,434514..434618,
FT                   434648..434746,434782..434967,435006..435074,
FT                   435227..>435253)
FT                   /db_xref="GI:71032216"
FT                   /db_xref="GeneID:3502863"
FT                   /locus_tag="TP01_0223"
FT                   /transcript_id="XM_760657.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(433340..433694,433748..433914,433944..434039,
FT                   434072..434267,434341..434396,434514..434618,
FT                   434648..434746,434782..434967,435006..435074,
FT                   435227..435253)
FT                   /locus_tag="TP01_0223"
FT                   /gene_family="HOG000284590" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032217"
FT                   /db_xref="GeneID:3502863"
FT                   /translation="MYYIIRRIHFGCFPGLRFQPCSLFNSSSYRIQNVHTYPGIRYDKI
FT                   PNYHKEDLSDEDDLNDVSRLSIKTLPFPSSVKEKLFALIKSISKKRDIDNIGSYISKKM
FT                   ASRTCVELPKILPSVLLDSNTPENKYLDQLKNLSKDSKFTHLYNLLNKGSIGPNEQAQI
FT                   NLSEAEDSRHKNSNINYSPQISVAYTAHTFFGHYAVFLRIFHEINKRVENLKLSKIMFY
FT                   NPGHGASLMYVSIFQNFSSANTIWDLKSSDILVVEPSQNLLKICQHLTSEHFDLIVLPY
FT                   VLSNTLGHKVVAEPGTPTGFRMIHSLRELFISQLQDKSFHFIAPCPHEGICPLALTGKD
FT                   WCHFSQRIYRIPHYIYNKGSISKSIDNEKFSYLVIGKYTGPRFALYYANSCYQAIRSKY
FT                   PKESLSISPAERSYFWPRIVMHPLKVGRRVLIDVCSSPNHFKRLICKRCTLG"
FT                   /protein_id="XP_765750.1"
FT   gene            complement(<435464..>436244)
FT                   /db_xref="GeneID:3502864"
FT                   /locus_tag="TP01_0224"
FT   mRNA            complement(join(<435464..435468,435596..435764,
FT                   435829..436076,436106..>436244))
FT                   /db_xref="GI:71032218"
FT                   /db_xref="GeneID:3502864"
FT                   /locus_tag="TP01_0224"
FT                   /transcript_id="XM_760658.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(435464..435468,435596..435764,
FT                   435829..436076,436106..436244))
FT                   /locus_tag="TP01_0224"
FT                   /gene_family="HOG000135804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: oxidoreductase activity [goid 0016491];
FT                   go_process: entry into host cell [goid 0030260]"
FT                   /db_xref="GI:71032219"
FT                   /db_xref="GeneID:3502864"
FT                   /translation="MDFGILLLIISLYLNKKIYNCYCMNFLHRSFSFLSPLKSMVTESP
FT                   LVGKTLSSEALSETLTTHKNEKTTLKKLLGELPPDYKGLVLFLFPSAGTPGCTKQACNF
FT                   TSNHKAFKDKGYEVYGLTSSERTPAGKWTEKHKLSFTTLVDKELKLVDHLDCRKLGLFV
FT                   HRSHLVLSKDGKVLAFEKGVNAV"
FT                   /protein_id="XP_765751.1"
FT   gene            complement(<436525..>437189)
FT                   /db_xref="GeneID:3502865"
FT                   /locus_tag="TP01_0225"
FT   mRNA            complement(join(<436525..436803,436941..>437189))
FT                   /db_xref="GI:71032220"
FT                   /db_xref="GeneID:3502865"
FT                   /locus_tag="TP01_0225"
FT                   /transcript_id="XM_760659.1"
FT                   /product="DNA-directed RNA polymerase II subunit Rpb7"
FT   CDS_pept        complement(join(436525..436803,436941..437189))
FT                   /locus_tag="TP01_0225"
FT                   /gene_family="HOG000158201" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase II subunit Rpb7"
FT                   /note="go_function: RNA binding [goid 0003723]"
FT                   /db_xref="GI:71032221"
FT                   /db_xref="GeneID:3502865"
FT                   /translation="MYFVVEQWKLINLKPCQLGPNYQQNIEEMLRDQVEGHCTNKYGYV
FT                   VCVIRIVQNDMGRVQDGTAMIVVNVKYQAIVFKPFKDEVLDAIVTDVNKLGFFAQAGPL
FT                   KAFVSRNSIHPNFVYDSDSAYPCYSDGTISIKPQSEVRMRLQGIKYDNSNLFAIATINA
FT                   DHLGAFESDIAN"
FT                   /protein_id="XP_765752.1"
FT   gene            <437441..>438337
FT                   /db_xref="GeneID:3502866"
FT                   /locus_tag="TP01_0226"
FT   mRNA            join(<437441..437610,437822..437899,437960..438013,
FT                   438274..>438337)
FT                   /db_xref="GI:71032222"
FT                   /db_xref="GeneID:3502866"
FT                   /locus_tag="TP01_0226"
FT                   /transcript_id="XM_760660.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(437441..437610,437822..437899,437960..438013,
FT                   438274..438337)
FT                   /locus_tag="TP01_0226"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032223"
FT                   /db_xref="GeneID:3502866"
FT                   /translation="MNLSSGKLKVLIRKFFTPSRKKHILPTPKYPKKVWHLSPSITKNY
FT                   DLSTVDSKIISNLSNTYCEIPPGFTHSATASISIFFQSLFKTDTSFGDKVKKFFTSSDL
FT                   VLLLGNPFPVIITSGTF"
FT                   /protein_id="XP_765753.1"
FT   gene            complement(<439339..440208)
FT                   /db_xref="GeneID:3502867"
FT                   /locus_tag="TP01_0227"
FT   mRNA            complement(join(<439339..439413,439447..439490,
FT                   439554..439631,439672..439786,439841..440208))
FT                   /db_xref="GI:71032224"
FT                   /db_xref="GeneID:3502867"
FT                   /locus_tag="TP01_0227"
FT                   /transcript_id="XM_760661.1"
FT                   /product="centrin"
FT   CDS_pept        complement(join(439339..439413,439447..439490,
FT                   439554..439631,439672..439786,439841..440014))
FT                   /locus_tag="TP01_0227"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centrin"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:71032225"
FT                   /db_xref="GeneID:3502867"
FT                   /translation="MNSRKSEVSYTTPSKVPYHQNNRKGRFDLSNEQLKEIKAAFNLLD
FT                   SLNTGKIDYHELKVAMRALGFDVKKKEVLDLIQKYDKTNTGYIDFENFKEIMVKKFSER
FT                   DPMDEINRAFELFDEDNKGNIVFKDLKRVSMELGHNLTDDDLRAMIEEFDNDRDGAS"
FT                   /protein_id="XP_765754.1"
FT   gene            <441272..>442308
FT                   /db_xref="GeneID:3502766"
FT                   /locus_tag="TP01_0228"
FT   mRNA            join(<441272..441424,441455..441542,441575..>442308)
FT                   /db_xref="GI:71032226"
FT                   /db_xref="GeneID:3502766"
FT                   /locus_tag="TP01_0228"
FT                   /transcript_id="XM_760662.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(441272..441424,441455..441542,441575..442308)
FT                   /locus_tag="TP01_0228"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032227"
FT                   /db_xref="GeneID:3502766"
FT                   /translation="MKIGYPKGDNYKLVLASLQPCQRAFIECLTTCSDDDLLIHLRAFT
FT                   QWVWEKSDVICWASVLNRFDDIFSHYINLSRGYIKGECEIDPQSYFKEVELVKSALRTS
FT                   IMIVENCGSKSTYNSVDLLVHLLDDLNLEIVYLSTRMLCVCFSIRNLRNSVLKEIPLVS
FT                   QRLSTFVTSPLPDRDLKVLSSNPTNLTRKFNQGPDSEFSVSCPLVLEYYIKCYQYWVSR
FT                   DSTIKLEMSNKAHENANEYLEIPIHEILNPESLSQNESNEKFVNYTSNEKFVSLVNSFV
FT                   SSIDENQLYLHILKTFKYLVSKYTIDENNYNVSLKCYTVNKYL"
FT                   /protein_id="XP_765755.1"
FT   gene            <442719..>455524
FT                   /db_xref="GeneID:3502767"
FT                   /locus_tag="TP01_0229"
FT   mRNA            join(<442719..444411,444580..448067,448211..>455524)
FT                   /db_xref="GI:71032228"
FT                   /db_xref="GeneID:3502767"
FT                   /locus_tag="TP01_0229"
FT                   /transcript_id="XM_760663.1"
FT                   /product="ubiquitin-protein ligase"
FT   CDS_pept        join(442719..444411,444580..448067,448211..455524)
FT                   /locus_tag="TP01_0229"
FT                   /gene_family="HOG000135802" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-protein ligase"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_function: ubiquitin-protein ligase activity [goid
FT                   0004842]; go_process: ubiquitin cycle [goid 0006512];
FT                   go_process: protein modification [goid 0006464]"
FT                   /db_xref="GI:71032229"
FT                   /db_xref="GeneID:3502767"
FT                   /translation="MIYDGIQYKTLSNLLGFGVPQGIYIKVLKSYLHHEHESQPLPPIL
FT                   KMKSPGSSEASTAPCKDFDYRTKDEKEICMLQPTGYVCENLEGDVDWKFLVQNPETREQ
FT                   ILHDEERMRVLLQLLVVYYSIINYHGNCSALTSLSVLEMLVRFTRCRNPIYTPVIIYVV
FT                   QVLEALLDYNQTVSRLLRTELHLYHVYISRIQFDMCKVENSLHFGSDLCNKNSWPNGWI
FT                   LPRTNDELVLRVYWLSFSEFSARKFLFKSIIKDIYLVTRPYSGRAEINDYDVFAPTSPM
FT                   VPIFLAILKDPLSYGHGVYSTVISLVLDTIRDDPVSQEEMHNLGIIPGLLNSINEETLK
FT                   SEDSLNLVPTAISDLFLHRTAQDYYKSMKYSFVLRLIDVVVKRDFVLFHMFGEVSASIG
FT                   LSLCTVIKHHETAHSLFMKRLIKVIYDLLLEALTFPEFKPVSTQVSQSETEEYLNQFKT
FT                   NSPPMALETLSLLDEVKSSDFYADRIANLGKCLSTFLSLKQSVSQFISCDGIKLLMQLC
FT                   TVPCLPPMFPQIYPQHPLVLIIKYLTTQAAIPSIIHFHTISQHYLNISEDWKRLYMTYH
FT                   FLYLIHKDNFSLYHTGCSGSYQLSVDFENLSTCELHNTVTMCLNTLINEYPRLLFKLSS
FT                   KIGDDNCLMGSSSYLGHEHPQLRAYKQFTADKKNEQNDVIFSANDLFWSTQCSYAYSTD
FT                   LTSENGVNSKMQLLNSEELFGLEFCRSMVVMSKSLLLSLNVSINEAVGMTSSGNECLKT
FT                   YICKHSFQVVSLFFSLLHNLDNITTSNGSGGNLEYFRNIRYISDVLELVYKLLIDDRTS
FT                   GLYLLTTCLFSSRGGMTLVCTCFDYVFTLFMGIVFAMALKLNKDLTMKELVGTKIDLGS
FT                   FPRIKALLSDFTNLEFSVLRNLYNPTLKCLQICLSLFSKCTNPRTVLNTNIDSNIANLL
FT                   TKYHKSYFTFSVTENQNLDEKSNIGTLVNGMILTCVKSCWSWFAFLVHMEPCTPSSSTS
FT                   NPFFYIPTKIVTLLLKVHIYYLDYLSPSRQQALNLHFANSVTSSKTNKVSDAVSSGLNV
FT                   SRRSRVRSRMVVSTTDDSFDVYEDRDQQDIESVRSYLSEMGFNERDINNAISYCGTSDI
FT                   ATLTDWLVSVGELTPENLELTNYSQIPEDDHINQKILQHLNSSYLLHLNNVDLDTNMDA
FT                   NNDMNMNNGADNLNSSLHPGDNAQLNDLQLNSEQLNRYEDVDYVKLMNDVFTELKTQII
FT                   PYILKLAHLMPTFLQTAYDSIFKLHSFKIRFMLCVDSFEGDDVLKMFPNFDRNYETDFN
FT                   VLNLMNFLMSKVIRLHKILQSRSLNVKNEHLLSLFSPLIFIYDNEKQLALDQLFDKETT
FT                   NCTNSSEKLDTSDQQDDMLYNYVLAIEHEHLLCYFYLLSHLMAGKENLVHFTTKLRDFN
FT                   TGRPINVLNQVLEVVDFFVNLRSQCFSKAILNVSSLGLKRKFGLSIPVPEWCLLGESES
FT                   WFMKRESTEKFEFNSLKYGLYATKCIPQISSPPPFFKYALICIHEIVKTRIIEGFTPHD
FT                   HIYNAPSSASFESSSSQHNQKGSPGRNLFNTSPSFSFDSGISQSDKALQSSQQSSSELS
FT                   KHSQRLTHRDSSKDSLGRDKESPNKFYKETLKVYKEYEIPEMVQEKLLYSCMKILEMFP
FT                   GSDGDVTFSLLSILNTITDSYRNAEKLVRFRATVNKSSMDFLKILLTIPRSGLCPGLLR
FT                   MISNIILHTMEDYATLKMALRNKIIQILTPGPLSFDRFVDELNAYYRKCPSLMIQLIDS
FT                   LCVITVDEALYPNGSFNLPKLTEDTASSSNLPRFNATNDNGPGGSFSSSNTISEKEEME
FT                   NTLINSENKVYKVKDLFITLKNHHLLKDLVSYEESDFSVCDSSDYKLDLRKLFQILRTI
FT                   VEFLHISSNLQALTHSGGDSTLKHSDSFGNTVNNTVSGTVTRSVSNTLNSTVTNNSVDK
FT                   TANKMYYPYSLDLNSYFFLFNLINHNFPLPLMYPELTPTLPGEIHLKSFPYKLDKLDKF
FT                   NVRSLLIYVTRCVFAMICGLVVPSNLSVEVSDPDFERVQKMISDSLDNYSTALMLFSSK
FT                   NVETCTCVVEEIAHVLHYISGLNSSDAGPYFVPIAVYTLCNLLNNLLLLRFRKFFDISE
FT                   VISKLKRVLCQIIGRLELSRNETRIVCLSITRVLVILTTSGTASFGHAVNSDRINAYGE
FT                   INGARDLSEGEEDETALVVELEDTDEDNMDMDSHETDTEETDEMEESDEIEESDSGTNS
FT                   GDMLIDVDSSGEESGGSSDSENPMDDVEVSDDEANEEVALPHEVEEDYASNQYSETVTT
FT                   SSIEDLEEEEEDDGPRIRVAGEIDETSRNENSQTIDTTTNISIPEDNESDSSLDEFPAD
FT                   FDLTTDNPNPTDTAVANANNISNNNIRISDIAGVQSGLDGHSIQIEIQLGNNQNLSIID
FT                   PSGSFFGLTQQVQGTAGNFNNPASDGSSTDRVFSFNTFGNINLNSNNQRDSNSYRVDLG
FT                   NQRNQGVDQRVDQNTRGDTWSTAGDLDLVLKNPVLPPFKKSFNSESYDPIYPLYLLILK
FT                   KLKIVKVNSNQPIEQHDTAIDTEIDEQLVDQDVEVDGQLLQQASEINQERMDQDVEIDG
FT                   NQDTEVTQQQDGQNIEREIDSEGRYYNRGLEVIAHALGITYGDLFTLANMDPGVIAELP
FT                   EDMREEIILHQLNTINVDAVASVRQSRSSSSSDRPTIPPQVDGENMRVEMQYLESLPRS
FT                   LRLDVTRALYGENSSAANEINASLDLEGDHSSLLAALGPFIRSEGLNSVNDLLNNLATS
FT                   LSQTTDDNLHPVLFEAVRSRLQILPNTNSNNTNTGNNSQNTANANSSNRFTTSSININN
FT                   TIPNFESSFFGGNGFIVPLNDEGGIGEPPIPIFRDLSRRNARNQRDRNFVEGEVGRTGL
FT                   TLGFVIGEVSRQNNGNRGRLNRSSMGALNRNTISFISRNPMNTVNRSGLNGINRNTINS
FT                   ISRAALNSINRNALNAVNRSGLNPVSRSTINPINRGGVNGMIRGGRLELTDEMFLMPGR
FT                   GIRMSRLNEPLNQISITGSEGLGLGLDSVDDRNSLDTRLLQTIPQILNSIDPNMFELFP
FT                   QRVNQTENNDVLLNENCDSILENIIKLIPKSICSSSQTKNINTQVGGPTHSANNSAVNN
FT                   NVSVNVPTSTNPPNATTTNNVQMDNANLDQVEKSIGTMGCGGDMDTLSLVSICKMFFLP
FT                   VEMNKRIFFKLLYNVSSGPSQGDLMRMLLYILREAILGVDAEYDCPDVDETFFKNMPKS
FT                   HFSHLSDLVNRTKVTLEPSYSNSIMAVFESKATVDYYNFSYICSERVLEQLRSILIALP
FT                   TTITSLSRPISHSEESSVHDLKRKKKRFNPLLSDSSDSAEGTSVAVCNPIDLLFYATAT
FT                   NLFQSSVKHMNHLLMVIHNLLVFRAGANMSDLDSEILSNLVNTPRVSEDVHSDIVNSLS
FT                   EEALGSFLRIYTSFTCQSTWLQMCNTKDANAQSQLEVISQIISVLLKSKHKQFVIGVLS
FT                   EKFQLVSSLLSERLSNLTDSIVFDYQIEPLIHTLLRITQLLNTVNINFINDSDFTTNLT
FT                   AEVGPEHTPEVSVNEALGGDVGPNGAIDGELRANSAVEGDDIIKQNDIVVCEFFREMNS
FT                   GILEILWNRLDQCLIYLTDESLVKNFMGDFYKETHIENQHYFDVLRSLIPLIEVFFIIS
FT                   QLFIAHDYGVTDMKFDKILANLNYEHFYNFHNLRSNSSNTPNKKSANEISESNIGKMSL
FT                   SDIGKMTQSGELGKLIQSGEMGKLSNLGDDEDMIEISENHLLMMNFVEKHKRLLNLFIK
FT                   QTPSLLNGTFMPMIRLAPMCLSFDIKRQYFRQKLKEGRVGLRIDPIKINVRRQHVFLDS
FT                   YHQLRLKTSDEMKGKLSVSFGGEEGVDAGGLTREWYTILSKEFFNPNYALFTREGRKQE
FT                   FNHPNPLSAINPDHLNYFKFIGRVIGKALYDGHHMEAYFCRSFYKHMLGSRITPCDAES
FT                   VDPQFYNNLISIRNCSLEQLGLELYFSTEIDEFGKVKIIDLVPNGRNILVTDENKHKYI
FT                   QLLCRHKVTNGIKEQLDAFMQGFRELIAPELISIFDDRELELLISGIPIIDLENMKQNV
FT                   EYINYTEDSLQIIWLWEILSEFDQSHLAAFLQFVTGTSRVPIGGFKNLMGMRGPQKISI
FT                   HKTFGQNRLPTAHTCFNQLDLPCYPEKDMLKSKLLQAILEGKEGFGFM"
FT                   /protein_id="XP_765756.1"
FT   gene            complement(455920..>458285)
FT                   /db_xref="GeneID:3502768"
FT                   /locus_tag="TP01_0230"
FT   mRNA            complement(join(455920..456323,456500..456766,
FT                   457073..>458285))
FT                   /db_xref="GI:71032230"
FT                   /db_xref="GeneID:3502768"
FT                   /locus_tag="TP01_0230"
FT                   /transcript_id="XM_760664.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(456079..456323,456500..456766,
FT                   457073..458285))
FT                   /locus_tag="TP01_0230"
FT                   /gene_family="HOG000135801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032231"
FT                   /db_xref="GeneID:3502768"
FT                   /translation="MFIEESLSFENFSSSGLRGSTNYYDVQYDDRVLPQGELEENIPEF
FT                   PFSEETQRRLSTDTFAITNDLHDHAVLHNDHTALLDTILQDTLLQDHKRMDNAVIEKNM
FT                   MDKEKPLKNGFELASRQLTNRQHVSNRQNANNKQQLNNRQTAGNRQQSNNKNQYSVKQH
FT                   STKKSELNNRQLNGTQVTNAHPNNGQLSNRQQLTKRRQLHNGHHLRPRTEDQLRIGKDY
FT                   FDDLSDYLNLEDEVPEVKKNPVLEQNLKCKIDEDALIDIFKKNGAKCESKSEMAKILAK
FT                   AKKKYVWAPGFCLQLGSKGRKIMLQLLRMAYKTNKKNKRVFQCKNPPTTISNLPFFKIN
FT                   MLWELAYDMGVFDEALLIHEFFGNVKRTNKPSPSLYGEFQVTFNNKKPDPMKYPLPNPQ
FT                   INNIPRNGYVYDGFGGFNDSYNDPYVQDHIPISFAHSAEFVGGDNGMVPDSNDLSNIIS
FT                   REEFISTISETYTRSLAMNANNQFLHDDNTTQFVQRIDPLNVHFRLGDPQLNSVHEFVT
FT                   NNAMEDHPVRVEKRRYRNGLKHDTHISTSPSSLSTDVPSVTEDQINDDEIYLHHSFE"
FT                   /protein_id="XP_765757.1"
FT   gene            complement(<459531..>461356)
FT                   /db_xref="GeneID:3502769"
FT                   /locus_tag="TP01_0231"
FT   mRNA            complement(join(<459531..459611,459647..460040,
FT                   460074..460303,460373..460482,460560..460584,
FT                   460616..460779,460903..461005,461087..461212,
FT                   461246..>461356))
FT                   /db_xref="GI:71032232"
FT                   /db_xref="GeneID:3502769"
FT                   /locus_tag="TP01_0231"
FT                   /transcript_id="XM_760665.1"
FT                   /product="ribosomal processing protein"
FT   CDS_pept        complement(join(459531..459611,459647..460040,
FT                   460074..460303,460373..460482,460560..460584,
FT                   460616..460779,460903..461005,461087..461212,
FT                   461246..461356))
FT                   /locus_tag="TP01_0231"
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal processing protein"
FT                   /db_xref="GI:71032233"
FT                   /db_xref="GeneID:3502769"
FT                   /translation="MEVRVLHRRRSDYVPEGPNRRPMPMRNPDPALHPFSRAREYTRAL
FT                   IATKLSKMFAKPLISALEGHTDSVNTMAVSRTQLADLFTGCCKGEVRMWNLLKKNKGKV
FT                   LGKHDGFVNGLCVNNDGTLLYSCGTDKYLKCWRVPDKANLEEIEVESEDNSYYDIISQY
FT                   KNDTKAANVFLAGTTAGDVLDIWDGNRSLPVMKFEWGCQSLYSVKFNPTTVNLVGSTGA
FT                   DNSVGLYDIRANTPIRKVILRLRSNALCWNPQNPIHFTVANEDSNLYTFDMRKLERALL
FT                   VHKDFVNSVTDVDYSPTGSEFVASSFDKCVRLFTMEGRSRDVYSNRRMQNVLCCRFSLD
FT                   GKFVCSGSSDMCVRIWKANASEPLGPRPPRERRSLDYRNKLMEKYKALPEIKRIQRHHH
FT                   VPALILKQKKLQQEKSAAKRRREINRALFSKDGTVTQEKEKPILNQLD"
FT                   /protein_id="XP_765758.1"
FT   gene            <462404..>463129
FT                   /db_xref="GeneID:3502770"
FT                   /locus_tag="TP01_0232"
FT   mRNA            join(<462404..462536,462684..>463129)
FT                   /db_xref="GI:71032234"
FT                   /db_xref="GeneID:3502770"
FT                   /locus_tag="TP01_0232"
FT                   /transcript_id="XM_760666.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(462404..462536,462684..463129)
FT                   /locus_tag="TP01_0232"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032235"
FT                   /db_xref="GeneID:3502770"
FT                   /translation="MVLKMNSALIFFFLFFKAAESHKYRVNFLGPSKKSSFVEKSNVEK
FT                   LTKVLREDLNSKVDEVVDLIATDLERELLKNGLTNLSLMQQSDVKGFGSKAKEIIKKTL
FT                   VGVMRSLLPVFERWIHDSVQPPVVDKHVYGVLIHPIGYRICEQIHEKLKISEPNPWKDD
FT                   EIEEEEEPEEEQDEGDSVSDEAIDQLLTM"
FT                   /protein_id="XP_765759.1"
FT   gene            <463335..>463982
FT                   /db_xref="GeneID:3502771"
FT                   /locus_tag="TP01_0233"
FT   mRNA            join(<463335..463496,463591..463742,463859..>463982)
FT                   /db_xref="GI:71032236"
FT                   /db_xref="GeneID:3502771"
FT                   /locus_tag="TP01_0233"
FT                   /transcript_id="XM_760667.1"
FT                   /product="RNA polymerase subunit"
FT   CDS_pept        join(463335..463496,463591..463742,463859..463982)
FT                   /locus_tag="TP01_0233"
FT                   /gene_family="HOG000175572" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase subunit"
FT                   /db_xref="GI:71032237"
FT                   /db_xref="GeneID:3502771"
FT                   /translation="MTTASCVFEDRFLVRSIDNSKFERVSRLSAKSTGFDAELLLDFNS
FT                   DLLQVYNKQVLHILITNSLLPSGSDVNLSESVDIPSLLGDYEYAMYGKIFKFEEVSSET
FT                   RTIYASFGGLLMSLTADKQVVADLDLDMKIYLLVRRISSNR"
FT                   /protein_id="XP_765760.1"
FT   gene            complement(<464095..>464391)
FT                   /db_xref="GeneID:3502806"
FT                   /locus_tag="TP01_0234"
FT   mRNA            complement(<464095..>464391)
FT                   /db_xref="GI:71032238"
FT                   /db_xref="GeneID:3502806"
FT                   /locus_tag="TP01_0234"
FT                   /transcript_id="XM_760668.1"
FT                   /product="dynein light chain 1"
FT   CDS_pept        complement(464095..464391)
FT                   /locus_tag="TP01_0234"
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein light chain 1"
FT                   /note="go_component: microtubule associated complex [goid
FT                   0005875]; go_function: microtubule motor activity [goid
FT                   0003777]; go_process: microtubule-based process [goid
FT                   0007017]"
FT                   /db_xref="GI:71032239"
FT                   /db_xref="GeneID:3502806"
FT                   /translation="MATLRNDAKPTVADAVIKNVDMDETTKTFALKVAVDAITKFEVEK
FT                   DIAGHIKKEFDKTYEPTWHCIVGKNFGSYVTHEKQCFIYFYLGKMAILIFKNG"
FT                   /protein_id="XP_765761.1"
FT   gene            complement(<464688..>468176)
FT                   /db_xref="GeneID:3502807"
FT                   /locus_tag="TP01_0235"
FT   mRNA            complement(join(<464688..465965,466131..>468176))
FT                   /db_xref="GI:71032240"
FT                   /db_xref="GeneID:3502807"
FT                   /locus_tag="TP01_0235"
FT                   /transcript_id="XM_760669.1"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 10"
FT   CDS_pept        complement(join(464688..465965,466131..468176))
FT                   /locus_tag="TP01_0235"
FT                   /gene_family="HOG000135800" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 10"
FT                   /db_xref="GI:71032241"
FT                   /db_xref="GeneID:3502807"
FT                   /translation="MHNFQKPENALKRAAELRAIGQSDEALVILHSAIGHRFFRIQGWD
FT                   MVQEQIMLEYVALCIDQDKLRMARDGLHQYRLISQHANVASLGKVIVELLDRAESRLVN
FT                   VKSKLPASYTGKSPTQFTSGIVEDGMEYDETPEGLMASTLQVEMRDPHSKTLHDVYRFL
FT                   WEIYKMILDITRATPKLEKVYHETARKAITFCRENSRLVEFKRLCDVMRGHYAFLLKVQ
FT                   NKPEMECMLKPELHIETRINQLISACELGMWKEAFNTVEDLYTLGIRDYITKTFQGSVS
FT                   VLGQQKEKLLKWLAIFYEKLALIFWVSDLLLFHALAVLRYVMHIRMYKKKVTEEEITYL
FT                   CSKCVLAVLSVPNHSLSPSSSTASSTAVYEMQKRMSTLLGYNTIPTKETLHYSLALKNV
FT                   LPLAHKNVQKLYDLVENDNSMKLCQQLVLILNEPNSDNVEKDSTDSKEGETKTDEAKTG
FT                   AEPNKPTTTLPNTYKEDLARYYEKVKSVVFHKVLTRLSKVYASMTIDFFTKTICPPEFY
FT                   TWDYAEKEIVELVHKGLCHVRFDYTNKVLYFNSSSVNSDSIASIRHQLTDLGKNLYYAI
FT                   TILSPTDVNKSAEQRRLQLVSMKNSIEKERSRLMKRTSEIYQRRQEHQEEQMRVEEERK
FT                   KQELQQKINEEKAEKERREEALRQLELQRKKDERYKIKSDIANQMLQELRKLCLSSSSK
FT                   IYIKGKGLDEFTVDDLIEGLLECEDLEKAQEEHMVRERQELQKQRRNEVRKVEHFLRAV
FT                   READKQLYDAYLEDLVKRDTALLLEVQKSREDKYKQNAEAMRQEKILFKSFEAEKQQWV
FT                   EKQLQSRKKEHQSKVDAQNARFKKMLVEEKIARAKMRYNQEQLRLEQKRKEEQLRLEQK
FT                   RKEEELRLEQKRKEEELRKRREQELHRQRLDEIAEIQRQKQLEIERRLAATNNTVTVNS
FT                   GYGFSNSVNKDVGRNYQKGMTRDLNNSSVRDMSIRDSSVRDASVRDTSMRDNLTVRNNV
FT                   MRDNAVMERNQNRRREYSNAHQGQGSSGFSRHDPFNRNLARNDSDLTRAEVTRADNKVE
FT                   NANSTYGDPDKPAVKEINRQTTDDSNWRSDIKKTTSKLFKSFSKKSVKTPSDDEGNWRT
FT                   "
FT                   /protein_id="XP_765762.1"
FT   gene            <469135..>471207
FT                   /db_xref="GeneID:3502808"
FT                   /locus_tag="TP01_0236"
FT   mRNA            <469135..>471207
FT                   /db_xref="GI:71032242"
FT                   /db_xref="GeneID:3502808"
FT                   /locus_tag="TP01_0236"
FT                   /transcript_id="XM_760670.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        469135..471207
FT                   /locus_tag="TP01_0236"
FT                   /gene_family="HOG000135799" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: RNA binding [goid 0003723]"
FT                   /db_xref="GI:71032243"
FT                   /db_xref="GeneID:3502808"
FT                   /translation="MVGDEDFPRSDLKDGVKTLDIKKKSLLSKFQKNKTNKPSKKDEED
FT                   ISEGIFGSNCSDDVKLPTLDSFTPGTLVLGSVALVCPYGLRIHLLNNIVGFAKYTDLFD
FT                   SADSSSNNSNLGHDRDNKLNSPFKVGSTVICYVLKVNYSYLSLSLKPSLINRDLRVDNM
FT                   YPGLVLPATVVSQEDHGLSIKFNTLSTLNGFVKYDEQGRESVKNILKTNYPINSTVYVS
FT                   VVTVNSEREFVKCQWPWHYKTPANTDTSLVFDMLKPGLLLTAEVLNVHSLPLEASNKSI
FT                   FAGYTVKCLGSIKAPISSLHSITHDILSNEVEMEDLYSLVGEMVECRIIYVDFESKKLY
FT                   LSMQSQILRWRGPLGQAFKPIPNKIIKCKIIQCFSSGFLLESIPPAGDDINNADKRVLH
FT                   CYCAIGDVLDDKSLTEETIFSSNKYSVGSEHECRVIEFDHFTRLTRVSLKSSLISEDYV
FT                   TPFELSASDIVTGKIINLVNTGAIVQISSLVFGKVPLGHLTQFPVSKLPEGFKVGKNLK
FT                   LRVLKFDHPHNKLILTAKWLMVDDTDPVVKFDQLHVGKQLIGYVTTSNDTLYTISHLDS
FT                   ESTHSDELGDLKDTKSQQKIYVKFYNELKTVLSSEEVKKAKELSVDLKTDSVVKCAVTR
FT                   VDRDKKVFSVTIDEIKISKLLENKDTTKKPRREKRKLLCKEIFKDYKTKKKLKTK"
FT                   /protein_id="XP_765763.1"
FT   gene            <471336..>472740
FT                   /db_xref="GeneID:3502809"
FT                   /locus_tag="TP01_0237"
FT   mRNA            join(<471336..471578,471614..471918,471977..472106,
FT                   472141..472301,472366..472569,472635..>472740)
FT                   /db_xref="GI:71032244"
FT                   /db_xref="GeneID:3502809"
FT                   /locus_tag="TP01_0237"
FT                   /transcript_id="XM_760671.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(471336..471578,471614..471918,471977..472106,
FT                   472141..472301,472366..472569,472635..472740)
FT                   /locus_tag="TP01_0237"
FT                   /gene_family="HOG000030966" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032245"
FT                   /db_xref="GeneID:3502809"
FT                   /translation="MGDENPLIAVKNDHKGKNSGRNKMKNKIPDRNKKINKKSQLNGKN
FT                   PNLSNEKVNNKEEKDGKPRNKKDKKGINLNIDSKLEYENEIKIRELEDRIADKEWMRNP
FT                   NSVMDFERLVVTNARSSAVWIAYMAFYINSGDIEMARKTVKRGLKAIDFREMVEKMNLW
FT                   VAYLNMECIYGNNVMEIFNQATQYNDSKSIHLKMINIFVNNNQLDKAKEICEKAIKKFH
FT                   KSKKVWLAYLRLLYENMKDFEAGRQLHKTCITRIPEKKRINITSSTALLEYKHGSPEMG
FT                   KMYFENILLDNPKRMDIWNQYLTAHIKLNMDESKTQKSEGLKNVRNLFDRAITLDLKPK
FT                   KMKIIFSKWLEFECAYGTEKSKESVQKKALKYVEYIEKKLSN"
FT                   /protein_id="XP_765764.1"
FT   gene            <472891..>474173
FT                   /db_xref="GeneID:3502810"
FT                   /locus_tag="TP01_0238"
FT   mRNA            join(<472891..473020,473057..473155,473228..473379,
FT                   473432..473915,474106..>474173)
FT                   /db_xref="GI:71032246"
FT                   /db_xref="GeneID:3502810"
FT                   /locus_tag="TP01_0238"
FT                   /transcript_id="XM_760672.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(472891..473020,473057..473155,473228..473379,
FT                   473432..473915,474106..474173)
FT                   /locus_tag="TP01_0238"
FT                   /gene_family="HOG000174091" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032247"
FT                   /db_xref="GeneID:3502810"
FT                   /translation="MSVTGPAANTNAIHRLSELELKKGIIGEGSWHNQYKDSCYIFIGG
FT                   LDHRMTEGDIIIVFSQFGEPIDINLKRDKDTGKSLGYCFLGYKDQRSTILAVDNFNGST
FT                   LLGRRIRVDHVMDYSAPVVYDDKVDDEGNKIRKEYKPTGAEGLGLGKYYVTETERLLRE
FT                   TSSKTAKHEPVQQMDEDEKWALEFEQMIKKENLESDDHPKENKEDTVSVKKEDKERDKH
FT                   RSRGKSRSRSRDRSRNRYRSRSRERDRHRHRDRDRYRSSDRDRRRYSRSSSRHKYRRDR
FT                   HRRSRRSKNNKNFEIKGVLDSFDVIGHKS"
FT                   /protein_id="XP_765765.1"
FT   gene            <474509..>476341
FT                   /db_xref="GeneID:3502811"
FT                   /locus_tag="TP01_0239"
FT   mRNA            <474509..>476341
FT                   /db_xref="GI:71032248"
FT                   /db_xref="GeneID:3502811"
FT                   /locus_tag="TP01_0239"
FT                   /transcript_id="XM_760673.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        474509..476341
FT                   /locus_tag="TP01_0239"
FT                   /gene_family="HOG000135798" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032249"
FT                   /db_xref="GeneID:3502811"
FT                   /translation="MAVYGFNSPNVQGVSTPLSGLSHSPLSARQQSPVTSYVVPGGSPV
FT                   KVVSSPNVSKSVGSGFSQTSGVLPQNSQETREISTVYLPPIRYRYDNVTGTLVQVSDQS
FT                   QNANFPSGSNVQSPSGPFPPNFSPPLSSFSPTFNSNLSHFLNSNPLNQTNQFNFQNQLN
FT                   QMNGQKGMNSFLNQPMGGPNRVPTPRNEAFKFPNFSPPNFNKPVQTQFSQPSGPQFNSF
FT                   QPSGSQFDPGLFNNSQFSGAQFKPPFQNSPQFNQPAGPQFNQPPSGLFGNYNHSVPTFG
FT                   NVQNPLNTRTPGGGNFHRYGNHLYMDTPRARYEAAVKDYYDRMNNYNSYPTFGGYNPNP
FT                   GGFNPNLNGFNPNFNSQGYNGFTPNNFNGTENSPIGFSKAFSKFEDVATKLFTNSDSLV
FT                   SDIKNAAFKIFNANSPDYMRAVVFKLDRLENVPVNPNSVSKLTFSVVAYFDVDTENYNI
FT                   HKSEQQWALPTETQGLVNCDLKGESIKIPWKGEEFVFLKILEHVGYNRFVLGRLQLKLD
FT                   TLVTGHPLKVTIIGDDGKNKGSAILEFGIGAVSLEEFNQMNMQSNNTNGDYTPMHNMTR
FT                   RDHGRANGNFMDKNEEWKQTKLRNKYPKKVSLYK"
FT                   /protein_id="XP_765766.1"
FT   gene            <476641..>478282
FT                   /db_xref="GeneID:3502501"
FT                   /locus_tag="TP01_0240"
FT   mRNA            join(<476641..476710,476754..476847,476899..476963,
FT                   477070..477778,477943..>478282)
FT                   /db_xref="GI:71032250"
FT                   /db_xref="GeneID:3502501"
FT                   /locus_tag="TP01_0240"
FT                   /transcript_id="XM_760674.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(476641..476710,476754..476847,476899..476963,
FT                   477070..477778,477943..478282)
FT                   /locus_tag="TP01_0240"
FT                   /gene_family="HOG000135797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032251"
FT                   /db_xref="GeneID:3502501"
FT                   /translation="MTRDRGYYNPGNDSFGYNSRRNNDYWLGPNNSGNRNDSYGYKNQG
FT                   QSRNSTNSSKSRFGDHNKDSTPVICKHFALLDQCRFGNKCSFLHSVKRILYMQDVFKGG
FT                   VYCSTMRMTSDNAIEFFACGHGPTIKRFKFHSNNANEIQTTTYPNITIQMPSGHGNQNN
FT                   AVRNRVKGPVTDQAIHSLLFMDDCLFAGLRTGHICVHHLPSGTFTMLEGHDASVSSIIV
FT                   IEGIVLSSCENGKINLWRFDSGAFTCVNSLLTNSKINSLLEVNCDVSSATSNQPRLLWA
FT                   GGSVINIIDLASLTVVKTIQLPSNVVVKCFKRYGGHVIVGFSNGYVKVFTPLGDEVYMS
FT                   SNESGSITAMDGMQTAEGDLLLIGSRSGELTVVQLPSFNLQYVLMCHIDGHKKSGISKI
FT                   APIGAQHFLTTGYDGNVSFFMWKNLI"
FT                   /protein_id="XP_765767.1"
FT   gene            complement(<478494..>480614)
FT                   /db_xref="GeneID:3502502"
FT                   /locus_tag="TP01_0241"
FT   mRNA            complement(join(<478494..478797,478922..479148,
FT                   479182..479334,479440..479856,479921..480013,
FT                   480068..480226,480290..480432,480515..>480614))
FT                   /db_xref="GI:71032252"
FT                   /db_xref="GeneID:3502502"
FT                   /locus_tag="TP01_0241"
FT                   /transcript_id="XM_760675.1"
FT                   /product="chaperonin 60 kDa"
FT   CDS_pept        complement(join(478494..478797,478922..479148,
FT                   479182..479334,479440..479856,479921..480013,
FT                   480068..480226,480290..480432,480515..480614))
FT                   /locus_tag="TP01_0241"
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperonin 60 kDa"
FT                   /db_xref="GI:71032253"
FT                   /db_xref="GeneID:3502502"
FT                   /translation="MASKVSAPPSNNSVWNRNEKTADVRKKNILAAKAVADLVRTSLGP
FT                   KGMDKMIQDGKGGVIITNDGATILKELSLVHPTAKMMVELSKSQDIEAGDGTTSVVVIC
FT                   KALLEMVENLLNQGIHPQTIADSMMLAVNKTEEILESISKPISLEDRSLLIDIAGISLQ
FT                   SKVVSQNASLLAPMAVDCVLGVMDSPESRNVDLRSVRIVKSIGGTIEDSEMVDGLVFSD
FT                   QKAVKTASGPTRIVDAKIGLIQFCLSTPKTDMDNNIVVKDYQSIDRIMREERLITAKMV
FT                   KKIAQTGCNVLLIQKSILRDAVTDLSLDYLAKAKIMVIKDIEREDIEFITKSIGCEEVA
FT                   SIDHFTPEKLGTAKLVESKVEGASRIVKITGVNMKKTASVLIRASNTLVLDEAERSLHD
FT                   ALCVVRCLVKRRSILPGGGAPEMEISHKLSQWAMTLEGVSQVCVKAFAEALEIIPYTLA
FT                   ENAGMYPLSVITELKAKHVQGGTNYGINIKKNSISDMFEDNVIQPLLVTLSAIKLATES
FT                   VLMILKIDDIVLSR"
FT                   /protein_id="XP_765768.1"
FT   gene            <481445..>484685
FT                   /db_xref="GeneID:3502503"
FT                   /locus_tag="TP01_0242"
FT   mRNA            join(<481445..482447,482479..482586,482653..483017,
FT                   483073..483201,483281..483382,483415..483522,
FT                   483588..484239,484322..484398,484428..>484685)
FT                   /db_xref="GI:71032254"
FT                   /db_xref="GeneID:3502503"
FT                   /locus_tag="TP01_0242"
FT                   /transcript_id="XM_760676.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(481445..482447,482479..482586,482653..483017,
FT                   483073..483201,483281..483382,483415..483522,
FT                   483588..484239,484322..484398,484428..484685)
FT                   /locus_tag="TP01_0242"
FT                   /gene_family="HOG000135796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032255"
FT                   /db_xref="GeneID:3502503"
FT                   /translation="MFNVNDSTERRSSIFSPSGQIGLICDGNSFCLNHLGTSSFIIVSA
FT                   LGQFVVYDSLSLRVVFISLPLKSNIKSIASEYENVFLVLKDNSLYVFHKYEHREITHEH
FT                   ASEIIDVFYHQNQLVTYTASELITYIKASSDDDNSVPKWTLEKVIRMDSISEITTVFPL
FT                   LGMNNKVLVGFLDSSLILLNLKSGKTLYKFTKHICNGNNTVDGVESNGSDLGGVSVMAQ
FT                   SCNNSSGVVAIGYNSGYVSIFDVNKDEFLGGFTLTKKQNQPKSMSFVLDYLGITSKSDS
FT                   LTRPELLVVGTSSGDLVVFDLLKFAVISTIELAHNTPVVRLMHIEADKCLISLGENSMI
FT                   TWSMDSDKSFLRELRSRKGFIGTINLLTPYDDEEHDLLVCSSNEGSGSLGKMSTIQQHQ
FT                   CVTFSTKSSKTKLKKITGISSCYQRHYDWPNIVTCHLNSHQVHVWSGFKKILTDKVLKA
FT                   PEMNSVATSVCLTKCGNYAIVGYQNGQIHLFMLQSCNYDSEFTRGDENNPLPAHSSQVI
FT                   NISLVGNSKIISISNSKTDRMIRVWDVIKVKMDMEYDPEIPKGVGAYNSAVGNFLTALA
FT                   CTDDNIYVLDVKGNVIIRKITYHSKVNSMKFHMNDSWLMMTTERGTMLVYDILSACYVD
FT                   YVEFLGKILDFHMDSSGSFMLVSNEKAPGVVLQYANKHAFELFPKSILYKDIPKQPIPV
FT                   DIPPSKIDLDQTVESEDENKTEETEFQSTKSQIEAGLITLSGLSYSKLQTMLFLDEIKE
FT                   RSKPKEPPKTNDNLPFFLPTTYKDGQLVFVEPEPEEIETPKPRESLLKSTDSQTQFELL
FT                   LYSNHEDKFERMMEYLLEQSPAMVHISLGLFSESNMEETLCEMLRFFQYQVKSKRNADA
FT                   LQVFLHLFLKFHAERLTNLKSSDAKKIMCELKTDLKTAYKLLQESFDKTSCYIKFLTHL
FT                   QLD"
FT                   /protein_id="XP_765769.1"
FT   gene            <484867..>489662
FT                   /db_xref="GeneID:3502504"
FT                   /locus_tag="TP01_0243"
FT   mRNA            join(<484867..485226,485298..489000,489211..>489662)
FT                   /db_xref="GI:71032256"
FT                   /db_xref="GeneID:3502504"
FT                   /locus_tag="TP01_0243"
FT                   /transcript_id="XM_760677.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(484867..485226,485298..489000,489211..489662)
FT                   /locus_tag="TP01_0243"
FT                   /gene_family="HOG000135795" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032257"
FT                   /db_xref="GeneID:3502504"
FT                   /translation="MYGYFVTTAASGATLKAIRCRLVKDSLKEYLVCLKRHSIEVYSLE
FT                   NNENRNVDNDLDHFNPPVLISVLNASSTFVDFVEYRPPSESQTHLLVLTRNFTLFLLTY
FT                   HDNLAKFTSKTVSSLQELHGRPNYENIIFKVDSGYNLLVFYGYNRVLKCIVLDPNNYFN
FT                   FSDLVTIRTNDTIFVDFEFISSEYIEKPDASKSSSSPRRRNTSTGTPTRSFSGSSSSSV
FT                   SKDIQFKSPTRNSSFHFLESKLIILGEDNAYGSNKTPVRWLYGMKLMFEIEILNGCKRF
FT                   NSYNHTPLFGDPIKLPIPYSKFIPLNLVNKANRYDSVMLLGPGSTGFINFKSPRHVKQF
FT                   KIDNSITEITCFCMYRDNKFIFGDDNGGLYLLRLSVSTMRKSANTVKRRAVYTPGMSSS
FT                   SNTLSSSTVSSQQSNRNVSGDGDFMINEVMAIRLGSFPVPSSLIKLGDHHIFYTSKMGN
FT                   SSIISIYSILNSRNNEEQTLEQGDFKSSEWAQTNLGPITDFAYREEASSGENTILACCG
FT                   MGNSASFCEIYFGLSSEVIHTSDVPGVHDLFSFPMKSPDDSSSSLLCISFFRFTRFYTV
FT                   SFSKPDVSDPPELISIESTPQPAQNRRVNARRVNKRQKARTALINALENNRRPSENPSQ
FT                   VVNNHNNSQRNTNTNRTGKITKFQNNALLCNEKTILFTKLRDGNILQVTPKNIILVNDS
FT                   FKSVRRAKISQIVTLPGDKYALSSLVCSPYILLLMSTNCIVVLEYDFKNFNSRCLDFTV
FT                   SAMGCISKNDLLNSDLGIFASGGGLVGVSSWANNNMILFLTVKDLKVVYSHKVNLDYDV
FT                   YVVSIKFAKINSNVYLLLSLSNGFLYIYQLTRADRRIKMTLSNKSKLSFWSFKLLELKV
FT                   GSGEGEDTCDLSKVNLITTGPKSYVIHPKNEKITYTKINIDNLHTVTNIVNLGTVAEKE
FT                   KEELLVIYGNHKSVVVGRLNLLNNFNVQKILKGSNFNKVIYDSRTKLAVISTIPQYIIN
FT                   PNNLYTYTPSNSQSTDVPGYCETPSTNTQSQPSPYISQHSNNSQNSNSQLTDSDNLLLC
FT                   MSDDQILSGTDTINVPSEALLVDIETKEVVYRLNMPQGHLISSMHKYTHDDLGKDYILL
FT                   GTSKVSEANDVPTEGYLYFLEVYKEADACTVVVNRNAIPLGGGVVEITNLNKFIVIAVN
FT                   SNVMVISLTASNENSSPNDPSSSSAVNNGSHRQGTRSKLELVDLKDSRLSIPKQDETTL
FT                   FIDVVANYDSNTFVVSLDTKDDVIFVGDLMTSVKMLKFRDNRLLETCRDFNTLWTTSLA
FT                   AVDNSSCLVSDDLGNFLLFKKVQHPTTDQQSIRFDKQGLFHHGEVVNKILKRTQMSVQH
FT                   VANSRMSRSNPREFMVSNRVVSESESNNPSETLNVNEYTNLFKSFFTCATTSGSLLQVC
FT                   FFDDLNMFLKLSLLEHTMHLVQKDLGNIPSRNQRNFEDLHSNIPTKGFVDGDLVEAFLK
FT                   LPDSLKKWVFETMLINSRHLGVKLSSLESLLYEVDHIKHLRLE"
FT                   /protein_id="XP_765770.1"
FT   gene            complement(489759..490814)
FT                   /db_xref="GeneID:3502505"
FT                   /locus_tag="TP01_0244"
FT   mRNA            complement(join(489759..489902,489995..490241,
FT                   490306..490397,490485..490814))
FT                   /db_xref="GI:71032258"
FT                   /db_xref="GeneID:3502505"
FT                   /locus_tag="TP01_0244"
FT                   /transcript_id="XM_760678.1"
FT                   /product="cyclophilin 1"
FT   CDS_pept        complement(join(489801..489902,489995..490241,
FT                   490306..490397,490485..490727))
FT                   /locus_tag="TP01_0244"
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclophilin 1"
FT                   /note="go_component: cytosol [goid 0005829]; go_function:
FT                   cyclophilin [goid 0004600]; go_function: cyclosporin A
FT                   binding [goid 0016018]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:71032259"
FT                   /db_xref="GeneID:3502505"
FT                   /translation="MHLRQYSWLLILFYQLLIFSSCLKFHNHPKHYSSFINNLVLTRRH
FT                   KFFDLFSQTLPEMSKRPRVYFDLTVGGAKAGRVVFELFSDVVPKTAENFRALCTGEKST
FT                   PGNPLHYKGSTFHRVIPHFMCQGGDFTNHNGTGGKSIYGAKFEDENFTLKHDRPFLLSM
FT                   ANAGPNTNGSQFFVTTVVTQWLDGKHVVFGEVVEGKDVVRAVEAVGTQSGKPTKPVVVE
FT                   DCGQL"
FT                   /protein_id="XP_765771.1"
FT   gene            <490869..>492510
FT                   /db_xref="GeneID:3502506"
FT                   /locus_tag="TP01_0245"
FT   mRNA            join(<490869..490876,491125..491900,491990..>492510)
FT                   /db_xref="GI:71032260"
FT                   /db_xref="GeneID:3502506"
FT                   /locus_tag="TP01_0245"
FT                   /transcript_id="XM_760679.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(490869..490876,491125..491900,491990..492510)
FT                   /locus_tag="TP01_0245"
FT                   /gene_family="HOG000135794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032261"
FT                   /db_xref="GeneID:3502506"
FT                   /translation="MLNKLRYKVITCLTKMLKEPLNTISGSSAVYCDVIPSLLAERIDQ
FT                   LSVYGPLFEALTNNHFIKSGYNMNSGSVFSKPECQLEVEVRLGFIQNIRSEHRFTLPVT
FT                   TDTLLASRAPVKFVPGVTEDQYNAARNFLIETSEEDDPKNEWTTCLNSCTINRFFEIQG
FT                   YDELVRISVSNDSNSPVNRQQKEPVDAIRKVNLLTWNISSGSTEEPSEESEEFSTGLEG
FT                   LDYRIAVNLEYKVPLTNLPTTSNAKYCRRRLRDSFIHTESKMRFDLSKVEDVTENKDPT
FT                   TSKFEIEIELLGEEIVKSLMDKSLSSDQRMMNLKYHCSTLIRSSRYIMDLISSKNERLK
FT                   YSSFINSISEKVGVYDLRIVSQDPESVERYKRYLSPQLPLIGDYLYRAVSVNLEKKPDL
FT                   YNNRKSLYTQEAKDIPGPFVVKMDTNGHRYVTLDK"
FT                   /protein_id="XP_765772.1"
FT   gene            complement(<492561..>494471)
FT                   /db_xref="GeneID:3502507"
FT                   /locus_tag="TP01_0246"
FT   mRNA            complement(join(<492561..494104,494188..494304,
FT                   494390..>494471))
FT                   /db_xref="GI:71032262"
FT                   /db_xref="GeneID:3502507"
FT                   /locus_tag="TP01_0246"
FT                   /transcript_id="XM_760680.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(492561..494104,494188..494304,
FT                   494390..494471))
FT                   /locus_tag="TP01_0246"
FT                   /gene_family="HOG000135793" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032263"
FT                   /db_xref="GeneID:3502507"
FT                   /translation="MAQDVLKNITDRLDNTIKETNDFFKSLSIGNVSGAKLKILKDSEV
FT                   DAPDKKWVLPYTLPVLKALTQGTAREGDKPIVLPAPVLTGRAGNVSSFQTTTRENPEYP
FT                   DLNTSKYEEKYNSSLEGWTERQKRFFYRFAADSEKKMRQESLRLQDEYNKQLATKLAMV
FT                   KNELYETNRKNLLELQEMKLERERWLLDESDTKNSLEKVSSAFESLQKSYDNLRLELDE
FT                   REFKISNLNGELSKNERLLNALRSDNEALQTELHGRSELISRLQTDVADAYLRLENETT
FT                   KSANLEQELYALNQEKKDLLEVNKDLKAQVDSLLLSNKFLLNEKESLENRKCKLEQDVS
FT                   DLNRTVYSQQNLLRSFEISESSKITALEEKVNTLQNQLKRAQIDLLAADNRPELESLTR
FT                   EVNTLRAHVKQLNADNDAMFKENSIILKKLDQEKALVKEHLNELYVTKCKANNLRHQLK
FT                   SLLQTTSRNNDTVTVSPELLELYKEKLAETNSKKEKPKDLFQPTMFDGPDDETQIKIDD
FT                   LEKELTELYLEKDRLESEMIRCNLGPGSPSRVKRQHFLLEGKLAETRKKINELSTRIKQ
FT                   LYKK"
FT                   /protein_id="XP_765773.1"
FT   gene            complement(494748..497189)
FT                   /db_xref="GeneID:3502508"
FT                   /locus_tag="TP01_0247"
FT   mRNA            complement(join(494748..494837,494904..494969,
FT                   495039..495299,495377..495496,495533..495638,
FT                   495675..495709,495849..496045,496076..496235,
FT                   496286..496359,496429..496580,496667..497189))
FT                   /db_xref="GI:71032264"
FT                   /db_xref="GeneID:3502508"
FT                   /locus_tag="TP01_0247"
FT                   /transcript_id="XM_760681.1"
FT                   /product="diacylglycerol O-acyltransferase"
FT   CDS_pept        complement(join(494781..494837,494904..494969,
FT                   495039..495299,495377..495496,495533..495638,
FT                   495675..495709,495849..496045,496076..496235,
FT                   496286..496359,496429..496580,496667..496995))
FT                   /locus_tag="TP01_0247"
FT                   /gene_family="HOG000135791" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diacylglycerol O-acyltransferase"
FT                   /note="go_component: membrane [goid 0016020]"
FT                   /db_xref="GI:71032265"
FT                   /db_xref="GeneID:3502508"
FT                   /translation="MINTRTLPEKSRSKSLKQICRSISTFFLNDSIKRTQFSSQNINFV
FT                   NDSKYNESKSTFYQSKQAPEAVGRIPSHRRGSIRKRRSNSAPNRPLVDYSSLSKPGEPQ
FT                   KDYSGRPLHEILHTECRQSLLSTGMKHLNLSGFVNLVFVILVAMNFRLVINNFRKYGLL
FT                   MEIPKGFTQMYQDWPLLRCTLKTHIAILFAWGIERFIAPLSTKPLTLPMVLLQLLNILI
FT                   VLLYPYLTVISYKTEPSLSALMLITSVVWAFKMYSFHHVCFDYRKAVWYILHYKIDLIV
FT                   TEITCWKCAKAEKKRKLLQHIQIFLQFVFFLAVIKILADQYIVVAVTNTFTMDEFKSAN
FT                   FFTVACHIIDRMLLLSVPILYCWLLMFVVIFHFWCNFLAEITRFGDRRFYGDWWNASCF
FT                   GEYWRKWNLPIHQFLIRHISKPLTNLGLPRGLINIVVFVISAALHEYLISVPLGLGWTG
FT                   YVFWAMMGQIPLLLFTDMDVIKNNKTLGNVLFWCLFCFTGQPLGVLLYWYLWGVKQGSF
FT                   I"
FT                   /protein_id="XP_765774.1"
FT   gene            complement(<497282..>498410)
FT                   /db_xref="GeneID:3502509"
FT                   /locus_tag="TP01_0248"
FT   mRNA            complement(join(<497282..497582,497613..497692,
FT                   497724..497809,497863..498032,498093..498101,
FT                   498175..>498410))
FT                   /db_xref="GI:71032266"
FT                   /db_xref="GeneID:3502509"
FT                   /locus_tag="TP01_0248"
FT                   /transcript_id="XM_760682.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(497282..497582,497613..497692,
FT                   497724..497809,497863..498032,498093..498101,
FT                   498175..498410))
FT                   /locus_tag="TP01_0248"
FT                   /gene_family="HOG000204890" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032267"
FT                   /db_xref="GeneID:3502509"
FT                   /translation="MANSKYSYVREFEQDSTLLNDCWIVVRVDGRAFSAFSNRHEFRKP
FT                   NEPRALSVINAAAVNVMSEFDDIVLAYGHSDEYRRKQKILSCVVSVFTSSYCYYWDTFF
FT                   PNRPLLTVPSFDGRVILYPTYESVLDYFSWRHVDCHINNQYNTCFWCLILDGKSNDEAY
FT                   NWLKGTTKLEKNEYLFTSHKLNYNNLPNIFKKGTTLVKSNTKDVNSNGENCINYNMFDQ
FT                   SDNMCKRESGEILGEGLVDKERKIALEINQSELNELDSKVKEQASAHNILVLHCDIVKD
FT                   SFWELVSPLILN"
FT                   /protein_id="XP_765775.1"
FT   gene            complement(498489..>499899)
FT                   /db_xref="GeneID:3502510"
FT                   /locus_tag="TP01_0249"
FT   mRNA            complement(join(498489..498627,498690..499423,
FT                   499479..499583,499617..499686,499720..>499899))
FT                   /db_xref="GI:71032268"
FT                   /db_xref="GeneID:3502510"
FT                   /locus_tag="TP01_0249"
FT                   /transcript_id="XM_760683.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(498553..498627,498690..499423,
FT                   499479..499583,499617..499686,499720..499899))
FT                   /locus_tag="TP01_0249"
FT                   /gene_family="HOG000135790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032269"
FT                   /db_xref="GeneID:3502510"
FT                   /translation="MVYSWKSLIFGDSESFEDKFPLHYHLLKNDISGVIEQFKGGADPL
FT                   KKDEKGEDAIYLALKFFIKYFNKCLMTPVSLGFSNKNSEFSSNLNSNGRYGSFKSTLTK
FT                   YNSLNSTLNDSVHLKWYKVCDIGRLSTAENGEYERLETQRCVEYYVRFQEVSWCVSRFF
FT                   DNPRDEEMILAVHARLLKKTRGFLTVLKVICENNDYRSVARKYLEENISMVGYPLLYVG
FT                   IMDHLFSMFPYDSYGRKLNKKDVNDCKRLYTYATRSKLSGIYIMKFVTQICDLLQQLFL
FT                   LLNHPIDSINREYSSDVSVQKFEYKQRIVQLDGLSLNIMELYANLAFVTDLPILFNVML
FT                   LQPKFDLENTQFNWNHLLNTITKRRNKLGSKTELLARNHFLIPMRYN"
FT                   /protein_id="XP_765776.1"
FT   gene            <499999..>501532
FT                   /db_xref="GeneID:3502511"
FT                   /locus_tag="TP01_0250"
FT   mRNA            join(<499999..500054,500118..500221,500288..500383,
FT                   500418..500616,500695..500980,501091..501165,
FT                   501218..>501532)
FT                   /db_xref="GI:71032270"
FT                   /db_xref="GeneID:3502511"
FT                   /locus_tag="TP01_0250"
FT                   /transcript_id="XM_760684.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(499999..500054,500118..500221,500288..500383,
FT                   500418..500616,500695..500980,501091..501165,
FT                   501218..501532)
FT                   /locus_tag="TP01_0250"
FT                   /gene_family="HOG000284389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032271"
FT                   /db_xref="GeneID:3502511"
FT                   /translation="MAPFFISGRLVSDNITPPSFKLFFCKLSKCVTLLLLLYSRVSQSS
FT                   DDIQKLKNDIMVMDSNVHDLARVLDKSLYNSFQISDSVCLGENVMTSGIKAKGLAGYWT
FT                   FDKLYPVDETGNGNHFYSPVVSGPPSNGIFKSNSKTSRSRFQSFLQYGIRATESLDLGQ
FT                   FTITFRVYLLGDYSPNFRNFLSRNYYNPQSPNILFYPYNNKLSVRVFTESGDIEGLSSN
FT                   SSIPSRRWTQVTIVCTENAVKIYINGLRGKPTVSSGDLVMGKALRYDGFAGYVDDLRIY
FT                   NYGMGSHEVAAFVSDCLSGFDNSFRVQLGCTFCGHREANSNGFCPSGFKLCTLDQLYIS
FT                   GAHIARANGWLHSSNQIWYKNIKNTQNESRAALCCS"
FT                   /protein_id="XP_765777.1"
FT   gene            complement(<501589..503537)
FT                   /db_xref="GeneID:3502416"
FT                   /locus_tag="TP01_0251"
FT   mRNA            complement(join(<501589..501789,501822..502222,
FT                   502257..502832,502863..502975,503010..503070,
FT                   503160..503537))
FT                   /db_xref="GI:71032272"
FT                   /db_xref="GeneID:3502416"
FT                   /locus_tag="TP01_0251"
FT                   /transcript_id="XM_760685.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(501589..501789,501822..502222,
FT                   502257..502832,502863..502975,503010..503070,
FT                   503160..503523))
FT                   /locus_tag="TP01_0251"
FT                   /gene_family="HOG000135789" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032273"
FT                   /db_xref="GeneID:3502416"
FT                   /translation="MEDKTDEYSEVVRIEIVVPDPIHYSGGPFCAFINVLPVESENSIN
FT                   KSTINIDFISVNLYGVLTFDTRAITIPKTNNTLHFPFLQSERAELNNGQDISLIFTSNP
FT                   VVFCTFKEFKPDFDELCYRFKAVIPPFLPPSYHGKHVSYSYFLYASVQYRNPNSVNEIS
FT                   TTSRKLEFNLLGSVYFDFPLLDSKCFPILPKPTGFDLSNLDTMDESVCVQMIETYLGED
FT                   ESNQNLFFSFKCSVEDTSEDNDPPPLSNNSIISRDLDLVWTFYDVCINTQEHVGSPSES
FT                   VHSSLEDMFEKFSSLGLDPYKMEQVKKCFESFHTVVQLPGEENPDSLTELTKSFKRRLE
FT                   QRLQLNQQDHLELIKTTAPNFCKLDSGTNQKETLSFTFDGLKLCSCVISGFKSTNLAQN
FT                   LEISVDSWFSVHFDFSGAYKHCLKARVRLIRSETCPESGKMEQSTVIDESMSTLGKQKC
FT                   TITSSMPGLLVPSFNHFVVKVSYELEITFFCFQKDVDVHDVNSIKASVNSLRTIKWNKP
FT                   VRIFQDDSLEQDAEDFQDQDQPGHLKYSKYFSKNKLSSFIFSLKNNTLYKVIKL"
FT                   /protein_id="XP_765778.1"
FT   gene            complement(<503642..>506004)
FT                   /db_xref="GeneID:3502417"
FT                   /locus_tag="TP01_0252"
FT   mRNA            complement(join(<503642..503810,503840..503939,
FT                   504030..504567,504615..504713,504869..505069,
FT                   505154..505206,505263..>506004))
FT                   /db_xref="GI:71032274"
FT                   /db_xref="GeneID:3502417"
FT                   /locus_tag="TP01_0252"
FT                   /transcript_id="XM_760686.1"
FT                   /product="ABC transporter"
FT   CDS_pept        complement(join(503642..503810,503840..503939,
FT                   504030..504567,504615..504713,504869..505069,
FT                   505154..505206,505263..506004))
FT                   /locus_tag="TP01_0252"
FT                   /gene_family="HOG000135788" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   ATP binding [goid 0005524]; go_function: ATP-binding
FT                   cassette (ABC) transporter activity [goid 0004009];
FT                   go_process: transport [goid 0006810]; go_process: multidrug
FT                   transport [goid 0006855]"
FT                   /db_xref="GI:71032275"
FT                   /db_xref="GeneID:3502417"
FT                   /translation="MGNRVSVPNEEVMKSSDNIPLSTSVIRFARELEPDEKYHLILGSL
FT                   GLMANAITNMLYPRIIGLLIDSSDLSKAPSLEKCPEYFFPFPLFAINNLFSKFDALGSD
FT                   FLFNRILVCSIPLYILGSMASWFRVYHTQTAIYLIQKRYRRKSFTKLLSQNLFFFHSHT
FT                   CNYLLSKLLSDCEEGPKALVESQMQFLRCCNSAIGGTCHLFSISAKLALVILLSLPLMG
FT                   VTIRQLSSMVKRYQTLRKTRLENVMAKAEEVITGIENVISFANEEYESDSFMKSLNECD
FT                   EVAIRANSSEGIMMGSILATFNLSTLIMIYFGSKQMRSGSLTVGWFFNFSMIYTDVVRG
FT                   TNSMRSVYEITDLKEPEEKLLELEEVRGDLEVCSLFFQFPETKPANKLQDIGELRDNDD
FT                   ARQGELNLQTEIINGVSFKIKSGDVIGIVGPSGAGKTTLCKLIMGIYKPTSGEILLDSN
FT                   DISNLSSKWLRSSVFSILHQEPILFSTSIEENMKYGNKKATKEQVIEASKQCNLHEYIE
FT                   SLPSKYDTPVGPKGCTLSTGQKQRIALVRTILKESKILILDEPTSSLDGYSEELVTQAI
FT                   EMARNEKTLIIVTHNQEIVKKVDKVLVLNRGMEYFGNVEEAKVNSPTFNLIFPNIVT"
FT                   /protein_id="XP_765779.1"
FT   gene            <506610..>507958
FT                   /db_xref="GeneID:3502418"
FT                   /locus_tag="TP01_0253"
FT   mRNA            join(<506610..506713,507435..507572,507636..507728,
FT                   507767..507813,507846..>507958)
FT                   /db_xref="GI:71032276"
FT                   /db_xref="GeneID:3502418"
FT                   /locus_tag="TP01_0253"
FT                   /transcript_id="XM_760687.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(506610..506713,507435..507572,507636..507728,
FT                   507767..507813,507846..507958)
FT                   /locus_tag="TP01_0253"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032277"
FT                   /db_xref="GeneID:3502418"
FT                   /translation="MPGFGWPLLSFISEGITVGCTCGMFYNVESNYITIRKYNILKYTI
FT                   VSLMVQIIVNFSCCQLFLVTNRKSSKRFTQALDHPRGSWVDPMSGFGSLGTFPGGPYRG
FT                   SGFSLTTWMGNMYKNVHTPESANEPAAANMALQIFNMVKGVIQTIIAIIVDTVPPMVLG
FT                   K"
FT                   /protein_id="XP_765780.1"
FT   gene            <508175..>509372
FT                   /db_xref="GeneID:3502419"
FT                   /locus_tag="TP01_0254"
FT   mRNA            join(<508175..508292,508332..508358,508390..508424,
FT                   508472..508499,508700..508888,508966..509134,
FT                   509201..>509372)
FT                   /db_xref="GI:71032278"
FT                   /db_xref="GeneID:3502419"
FT                   /locus_tag="TP01_0254"
FT                   /transcript_id="XM_760688.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(508175..508292,508332..508358,508390..508424,
FT                   508472..508499,508700..508888,508966..509134,
FT                   509201..509372)
FT                   /locus_tag="TP01_0254"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032279"
FT                   /db_xref="GeneID:3502419"
FT                   /translation="MNGIISSYVLKSSDQNFVLVFLRNTQLRLEEQMTLDTKHAPPFTL
FT                   GCIVQVFSQCAPPVQHKLLKHFPYDIAAACGSNVSVIIKLKFYNLSQVPPFCSFSAFVN
FT                   YPRIPPQYTSYEASKLYTEICPKYDPNQDLPLDLYSRKDGFHSSISDASKEKAAKLPLY
FT                   EKLIRSLEFHYAPRPKPCDCEKVKAKSKHPNKFLRLITRNLKLQVSMRKDAVLNANPFG
FT                   KPFTLLNSSYELNLISFNYIPNV"
FT                   /protein_id="XP_765781.1"
FT   gene            complement(<509428..>510067)
FT                   /db_xref="GeneID:3502420"
FT                   /locus_tag="TP01_0255"
FT   mRNA            complement(join(<509428..509481,509595..509678,
FT                   509709..509792,509822..>510067))
FT                   /db_xref="GI:71032280"
FT                   /db_xref="GeneID:3502420"
FT                   /locus_tag="TP01_0255"
FT                   /transcript_id="XM_760689.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(509428..509481,509595..509678,
FT                   509709..509792,509822..510067))
FT                   /locus_tag="TP01_0255"
FT                   /gene_family="HOG000135787" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032281"
FT                   /db_xref="GeneID:3502420"
FT                   /translation="MPEGVNVSRGKKICEQRSPLIKGILEWNVSEVDEMTRWIPKKKQP
FT                   ILTEKVRQRLYGTPGMNIFNYERDKPRPRKLYEPQFDVGMIPKEEPKRLTRCINILNSA
FT                   LKESLDESLLPKEGSEIRTAGKPILNKAHISQLKTNLIPTYNRVSRRKTFD"
FT                   /protein_id="XP_765782.1"
FT   gene            complement(<511045..>515109)
FT                   /db_xref="GeneID:3502421"
FT                   /locus_tag="TP01_0256"
FT   mRNA            complement(<511045..>515109)
FT                   /db_xref="GI:71032282"
FT                   /db_xref="GeneID:3502421"
FT                   /locus_tag="TP01_0256"
FT                   /transcript_id="XM_760690.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(511045..515109)
FT                   /locus_tag="TP01_0256"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: alpha1-adrenergic receptor activity [goid
FT                   0004937]; go_process: G-protein coupled receptor protein
FT                   signaling pathway [goid 0007186]"
FT                   /db_xref="GI:71032283"
FT                   /db_xref="GeneID:3502421"
FT                   /translation="MSLGCLLRYLVTYLLLFSLKSFVSSAESKSGSKGSSGTTARTGNA
FT                   SPNQSSSSQSGGSSSGRAGATGAPSNVTGSSSASGQSQSQTSSTQKSQNSQQQSSSSET
FT                   SQPRSGASVGQGGQTGVSTTVSQTRGTPGSTSASGTTATSSATGQAKETAAETPLDVSS
FT                   YTRLKTSGETPPDKVKLYSKKSDASDCAVTKDDDDYEYDLKDLECEAITHDDKCVWKRK
FT                   EGQGHPLKMIYNGDDVITINFDDIYILCTMFDNEWHLDERKTPTSGAAATAATTQPQSS
FT                   ASATPQPRGGTTASPVQAKVSEGEGTPAKETAPTTPPLDVSSYTRLKTSGETPPDKVKL
FT                   YSKKSDASDCAVTKDDDDYEYDLKDLECEAITHDDKCVWKRKGNKPYPLKMIYNGNDVI
FT                   TINFDDIYILCTMFDNEWHLEERKTPSTGSAAATTQAKAAPATTPAKAPAATAQPQPKP
FT                   TPQTAAPTSSSPAKAEAKSGTPSVTPAKAAPASTPVSQPGATTPATTAAQPAPTPQAKQ
FT                   APVTSTATPVSTPKAPPPSGTPVTLDIEKTQSTNQFEYTKNDIFHKYEVKSGHYFSKVT
FT                   EKSTVIWEIKDNIFGKLVRVKSENNEKYFAILLGDNSFKLFHQPGKSQSWKDVTSERYD
FT                   VRQLKFYGDGDKELKSSDYTSTLVNYSFEFKFNSGVNCKKIKYGQDDVWKHTDDPNLST
FT                   IKMLHLGLVSNSFFVCKDESQSKKIEFKPTQAKITPVTAPVTTRPSTEPEKTIEPVSLT
FT                   IISVRFVELAINKSDGTIEFDYVDIGVYRTFICKGGYGFNKIVRPKTAGSDVILWQAPS
FT                   GDYATKVRVREDTNTKEKQILVFLASHKYAFFHADKGKQFENVTDKRHKFFNLKVFATE
FT                   NGVEKTLKPDQYTISLYHMSIGCTIKYEYTCTKITYEGRVVYKKEEYQDLGKIKGIYLD
FT                   LIRNSMYVIGVNDETKVLEEMKEAKAVTVDIRNQKCCDEFDFTQDYQKNVKIYTARGNA
FT                   IFTKVIKGAALGSGTVIWQSTATNIYGTKVVMDGLPDLNKTKNVTVHLSNGDVKHYHKA
FT                   GIGNKWAEVSNKVSLDINKTQSNIEFDYFLKGEFTTFTAKDSYVFNKVVQPKKVGSDTV
FT                   IWETNNNNELSKKACLMVTGKEKYLGLLRIDEKATLLHKPPNGDWENITSKISEISGLK
FT                   MSYYDDNTKKYVLLSPEKYKVTLNNLNHGYELTAGVSCHRVRFGDKILWSHKSDKTFKD
FT                   LKAVYLYLRSNQFIVVSTSDEKKEIGLRDLTADDGVKEVDESENVKTVQASDSSQLRGT
FT                   GGELNLADALVPSSSSEGSTPTPKPGTSGTTPSTTGEPRDFNLADALDSTTPKTQSSTT
FT                   ATSGGSQTFME"
FT                   /protein_id="XP_765783.1"
FT   gene            complement(<516339..>523523)
FT                   /db_xref="GeneID:3502422"
FT                   /locus_tag="TP01_0257"
FT   mRNA            complement(join(<516339..521133,521167..>523523))
FT                   /db_xref="GI:71032284"
FT                   /db_xref="GeneID:3502422"
FT                   /locus_tag="TP01_0257"
FT                   /transcript_id="XM_760691.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(516339..521133,521167..523523))
FT                   /locus_tag="TP01_0257"
FT                   /gene_family="HOG000135749" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032285"
FT                   /db_xref="GeneID:3502422"
FT                   /translation="MRTSYLFRYYFIYLLLNNGKWFVISADNEPSKAKGSSQSTNPVQA
FT                   SSTTSSSVTVPSDVGLFTTDASGKKVKLDDSQFKTVQEGVEYSFEPDSGVQLTEVRHGS
FT                   TTVWEHKSGEPYPKSVSYKSDDKQFAILFDGRVFMFRFQNNEWKSELDSLSPDPTKAEG
FT                   KPAVTGVELDLKATAGSNQFEYKRSGDTATFTAKTGHEFTTVMETTGTGGSRTVTWRSA
FT                   NPNENATKVELEGVGKNDQKLTIHKKNDSKLKFNKSGANANWEEVVTKVELDLGKTSAT
FT                   DQFDYDRKNEFATYFARDGYGFNKVLKAKATDYSREELVWAAEASSKNFVKLVRVKLTD
FT                   NHVALLLNNLELLLYHKTAEDQPWKDITSDRHKLSELKFFTFDQSGSPKEIDSTYYRVE
FT                   LNGFSYGYTFHDDFEFHQIKYQNKLVYDYDADEDFGLLKGVYLGLSSNNFFITNYDNES
FT                   KKLDVTKEVVLKKAVPITATAVTPTVKPKKPKKVKAPEEAAEAPPEPTPAAPETENTIE
FT                   PVSVTIPKATLVELKIDKSDSTNEFEYHDIGVYKTFSCKQGFGFNKVVRSKTFGADVLW
FT                   EAPANDYATKVRVKETAGTKEKHLLLFLASQNYVFFHSDKGKPFENVTDKRHKFFNLKV
FT                   FSVDESSKVEKTLKPDQYTISLYHMSIGCTIKSEHVCSKITYEGKEVYKKDNYQDLGNI
FT                   KGVYLDLIRNSMYVIGVNDETKVLEAMKKAKAIVLDINKTDSTEDFDFTQDYQKNIKTH
FT                   AARGNAVFAAVVKGSRITGVAADEIWKSSSPNVALERTKNVTVHLSNGDVKHLNYSDGK
FT                   WGSVSNKISLDITKTQSSIEFDYFLKDDFTTFTAKDSFVFNKVFESKTLGADTDIWKAT
FT                   NPSEYSTKACLMVTGSEKYLGLFRTDGNVILLHRPPGKDWENATSKIPKVSDLKMLYYD
FT                   AGSYMQLKPDKYKLTFDNLMYGYEFNHGVDCHLVKFGDKHLWNHSDDPNFKTIKGVYLY
FT                   LRSGQFIVVSPSDQRKEISLRGLTEGKEGEEEEEEEGGEEGKEEGKEEEEEEPKSSAPA
FT                   TLVELDVEKKESTEQYGYEKKDDDHVFKAKSGFKFSKVKKGTHVLKDLPDPHSPRVVAN
FT                   YGQVGKILLYVYKNNKDFEFSLVDDPDPTSEGPAVPSGSATGLAESKIVSEQFKLLTQD
FT                   DSGSSREIDKEQLKSKEQILSHLINYTFPEKAKCSELTYGNKSIWKHDKSIHGNYYPSN
FT                   VILNTNTSFLMVESQGQYQYYFTLMGDEWKCISGYKSHILQPLSLFKLKMFTLNEFSLI
FT                   NTDDATQYNKKVDGNVTTFKFKPGAKCIGVKYGGDSVWSYNDTDHEDHYPDTIIVNTNQ
FT                   NFLSLECSNLYRYVFSYYDGKFACIFAYKSRLSHPIEQEKLRLSKVGDLGLMTPADTSD
FT                   FELKESDTTYKFESGLRFASIKYDGDEVWKYDETKYKGKFPTSLSFNKINRNYLALEWP
FT                   GTYRQLFQFQNNKLTSLRSGDRVNYFYDVTGVFDLDKLKLYTQDDSSNLVELDLNQYSV
FT                   EQPTLITYNFKDSVKCGEVRYDDLLVWKYDHSEHGDVFPTAVVLNKAKNYIFVESSYFY
FT                   RHVLSYYNRQWKELPFGFKTSNLFFHKFKMFTEDTSDPNKLVELDSSKYEPLYSSNALT
FT                   INFNSDVKCTHIRYGDEDPWKHDSDEHRDKFPTSLVLNKKKKLLIVESGYDYRYVYSRQ
FT                   NNMWKLLPYGYKLSESSKTRPSDPNNLKLFTTDTNKKLAEIDESKYEKKDSENLFQIKF
FT                   NPDANCKVIKYDDVNVWSYDLDDHKDRHPTSLVLNKKKNYIMVESGHDYSYSYAYYNRK
FT                   WNLLPVSYNHRRSSDPIDHDKLKFFKLNENRIPEETTFGKEGDDSLTIYKIPADVKCVG
FT                   VKYDGVEVWRHNGDEHQDKYPTRVLLYKNNSTLMVESSSNYEYVFTYEDKVWKLVPFGA
FT                   RLKVTESRYNLEKLKLCSFDHTNKTFDLENLNHYSLQGSRNLARFTFNQGVKCTEVRYD
FT                   GKLVWKYHYDEHEGHFPTEVTVNLNTGFITVESKAHYETYFSYYDDKWNLVYGYKASTR
FT                   TKFRESAKLRFYITNEDGLLEPTISYDEVVTGPVITYNIYYGVKCTHVKFDEVSVWTYD
FT                   SDKYGDHYPTSVVFNVTKMVITVQSSDQYVHFSSLVGQEWRPFSGFVSSKTTGPSEVKI
FT                   YKIGRSGDQVLVHSSKYTVTWDSVSEYVYDLKDANCNEIRHNGTAVFKLDPKERYPKEV
FT                   SYSSQNKKFVVKLRDSYHVCTMDREGWKSMIHKMDGSNPVAGPKYPFDTARSTPSVLTT
FT                   APTSESTHASDSSQLRGTSGELNLADALGPSSSSEGSTPTPKPGTSTTSTTGQAKDFDL
FT                   ADAVESSQTSKGSAASPKEQPSSTTSTPPSGSETFME"
FT                   /protein_id="XP_765784.1"
FT   gene            complement(<524577..>526022)
FT                   /db_xref="GeneID:3502423"
FT                   /locus_tag="TP01_0258"
FT   mRNA            complement(<524577..>526022)
FT                   /db_xref="GI:71032286"
FT                   /db_xref="GeneID:3502423"
FT                   /locus_tag="TP01_0258"
FT                   /transcript_id="XM_760692.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(524577..526022)
FT                   /locus_tag="TP01_0258"
FT                   /gene_family="HOG000135786" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032287"
FT                   /db_xref="GeneID:3502423"
FT                   /translation="MWNYPYENGYDIYSNCEYNLMTMKPNVNSGYGTNMSTEQGLVDPI
FT                   SSTFNGDYGLQNFNSCINEIVPQNKSKDDNFTEYVSNFNNLDNYQNDIAFPTKGVNYLE
FT                   KDNSYNLNGINGQSNDGNNPELFFDPAEQYHTSSKHSLNGKEDNKKTDESHSNTCSLLN
FT                   PNSPAVENKKNHEQDFNSVVSNSPYNYDSYTETHYDTWDKSNDKMVGPMNDTYYWDSNM
FT                   LNNGYFNGLNGMTMAGYDYMGYNTNNSPNLDQYNMTQDPYTMNYMKNMMNNYISNGYNL
FT                   EYGSISSPNEPFADPYIKYNNKMYNNNFSPYYNQMPLNANLNVNYNCFNKLPQLKQSSN
FT                   PGLEDCNSNNNAVNQFDMLPNNFESVRKPELISLDDEALESFIYNGNIKKIDISNIDFI
FT                   NMSDKVWQALRGAGLFKLGNKGRAILKSKISKYLKMYPELRMRYLLSFNSFLGLHVYQE
FT                   FGEPPQGNCFNWHRSDYKFNFCF"
FT                   /protein_id="XP_765785.1"
FT   gene            <527332..>528199
FT                   /db_xref="GeneID:3502424"
FT                   /locus_tag="TP01_0259"
FT   mRNA            join(<527332..527666,527698..>528199)
FT                   /db_xref="GI:71032288"
FT                   /db_xref="GeneID:3502424"
FT                   /locus_tag="TP01_0259"
FT                   /transcript_id="XM_760693.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(527332..527666,527698..528199)
FT                   /locus_tag="TP01_0259"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032289"
FT                   /db_xref="GeneID:3502424"
FT                   /translation="MNLEEFLEFLEESDDDVDSNPNNQARESIKNEHINKDIDYNEIYN
FT                   KLVHEELSNDSDSLDLNDSSTSNNQLNKDKITNGSEEASGLLTDESFNNDSISTLPIDN
FT                   TITSLSLSTSDGKVTSKFETNFDLSEPVNIAKQSKIESSGKSNQHDVNICQCKIDNKLV
FT                   KYSIKNCGDLFNAVEHCVQMQLSEWDNKHKLHLINKLREYRNKLNNYHEESSKFNSTDD
FT                   SGTLERLIPDISKDYLKALSLPSTTLIDDSHNTKLSIRCRHKLTTSLELLKIFEDR"
FT                   /protein_id="XP_765786.1"
FT   gene            <528333..>533318
FT                   /db_xref="GeneID:3502425"
FT                   /locus_tag="TP01_0260"
FT   mRNA            <528333..>533318
FT                   /db_xref="GI:71032290"
FT                   /db_xref="GeneID:3502425"
FT                   /locus_tag="TP01_0260"
FT                   /transcript_id="XM_760694.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        528333..533318
FT                   /locus_tag="TP01_0260"
FT                   /gene_family="HOG000135785" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032291"
FT                   /db_xref="GeneID:3502425"
FT                   /translation="MCGSVFISEFSLYNSERKFCSYNEYDGLDSSIDPLNWYEIDSEKG
FT                   VSVTSLDILPNTSWITVGYSDGTVKLLQNFKVTRPPKGHSSLKAETGDSKNADSRTFGL
FT                   MADAVSSAFGGIKKTSSQTLCSTDVFNDSVLNCKFTFAESYEEIICSNLKSIAILTYSK
FT                   NVLSHNLNVNYLQSLNERLENDQVVDIVCLSSNPQAKFITGGDVGGICAILTLKTCLVF
FT                   STRPRLSIIINVSLDKLNRNVSADFNQTPSVTWMIFNTGKKNIKPLLLISMGNQIRFIQ
FT                   CNLQTVKGVPSMNVSNMGTIQFRNPIRCIRIVTRLILAIVDSTNTLHIVQINLNTLQMY
FT                   YDIIRSLDLTDLSTKMELGIDVFDPLWLLQPSILSTITVFSKTVKMVAKGYKKFSNLVS
FT                   DLFQGKKHTSSFELKNFSILILVPNGVLGIEINSWIKVIGELSASKMFCEALSIIYALS
FT                   EEWIPGLFDFRAFKNNLSQLILYILHQSSAHIIKLSKLVNETQNISTNLLNLDSEAPKE
FT                   DYWNTKVKTDVYDQINTLCCSMIDICVSSRLYEPLNDLIFRCFATIDLEHVFVKYILLN
FT                   VHNTRIGLEFLNSQIIESICKTYENVLDSMYTHFLEDHYYLEDEILYLNQVINPNFAIN
FT                   LKSKTYNNCEKCDISKLEVCNLIQKLVENIDYGDLGYLFKKFKFDHRLLSYHIICNNLC
FT                   KIQFYCFKNNVITETNKAINRLSRHFSWHCLIYCQSVVLDDYSNVLDIIITHAYNKCNE
FT                   LKTQMSVISENENESSKTIEADETETEPDNPDTQVNCEEEDSDEFESDISSLKNEENEL
FT                   NSGISKSEVTLPLKLSENLFVVQVLFLTLESFLTFENCGLTETIDTSSYCNIISYLTST
FT                   EVFKPTFPIDSRPIYARNTLVYDPVTIHFDEIESQQFEYDFKEPESSVIFKLLSISPRL
FT                   FFVCLENLFNCSDKFENYYTEIGTKMATFNFILNVVVSCVYKLEELFGSGSANMILKML
FT                   SFLFLTVSSSTESFYLNLNTSILSIYKLLKLKNEFLDYNPDLKVEVDYSKDLIDQEGYF
FT                   NITYFQDVFYRSNPVFDQECVMIVTPLSVDKVVFTFLRNFIYSISSKLTSKSDLWNNLE
FT                   FTQLVRMCKEFISFTSFSLRFFFYQITGDFDGIIKEYDALNREENIFTFLDKCIEYIRS
FT                   SPQAFPENVEHLLLLDSTIRKNFVGAVMKNLTILIKLDLNKVTNLLIQIFSLMDIIKTL
FT                   DATLETSPETILNTLEKLPDLQLLVLDALLKSKSTSGNMLQFPNSYFNRYLNLLSIHDK
FT                   ANVSNFLKRQKSLNITYCLKICKQNNIEDAVIYLLLRAGNLEAAVRLLVLSFSNNISKD
FT                   LRVCSTLIKTAQSICQEYENQLSYEIIERMWFTMLKSLIQSLKSDEPKSGVEPKEGLNN
FT                   DAVKINGSEEKPYDINKEEELKRLVEEIFSVGVLKYVKFPNALREITKYDTSLEIFKKP
FT                   LHNLLSDFQLQTYIANSASTMSKTIMNKEFRSTQIFNNRGVVINTIGRGPKINRNLICQ
FT                   VCNKSLIFNLNHDPEIMYKDKHRGQKPFYYEDFKISNLEEQIGLITQVPIQGMKTNVPG
FT                   SSENTSVNKVYNDRLSTLVTKKTKGSKTFSSSSSFGQYPSLIQSISRDLSYFRKDPIIV
FT                   FWCSHSFHEKCAPVSCPICNIDE"
FT                   /protein_id="XP_765787.1"
FT   gene            complement(533409..534247)
FT                   /db_xref="GeneID:3502426"
FT                   /locus_tag="TP01_0261"
FT   mRNA            complement(533409..534247)
FT                   /db_xref="GI:71032292"
FT                   /db_xref="GeneID:3502426"
FT                   /locus_tag="TP01_0261"
FT                   /transcript_id="XM_760695.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(533439..534179)
FT                   /locus_tag="TP01_0261"
FT                   /gene_family="HOG000135784" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032293"
FT                   /db_xref="GeneID:3502426"
FT                   /translation="MNAILKTLYILFSCFLVESQGVYTRNKYDNSEQLNYLSSFFKSFN
FT                   HIFSKRLIPEQLDHLIHSYLRTDFEDRNEFNPVIFYTGNENQPSSSESEGLNNGSSDNS
FT                   IAECLLSEDENFSQVVQKFYMPLKDAGSFAKNFNSKVEVLGNSQERFKVLNLEGRDPES
FT                   DVSRVMKKMNIKCTAVRADSISETCKACLYFEEIVLKRHFRYGHMVDCGVMECMNGYDK
FT                   KLTNSPSKGYFFNDFVKYHPICIT"
FT                   /protein_id="XP_765788.1"
FT   gene            534716..>536515
FT                   /db_xref="GeneID:3502427"
FT                   /locus_tag="TP01_0262"
FT   mRNA            join(534716..535031,535063..535251,535283..535578,
FT                   535609..535831,535906..536033,536110..536194,
FT                   536224..536286,536340..>536515)
FT                   /db_xref="GI:71032294"
FT                   /db_xref="GeneID:3502427"
FT                   /locus_tag="TP01_0262"
FT                   /transcript_id="XM_760696.1"
FT                   /product="dihydrolipoamide succinyltransferase"
FT   CDS_pept        join(534821..535031,535063..535251,535283..535578,
FT                   535609..535831,535906..536033,536110..536194,
FT                   536224..536286,536340..536515)
FT                   /locus_tag="TP01_0262"
FT                   /gene_family="HOG000281563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydrolipoamide succinyltransferase"
FT                   /note="go_function: acyltransferase activity [goid
FT                   0008415]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:71032295"
FT                   /db_xref="GeneID:3502427"
FT                   /translation="MAHNIRFCLRFHRYLNSFARNKKFSRFYSVLPTCKSAFTDPSTRY
FT                   TNCFVLSKSSDFNPLKLIGNRYFSKDLKVINVPTLGDSISEGTLTKWAVSVGDYLNVDD
FT                   LIAVVETDKVSVDVNSPFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPSDKPPEKKTED
FT                   KPPTPAPSKPEPKSPEPPKPSDSKPVSSSQVKPPTPVQSKPLPPLEKASSLSMVPPTQV
FT                   PSSDLEPETRVPLTRMRMRIAERLKHAQTENVMLTTFNECDMSELTKVRKMLNESGEVS
FT                   CKLGFVSAFMRASTLALLKMPIMNSYIEGNEMVTKNYVDISVAVATPTGLLVPVIRNCE
FT                   FKNWEELELSLLEMAKKAREGSITIEDMTGGTFTISNGGVYGSLLSTPIINPPQSSILG
FT                   MHAITKRPVVRDDNIVIRPVMNVALTYDHRLIDGRDAVTFLNTIKKFIENPSLLLLK"
FT                   /protein_id="XP_765789.1"
FT   gene            complement(<536796..>544811)
FT                   /db_xref="GeneID:3503586"
FT                   /locus_tag="TP01_0263"
FT   mRNA            complement(join(<536796..542518,542555..>544811))
FT                   /db_xref="GI:71032296"
FT                   /db_xref="GeneID:3503586"
FT                   /locus_tag="TP01_0263"
FT                   /transcript_id="XM_760697.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(536796..542518,542555..544811))
FT                   /locus_tag="TP01_0263"
FT                   /gene_family="HOG000135783" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032297"
FT                   /db_xref="GeneID:3503586"
FT                   /translation="MASEVDNTNKGQNSSQERTDEGTSDSSRQQCMNQECFYQDDTHCP
FT                   CYMCNNHGVDSKSTLSDDGFSGVEFAIRTFWRIAKTQNDIESPTEGSSKGFHYRLLLHP
FT                   RGTAGTDSESSHLSVFVEAVVQDWYPEYWVFPNVRFELTVVNFKDPKQSVTSWAHWSFS
FT                   SDATSRGWQKMISHARLTKAAGFMDDEGTVVIRGKAEPPYSSLWSRSILYQPQMMWEYI
FT                   PDRAQREICSEICNKLVNNSNPTPNHTTAPDSEDENITDVMLLKCLDSVVPAITPTLDS
FT                   DFLALMVHILYHLREFRRSILMWNYDFDTDVTEETSIILALQRVFAYMYLYPLAVSCRT
FT                   YKLSAVDNPKISKYYLYELVPKSTYKYKQQYLQINKDNSSNGESSENNQPEDCQSMHDS
FT                   HDHPSINCCSFDGGRYEWEVNNQESKTNSTKNKEENVKLDKGGYRLVPGSLSHSIGDRP
FT                   DIFSKLLPPPPNLKPILKAMHMTDLQTMEPQDQIVNLHSEMFTMILRDLASAKKVLKQR
FT                   RIKSNSSESISYPPDPEKKEGEKTVPLCMRDQTLLESTCKFLFSGSPENENLFRKPSVD
FT                   DISTIYIRCKHSNSLQKALEATPKTMTRYPQVLFFYLYPTKNAKKGELFDVPLRLDCTS
FT                   IKSAAAYDNMSDDSRNTNNYDDYGVFECSEDEDDTFGEFDNVCEKEHTSVKWYSLYALI
FT                   IKEGDLRYDGLGKGTSSFNTLLLRPEEDGPWYRMSEGKVEKLTTKMDFTEWKCHRDFFY
FT                   MLQVGEVDLIGNLKQWNPKLYYGTLTELGVCEQDILLAIKYKMNHSKAETDSNKSSDTS
FT                   SKDNSVSKDLKFNNRFLNPKELGREEDLIEKFGKENVDSIYDFVHVRRIGQNHPRLSSC
FT                   CEMHGYNHTLLMGLDEKERRLKYELSVGKRDVMRRLNRLKTIGPFVNWLFNASKENTAL
FT                   LNGIIPPADGKLLVNFLQKRERLFEEEFRHLISEMFFKEMAENLASNGIYSWNGSSCSC
FT                   GCPCKTCLNKPAMLLTQNGRFPGEGLKVYLSEPATILFRNIQILRCHLEYFCKDCRNLT
FT                   LQFQAKRMNKTQEKKQEVEVQPIQHLLEGTQLQLQYQQYLSNIQNNGSSTSSQQNPDDI
FT                   VSHKLVKYEFDSHPTLQQILNPHKFEAGDKGSEMSQFKSTSERSALFLIECIWDACVRY
FT                   TMDCRTILFLKACSIENFNKGSTSPSGSGGFRNMLIPPGAHCKDLFVFDGTLGSCSELL
FT                   EHEDMNHFDTKYDLSPKDELDIMKHFSKKYKIPSVADMRNYLRRCHVLVYPLIRPHELL
FT                   RSYLERRYKINFVEEVEKLGYNVVWNEEAFNQKASLSDLSDSELKLYGIHNINTDSFKG
FT                   IGHYLCNIYENLLTKMLVHMQDVDKQIYPNCFDYVYTVGDIAKIVQAIKYECDKTLGAA
FT                   KDFASTTSEPLGEPGSNGTENLKCGNSCGNINSNMHLCSHEGCVCLGHECRYNFGYTGY
FT                   ILPFWIANEMADLSMFTNSQLQAYNESLIEDLSELCLKSDDKKKKKVKPRKQTLEKVTC
FT                   IIPPLDVKLKQISFDQFLAYKSDPTLFMNPNTVARFYYKRDGFLEKQRFPQLHNNANPY
FT                   KHSLNTSLSYLTILNFNNQKKGSGPNSPTSRSEQVNNLPDDEKVIDKLKLSKEKDNSDV
FT                   SLEDGDSGRPRVVTNFNIDNNESESNKVKNSIEIGILTTHDLFGLEGFSCETKVVPTKR
FT                   LFVNYKYNGSPTKVCHLYWAIRKLISAQMSDELLTLGSNKPKKKSKCICDNECPYENEC
FT                   PIKQSWRPCAGDCFMLYALKNDIHSLRIGKKFVYMQPGMDLSYYLNPDKARGPDITVLI
FT                   SGGPSSFYLNGASTWFPLQDDSDYPLLIFKWMCVDTVDLVCLGAIVCDSKKQLQQYIFE
FT                   WLLPIIKELGYLPSNETGKDGSNQGNWTNKDEDVDRYQVLEECSVRSVQNVRRWSCAIK
FT                   KINKRSGDVIITQLKRTVDSPATMRFKESVLFMNLVKELTELEALELLPETNNFYSDTW
FT                   SKPEEDQPDLVNKLSKKKKRKSTKSAIPSNKKSTFSKRVQPAQIDDEDIADYKNEDSGP
FT                   VTSSVDVIEHRERDSDQEIQPTKDKKEKVKDDEDESYFGKDKRDAYSMMKQSLDENLDD
FT                   LLEIEKKEHLEHILDELTESDKEPHDMNQLMTDFKDLDHLEDKDYLRSVDDMSKLRMED
FT                   SDRDYFTSSENRESFDLHSSVDKTPEDTQDDIVVLVKEGQFRRILDLCPTLGLEKVCEE
FT                   VATMFENELKRDFVQLGKRLKNLLKLVKMLYTRISRPEPVREMVKKIHETHSLKASFLL
FT                   SHLLLDYNPTIPLMDDVFDYVLEDVLKYSYYLFTDKNEYIRTLLHQMVNSLYKNAKITY
FT                   KFDSSQLFLIYVVANTKIEFPEIKTQMKPTTKHESEPDHVEYEKQLSDENPETADSEEL
FT                   GENNVRTLLQKKMDFVQRRTIKETFLFNFEDNEELVTTPMLEWLDDEIEQFERLFLQQL
FT                   KVWWNTRQVILDKIKSNIHATSGRFKDSLVIHINNSVKPHTSGRDNYNYKYGKDELYLD
FT                   LYEFRILLYFVENYPEITLCFNKDSITLYFSGKIDKKSFLRSIKESRQFFGTKNTIRSI
FT                   PNLPIEHTDTATTTASLMDMQLNNNKTALLLLSIKYSSFSQQVDSQFLKSISSYKTYRS
FT                   FNIPPPPSSSASLVQDSV"
FT                   /protein_id="XP_765790.1"
FT   gene            complement(<545668..>547616)
FT                   /db_xref="GeneID:3503587"
FT                   /locus_tag="TP01_0264"
FT   mRNA            complement(join(<545668..546147,546178..546962,
FT                   546992..>547616))
FT                   /db_xref="GI:71032298"
FT                   /db_xref="GeneID:3503587"
FT                   /locus_tag="TP01_0264"
FT                   /transcript_id="XM_760698.1"
FT                   /product="glutathione synthetase"
FT   CDS_pept        complement(join(545668..546147,546178..546962,
FT                   546992..547616))
FT                   /locus_tag="TP01_0264"
FT                   /gene_family="HOG000135782" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione synthetase"
FT                   /db_xref="GI:71032299"
FT                   /db_xref="GeneID:3503587"
FT                   /translation="MTIFLRELAKLLKSFVICKVDENSDKIKIPSDYTLLPNEQNFEIC
FT                   VDTARNFLFKGGMIQKFELINNLPENSSEKFQLEAYDGILTMVNFVLFPLPFPLKCYED
FT                   CCLTSTILVEIVDEMSVDLELLNDVFSPLLKYDKFVRDLLQISNEVYGSGARNIKDDLR
FT                   TYICRSDYFIHIDNLTKNKTQENEFCKTCYYNHCLCHFSETNNYTENKQLEFKLVEFNN
FT                   TASSVSYLSGLMHRVHAKLLNTYLIDLHDLDDKHAEKLLLEKEKLHVYNNPDTCFTYPI
FT                   YESHRMYLDRYNPIFGKNRVCVFLVVRNNLNNYYDTYFMANDVFDKYGVHVKTVTPRQM
FT                   IQWMKKRIFLLVRDWEYNSDGTVKLLKYADSTVKLHPGRLVIIMGSKPGLNRLNRSDCF
FT                   EVSTVYSRDYYDPKLMESEERVLMRKFLEFSDAVKIPTTVAQLVNTKRAQMYFSKPENT
FT                   EKLVSLYNKRVKGVNRNADVLDLVKQTAILQVDPSLESSLHVVKDAIQNPSDYILKNNG
FT                   EGGSACIFGVEISERLRAGLNNKEELCQYVLMKKIKPPSQPALFVRNLKNGSFEVKGHN
FT                   SLTELGVYHYAIYDGDECIANEQNGYLARTKPEFATGGGLGAGFGYVNSLLLF"
FT                   /protein_id="XP_765791.1"
FT   gene            <548707..>550650
FT                   /db_xref="GeneID:3503588"
FT                   /locus_tag="TP01_0265"
FT   mRNA            join(<548707..550140,550171..>550650)
FT                   /db_xref="GI:71032300"
FT                   /db_xref="GeneID:3503588"
FT                   /locus_tag="TP01_0265"
FT                   /transcript_id="XM_760699.1"
FT                   /product="glutathione synthetase"
FT   CDS_pept        join(548707..550140,550171..550650)
FT                   /locus_tag="TP01_0265"
FT                   /gene_family="HOG000135782" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione synthetase"
FT                   /db_xref="GI:71032301"
FT                   /db_xref="GeneID:3503588"
FT                   /translation="MSCLLSMFVDLYINFLENSRTQENKLKIPSQYKLTNSTSNWDLAV
FT                   DCVRYLVFNGGLYQARGLITNLSNDLRENFHLEAYDSLLVMVNFVLFPLPFPLKCYEDC
FT                   CLTSTILVEIVDEMSVDLELLNDVFSPLLKYDKFVRDLLQISNEVYGSGARNIKDDLRT
FT                   YICRSDYFIHIDNLTKNKTQENEFCKTCLYDKCLCEFSRKNDTKGIVSIIKLFSDGHVA
FT                   YKLVEINLGACSLSNYSRKLYKVHDKLLRTYLIDLHDLDDKQAKRLLLEKEKLHLYNNP
FT                   DTCFTYPIYESHRMYLDRYNPIFGKNRVCGVLIPDINFFNFYDTYFISNDMFDKYGVHV
FT                   KTATQPVLIEWMKSKTFLLVSDWEYNTDGTVKLLKYADYTSKLHPGRLVIIMGSQPDLN
FT                   RLNKLECFEVSTVYSRDYYDSSEMVTDDSVFLRKFLEFSDAVKIPNTLAQLVNTKRAQM
FT                   YFTKPENIERLVSSYNKRVKGIKRNNGMMDLVKQTTILQVDPSLESSSNIVKDAIQNPS
FT                   EYILKPNREIGKGILFNVEISERLRAGLNNKEELCQYVLMKKIKPPSQPALFVKNLKNG
FT                   SFEVKGHNSLTELGVYHYAIYDGDECIANEQNGYLARTKPEFATGGGLGSGHGFVGTLL
FT                   LY"
FT                   /protein_id="XP_765792.1"
FT   gene            <551356..>553470
FT                   /db_xref="GeneID:3503589"
FT                   /locus_tag="TP01_0266"
FT   mRNA            join(<551356..551500,551536..551787,551851..552153,
FT                   552185..>553470)
FT                   /db_xref="GI:71032302"
FT                   /db_xref="GeneID:3503589"
FT                   /locus_tag="TP01_0266"
FT                   /transcript_id="XM_760700.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(551356..551500,551536..551787,551851..552153,
FT                   552185..553470)
FT                   /locus_tag="TP01_0266"
FT                   /gene_family="HOG000135780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032303"
FT                   /db_xref="GeneID:3503589"
FT                   /translation="MNLLNSYKLIYYIFILLFRFGIKYSKGTDDLSNYRDDVRILDVDL
FT                   AKSVHCIDFEKKAILQCKPRHVLIVHAAQWSDASCLEKTDFEAKQTTGKNYHFFDRTEV
FT                   LKQLCDGFSYCFLKPSKTRNTEANHTFLVSCLNRELTVRGRKVTDTIVNKDKNVEFGCN
FT                   EDEQIHLSVTRVDGYTQNGPDRSLTFFNFGPELFGCHLKQKCTVTTEQLRKCETLKEMS
FT                   YGTGLLVYYCRKPLRFSFCDHVKVTKSGSENVDKFVLYAEQDSQVRVKAPIFTVLTTDS
FT                   AVWSTYDKLTDNEVKKDRKELLRFLCDNRNYCAFSPKRSAAGPHESSFEEVHFGGILNE
FT                   TKPLVLLATFYTKPLKELKNLANEGVKSVKVNLGEKLSFACLETEEGTLHVLSAVAGPK
FT                   DQTDVDNQTDSVKFKDLTKVMYKICYRRRSCEWNLNPQPVHEVLDPNSVTRSALEVAYL
FT                   LQMSNKPAPQRQETQAQAQSVLPSGLAEQEITVKYMCKKYTHDPSLVDMPGQKVNFLEM
FT                   SQDEVHSLVDKEQAETVQLTTNTKLFINLEVFGNFKVHVGDFFEIDVPGGTTNTVNAFF
FT                   LNNKESKLTQNLTRQSTKYVFYLGFAKGNTLEFSLDASDGVNSEKVTGKVTAASDLVYP
FT                   ISLKDVVKAKGSIVGMRVYLVKHNVN"
FT                   /protein_id="XP_765793.1"
FT   gene            complement(553446..554033)
FT                   /db_xref="GeneID:3503590"
FT                   /locus_tag="TP01_0267"
FT   mRNA            complement(join(553446..553526,553557..553617,
FT                   553649..553773,553805..553875,553920..554033))
FT                   /db_xref="GI:71032304"
FT                   /db_xref="GeneID:3503590"
FT                   /locus_tag="TP01_0267"
FT                   /transcript_id="XM_760701.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(553476..553526,553557..553617,
FT                   553649..553773,553805..553875,553920..553959))
FT                   /locus_tag="TP01_0267"
FT                   /gene_family="HOG000135779" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032305"
FT                   /db_xref="GeneID:3503590"
FT                   /translation="MEDLINEINSLREKHREQTIVHSQLLTQQNESTAALNEIKLVEDD
FT                   TKIFKATGPILTSQTKEDAVSTISKRLEYINTEIETVDKSITTLQSKIEEKCKKLEALK
FT                   AKNTPTVPAST"
FT                   /protein_id="XP_765794.1"
FT   gene            complement(<554149..>554585)
FT                   /db_xref="GeneID:3503591"
FT                   /locus_tag="TP01_0268"
FT   mRNA            complement(join(<554149..554411,554459..>554585))
FT                   /db_xref="GI:71032306"
FT                   /db_xref="GeneID:3503591"
FT                   /locus_tag="TP01_0268"
FT                   /transcript_id="XM_760702.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(554149..554411,554459..554585))
FT                   /locus_tag="TP01_0268"
FT                   /gene_family="HOG000135778" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032307"
FT                   /db_xref="GeneID:3503591"
FT                   /translation="MLEFGCIFLNSWMIRILKAILINQIINLITNGVLIVECVGNKEST
FT                   KIANILTGNITGDVVPSTYPSIKINQSANNDSNFYNFYKDELRELEEETMELMDKQRKV
FT                   FEDLRRKAKEQNKIFEDLSIAVQRQ"
FT                   /protein_id="XP_765795.1"
FT   gene            complement(<554790..>556083)
FT                   /db_xref="GeneID:3503259"
FT                   /locus_tag="TP01_0269"
FT   mRNA            complement(join(<554790..554837,554855..554981,
FT                   555013..555123,555155..555215,555255..555372,
FT                   555405..555513,555545..555603,555636..555721,
FT                   555754..555836,555868..555924,555959..>556083))
FT                   /db_xref="GI:71032308"
FT                   /db_xref="GeneID:3503259"
FT                   /locus_tag="TP01_0269"
FT                   /transcript_id="XM_760703.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(554790..554837,554855..554981,
FT                   555013..555123,555155..555215,555255..555372,
FT                   555405..555513,555545..555603,555636..555721,
FT                   555754..555836,555868..555924,555959..556083))
FT                   /locus_tag="TP01_0269"
FT                   /gene_family="HOG000203649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032309"
FT                   /db_xref="GeneID:3503259"
FT                   /translation="MLSTEPSDLSNESMDPWSFWKSINSPKFIVAPMVDQSELPFRLLC
FT                   RRYSADLAYTPMLHAKIFSENENYRNIHFHTSSDDKPLIAQFCGNDPNAFILASSYIKN
FT                   DVSAIDINLGCPQGIARKGRYGSFLLEYPQLINEIVRSLTQTGINVTCKIRKVEKDCLQ
FT                   STLNLCYSLEASGCKALTVHGRHRSETKTRISECDWDSIKIIKSKVNIPVIANGGIETF
FT                   EDVKRCLEYTGADAVMSSEAILENPYLFSGKIYNNIDIFEEYLSILKGSPRQKISCIKG
FT                   HAFKILYKYINQHHDIRTAISNANTIKKFENKRSFKDNTFISGYMV"
FT                   /protein_id="XP_765796.1"
FT   gene            complement(<556373..>557018)
FT                   /db_xref="GeneID:3503260"
FT                   /locus_tag="TP01_0270"
FT   mRNA            complement(join(<556373..556379,556529..556788,
FT                   556830..>557018))
FT                   /db_xref="GI:71032310"
FT                   /db_xref="GeneID:3503260"
FT                   /locus_tag="TP01_0270"
FT                   /transcript_id="XM_760704.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(556373..556379,556529..556788,
FT                   556830..557018))
FT                   /locus_tag="TP01_0270"
FT                   /gene_family="HOG000135777" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032311"
FT                   /db_xref="GeneID:3503260"
FT                   /translation="MSISAIISKNCSFNRRLLLNVCQPSTIYLSSIISPVNLIKTPDRI
FT                   HIENLNNNHVSIHSNIPKKIETPLTSYPIGLPQYVNNIKYKNPLINNSILNYIENKVQL
FT                   YIDEHTRERYLFNKLRNDTKNRKRAFVKRGYFRRTHSLNRKLNRLSN"
FT                   /protein_id="XP_765797.1"
FT   gene            complement(<557120..>559081)
FT                   /db_xref="GeneID:3503261"
FT                   /locus_tag="TP01_0271"
FT   mRNA            complement(join(<557120..558473,558504..>559081))
FT                   /db_xref="GI:71032312"
FT                   /db_xref="GeneID:3503261"
FT                   /locus_tag="TP01_0271"
FT                   /transcript_id="XM_760705.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(557120..558473,558504..559081))
FT                   /locus_tag="TP01_0271"
FT                   /gene_family="HOG000135776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032313"
FT                   /db_xref="GeneID:3503261"
FT                   /translation="MAKCNIKASNVALEWSNICKELTSQQAVRLLHRFTSGLINLPPRI
FT                   ERISSDSCSGFLEKRVAYDFLEGKKLLNSNNLSFSKSLDILQHKIIDLNDKSLLKPKDV
FT                   SLSLNSYAKFYQNLHSNRSYNHLYNLIPTDNIKRYVSQLLSIANKNIQHMNEQDLSLVL
FT                   NCISKINVNHDAFLKSSNKLLYNSLQEFYRKGLTLEDDSSSDNLMKNITPQGVSLLLNC
FT                   FSKSNIELDPSVLDFFVDEYVGKLVEKFQINQLIVTLNSFLKFKIPLTRVFKAVKTADI
FT                   MLKESEKEYNMKLISTSLYTFAKYNYQPIYCFRNIVSYLDRVNLKHSSELELGNIYYAF
FT                   GKLNYRNTKLIDKMNENVYENLKTFTPHGVVGIYHSLSKLDYKSKLFSQNEKLQNMENR
FT                   FISEFLKFFKDDLSLAGVNNSNFNIPVSYYPHKDFQVVPLHNINFCFSCSINNIVDHKI
FT                   YSLLLRKLTCMIENEPSSPIFKIGNIVLNYREELTNDHDQFKFLSKYIGIQGIYQLYCI
FT                   LQHVLNYVERGLESIEYSVLASINSLMDHFNILSTGKRRKFFTEDLIFEPNKVEDDVKL
FT                   DETTHLTSKIHEDVYSVLEKIAHERNEDNNQPGLDGNESSGLANDKSILYKEHEALPYT
FT                   IDIVLFKF"
FT                   /protein_id="XP_765798.1"
FT   gene            <559215..>560111
FT                   /db_xref="GeneID:3503262"
FT                   /locus_tag="TP01_0272"
FT   mRNA            join(<559215..559265,559336..559551,559584..559706,
FT                   559736..559819,559848..559937,560025..>560111)
FT                   /db_xref="GI:71032314"
FT                   /db_xref="GeneID:3503262"
FT                   /locus_tag="TP01_0272"
FT                   /transcript_id="XM_760706.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(559215..559265,559336..559551,559584..559706,
FT                   559736..559819,559848..559937,560025..560111)
FT                   /locus_tag="TP01_0272"
FT                   /gene_family="HOG000135775" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032315"
FT                   /db_xref="GeneID:3503262"
FT                   /translation="MGNPLLIITIIYIHILFFSDDLEDSTERNLDVYITLYSKIANIGP
FT                   VLDYALNVNDYNKPLNSEDSFNSIKNPKSILDFNVLFLVLRPSLILSTDHLLHSVARAL
FT                   TNVLNSKPVSSNFTTEVAFMLSGSSSVAKSLERVLLSKSDKFSPALIVTLVQNKSKDNI
FT                   LDIIDGVQDDISNLDKYTKVDELIKEFKITQEELRLPGGLEASILCRIGVKRI"
FT                   /protein_id="XP_765799.1"
FT   gene            complement(<560190..>561259)
FT                   /db_xref="GeneID:3503263"
FT                   /locus_tag="TP01_0273"
FT   mRNA            complement(join(<560190..561089,561146..>561259))
FT                   /db_xref="GI:71032316"
FT                   /db_xref="GeneID:3503263"
FT                   /locus_tag="TP01_0273"
FT                   /transcript_id="XM_760707.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(560190..561089,561146..561259))
FT                   /locus_tag="TP01_0273"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032317"
FT                   /db_xref="GeneID:3503263"
FT                   /translation="MLNNVGDWLNDKKHGFGRLETRTYTYVGDFRHNRCHGNGTMSYKN
FT                   GVKQKGEFKHGKFEGKGMMTMPDGSVRMGNFKNGVIFGVCSVIDKTGRVYVGQLHGDLF
FT                   HGKGILKYNKSTSFEGYWVKGRRVNQGMINTIISGSPLRVEAVWQDDNMLMNEVSIKFP
FT                   NGFKYNGSLRFYPHQTLDMNELKDDLEFMKLDPMINEEDLKLFAQEFDKLDNKLLPHGP
FT                   GIYKDTKGEVYNGLFFYGSKHGNMSQVFPNGIIYTGQYHLGRLHGRGTFQLLTKRTLEV
FT                   KFNRGNLETDLDAQDHSYIKQFLEQDYPTFVEEFVKYKLDSLLDVMRRSNILGVNM"
FT                   /protein_id="XP_765800.1"
FT   gene            complement(<561499..>563340)
FT                   /db_xref="GeneID:3503391"
FT                   /locus_tag="TP01_0274"
FT   mRNA            complement(<561499..>563340)
FT                   /db_xref="GI:71032318"
FT                   /db_xref="GeneID:3503391"
FT                   /locus_tag="TP01_0274"
FT                   /transcript_id="XM_760708.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(561499..563340)
FT                   /locus_tag="TP01_0274"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032319"
FT                   /db_xref="GeneID:3503391"
FT                   /translation="MIYSECAARTSTCILSLLTMIPCASSLNFNSKAFGSLWFNWKKYG
FT                   FPLDLFRSDNPIYPYFTESMPPLLNKMSGYLIGVSDLKILNKLSNPPTLIFDLEEEIIR
FT                   LRTRELLGYYSPSFYEISFFDDFELLDELEIDDEPLKMVMDTSENIFHFVGDYLSRAPS
FT                   TIIELGGKASKIYHMGRRLGMRRHKESYLRLFDIYFPGALPKFLRFSKKKSKSKKKKEK
FT                   EPEKTGETEGKDEDVEKDDSKEERDDDVDKTEDTGEPVEKADTIERDQDLEKTVETVGN
FT                   QEDLVKMEQNDEEEEEKMAQSDGELDKPGQPDGDKEDVDKFSDVGENDVVGAQDRASEY
FT                   KKVKGFDPLGELKAQWDELTKIVDDDPNPSQVVKEEEEVSSVEENPTFTFDVMFEKMMK
FT                   RSTKYTYLGYVQYLQYEDVKDRNKEIEYAILTRIQPLRDFLLKFLKSFAYAGGKGRRPY
FT                   HLVMDFFFELDSVIDFNNPVDGVYIVRGDKYLRGSMQELPDSDVEDHQPIDDAQRKSYI
FT                   MEGDQEVKIKLPSILATHIVEIQNNYSLDFVELWIQTHNFKDFYMNHNLEVFNEPVFYL
FT                   SQNVAKYTYPNGDFYVGELVDMLRDGKGSYVSKDGSR"
FT                   /protein_id="XP_765801.1"
FT   gene            complement(<563412..>564862)
FT                   /db_xref="GeneID:3503392"
FT                   /locus_tag="TP01_0275"
FT   mRNA            complement(join(<563412..563489,563521..563578,
FT                   563609..564114,564146..>564862))
FT                   /db_xref="GI:71032320"
FT                   /db_xref="GeneID:3503392"
FT                   /locus_tag="TP01_0275"
FT                   /transcript_id="XM_760709.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(563412..563489,563521..563578,
FT                   563609..564114,564146..564862))
FT                   /locus_tag="TP01_0275"
FT                   /gene_family="HOG000135774" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032321"
FT                   /db_xref="GeneID:3503392"
FT                   /translation="MVRRFFESRSSKSKAGSKDKKVEESTLADDFVEILDLNVGSSKPP
FT                   DPKPSDPKPEKVGSESDLLIFTQDSTFKEPLKEIAIDAVPMDFTDTTPQSVTDTDKLTS
FT                   TSFDSKVTLSAEQSDELDSLDYLDFESAAFEEHKNRERLDSFSENDSLPGFPPSETKLI
FT                   PEPEDTDKTDLTKEEFKETEFTKFYDNLYSTELHGDTIVGAFIISHRDSKSEYLFSYPP
FT                   ILNPNQKHDTKSLKVQYKTESYTANRDTDSELQSCLHLLPELALGAKKSNSLVDFVHFV
FT                   LPTAATNVLYGTSYVIQLAEEIQLKNGEPEKNLSESLEPTETTEQTEPTGNENENENEV
FT                   KEKNEEPVLVDTGSDEPPKPIVKKTSSQSPNGQFVAICLVYKVPFFGLIGSRLEYLAQA
FT                   YFDNKNFYDHSLLLSFVEHVNRNDKVEDWSYESLFFNLEYHFKPFSLCLSYSK"
FT                   /protein_id="XP_765802.1"
FT   gene            <565369..>566010
FT                   /db_xref="GeneID:3503393"
FT                   /locus_tag="TP01_0276"
FT   mRNA            join(<565369..565462,565549..565612,565647..>566010)
FT                   /db_xref="GI:71032322"
FT                   /db_xref="GeneID:3503393"
FT                   /locus_tag="TP01_0276"
FT                   /transcript_id="XM_760710.1"
FT                   /product="translationally controlled tumor protein"
FT   CDS_pept        join(565369..565462,565549..565612,565647..566010)
FT                   /locus_tag="TP01_0276"
FT                   /gene_family="HOG000203361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translationally controlled tumor protein"
FT                   /note="go_component: cytoplasm [goid 0005737]"
FT                   /db_xref="GI:71032323"
FT                   /db_xref="GeneID:3503393"
FT                   /translation="MKVYKDLYSNDEVCSDAYDHHDPFDNADLSSVAFEVKTSKVPKGE
FT                   EDYGIGYNDEEGADQMNVDPNVEMVVDVVDKFGLQSLSLTKKDYSSYIRKYIQRLVATL
FT                   QEKNPERVEPFKTTVSDFVKHVLANFEDFEFYVGESLDYEAGLVYAYYKGEEVSPRLVF
FT                   LKDGLVEERY"
FT                   /protein_id="XP_765803.1"
FT   gene            <566247..>567259
FT                   /db_xref="GeneID:3503394"
FT                   /locus_tag="TP01_0277"
FT   mRNA            join(<566247..566558,566651..566774,566816..566936,
FT                   566971..567070,567143..>567259)
FT                   /db_xref="GI:71032324"
FT                   /db_xref="GeneID:3503394"
FT                   /locus_tag="TP01_0277"
FT                   /transcript_id="XM_760711.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(566247..566558,566651..566774,566816..566936,
FT                   566971..567070,567143..567259)
FT                   /locus_tag="TP01_0277"
FT                   /gene_family="HOG000246462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032325"
FT                   /db_xref="GeneID:3503394"
FT                   /translation="MTMDTIGGVVHKNFKYVYVSSDINIPVKVLEFSGKENSFRDLITS
FT                   HFTRHNLLPEERQDFEKYLIKEYEGSKAKNNSENDPSGGFKLTPDFLSNTIDTAGSNYQ
FT                   IIPLTLPSKKNDFLGVNCYIDSIGRVKNLPTNSRMTRLCSTDIRGDCFISRTYDDEDVF
FT                   KRVDFTLEDYNELMENPPSAEGRWDVSKAFSNALSQDSLTKPQETVVKNHCENCKKEGS
FT                   ESQVLKICTGCKKVKYCSVNCQKEDWRFHRRICKL"
FT                   /protein_id="XP_765804.1"
FT   gene            complement(<567329..>570393)
FT                   /db_xref="GeneID:3503395"
FT                   /locus_tag="TP01_0278"
FT   mRNA            complement(join(<567329..567929,567964..568124,
FT                   568156..568344,568382..568567,568707..568765,
FT                   568797..568940,569005..569079,569110..569174,
FT                   569211..569306,569391..569548,569614..569721,
FT                   569751..569908,569938..570033,570078..>570393))
FT                   /db_xref="GI:71032326"
FT                   /db_xref="GeneID:3503395"
FT                   /locus_tag="TP01_0278"
FT                   /transcript_id="XM_760712.1"
FT                   /product="translation elongation factor G 2"
FT   CDS_pept        complement(join(567329..567929,567964..568124,
FT                   568156..568344,568382..568567,568707..568765,
FT                   568797..568940,569005..569079,569110..569174,
FT                   569211..569306,569391..569548,569614..569721,
FT                   569751..569908,569938..570033,570078..570393))
FT                   /locus_tag="TP01_0278"
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor G 2"
FT                   /note="go_function: GTP binding [goid 0005525];
FT                   go_function: protein-synthesizing GTPase activity [goid
FT                   0008547]; go_function: translation elongation factor
FT                   activity [goid 0003746]; go_process: translational
FT                   elongation [goid 0006414]; go_process: protein biosynthesis
FT                   [goid 0006412]"
FT                   /db_xref="GI:71032327"
FT                   /db_xref="GeneID:3503395"
FT                   /translation="MQKCCHKFLFYLTFIYTCVNSVNSLNILNSSAQFFVNNVLTNGIP
FT                   LSLTNRSKCNKYTQGFINKTAVIKDSSIPFLKNDRNQQRLQALPKTFEITEVKLDRYRN
FT                   IGIMAHIDAGKTTTTERILYLTGVTYKLGEVHDGEAVMDYMPQERERGITITSAATTCF
FT                   WRGGYRKIPLHRINIIDTPGHVDFTLEVERSLRVLDGGIVVFDGVAGVETQSETVWRQA
FT                   DKFKIPRIAYVNKMDRIGSNFEKCLDEMKEKLGAFPIPVFIPVGNYTDFQGVIDIVRSK
FT                   FYKFKDEKKNFEYEELEVPKDQMDEYNKYRDLLVETVAQESDELLEKFISEEPITEIEI
FT                   RRTLRSLTLSNTVIPVACILDMVLDFLPSPCETNKLFLNTVKSNEKDESEVETGNNEEN
FT                   TELDINQNVNFDVTDFTLPLAALVFKLSFDQQVGNQTFIRIYRGSIKTGDYVYNPRTKK
FT                   SQRVQKILFMHSNERKLIKEAHAGDIVSLVGIKAITGDTLCCEKNPIVLESIDFPEPVI
FT                   SLSIDIVNPQDEPRIQQILDRYAEEDPSFKVHRNYETGETLISGMGELHLDVMVDRIKR
FT                   EQNLPLKVGSPQVAFKETFIKEVVSEGKFIKQTGGKGQYGHVNLQVVPLEQGSGVKFES
FT                   KIIGGAIPKEFIPRIEDAIRDELNTGLFANYPVTDVLIVLTDGSYHEVDSSEFAFRMAS
FT                   SRGIKEAARLSGMKLLEPIMKVSITCPTDNFGEVVCDLSRRRGRVTNTKQGYGTVKEIE
FT                   GEAPLREMTGYMTTLRKISQGRGFYTMEMSHYSPVPRDIQDQIVASKQTK"
FT                   /protein_id="XP_765805.1"
FT   gene            <570702..>572013
FT                   /db_xref="GeneID:3503396"
FT                   /locus_tag="TP01_0279"
FT   mRNA            join(<570702..570831,570891..571316,571382..571647,
FT                   571735..>572013)
FT                   /db_xref="GI:71032328"
FT                   /db_xref="GeneID:3503396"
FT                   /locus_tag="TP01_0279"
FT                   /transcript_id="XM_760713.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(570702..570831,570891..571316,571382..571647,
FT                   571735..572013)
FT                   /locus_tag="TP01_0279"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: GTP binding [goid 0005525];
FT                   go_function: small monomeric GTPase activity [goid
FT                   0003925]; go_process: small GTPase mediated signal
FT                   transduction [goid 0007264]"
FT                   /db_xref="GI:71032329"
FT                   /db_xref="GeneID:3503396"
FT                   /translation="MSIYQKIADIEAEMARTQKNKATNFHLGLLKAKLSKLRAQLIEGG
FT                   GSKGGGAGEGFDVSKTGDARVGLVGFPSVGKSTLLNKLTGTFSEVADYEFTTLTCVPGV
FT                   IKYKGSKIQLLDLPGIIEGAKDGKGRGKQVIAVARTCTLILVVLDAAKSMHHKKLLEKE
FT                   MEGFGIRLNKSPPNITFTRKDKGGVSITHTVPLTNIDEEMIKSICHEYRISNASFVIRC
FT                   DPTVDDIIDVIEGNRIYIPCLYVMNKIDQITIPELDILSQVPHYVPISAHHEWNLDCLL
FT                   ESIWKYLDLIRIYTKPRGKIPDYEAPVILKRNHSRVEDFCLRIHKSLLTQFKYALVWGK
FT                   SAKHNPQKVGKDHFLADQDIVQIVKK"
FT                   /protein_id="XP_765806.1"
FT   gene            <572177..>572636
FT                   /db_xref="GeneID:3503027"
FT                   /locus_tag="TP01_0280"
FT   mRNA            join(<572177..572356,572448..>572636)
FT                   /db_xref="GI:71032330"
FT                   /db_xref="GeneID:3503027"
FT                   /locus_tag="TP01_0280"
FT                   /transcript_id="XM_760714.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(572177..572356,572448..572636)
FT                   /locus_tag="TP01_0280"
FT                   /gene_family="HOG000135773" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032331"
FT                   /db_xref="GeneID:3503027"
FT                   /translation="MSSNNNNPPNIDVDVVKGLSQPSALYDEVVQYILSTVGCKLQNES
FT                   TLRLVSHSAQIALEKFFEEAKSVQVSNRLNRADYEDKMSVLKQDIKELDYQSICETLQK
FT                   YKSNSHNYNLFLEPNEKF"
FT                   /protein_id="XP_765807.1"
FT   gene            complement(572691..>575762)
FT                   /db_xref="GeneID:3503028"
FT                   /locus_tag="TP01_0281"
FT   mRNA            complement(join(572691..572776,572809..572994,
FT                   573072..573150,573267..573424,573522..574487,
FT                   574586..574926,575034..>575762))
FT                   /db_xref="GI:71032332"
FT                   /db_xref="GeneID:3503028"
FT                   /locus_tag="TP01_0281"
FT                   /transcript_id="XM_760715.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(572701..572776,572809..572994,
FT                   573072..573150,573267..573424,573522..574487,
FT                   574586..574926,575034..575762))
FT                   /locus_tag="TP01_0281"
FT                   /gene_family="HOG000135772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032333"
FT                   /db_xref="GeneID:3503028"
FT                   /translation="MRDSYTDNYYHNFSCKNIENRFLRNGYTFNGRPKRPISRITSYIN
FT                   SYSSDSDESFKDDLADITSNYHSSPQTQSSINCTPIPVQIIQSPNDKVDTGTKVDNSND
FT                   AEYTEKPLGDQILTPRPSRYRRIQKVKSVKREPPIREISYAELSTPDVTKKQVKDSKYN
FT                   YSDQNIDSSYTSYVDSLFGVEPYKYVHEHQPLKLFWLENSEVSGLMRIPSLTSLSNEFS
FT                   NSEKLYMVFTDYTIDIIQDVSCLKMIKARDGYTPFVVIYSYNLKSMYFKVVKRTMSEVS
FT                   MVSFNKNSTDLDDCLSFDCANSQISSSDEQDSNYEFYRSYLYGKDDGTDPNRVRVLVHP
FT                   SNKTHFDLRYLSVNPNSHREEMVDNKSMVKKENVEVKDEESDLESSNSDSPFSNTFQNG
FT                   TQFNLPDDLFDECKLLVGVDVSNKGSSCPDSVANYRSESVIKKNYTVYIPENTLPLDQI
FT                   DDMTNGNLSNTGDELGKGDEQLSKEFLLNLVKVRDEGNVLYRSGDMVLTEGQVLKIEFP
FT                   TIYTKHFEYDYVTLYSDNTLKSCFNFIKSLLPEDCLNININKLAQFCPNIFWNLALAGD
FT                   IETSIIELDPEMVKSLYRRKRTVTVDSEFRNGKTKITPNSLSYLDNNFIIMQNLFQRDA
FT                   EEKIKKLLEIERQNGGKMTRIVINKHAEDDDLIKLLIDDNGFTRKSMQVLTEKQKNMVY
FT                   NECMKRNFYVPVHIKFNPQKGRGVYAAYKIHKDDFLMEYKGELITEKVANFRNNKYNKS
FT                   KKYKGSFIFFFKHNGTRYGIDATEEDISFGPARLVNHSRKNANIVPKTLLSNNYPRLIF
FT                   IAKRDIECGEELLVDYGERDPSVIKDNPWLLD"
FT                   /protein_id="XP_765808.1"
FT   gene            complement(<575913..>576428)
FT                   /db_xref="GeneID:3503029"
FT                   /locus_tag="TP01_0282"
FT   mRNA            complement(join(<575913..575977,576247..576283,
FT                   576360..>576428))
FT                   /db_xref="GI:71032334"
FT                   /db_xref="GeneID:3503029"
FT                   /locus_tag="TP01_0282"
FT                   /transcript_id="XM_760716.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(575913..575977,576247..576283,
FT                   576360..576428))
FT                   /locus_tag="TP01_0282"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032335"
FT                   /db_xref="GeneID:3503029"
FT                   /translation="MGHLMWKFPVESGKNEFVYFKTEFLKIDLRMDSYQILVIYVIISN
FT                   HLFCPLMSLVS"
FT                   /protein_id="XP_765809.1"
FT   gene            complement(577142..>580990)
FT                   /db_xref="GeneID:3503030"
FT                   /locus_tag="TP01_0283"
FT   mRNA            complement(join(577142..577378,577525..577990,
FT                   578116..578789,578901..579121,579268..>580990))
FT                   /db_xref="GI:71032336"
FT                   /db_xref="GeneID:3503030"
FT                   /locus_tag="TP01_0283"
FT                   /transcript_id="XM_760717.1"
FT                   /product="karyopherin beta"
FT   CDS_pept        complement(join(577163..577378,577525..577990,
FT                   578116..578789,578901..579121,579268..580990))
FT                   /locus_tag="TP01_0283"
FT                   /gene_family="HOG000283667" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="karyopherin beta"
FT                   /db_xref="GI:71032337"
FT                   /db_xref="GeneID:3503030"
FT                   /translation="MSENMNSEVFVSLLEALSSSDNSLRSDADAKITTLKNHDLNGILR
FT                   LTLNVMLTEPKDERRLQSVVLIRILLDVSRSGEAPHNTWKLVSNDVKSLLKSSLLKSIE
FT                   SESHQSIRRNVCDTIADLVSRSMAPGEWPELASITIRLIQNDNPVYRKSGLKLLGECFS
FT                   YFAEDLVSRSNEVAALIKTSLMSVDTSVRTEAICVIGVAVDYEEVGVASYLRDTVPLIL
FT                   DSLRRLLGCTEPGARDELESSLTGVLMILENNAKFFKPHIELFFTRMLELALAEGPARG
FT                   LDGELRALALELLLVLPEKKPQTALSIPNFGLRMVNCLMTCMLDIQDESYTEWLETGTE
FT                   DDAHTLYSASEEGLDRLGRAFESVDNCPFMDWVLSTASQYLQTPQWQYKFVAIMAISQT
FT                   VEFLTDDEIDRLSSIIGIMLEKLSDADYRIRFAVCQTIGQIALDHQPYVQLNFHEEVLP
FT                   PLIKAFEDPSPRVQSHALSAFINFAEEVQKEHLLPFGDLVVQRLLSKISANTGRSVTEQ
FT                   AVTSLAVTAGVLEEHFIKYYNTIIPLMKEIITKCTSTEERTCRGKAIECISIIGMSIGK
FT                   DVFRNDGIECMNALIQIMEQPSESDDPVREYINEALGRLCTALGTNFVPFLPKIVPLLL
FT                   TELTKSSQSFQDQDVTLLMGLDGGAGLRTSLVDELEQTLSLVAIIVDELKELYEDYIPS
FT                   TAQAVLPLLSCVLTAELKQKALSAMANMIEAKRIAIEKRNSSKEMLLELLLNIMNAVLT
FT                   DLEKTREVDSEYTVPVDILSVSANGLYRCLDCAGPGILNQNVLNLLTNKLLLIIEKSSK
FT                   IKAIYRKCRASKDLDPDEILTLEEDEEAEQTFRSSLLDIFGVVMKHHPDEFMSTCHPQC
FT                   LQFLCMNLEKNVPDDVAIALYFCGDMIEFLQSRVITFWDKFLPHVLKNIESKEASVRQY
FT                   ACYSVSRLSKLPEFAHLANESAVKLSSALKMRFPSSQKDQQNATDNAVAALGDLIRYQG
FT                   NNLPDASNYLTLWLKHLPLRQDETEGKRVHKELMDLVLSNNQMILGVENSNLGQLAKIF
FT                   ISIYETEFSTEELNKQILHLMKHLGQDFLKQLNPSLSKRLQMQLKVIAKSL"
FT                   /protein_id="XP_765810.1"
FT   gene            <581117..>583596
FT                   /db_xref="GeneID:3503031"
FT                   /locus_tag="TP01_0284"
FT   mRNA            join(<581117..581197,581620..581985,582016..582173,
FT                   582206..582291,582368..582570,582602..582687,
FT                   582757..583020,583107..583192,583263..583467,
FT                   583560..>583596)
FT                   /db_xref="GI:71032338"
FT                   /db_xref="GeneID:3503031"
FT                   /locus_tag="TP01_0284"
FT                   /transcript_id="XM_760718.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(581117..581197,581620..581985,582016..582173,
FT                   582206..582291,582368..582570,582602..582687,
FT                   582757..583020,583107..583192,583263..583467,
FT                   583560..583596)
FT                   /locus_tag="TP01_0284"
FT                   /gene_family="HOG000135771" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032339"
FT                   /db_xref="GeneID:3503031"
FT                   /translation="MEIMIYYMLHIYFNNFNEILRLWGYPMEDDENLNYNFSLKSFEIC
FT                   SKFTKSSDNNVSDNEEEVQSTSEMCEYFVNCDGQIRDVDILHTLVYSQFENVLLILVAT
FT                   NSTSHYFTNEDDFYTFLQLYTLKFDSENSLNLENSLQLLSLFPVKMDYCVQLKWLQVNY
FT                   ETGFLFAVLLFNSGKVKIARFNINKLSNLLQSTQDLSKRVLDLEFVWEYNQNINYNNKI
FT                   NCFDISYKICESLVMLACGTNDGFLLILDFNLNLFNSNTHTSDTKDEVDCIEVDSEVVD
FT                   SFKTVPVLTGVNNTPVYRSILSLNFLPLPNSFILAIGTFSKGVVLWDVRHVDGELKTYS
FT                   NIMKPVNKVNWSRNSQFLLCCTSSGLYIDWQNNTTANSINPVKLSKDKINNVWDNICWN
FT                   VDSSDDTITYSFDSGQLIQLMMSNMNKKNIYNDFTIYQWDFLKPQMEMEVYKYSDSMVD
FT                   NVNYSMKNRFIKDLNFAKKVGISITKSNSSVNTSNVEPNDNLLKMRTKILSLNTESGTP
FT                   TPNTNG"
FT                   /protein_id="XP_765811.1"
FT   gene            complement(<583711..>584609)
FT                   /db_xref="GeneID:3502725"
FT                   /locus_tag="TP01_0285"
FT   mRNA            complement(join(<583711..583836,584008..584325,
FT                   584408..584472,584555..>584609))
FT                   /db_xref="GI:71032340"
FT                   /db_xref="GeneID:3502725"
FT                   /locus_tag="TP01_0285"
FT                   /transcript_id="XM_760719.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(583711..583836,584008..584325,
FT                   584408..584472,584555..584609))
FT                   /locus_tag="TP01_0285"
FT                   /gene_family="HOG000135769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032341"
FT                   /db_xref="GeneID:3502725"
FT                   /translation="MSSSLIDNYQCYIGCLHHSIGDEEFMTLAKCFSTNVISTKLIRGQ
FT                   SSSSHLGYGFVQYTDFTASDEAILLMQGIYSKGIPLVIRSTSNYTNAYNYDNTQPADTT
FT                   QNNTVNTTVHVSNLSDQDTQDSINDLAKPFGDIESINFIPDKTISCFWALHSNEPKSYD
FT                   KKLLDKEKEDEVYYTYVVTRYILM"
FT                   /protein_id="XP_765812.1"
FT   gene            <584879..>589447
FT                   /db_xref="GeneID:3502726"
FT                   /locus_tag="TP01_0286"
FT   mRNA            join(<584879..585197,585230..585456,585578..585729,
FT                   585836..586001,586036..586124,586386..586866,
FT                   586913..>589447)
FT                   /db_xref="GI:71032342"
FT                   /db_xref="GeneID:3502726"
FT                   /locus_tag="TP01_0286"
FT                   /transcript_id="XM_760720.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(584879..585197,585230..585456,585578..585729,
FT                   585836..586001,586036..586124,586386..586866,
FT                   586913..589447)
FT                   /locus_tag="TP01_0286"
FT                   /gene_family="HOG000135768" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032343"
FT                   /db_xref="GeneID:3502726"
FT                   /translation="MSELDGLDSESFLSESSVSSENVTEVVESVHSLQTDNNLLSFSEK
FT                   NDVNLGQTSRYELNPFHLSSDQRLKRGTIHAIELHNFKSYFGTVLIDKFASFNAIIGPN
FT                   GSGKSNLMDAISFVLCIRTSTLRGNNLRDLINKVPDPSDPLENRFAYVALTLKGDTDFS
FT                   TFKRLINHNGHISYIYNNNVITFKGYTEALHEYKINTLGSTGLIFQGSVNDIISRSPSE
FT                   LTKLFENISGSILYEKPYNYMRDKIAKMRMEYKNLLLKKKNLNNELKQFKTMDSTNKKY
FT                   HKLLQNHNEIMVKKNLCEFQILEHKFKSHTNKYFTLLNEYKEVVKRWDESNGMKNELEE
FT                   KLANLYYEQGKLNRQIQQKTQTLNSLRNSMMDFFSNKITLENKIDTLNSVITSTTEDQT
FT                   LLHTQSQELKIAKSELEKEIESLNTELKSCEKDTFTLSSAQMTEFNRYLKEFNTLTSDN
FT                   KINIKIIQNNINQFTTQLKSIKSKLKGMRSQEEQVVGNLTKYTGLIEETESKMRDFRSS
FT                   LEQLQTHMTQLKVRKEKLHTQNCELQDKKDNYTQMLTSLSVLKHEYNYMFKRSVLNNEM
FT                   AKTVPGVLGEVISLFELTNEAYSTAVMASLGFRAHAIVTRDYQTIAKCIEFLKEKKAEK
FT                   RDFISLQQLKSDKSTTRQHLSHLLRRFNKLNYAFAIDLIEPNGDSVSNLFEYLLGDTVI
FT                   VDNLDEAERVVNLRHGRDGVNLQFNVVTLKGQMITRNRTIVVGSTLSTKKSEMELELNK
FT                   YNKFNALLIEVEKELRDNSDETKRIETELSSGTDKIERFKRNLQLLLTKLEYLRKHKES
FT                   LDSQRNELSAESDKLMTQLKSLEQTLQELENKLSLENEQLDKLKNEHFAPLNTKFEVSD
FT                   VYEMVMSRDDKVNNLHNNLMGKKMTLSRYETDLLELERKIESINGRLSDLNAQLTDVKT
FT                   QLLTLKEDNLSSCDGIETVQSEITSLKQLLQGYTTDINLYTEQLNNITTTDDKYDVMEE
FT                   INGLKEEIYQFHSQAMALTEFCKVHNLPLRFSITPKSQSESLNLEEEMEQIVLGFPILS
FT                   NAHEFSISSTSDLESEYKLLCETLVSLKKSLSNLRSYGDLEDKIESTTEEISSVDKETE
FT                   TLKTQLVKLESDFNKIKHERSGLFLHCFETVRENLGPIYRKLSQNEEGAEGQAFLTLDD
FT                   FPTTSTTPTNSVNTFNSTIDGTLNNNGSNTVNSLVDLEPFNRSIRYNTIPPMKKYLSIN
FT                   LQSGGEKALSSIALLLSLHIYRNSPFVVLDEIDANIDSVKLNNLTKFLMESTFQVIIIS
FT                   LKDKLFSKAQRLIGVYRSHPLCTSKCLVLNLENYPPDE"
FT                   /protein_id="XP_765813.1"
FT   gene            complement(589672..590256)
FT                   /db_xref="GeneID:3502727"
FT                   /locus_tag="TP01_0287"
FT   mRNA            complement(join(589672..589757,589843..589915,
FT                   589944..590001,590124..590177,590211..590256))
FT                   /db_xref="GI:71032344"
FT                   /db_xref="GeneID:3502727"
FT                   /locus_tag="TP01_0287"
FT                   /transcript_id="XM_760721.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(589687..589757,589843..589915,
FT                   589944..590001,590124..590177,590211..590233))
FT                   /locus_tag="TP01_0287"
FT                   /gene_family="HOG000238677" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032345"
FT                   /db_xref="GeneID:3502727"
FT                   /translation="MSETKCGAKVTFKIVLASDANQPYKVLSVPEQAPFSAVIKFAAEE
FT                   FRLNPATCAIITNDGVGINPTQTAGGVFLKYGSNLRLIPRDRVGFYY"
FT                   /protein_id="XP_765814.1"
FT   gene            <590978..>592888
FT                   /db_xref="GeneID:3502728"
FT                   /locus_tag="TP01_0288"
FT   mRNA            <590978..>592888
FT                   /db_xref="GI:71032346"
FT                   /db_xref="GeneID:3502728"
FT                   /locus_tag="TP01_0288"
FT                   /transcript_id="XM_760722.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        590978..592888
FT                   /locus_tag="TP01_0288"
FT                   /gene_family="HOG000134865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032347"
FT                   /db_xref="GeneID:3502728"
FT                   /translation="MSTIKDKNISTDLPPKNSRFVELNINIKEYGYGFDYFNRNRYSEY
FT                   RSSNGYVFNKVLEDDTVVWKATCTYDFAQYVLVYEGDEKYILIIPYYNNLILFRQLKDN
FT                   TWERINIEINLAKLKLYKQYVYHNVQIINFKFKVLETVDKLRDMNTLSGDYYYDLEKTN
FT                   FRIIFDRFCHVISHEEKEIWKQTKDNAHHGHLISLNFELISGCVTIKFIDGTDETLDLN
FT                   RPSNKRPRAEVESTEVVDLNQSINQLNENSEPSNENVEDKSVSPEVITLDTDTMMSTNK
FT                   YKTVRVPNYHHFKANNGFVFGKIVDGDRVILDTDDPSKYVTEYNCRVEFDSNLEKHFEY
FT                   FECIRPNIDKLKLYKKNGIELNPDDYCVLSSKYYYQILFNKSLYKIIYDGKVYWKYNYY
FT                   KNECFPYRLYFSYINSNMTMSFRGGHEKEIKISCNLLKMYKLENNNKIQLEDEHYEVIT
FT                   LEYDRIFYTLRDDIKCTEVWFDDCIVWEHKSGKEYPKSICCNYKLARIDIRFNSYVASF
FT                   VRFGFQNYITKFFYLPKDLKFYKEDKNGNSLELRPNDYRIDLLCPSSIVYILKPVKCNE
FT                   IRLGDLTVWKRQNKKAFPRKIVYDLEGPSIRVYRKQTRHGDFHKTRLMKIHRKNGVWRF
FT                   Y"
FT                   /protein_id="XP_765815.1"
FT   gene            complement(<592954..>597125)
FT                   /db_xref="GeneID:3502729"
FT                   /locus_tag="TP01_0289"
FT   mRNA            complement(join(<592954..593046,593076..593207,
FT                   593237..593299,593329..593412,593726..595557,
FT                   596333..>597125))
FT                   /db_xref="GI:71032348"
FT                   /db_xref="GeneID:3502729"
FT                   /locus_tag="TP01_0289"
FT                   /transcript_id="XM_760723.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(592954..593046,593076..593207,
FT                   593237..593299,593329..593412,593726..595557,
FT                   596333..597125))
FT                   /locus_tag="TP01_0289"
FT                   /gene_family="HOG000135767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032349"
FT                   /db_xref="GeneID:3502729"
FT                   /translation="MDVKCESLDWIRCMNSQLKSPGAYISTRLESVSLEQLQREFSSLL
FT                   LTSQSHGSTLLSTAFSNATGHNDNLKKIIMSMWPLKDKVTSSYESLKCIRDKNTQILAS
FT                   VNSLLHRLTVVLYSKKALSKLILSKRLFHTLCTELLHTFKSLNVDNVGVSNTVDSVTNS
FT                   VGVSNSVGVDECVVSVVVRMIELVSKNVYRLNSMIHNIEGYNLESSWLILQFAPKELDR
FT                   VLQLVEEFKSYDGKLRELVPNYTISDDFESCLQYVIHHFSIADYVNLEAELCVKKLEED
FT                   VRSVRKSLVTLTELCSSVAFTRLYKLYTELNELNTIINSDGVDRVRIRAEINKFLSALT
FT                   YTIRGFTLLNSDLTPLLHIFNDTFLIPFSNSFNTLTITTFNSVTNVNNVNSVTNVNSVD
FT                   SVSSVNVVNSVSKVNSVNSVGSVEMLHEEAGTFSGFVDRVEKVIFTESVLMQFLDELSE
FT                   LIGDENFKSLCILRPVALWIFTIIEDSFSHIFSPIDPDYRVNYSSFERLLTIIECKSDS
FT                   TLCNLFKWRASALPYSYSTRFCVNVITNNFLDNVISTVNSELHKYHELGNLQTYHIKPH
FT                   TNSNSNTDTTQTEMCDGGVRSFFLTSSLVVYGQMIELFSVQMFNHMFGQHLKTFSDVVK
FT                   LYLNHIESFIIHMEMNNNTDSSARSSVLDYHSGKSVTHSASGLDGGFLWPSGLSFAYSA
FT                   YVLHDIIQILNSLTISDLTHCKFNNLSGERFNEFSGEKSNNLSGEKSNNLSGEKSNNLS
FT                   GEKFNEFSGEKFNEFSGEVRFHGFGAVSILILKTCLIPLKLYINRKNIKDLSTLWDHTV
FT                   RQGSPEFDCDKELYPDELCGEELGDKELCEVRRLLKFTVKGMLLLIEFINNINDHINFI
FT                   KDKLDCEVSDYVKFLVAPLCSFHEFTREILSQEVVKDIMVKTVQLVSSDYISHIKALVS
FT                   SVETLNSSLTNPKHISLSEYSESFLIVDIEMLKKQISRDIEEFYQTCKHKFNVQKSDCN
FT                   SLELLLQFN"
FT                   /protein_id="XP_765816.1"
FT   gene            597378..599910
FT                   /db_xref="GeneID:3502730"
FT                   /locus_tag="TP01_0290"
FT   mRNA            join(597378..597750,597869..597973,598207..598423,
FT                   598539..598595,598666..598730,598848..598974,
FT                   599115..599336,599568..599680,599767..599910)
FT                   /db_xref="GI:71032350"
FT                   /db_xref="GeneID:3502730"
FT                   /locus_tag="TP01_0290"
FT                   /transcript_id="XM_760724.1"
FT                   /product="26S proteasome subunit"
FT   CDS_pept        join(597526..597750,597869..597973,598207..598423,
FT                   598539..598595,598666..598730,598848..598974,
FT                   599115..599336,599568..599680,599767..599895)
FT                   /locus_tag="TP01_0290"
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="26S proteasome subunit"
FT                   /note="go_function: DNA binding [goid 0003677]; go_process:
FT                   two-component signal transduction system (phosphorelay)
FT                   [goid 0000160]; go_process: regulation of transcription,
FT                   DNA-dependent [goid 0006355]"
FT                   /db_xref="GI:71032351"
FT                   /db_xref="GeneID:3502730"
FT                   /translation="MSTTEDSIDLSEVCVLSDADVRARINMIDAEVKILKSEHTRLKSQ
FT                   QKMIQERIKDNLEKIQLNKQLPYLVANVVELLDMDEEYEEEYGSAQNIESKPKGKSLVI
FT                   KTSTRQTIYLPVIGLIPHTELKPGELVGVNKDSYLVLDKLPPEYDNRVKAMEVCEKPTE
FT                   DYSDIGGLDKQIQELIEAIVLPITHKEKFEKIGIKPPKGILMHGPPGTGKTLLARACAA
FT                   QTKATFLKLAGPQLVQMFIGDGAKMVRDAFNLAKEKAPTIIFIDEIDAIGTKRFDSELS
FT                   GDREVQRTMLELLNQLDGFSTDDKVKVIAATNRPYTLDPALLRSGRLDRKIELPHPNEE
FT                   ARAHILQIHSRKMNVHKDTNYMELSRSTENFNGAQLKAVCIEAGMVALRRGATELDHED
FT                   FVEGIAMVQAKKKNPLNYLT"
FT                   /protein_id="XP_765817.1"
FT   gene            complement(<600416..>601808)
FT                   /db_xref="GeneID:3502731"
FT                   /locus_tag="TP01_0291"
FT   mRNA            complement(join(<600416..600567,600660..601458,
FT                   601707..>601808))
FT                   /db_xref="GI:71032352"
FT                   /db_xref="GeneID:3502731"
FT                   /locus_tag="TP01_0291"
FT                   /transcript_id="XM_760725.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(600416..600567,600660..601458,
FT                   601707..601808))
FT                   /locus_tag="TP01_0291"
FT                   /gene_family="HOG000135766" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032353"
FT                   /db_xref="GeneID:3502731"
FT                   /translation="MYLILFVFSLVVVSMVALDMAELVHFFPKAPELHNLTLLGLTGPF
FT                   VTRFKVPNASVLFPFNFFKLPNDTTGVLPQLQHPDTLIHPDTLLHPHSLVHPDSLANPE
FT                   SLVNPDTLVVTKFTVTNIDQHDHKHCNKLNTKIGDDRFDDDLSGVLDNFDDADDLNSLR
FT                   NALKQRLQNKNSGDTTGDTTGDTTGNTDGTANYNAYDNPDGKVAAKDVNSGNTANSVNN
FT                   TPNSVDNTANSSDNTSNSVNNKKSGDDSFYDHLPFMPHPGETEGESEEVSKDEFPPETN
FT                   DLTPEGKSEVVVLYKLQKRSFKFAASAVISLFVMFYVYSFWVALSFGVSKCSTMHEFSV
FT                   QPDQFPPLID"
FT                   /protein_id="XP_765818.1"
FT   gene            <602772..>604565
FT                   /db_xref="GeneID:3502732"
FT                   /locus_tag="TP01_0292"
FT   mRNA            join(<602772..602837,602995..603184,603638..603751,
FT                   603799..603906,603987..604128,604315..604420,
FT                   604455..>604565)
FT                   /db_xref="GI:71032354"
FT                   /db_xref="GeneID:3502732"
FT                   /locus_tag="TP01_0292"
FT                   /transcript_id="XM_760726.1"
FT                   /product="hydroxyacyl glutathione hydrolase"
FT   CDS_pept        join(602772..602837,602995..603184,603638..603751,
FT                   603799..603906,603987..604128,604315..604420,
FT                   604455..604565)
FT                   /locus_tag="TP01_0292"
FT                   /gene_family="HOG000058041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydroxyacyl glutathione hydrolase"
FT                   /db_xref="GI:71032355"
FT                   /db_xref="GeneID:3502732"
FT                   /translation="MTNSSKFKFFTPNSLSHNSSLNKAVGEVLIVPVLQDNYSYILKDP
FT                   ASSNALCVDPVEYEKVYNVSKENNLTLKLALCTHKHWDHSGGNNGIKKLVPDIQVVGSS
FT                   YEDTPGVTLPVKHQQTIPFGSLVIECLKASCHTMGHIMYYIYHPTNPNLQPLLFSGDTL
FT                   FVCGCGRFFEGNAKSMLEIVKSVKSLPEHTLLYCGHEYTLKNLQFAYTVDPSDVVLRKL
FT                   DWAKETISKGLPTVPSTLQEEKLYNPFLRVEELMKSLNENSEESTMNKLRSLKDKF"
FT                   /protein_id="XP_765819.1"
FT   gene            complement(<604673..>604912)
FT                   /db_xref="GeneID:3502733"
FT                   /locus_tag="TP01_0293"
FT   mRNA            complement(<604673..>604912)
FT                   /db_xref="GI:71032356"
FT                   /db_xref="GeneID:3502733"
FT                   /locus_tag="TP01_0293"
FT                   /transcript_id="XM_760727.1"
FT                   /product="60S ribosomal protein L38"
FT   CDS_pept        complement(604673..604912)
FT                   /locus_tag="TP01_0293"
FT                   /gene_family="HOG000188979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L38"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032357"
FT                   /db_xref="GeneID:3502733"
FT                   /translation="MPKELKELKDYLSVLKRPDARSVVVYKKKSKGGLLSTKFKVRCSR
FT                   YLYTFSVPNQVKAAKVEATIPSHLEKKVITNKKN"
FT                   /protein_id="XP_765820.1"
FT   gene            complement(<606047..>607012)
FT                   /db_xref="GeneID:3502734"
FT                   /locus_tag="TP01_0294"
FT   mRNA            complement(<606047..>607012)
FT                   /db_xref="GI:71032358"
FT                   /db_xref="GeneID:3502734"
FT                   /locus_tag="TP01_0294"
FT                   /transcript_id="XM_760728.1"
FT                   /product="60S acidic ribosomal protein, P0"
FT   CDS_pept        complement(606047..607012)
FT                   /locus_tag="TP01_0294"
FT                   /gene_family="HOG000210987" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S acidic ribosomal protein, P0"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: translational elongation [goid 0006414];
FT                   go_process: ossification [goid 0001503]; go_process: cell
FT                   adhesion [goid 0007155]; go_process: protein biosynthesis
FT                   [goid 0006412]"
FT                   /db_xref="GI:71032359"
FT                   /db_xref="GeneID:3502734"
FT                   /translation="MKMVEMSCRMAKVSKSEKKKLYFERLTSLMRTYSKILIVSVDHVG
FT                   SRQMASVRHSLRGMATILMGKNTVIRTALQKNFPDSPDVEKVAQCVKLNTGFVFCEADP
FT                   MEVREVILNNRVPAPAKQGVIAPSDVFIPAGSTGLDPSQTSFFQALGISTKIVKGQIEI
FT                   QNEVHLIKKDDKVTASGATLLQKLNIKPFSYGLKVEKIYDSGAISDASVLDVTDEDILS
FT                   VVKLGVSYANAMARELGYPTSLSVDHALLEGFKNCISLVLDSEFTFPQMSTLKQFLENP
FT                   DAFSGTASGTVTSQAVEEKKEEKEEEEEEEDEDMGFSLFD"
FT                   /protein_id="XP_765821.1"
FT   gene            607356..>609471
FT                   /db_xref="GeneID:3502735"
FT                   /locus_tag="TP01_0295"
FT   mRNA            join(607356..607432,607535..607574,607683..607840,
FT                   608072..608204,608312..608549,608706..608841,
FT                   608976..609188,609218..609295,609325..>609471)
FT                   /db_xref="GI:71032360"
FT                   /db_xref="GeneID:3502735"
FT                   /locus_tag="TP01_0295"
FT                   /transcript_id="XM_760729.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(607538..607574,607683..607840,608072..608204,
FT                   608312..608549,608706..608841,608976..609188,
FT                   609218..609295,609325..609471)
FT                   /locus_tag="TP01_0295"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032361"
FT                   /db_xref="GeneID:3502735"
FT                   /translation="MDEKYKSLKSKHELLKEGFKKLYSDYETVKNDLSAKLEEFSKLHE
FT                   ENSQLKHNYDLLLNEINQPTRLKGVQSWTNALTLIKGGTDTDTQKYIDEINTLKAKLES
FT                   TLKLTEAMDLEKRELERDMEDMKAKHGVVVSELKDRLLGLESILKDLQEQLNKNELKLT
FT                   QYTSDIKSLNTELQHKNHQIFQLQLLMENSRTAYESEKLQWDRKLNEKFKFDLRRNPHI
FT                   NLNNSYQNTTSHEMCVDGMSCGELSGRIIASLSEVFKSWSNCLRFIPSGVSSDAFSTES
FT                   DCTFVTLFTQDLHLLRNLDSTTREIEGIIVKICHGLEFVQATGYFKLFLQLMKQLIKHQ
FT                   RIYFCLENFLTHFNPQDGGNSGTIGNSCTSVTSGEVNLM"
FT                   /protein_id="XP_765822.1"
FT   gene            <610548..>611874
FT                   /db_xref="GeneID:3502564"
FT                   /locus_tag="TP01_0296"
FT   mRNA            join(<610548..611316,611435..>611874)
FT                   /db_xref="GI:71032362"
FT                   /db_xref="GeneID:3502564"
FT                   /locus_tag="TP01_0296"
FT                   /transcript_id="XM_760730.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(610548..611316,611435..611874)
FT                   /locus_tag="TP01_0296"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032363"
FT                   /db_xref="GeneID:3502564"
FT                   /translation="MTELQSVNYSTLLINELINQFSSSNTTHTPDTNTIESNPTDGNPT
FT                   DGNTIELLLGKCYGVVYNLIREMCVLLMELREILSHRICYPKIVKGMFLPFTGGTKQMV
FT                   QLSSSITHLHSQLSSITKSRLKTLFNKIFNRNTRCNNNNNNNNNNSISSNSNNGNVVSY
FT                   VVRCNEKLLSSGLRIDLKSLESELAKLKRSEVELSELRLKYATAQEELSIVRLNSENYL
FT                   KELESLKQTNHIQHICTKLFQQTFNKYSTNFCNKEPFANSVEASVTSVDACVPSVDACV
FT                   PSVDACVPSEDPVSTHLYMCKLMNNVRYLMKMVSNLEDVNGQLRLALQVNRDQYRLAKE
FT                   NEDAIHRNYNDQLVLMSEHITELNNTILNSEYKIAELTQTKVSCPSCGFNNTLGILYTV
FT                   LYS"
FT                   /protein_id="XP_765823.1"
FT   gene            <613153..>613782
FT                   /db_xref="GeneID:3502565"
FT                   /locus_tag="TP01_0297"
FT   mRNA            join(<613153..613417,613450..613544,613777..>613782)
FT                   /db_xref="GI:71032364"
FT                   /db_xref="GeneID:3502565"
FT                   /locus_tag="TP01_0297"
FT                   /transcript_id="XM_760731.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(613153..613417,613450..613544,613777..613782)
FT                   /locus_tag="TP01_0297"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032365"
FT                   /db_xref="GeneID:3502565"
FT                   /translation="MKNRPDYDISKLVNNSCVKRCNEFIPKFKESTLQVESDIKQGKLN
FT                   TLDSNLQLYTQDIKLSEDSNYLQDSNYLQPCEPLEDSEQSIFLDVGLGVFDVKGTTPSE
FT                   EALKEAGVALLDIKPQA"
FT                   /protein_id="XP_765824.1"
FT   gene            <613943..>614664
FT                   /db_xref="GeneID:3502566"
FT                   /locus_tag="TP01_0298"
FT   mRNA            join(<613943..614298,614607..>614664)
FT                   /db_xref="GI:71032366"
FT                   /db_xref="GeneID:3502566"
FT                   /locus_tag="TP01_0298"
FT                   /transcript_id="XM_760732.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(613943..614298,614607..614664)
FT                   /locus_tag="TP01_0298"
FT                   /gene_family="HOG000135765" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032367"
FT                   /db_xref="GeneID:3502566"
FT                   /translation="MDLSMKLRNLFLVMDAKKEGVLNEASVVLALQSIGFVVPNDVKSS
FT                   VSPMNCTEFINFGTQLAKKLPSDGGVGDLYSSLAGSKSKKVEMAEVRQVMETLKLTNPS
FT                   DLDVLSSLLDPRNSGIWSIFRLLYLRISLDYSN"
FT                   /protein_id="XP_765825.1"
FT   gene            complement(<615046..>616646)
FT                   /db_xref="GeneID:3502567"
FT                   /locus_tag="TP01_0299"
FT   mRNA            complement(join(<615046..615425,615459..615639,
FT                   615784..616062,616091..616197,616239..616362,
FT                   616551..>616646))
FT                   /db_xref="GI:71032368"
FT                   /db_xref="GeneID:3502567"
FT                   /locus_tag="TP01_0299"
FT                   /transcript_id="XM_760733.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(615046..615425,615459..615639,
FT                   615784..616062,616091..616197,616239..616362,
FT                   616551..616646))
FT                   /locus_tag="TP01_0299"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: GTP binding [goid 0005525]"
FT                   /db_xref="GI:71032369"
FT                   /db_xref="GeneID:3502567"
FT                   /translation="MYIRPRVRTCIYMYQGVLSYLTVTFTPHYTVTCEWISNVVPRICE
FT                   RGEEGIKRVVKLIYKKISDIALIGKPNSGKSSVIRRLTNARPRVANFPFSTRFPIHGIL
FT                   NQTQHDTNQVDKVGSAESVEQETEETEDEFDSCGYESDEEIDDTEEQIDVTDPGDRISL
FT                   VDVPGLIDGSSEGKGLGHDFLRQIEHSKTLSYVIDSSNQDPLGDYMSVRRELELYNPEI
FT                   LEKDEIILLNKIDLIDNQTIFKLINTFLKHTNHNHIYFLSAKTGENMDFINTLFQKLYS
FT                   SHTTHTTTTDGGDSVTKFDDLDDFRKLDRKKFTVTCESDGAFRISSPYLERKIKMMRFD
FT                   LPETMDKLKSILKANKVNKKLIKLGLKEGGIIHIGDLAFTAQSNNFFQ"
FT                   /protein_id="XP_765826.1"
FT   gene            complement(<617379..>618289)
FT                   /db_xref="GeneID:3502568"
FT                   /locus_tag="TP01_0300"
FT   mRNA            complement(join(<617379..617674,617704..>618289))
FT                   /db_xref="GI:71032370"
FT                   /db_xref="GeneID:3502568"
FT                   /locus_tag="TP01_0300"
FT                   /transcript_id="XM_760734.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(617379..617674,617704..618289))
FT                   /locus_tag="TP01_0300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:71032371"
FT                   /db_xref="GeneID:3502568"
FT                   /translation="MRIFGILRFLTFYTFLNFFTNSKIFNNSKLFTNSKIFNNCKLFNN
FT                   SKLLENCKLLDNSKIFTNCKLIPNKTNLNICKIKSFGFINPSNHTVNSSVNSVNTSVNS
FT                   SVNTSVNSVNTSVNSVNTSVNSSVNTSVNSVNTSVNSVNTSVNSSVNTSVNSVNTSVNS
FT                   VNTSVNSVNTSVNSVNTSVNSSVNTSVNLLGNDWSDYRVVDLCVIKVSGGDGGDGCMSF
FT                   RREKHVPLGGANGGNGGPGGDVYIECNDSVSDLRWFKANKIYKAQNGNNGKGSNRNGVR
FT                   TFYRIYHYYLVL"
FT                   /protein_id="XP_765827.1"
FT   gene            complement(<618410..>620055)
FT                   /db_xref="GeneID:3502569"
FT                   /locus_tag="TP01_0301"
FT   mRNA            complement(join(<618410..618518,618548..618651,
FT                   618731..618865,619248..619423,619489..619618,
FT                   619750..>620055))
FT                   /db_xref="GI:71032372"
FT                   /db_xref="GeneID:3502569"
FT                   /locus_tag="TP01_0301"
FT                   /transcript_id="XM_760735.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(618410..618518,618548..618651,
FT                   618731..618865,619248..619423,619489..619618,
FT                   619750..620055))
FT                   /locus_tag="TP01_0301"
FT                   /gene_family="HOG000163725" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032373"
FT                   /db_xref="GeneID:3502569"
FT                   /translation="MEEEMISLDSLEEKKPDTFYNITFNDIDHAIYSASENIEFPKDRN
FT                   IIRKAEDFRNLGNESFKKGFLESAIDYYTKAIKTYPHNHEFYTNRALCYKKQNKWDLVE
FT                   QDVRQALNLEENSVKAHYYLGQALLNLGTNHTVLLNTVPYHGDPVEGMRKLRKAKCLSE
FT                   HYKVPYIEEIDNEILKAKKAIWESQDIQFNNTLNSFYTFIHRERVESRMELEEYGERIQ
FT                   QLEHFRNYIAKSKEKHIPPYLCCKISMCLMRDPVISSSGLTYERKLLETHLLCNGEYDP
FT                   ITRELCKMSDLVPNYHVKEAVEDFLDKNPWAFDDYYTI"
FT                   /protein_id="XP_765828.1"
FT   gene            complement(620100..623109)
FT                   /db_xref="GeneID:3502559"
FT                   /locus_tag="TP01_0302"
FT   mRNA            complement(join(620100..620199,620556..620690,
FT                   621389..621541,621723..622004,622275..622445,
FT                   622566..622757,622863..622952,622987..623109))
FT                   /db_xref="GI:71032374"
FT                   /db_xref="GeneID:3502559"
FT                   /locus_tag="TP01_0302"
FT                   /transcript_id="XM_760736.1"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase"
FT   CDS_pept        complement(join(620173..620199,620556..620690,
FT                   621389..621541,621723..622004,622275..622445,
FT                   622566..622757,622863..622952,622987..623001))
FT                   /locus_tag="TP01_0302"
FT                   /gene_family="HOG000246855" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase"
FT                   /note="go_function: monooxygenase activity [goid 0004497];
FT                   go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:71032375"
FT                   /db_xref="GeneID:3502559"
FT                   /translation="MAGKKVTVVGCGNWGTAAAKVISENTPKFNLFNPTVRMWVLEELV
FT                   EGVKLSELINTTHENKKYLPGIKLPNNLLAVPDLNECVKDTDLFIFVIPHQFVKSTAVK
FT                   MRECGLMKKEAVALSLVKGIMILDNEPVLVSDVIERELGIPCSALSGANVANCIAREEF
FT                   SEATVAYTTRDEGRLWQRLFDRPYFKIRCIKDVAGIQVYGAIKNVVALSAGFCDGLGLG
FT                   SNTKAAVMRIGLVEIHKFAKLFFPNTTEDVVFESAGVADLITTCIGGRNVRCAAEFAAK
FT                   EGKRSWNEIEQEFLNGQKLQGVSTCHEVYEVLRTHDKLAEFPLFHVTYKVAFESTHPSE
FT                   LIKSLSTEELERFE"
FT                   /protein_id="XP_765829.1"
FT   gene            <623283..>627120
FT                   /db_xref="GeneID:3502560"
FT                   /locus_tag="TP01_0303"
FT   mRNA            join(<623283..623744,623854..623902,624041..624744,
FT                   624859..625023,625379..625689,625916..626022,
FT                   626109..626332,626752..>627120)
FT                   /db_xref="GI:71032376"
FT                   /db_xref="GeneID:3502560"
FT                   /locus_tag="TP01_0303"
FT                   /transcript_id="XM_760737.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(623283..623744,623854..623902,624041..624744,
FT                   624859..625023,625379..625689,625916..626022,
FT                   626109..626332,626752..627120)
FT                   /locus_tag="TP01_0303"
FT                   /gene_family="HOG000282280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_function:
FT                   protein serine/threonine kinase activity [goid 0004674];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71032377"
FT                   /db_xref="GeneID:3502560"
FT                   /translation="MSDRSWISEESSGSDLHKSKQSLSNSSNYSLHSSHTSNRSPHSKS
FT                   SLHSYRSLHSYRSHKSRRSHTRRSHRTGRSPDRSRHRSKSHRRSKSHRRSRTYRRGRSG
FT                   DRSYGRSRTRRIGSIDRSRRSSSNNYSQKIAENKHYRSQHHSHTPTLNTNEKKRKYYYQ
FT                   QKPITLSPEEGEIEELELEDEDEDVDKFLESRRQERHKLLLKHSKPLHTDLSHTESSEQ
FT                   SLQSVQSLQNIESIENIESIQNIESIESIESVEENMVEKPVEEKVREKRCLNPFSLLIS
FT                   HLNPNTSDKQDPGTPDPDITDSGTPVRQSEEPDVSLDSAKELEDISPISVTLSPRDYTP
FT                   RDMTPRNSTPRNSTPRDETLRDDTVNEMTDMTNDMTYVYSDLQKKLMLEKQKLRNFIIN
FT                   MKRSEQDELEYEEDEDDMDMFSTAVDESTVKKRKVLRRVITNKLENRSLAENWNDSEGY
FT                   YQAMIGEVMDDRYSVISELAGKGVFSSVLKCYDSVDNLNVAIKVIRNNDMMIKAAEKEM
FT                   DILRRLNETDKEDKKHIVQLLTSFKYRGHLCMVFHWYWGNLRSHLKLNGKGYGLNISYV
FT                   HSYTRQLFIALRHMKKNKIMHADLKPDNILVNEGYNKLRICDLGSASDESENDVTAYLV
FT                   SRFYRAPEIILGCRYNCKIDVWSAAATIYELATGDILFPGRNNNHMLKLMMEFKGKVPS
FT                   KMIRAGQFSSQHFDENLDFVYTSTDPLTKTTVTRVLQDLRPTRNITDCIFERQPWTKSN
FT                   SPKKEILVKKIRQLGELLEKCLVLDPNKRFSPEDALQHPFIRN"
FT                   /protein_id="XP_765830.1"
FT   gene            <627434..>627781
FT                   /db_xref="GeneID:3502561"
FT                   /locus_tag="TP01_0304"
FT   mRNA            join(<627434..627471,627505..>627781)
FT                   /db_xref="GI:71032378"
FT                   /db_xref="GeneID:3502561"
FT                   /locus_tag="TP01_0304"
FT                   /transcript_id="XM_760738.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(627434..627471,627505..627781)
FT                   /locus_tag="TP01_0304"
FT                   /gene_family="HOG000135764" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032379"
FT                   /db_xref="GeneID:3502561"
FT                   /translation="MRIVIILREDWNTEDIEEILGQPCIRCPQHKYVISISTGESFYRP
FT                   VEVIQVEENGRLRRKVLLLDWKSKGKCQRTHEVKVENDKVYVKLDESTDELPSDKYAFL
FT                   "
FT                   /protein_id="XP_765831.1"
FT   gene            complement(<628429..>628862)
FT                   /db_xref="GeneID:3502562"
FT                   /locus_tag="TP01_0305"
FT   mRNA            complement(join(<628429..628555,628586..628684,
FT                   628852..>628862))
FT                   /db_xref="GI:71032380"
FT                   /db_xref="GeneID:3502562"
FT                   /locus_tag="TP01_0305"
FT                   /transcript_id="XM_760739.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(628429..628555,628586..628684,
FT                   628852..628862))
FT                   /locus_tag="TP01_0305"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032381"
FT                   /db_xref="GeneID:3502562"
FT                   /translation="MKHIYKFEKSLKKLHKLVEYSYSQSYDLGSVIKGVITAVDDYNNP
FT                   YDWLYYNVVNKYLKCAEKLDNSLSVIDVIIYPF"
FT                   /protein_id="XP_765832.1"
FT   gene            <629303..>631935
FT                   /db_xref="GeneID:3502563"
FT                   /locus_tag="TP01_0306"
FT   mRNA            join(<629303..631866,631896..>631935)
FT                   /db_xref="GI:71032382"
FT                   /db_xref="GeneID:3502563"
FT                   /locus_tag="TP01_0306"
FT                   /transcript_id="XM_760740.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(629303..631866,631896..631935)
FT                   /locus_tag="TP01_0306"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032383"
FT                   /db_xref="GeneID:3502563"
FT                   /translation="MFRYTSDLSIEESLFSGLYVIISRTEGTSDALYNSALTFLNTNFS
FT                   SFSVRELLSNYLADEFSLSGKLHFTKKVRLGPTEILWPVERANSTPREALLNNAKSLSI
FT                   LERNDILSHLTEDSSVDLKFISEEKFNSLFIPKLFYPGNVIAIVILNDGTVDYSSLIDV
FT                   FYEKKSLYGDNLAKFQFLLSVSGDHTRDQLLESFDKHVVKNRLHKFTQVNHVYDPDLTY
FT                   DSFFLIDKHCAEVTQRVYAVLGEIVLNLLITIVSQLLTLLDDPKYSLENIRKSLTHTHS
FT                   HSHSHTRRGKSYSGSEIKRSGDVNLILGNNLTAICHYVCANYHFTSENNHLSHAQTLFT
FT                   LSVTLFKLFNLRIGIDSVSSQTVQSLNKFARGKTGKSVYELLKLVIERPVEYLLNSLKR
FT                   SFLVWLRTSDCSEELQLLFIFYTKLLADSALVIPVISSFVTYCRRLPPEQQLNVIQYVV
FT                   DLLQNTKYKRKLHFYQHLKDFINCETQSIGSKLCETEDEQDLEVLLGGVTKCLEMTTVD
FT                   PMALDMIKYYKNWYQINNSIINTELNNLRYSSDIVLVKRVLTLKLCNILQSIQEHTAKV
FT                   DICPRLQELKRYAKLFNLTYLTLSHLIIRTHYGQCDSVCSVCRIGLDDKLLYFGGYEGV
FT                   RLGKFPLICSMELSRADLHFRFSTLNLRFSSQNPKKINTINNNLTFHIVHTRKCRLQCE
FT                   HLGFHIRTKIKSKLYTTNTTNNVNNVNNVNNVNTVGNVITVINDLEDLVVYVDSLLTVE
FT                   VVMVNPLAVDLMLKDVELVGSGVPFDTVKTEFIVPGFSRNYIKTINLRVKDEGTLSVLG
FT                   VKFTLFDFLTCFQLLVNLDNSDPNTFISTLKSCETGNFTQFLSTIYHSYPYYHIP"
FT                   /protein_id="XP_765833.1"
FT   gene            <632509..>634293
FT                   /db_xref="GeneID:3503323"
FT                   /locus_tag="TP01_0307"
FT   mRNA            join(<632509..633545,633576..>634293)
FT                   /db_xref="GI:71032384"
FT                   /db_xref="GeneID:3503323"
FT                   /locus_tag="TP01_0307"
FT                   /transcript_id="XM_760741.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(632509..633545,633576..634293)
FT                   /locus_tag="TP01_0307"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032385"
FT                   /db_xref="GeneID:3503323"
FT                   /translation="MKMRCVKDCNECEIGLFSTDFKDKVEFITAASVSNTPNTLLSSRT
FT                   TSHRSISTRTTSSITSTGTTNSITSINNLRGDGGLCKSVLVCSEELCVDCSVLEQLMSN
FT                   MSEFTQNSPLLTGDRSLIYVKLSNKNKSHKFTNITVSVLPHVPEPSVKSQPLTAKDYLQ
FT                   FQILQQKLKQINHIKFSIYLHLFAGHTIKHSVASNRVGVGLQLLPGESLYLPLVYVANE
FT                   LFSSFDVVFDYQIGDSGVTGTCDSRLIRGNAYKSVNFKVEKSITVQEHQFVPVVHFNHR
FT                   LLRDNIDLFKEYYSSSTLQSLKNSRVKYDNKWLRMFFKVNNESDKLFSCKMGNLEFISN
FT                   PNTSNRYHVDIRKLPYKRHRKYQILNLFNSIHWSCNGNFGTIKLFDPGNGVTSTELGDN
FT                   TPRLTGKSKLTQWYKMCLERLIPMNDLIYSKISIKVLITVDGRVMAGDTLAVGKYFTVN
FT                   VLAKNNGTRPIADYKVVIIPFTYDLYTNVENLLWSGSLEQVGLEPITPGSTSCISTTRP
FT                   YRTVSGDVNGVDMCNVVEWEGYSGYKTVATAELVVKQPCKLSINAAILNSNQTLFHHKL
FT                   HSINFFTL"
FT                   /protein_id="XP_765834.1"
FT   gene            634286..>635208
FT                   /db_xref="GeneID:3503324"
FT                   /locus_tag="TP01_0308"
FT   mRNA            join(634286..634519,634570..634721,634806..634890,
FT                   634979..635060,635092..635158,635187..>635208)
FT                   /db_xref="GI:71032386"
FT                   /db_xref="GeneID:3503324"
FT                   /locus_tag="TP01_0308"
FT                   /transcript_id="XM_760742.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(634391..634519,634570..634721,634806..634890,
FT                   634979..635060,635092..635158,635187..635208)
FT                   /locus_tag="TP01_0308"
FT                   /gene_family="HOG000177330" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032387"
FT                   /db_xref="GeneID:3503324"
FT                   /translation="MSVVLPGMLLGTVSDYVPLRNVYVKDSIIYSSVLGSQHISPNNEI
FT                   SVESGCVRVPYVGAVVVAQISRVHINKADCHIIAVNGRTLKDQYKASLTSNNVLESKSI
FT                   EILMYEWFRPGDFIKAKVIYAGDGKVFTLSTAGIGLGVVKTTSSNGEEMVPISWKYFMS
FT                   KKSGALEKRKVAKSI"
FT                   /protein_id="XP_765835.1"
FT   gene            complement(<635295..>636266)
FT                   /db_xref="GeneID:3503325"
FT                   /locus_tag="TP01_0309"
FT   mRNA            complement(<635295..>636266)
FT                   /db_xref="GI:71032388"
FT                   /db_xref="GeneID:3503325"
FT                   /locus_tag="TP01_0309"
FT                   /transcript_id="XM_760743.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(635295..636266)
FT                   /locus_tag="TP01_0309"
FT                   /gene_family="HOG000135763" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032389"
FT                   /db_xref="GeneID:3503325"
FT                   /translation="MELVREFGNSENNSISDPEHSDHLEPSDSTPNNHLSNNLSNNIKM
FT                   NLSNNLPNGIKMNLGNNVKTNLGDESDFDQSGIVYISRIPPFMGLSKLRSYFSNFGAVG
FT                   KIYCHPESITEYNKRIKSGGNRRLKFTHGWVQFTDKKVAKQVAKMLNNKPVEDKRHSFW
FT                   REDLWNIKYLPKFKWRHLVEYWSNTKRERKEKLHSVLAKERKRNLHYLEQLEQEKVEQH
FT                   IEQKKGKNELIKGKNEVKKGEIDPKKGEIEVIKGKKEVKKDKISVKKAVKSSGKDVKKD
FT                   KISVKKGKIGVKKTVKSPGKGVKSVKKGKREVPMELLESIVL"
FT                   /protein_id="XP_765836.1"
FT   gene            <636379..>636849
FT                   /db_xref="GeneID:3503326"
FT                   /locus_tag="TP01_0310"
FT   mRNA            join(<636379..636648,636706..>636849)
FT                   /db_xref="GI:71032390"
FT                   /db_xref="GeneID:3503326"
FT                   /locus_tag="TP01_0310"
FT                   /transcript_id="XM_760744.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(636379..636648,636706..636849)
FT                   /locus_tag="TP01_0310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: chaperone activity [goid 0003754];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:71032391"
FT                   /db_xref="GeneID:3503326"
FT                   /translation="MFAKFIFSLQSSKLFTHTITKRLFSTANTRNNLHSNLHSSTHNGI
FT                   NSGINNSFHSGIYDSELPLRLKTGKITYYDVLQVPANASQSDIKKAFTRLAKEYHPDMN
FT                   KNKDTRAIFLCIKESHDTLTNHNKRILYNQSLK"
FT                   /protein_id="XP_765837.1"
FT   gene            <637677..>638261
FT                   /db_xref="GeneID:3503327"
FT                   /locus_tag="TP01_0311"
FT   mRNA            join(<637677..637766,637814..637899,638060..>638261)
FT                   /db_xref="GI:71032392"
FT                   /db_xref="GeneID:3503327"
FT                   /locus_tag="TP01_0311"
FT                   /transcript_id="XM_760745.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(637677..637766,637814..637899,638060..638261)
FT                   /locus_tag="TP01_0311"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032393"
FT                   /db_xref="GeneID:3503327"
FT                   /translation="MDSARWERYERYTKGERNDSLEDPHTWIKIIGSIVVSCITVSIGC
FT                   LIFGHILTQFPSSSVDDVYDVGSVRDERMVDAYYNPITERWERIIAPFAPPNPEVLISH
FT                   YQLDTSELKIPQKLTTLRVIN"
FT                   /protein_id="XP_765838.1"
FT   gene            complement(638559..639122)
FT                   /db_xref="GeneID:3503328"
FT                   /locus_tag="TP01_0312"
FT   mRNA            complement(638559..639122)
FT                   /db_xref="GI:71032394"
FT                   /db_xref="GeneID:3503328"
FT                   /locus_tag="TP01_0312"
FT                   /transcript_id="XM_760746.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(638583..638999)
FT                   /locus_tag="TP01_0312"
FT                   /gene_family="HOG000135762" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032395"
FT                   /db_xref="GeneID:3503328"
FT                   /translation="METKRQWMQSFDGRIRVGPEYQAMIPPFCKNYQSHQNDINPKDTQ
FT                   EPKPPLTQSHSDPLQSHQSFTESYQPFTQSYEPFTESYEQLTESLHQCEEYENVDLEDQ
FT                   CDISSHIKFVSEEELGRFESDTKSLEHYNSDKEF"
FT                   /protein_id="XP_765839.1"
FT   gene            639848..641705
FT                   /db_xref="GeneID:3503329"
FT                   /locus_tag="TP01_0313"
FT   mRNA            join(639848..640168,640592..640715,640751..640843,
FT                   640884..640941,640973..641070,641365..641399,
FT                   641450..641483,641513..641572,641606..641705)
FT                   /db_xref="GI:71032396"
FT                   /db_xref="GeneID:3503329"
FT                   /locus_tag="TP01_0313"
FT                   /transcript_id="XM_760747.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(639980..640168,640592..640715,640751..640843,
FT                   640884..640941,640973..641070,641365..641399,
FT                   641450..641483,641513..641572,641606..641649)
FT                   /locus_tag="TP01_0313"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032397"
FT                   /db_xref="GeneID:3503329"
FT                   /translation="MLYSLVKYYPYCFIPIGIMRNGILGLVFWVLEVRLIYCRDTHLHK
FT                   ICVHLFHQDSSLNQLLCQEIGLSPCVSAEVCRINPRIILDAYDKEKCLLTLFSFFSTFT
FT                   CNDNKVKEYIYNTENGTTVYVDKEITNLLWKSCSRRSRLRLSYLFQDGPKQFCKSLTLG
FT                   NSKVKIRQAINLPGLSKILPINLEQLAEINWLMGSPISWDLLRVKISGVLIILFIIFLS
FT                   VSTLFIRQGRSKNKLTEPDVIF"
FT                   /protein_id="XP_765840.1"
FT   gene            641808..643628
FT                   /db_xref="GeneID:3503604"
FT                   /locus_tag="TP01_0314"
FT   mRNA            join(641808..641859,641890..642056,642412..642612,
FT                   642810..642887,642918..642995,643133..643245,
FT                   643371..643482,643513..643628)
FT                   /db_xref="GI:71032398"
FT                   /db_xref="GeneID:3503604"
FT                   /locus_tag="TP01_0314"
FT                   /transcript_id="XM_760748.1"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 4"
FT   CDS_pept        join(641841..641859,641890..642056,642412..642612,
FT                   642810..642887,642918..642995,643133..643245,
FT                   643371..643482,643513..643545)
FT                   /locus_tag="TP01_0314"
FT                   /gene_family="HOG000239560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 4"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032399"
FT                   /db_xref="GeneID:3503604"
FT                   /translation="MMKIPENDLSSETKWADIEADDDYDNENLNVQHLKEFEIATDSQG
FT                   IKSLVSYSRNSRGHSVKITKRVKEIRVSKRIHKSVFERKNLVPFNLTDENDTGSSFVSN
FT                   EEIIIELSRNERRLNQDDDSDLIYSPVDANFLKLSRDLKLKFKSLKEEDNVPEEVEEEA
FT                   PAKYVPPSRKEGGERRSFDDNTIRITNLSEDIREKDLTELFGRVGRIHRAYLAKYKETQ
FT                   NPKGFAFVTYVNKEDAREAINKFNRWGYNNLLLNVEWARPSKDK"
FT                   /protein_id="XP_765841.1"
FT   gene            complement(<643575..>645231)
FT                   /db_xref="GeneID:3503605"
FT                   /locus_tag="TP01_0315"
FT   mRNA            complement(join(<643575..643627,644211..>645231))
FT                   /db_xref="GI:71032400"
FT                   /db_xref="GeneID:3503605"
FT                   /locus_tag="TP01_0315"
FT                   /transcript_id="XM_760749.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(643575..643627,644211..645231))
FT                   /locus_tag="TP01_0315"
FT                   /gene_family="HOG000135761" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032401"
FT                   /db_xref="GeneID:3503605"
FT                   /translation="MYKILINFNSLLIFYYVLMFNVSSISTHRSNNKLHFRRDSPKYLM
FT                   INEKSLSGITSLNRVELKIKTFWGKESQFNSEIPVTVSLNDTFLNVKKLISSKTGIPVE
FT                   LQSLYLPLRNTPDSEHNSIILSKCVRLSDADSVMSCLRSCRIGSRALELELLLDLPAPA
FT                   FKSSTPNPNRIGDYLTAVVRYNNLLTAGTVTHGNCADNINSFIKHAEVYNTKLGPTDST
FT                   NGTEGTGGTEDRGGTKGIKDEYVDKRVYVRICKDYPRSSNVLSERVGNLMKKYLPIDLG
FT                   NTLKLSAFCLLLKLNSNFSKTALDLIGLVPLVSVFVQTRPGILCYKTLFHLIAQQYIPK
FT                   LVYNILPAHLAEKVRVS"
FT                   /protein_id="XP_765842.1"
FT   gene            <645405..>649322
FT                   /db_xref="GeneID:3503606"
FT                   /locus_tag="TP01_0316"
FT   mRNA            join(<645405..645505,645563..645742,645785..645887,
FT                   645936..646045,646075..646095,646411..646580,
FT                   646737..646795,646983..647050,647127..647237,
FT                   647271..647391,647422..647581,647612..647659,
FT                   647824..647972,648151..648327,648370..648849,
FT                   649047..>649322)
FT                   /db_xref="GI:71032402"
FT                   /db_xref="GeneID:3503606"
FT                   /locus_tag="TP01_0316"
FT                   /transcript_id="XM_760750.1"
FT                   /product="ubiquitin carboxyl-terminal hydrolase a"
FT   CDS_pept        join(645405..645505,645563..645742,645785..645887,
FT                   645936..646045,646075..646095,646411..646580,
FT                   646737..646795,646983..647050,647127..647237,
FT                   647271..647391,647422..647581,647612..647659,
FT                   647824..647972,648151..648327,648370..648849,
FT                   649047..649322)
FT                   /locus_tag="TP01_0316"
FT                   /gene_family="HOG000135760" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin carboxyl-terminal hydrolase a"
FT                   /note="go_function: ubiquitin thiolesterase activity [goid
FT                   0004221]; go_function: cysteine-type endopeptidase activity
FT                   [goid 0004197]; go_process: ubiquitin-dependent protein
FT                   catabolism [goid 0006511]"
FT                   /db_xref="GI:71032403"
FT                   /db_xref="GeneID:3503606"
FT                   /translation="MSERSIEFDGLCSDLGLLIPDSSTVVHKSECLYSIDTEYSLGGIY
FT                   VNLLTYQSFGKDLLKFDPIYPNAIYLNIVKRLIPCQQEPDLNEFNTTDHVSEKKVFEES
FT                   VEYNVFSPQLGSIPLDHTFGQLLNLCNSIIGHAGYEFKNNQLTFSNILNVHFTQFYLQF
FT                   THSNLALFCLFTYELLDNLELSNFGRSRSMRGICIRLRIRSGLTMTIYPVKNAMPLLTS
FT                   GSIFPMDMLVVVGRTITVAGVRTALRDEDNLVIDPLLEEHLKHFGINIHDLRRTEKTLL
FT                   ELELEDNKNYNWLSDASGASLIHLQPKLIGILNLGNNCYLNSVLQMLNNVKELNDFFLQ
FT                   YYQTNLQNKFENVNLFLLQYAKICTCINTDVFIHKCNQILDQYKNLLSESHETDDSLTQ
FT                   VLTHDCFYINPNLFKFTLVTVYSVIVTVYIVIVTVYIVIVTVYSVIVTVYIVIVTVYSV
FT                   IVTLWVLDIMNQIIICEELKLVNVNHVETHILPFELMDIINSKINSLNSNSTDIDDIND
FT                   INDIEIDITDCVLGWYGSVLVDYISSGKVYKANLYNNLTNAPSYLFVKLNRFYMDKVPK
FT                   KLLNKVTITGEKLELNLNHLNLKEFQDYTQPPLERNSGFYEVDESFLNQLLLMGFNEFD
FT                   IRHLFTHFYTFYTILHIFTHFYTFLHTIYTIYTFYTIYTFYTIYTFYTIPLNMKLLGFY
FT                   GNSDKVVSYYEQLKTEQLSDNVRETVVYDLIGFITHIGSNVNSGHYICHLKKDNEWYAF
FT                   NDTRITKSTNPPIHHGYIYLFQKS"
FT                   /protein_id="XP_765843.1"
FT   gene            complement(650367..651230)
FT                   /db_xref="GeneID:3503607"
FT                   /locus_tag="TP01_0317"
FT   mRNA            complement(650367..651230)
FT                   /db_xref="GI:71032404"
FT                   /db_xref="GeneID:3503607"
FT                   /locus_tag="TP01_0317"
FT                   /transcript_id="XM_760751.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(650371..651102)
FT                   /locus_tag="TP01_0317"
FT                   /gene_family="HOG000135758" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: RNA binding [goid 0003723]; go_process:
FT                   RNA processing [goid 0006396]"
FT                   /db_xref="GI:71032405"
FT                   /db_xref="GeneID:3503607"
FT                   /translation="MCKIFSLGWLIFLILLKFSKCFILQRDLTFHSSAVNTICYRDIMT
FT                   NRTPKHKNSFRPGKVQLVKTLKQHLADSKIVVQFRLTRLNHRLRSYIKENLLKHFEPRD
FT                   GKLPYKMQLIKNTIMLRAVEGTEFEPLSSSLEKTNLYFFIYDDTIFPKFMSVVNGMRRA
FT                   SKIVKWRFEPHFGCFDHTLVDGNRLRCLSALPEKKELCSRIPHLLRMPLYKLINSVNVG
FT                   QSLVNSLDQLQSKLNTNQSNN"
FT                   /protein_id="XP_765844.1"
FT   gene            complement(<651608..>653626)
FT                   /db_xref="GeneID:3503608"
FT                   /locus_tag="TP01_0318"
FT   mRNA            complement(join(<651608..651961,652073..652186,
FT                   652277..652379,652532..652670,652802..653064,
FT                   653106..653148,653326..>653626))
FT                   /db_xref="GI:71032406"
FT                   /db_xref="GeneID:3503608"
FT                   /locus_tag="TP01_0318"
FT                   /transcript_id="XM_760752.1"
FT                   /product="serine protease"
FT   CDS_pept        complement(join(651608..651961,652073..652186,
FT                   652277..652379,652532..652670,652802..653064,
FT                   653106..653148,653326..653626))
FT                   /locus_tag="TP01_0318"
FT                   /gene_family="HOG000239474" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine protease"
FT                   /note="go_function: serine-type endopeptidase activity
FT                   [goid 0004252]; go_function: trypsin activity [goid
FT                   0004295]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:71032407"
FT                   /db_xref="GeneID:3503608"
FT                   /translation="MLMVWCRSTRKYIARMIEIGHECDLAVLTVDDESFWDGITPLEFG
FT                   DVPNLHDNVTVIGYPTGGDNLCITSGVVSRVDVTTYSHSNFRYLTSLHYLHIFYYYTNV
FT                   SFYTFLHTNLQLLCVQIDAAINSGNSGGPAIKDGRVIGVAFQAYDEAQNIGYIIPTCII
FT                   NQFLKQIQLFNKYTGFVNIGITYQLLTNPFLKSFLSHKQHNTELGLGGGIMVCQYDESL
FT                   RGVIETNDVILQINGHPIADDGTVHFRGDERVHLGYSLTDKFCGDDCELLILRNNKLKK
FT                   IHIKLGKPSYLVPEHQWDIMPRYYIYAGLVFIPLSMEYLKDEFGKKFYERAPTALLKPL
FT                   SDMFARESGEEVVILSQILASDLTIGYDFKNIRLVSVNNTKILNLRHLEQVLLSAVEKY
FT                   VKFQFEQDILVVLETAKVPEFEQQILQQHAISAHKSRII"
FT                   /protein_id="XP_765845.1"
FT   gene            complement(<653683..>654310)
FT                   /db_xref="GeneID:3503565"
FT                   /locus_tag="TP01_0319"
FT   mRNA            complement(join(<653683..653773,653802..>654310))
FT                   /db_xref="GI:71032408"
FT                   /db_xref="GeneID:3503565"
FT                   /locus_tag="TP01_0319"
FT                   /transcript_id="XM_760753.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(653683..653773,653802..654310))
FT                   /locus_tag="TP01_0319"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032409"
FT                   /db_xref="GeneID:3503565"
FT                   /translation="MFYFCRNLNHSQNLIKYSQTNILQVKYYSKFYKVNFARFLQIFNF
FT                   SPGKFCKKVPLLPCARRFNHTKSENATGFPYLPNTPEETHQLIPHQDTVVTPVTSVNSV
FT                   NSVNSVSSVSSVSSVSSVNNSVNYVNGSVGSYFTDACSGIIKLYCDSTDPNYSQPWQMR
FT                   KQIKSIGSAFVIKDKLILTNAHCVSWQNRCLVKKHG"
FT                   /protein_id="XP_765846.1"
FT   gene            complement(654604..655522)
FT                   /db_xref="GeneID:3503566"
FT                   /locus_tag="TP01_0320"
FT   mRNA            complement(join(654604..654715,654751..654812,
FT                   654925..654991,655167..655227,655259..655522))
FT                   /db_xref="GI:71032410"
FT                   /db_xref="GeneID:3503566"
FT                   /locus_tag="TP01_0320"
FT                   /transcript_id="XM_760754.1"
FT                   /product="glutaredoxin-like protein"
FT   CDS_pept        complement(join(654659..654715,654751..654812,
FT                   654925..654991,655167..655227,655259..655467))
FT                   /locus_tag="TP01_0320"
FT                   /gene_family="HOG000136432" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutaredoxin-like protein"
FT                   /note="go_function: electron transporter activity [goid
FT                   0005489]; go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:71032411"
FT                   /db_xref="GeneID:3503566"
FT                   /translation="MSSVKYLVLFTLVCVVSLFQPSQCRLDYHFFSDFLSKYSFTLPFK
FT                   MAEKTPKDWVDSLVKKHKVVVFSKSYCPYCTRAKDALKKLNLHDLHVEELDSNPNMDQV
FT                   QDYLNQLTGARSVPRVFVNGRFYGDSTKTVSDVESGKFMEHYKKTDL"
FT                   /protein_id="XP_765847.1"
FT   gene            <656493..>659451
FT                   /db_xref="GeneID:3503567"
FT                   /locus_tag="TP01_0321"
FT   mRNA            join(<656493..658591,659059..659332,659446..>659451)
FT                   /db_xref="GI:71032412"
FT                   /db_xref="GeneID:3503567"
FT                   /locus_tag="TP01_0321"
FT                   /transcript_id="XM_760755.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(656493..658591,659059..659332,659446..659451)
FT                   /locus_tag="TP01_0321"
FT                   /gene_family="HOG000135757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032413"
FT                   /db_xref="GeneID:3503567"
FT                   /translation="MGDGTNPFRKTEFYSDWSGYSQPQSDPNYRPESYSNPEHIKFVPY
FT                   DNYTHTHSNPHFHNSQSNSHYPNSGTFSQTNSQGYSQSSNGYNQGSNAYGQSSNGYGQG
FT                   SQYVPNSHNYSKPSTHYVSSHCIPSHTVTSNNISSNSIQSHGVSSSNNSVQLNNMKNVQ
FT                   YGQVGHVVGSVDGVSLPYQGQVLDGTNSFNRQNSEPIPVQYQDNVRYSFPKGNSGSTVA
FT                   PGNSGSTVAPGNSVNGPYYQRNIPGYKNEPDVYYPNYMYYNGQMASRPSTDSRELNRDL
FT                   TRDLSRDLSRDLPRELTRELNRDIPRDLPRDIPRDLTRPEIPRDLPRSELYFSRNYENL
FT                   ANKNFFNASLSFKEAATAMLSMDAKKSHSRQRTPSRGRPTARGLGKLQKPENTQTTSRP
FT                   EQSISRAEQSGPRDPNSYQRFPNTKPIYHQNYNNTDPYTLYKDTNRVGDVNRDTNRVGD
FT                   VTRGDVTGRSDPRVDPSRLADPRIVPMNRTDITRGDVPVVGRGDVPVVGREVPGVVREV
FT                   PGVVRVDKDPVYNYYMINSKINSPEYAKYRNRGLQQLSQYNLMSQYSQQHGIGNYMSNL
FT                   NNFNHIPNVHNVHNPHTVNLHGVNHHGVPGVNHPGVHGINHGVPGVNHGVSNFTGVRGF
FT                   KKVPVSGQRFVPVPKSVPVRTEKHHVIEEIQADNDHMNNLKTNAISSASSIMESFQHSL
FT                   SNKRKRVKNCLVEDCRNVIGEQPKIDVQYSSVEVDGRRKYLLSEILSSLLPYHTFYHEQ
FT                   LDPPRSTKFDYSEIRNQIQQVQTLLDNINNNEHIFNQSV"
FT                   /protein_id="XP_765848.1"
FT   gene            <659686..>660180
FT                   /db_xref="GeneID:3503568"
FT                   /locus_tag="TP01_0322"
FT   mRNA            join(<659686..659918,660057..>660180)
FT                   /db_xref="GI:71032414"
FT                   /db_xref="GeneID:3503568"
FT                   /locus_tag="TP01_0322"
FT                   /transcript_id="XM_760756.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(659686..659918,660057..660180)
FT                   /locus_tag="TP01_0322"
FT                   /gene_family="HOG000135756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032415"
FT                   /db_xref="GeneID:3503568"
FT                   /translation="MYVLRRLGVLSGKNLCLGFQRRGVKSFRDVEFISKVTDEYQKIFE
FT                   DPSPNTKRERDERRKQAFKYVYYNPTFLQRLLILKARFFATGWIHLLTAVLTYSGVKFM
FT                   FWLEKYTNKDRYYI"
FT                   /protein_id="XP_765849.1"
FT   gene            660389..661255
FT                   /db_xref="GeneID:3503569"
FT                   /locus_tag="TP01_0323"
FT   mRNA            join(660389..660734,661108..661255)
FT                   /db_xref="GI:71032416"
FT                   /db_xref="GeneID:3503569"
FT                   /locus_tag="TP01_0323"
FT                   /transcript_id="XM_760757.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(660487..660734,661108..661231)
FT                   /locus_tag="TP01_0323"
FT                   /gene_family="HOG000135755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032417"
FT                   /db_xref="GeneID:3503569"
FT                   /translation="MMIGRNVRFFSVMGRDTADLSSKILKRITPKFTQKPLGSYPFPPE
FT                   HEMVWKNRRTVLGGYFQQSISPFQLKFVYPVIHQAPARMWAKLSQAFWWVIWPTLMAYV
FT                   GFLTIKKLDKKYIKRHNYF"
FT                   /protein_id="XP_765850.1"
FT   gene            complement(661329..>663379)
FT                   /db_xref="GeneID:3503570"
FT                   /locus_tag="TP01_0324"
FT   mRNA            complement(join(661329..661784,661925..662700,
FT                   662977..663103,663318..>663379))
FT                   /db_xref="GI:71032418"
FT                   /db_xref="GeneID:3503570"
FT                   /locus_tag="TP01_0324"
FT                   /transcript_id="XM_760758.1"
FT                   /product="tubulin subunit alpha"
FT   CDS_pept        complement(join(661376..661784,661925..662700,
FT                   662977..663103,663318..663379))
FT                   /locus_tag="TP01_0324"
FT                   /gene_family="HOG000165711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tubulin subunit alpha"
FT                   /note="go_component: ribosome [goid 0005840]; go_component:
FT                   intracellular [goid 0005622]; go_component: microtubule
FT                   [goid 0005874]; go_function: structural constituent of
FT                   ribosome [goid 0003735]; go_function: GTP binding [goid
FT                   0005525]; go_function: structural molecule activity [goid
FT                   0005198]; go_process: microtubule-based movement [goid
FT                   0007018]; go_process: protein biosynthesis [goid 0006412];
FT                   go_process: cell cycle [goid 0007049]"
FT                   /db_xref="GI:71032419"
FT                   /db_xref="GeneID:3503570"
FT                   /translation="MREVIAIHVGQAGVQLGSSVWELFCAEHGVKPDGTTEKVSKSKKD
FT                   EEGAAFHTFFSESESGRQVPRCVFVDLEPSVIDSVEKGKFGSLYHPEQLISGKEDAANN
FT                   FARGHYTVGRDIYSPVMDRIRRLTDMCDSVQGFLFFSAVGGGTGSGTGSLLLENIGAEF
FT                   ERKTKLSFCIWPSPQVSTAVVEPYNSVLTTHSLLEHSDVAVVLDNEAIYGICKNNLEIG
FT                   RPNYQNLNKIIAQVISSLTTSLRFDGALNVDMSEFQTNLVPYPRIHFMLSSYSPIISKR
FT                   KAKHEQMSVSEITFSAFDPKSMMAECDPRTGYYMSCCLMYSILPILPILKMVCKCMCRG
FT                   DVVPKDVNHAISVVKNKKTVKFVDWSPTGFKFGINYQPPCVVPGDDISRPSRAVCMISN
FT                   STSIAEVFTRMDKKFDLMYAKRAFIHWYVSEGMEECEFQEAREDVAALEKDYESAGSQ"
FT                   /protein_id="XP_765851.1"
FT   gene            <665733..>669425
FT                   /db_xref="GeneID:3502530"
FT                   /locus_tag="TP01_0325"
FT   mRNA            <665733..>669425
FT                   /db_xref="GI:71032420"
FT                   /db_xref="GeneID:3502530"
FT                   /locus_tag="TP01_0325"
FT                   /transcript_id="XM_760759.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        665733..669425
FT                   /locus_tag="TP01_0325"
FT                   /gene_family="HOG000135754" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032421"
FT                   /db_xref="GeneID:3502530"
FT                   /translation="MSSYKEQILRSPGPFDYCKCRCNVPYYIPYNCFLDQSHSHTHSHS
FT                   HTQSHSHSHTQSHSHSHGHTQSDTSDELINKFKNLKTRNDTRNELRSELRSELRNDVRN
FT                   ELRNDVKSDVRNETRNELGDVFEDSPLLSDETDLTYCNLDNGLECTDFLEGIHCINCDK
FT                   PFLMYTNLDFKLFDNWINYVFFHNSINQLSLNTPNDPDSRHLNDTDYKLNDTDYKLNEA
FT                   DYKLNEVSHLNNGGYDRLNGDTCYNKLSDTVEYELVDDIISIGDIMSSILMSSEETMFG
FT                   IINNISPGEHCTNEKNQLFDSVKRFLQYCLGEDTIVHLTGSTAYDIDIDYSEGTSAAAY
FT                   SDLDIVLLSNSFGGDPRIILQKVYSELTNMQHVLKERNKCPIWVLADSNIKLVESAKVP
FT                   IIIIETKNGLLCDISVNTLYPLLHTELFKSYIDEHPMVRPLMRIIKHWLIVRGIPNMKE
FT                   GGFPSILWMSLFSNSLDATTLNTATSNLEYSYPFIHSTDAISTELLGDTVNSGDGANLG
FT                   NSVTADLVNDVNGTTALTNTTSLVETPSTHSPNSSTTFSHTNTADSNPAEPNNAVDSNN
FT                   HFHTANSDTHTLDNTATVNTVDTVNTVDSGATVASAITDVDHNTTAYDEESNNENESMY
FT                   EGSEGSEVYEEFNFNETYREMYMSEYNRGCSIGQLWDRLQGGRGEYGILCSLEKCFYNL
FT                   SKGLSLMDIVNRFTHIKNGSDYGGMSTFCKNVIRLIEMEPNVPYGTWLVYFYELNRAKE
FT                   YMNLYAKRLEILVTLLSFLRLLTNPMTHSDPEGHTIDRSGNTVSNNSSADCNSVSMSDL
FT                   EDLASNICHSFGYDLSYLWDSTRQDPHAKEEFNPLYLNNKYAFGYSLSNDNLNIETIST
FT                   DISTDTVASEHTAKPNLTSKQNLKHPDNDKLADKLNTVDKLNTTCDNMDKCGMSVMRII
FT                   EDFVVRVSSMLRIQLKSADLIRNIKLLTYHMFQQFKIIPNEIFEKAHDNLYTIPVSIDP
FT                   PTPIEDDVTDYFGAQKGSGFESCLWNDSGWYIVVLQDSLCIVKVIKICIEWDFWWSKEF
FT                   VSRRDSRSIFHGFVYRQLRLDDMKKSQPQLQSLHSASRAQFNSNSVNSPSILIKRGTLV
FT                   LFNPCDIVSKLHVLKVVKHEQYISPSLYSTDFYTGVKCIYVLPGFEVDRFMCFDQIAHK
FT                   LKHYVEFRPQVSFCKLCGIVNMKKINPYTEYKIPQRKLRNAKYVLCNQKYNHIYNLMQF
FT                   SHSLK"
FT                   /protein_id="XP_765852.1"
FT   gene            complement(669646..670689)
FT                   /db_xref="GeneID:3502531"
FT                   /locus_tag="TP01_0326"
FT   mRNA            complement(join(669646..670041,670211..670460,
FT                   670545..670689))
FT                   /db_xref="GI:71032422"
FT                   /db_xref="GeneID:3502531"
FT                   /locus_tag="TP01_0326"
FT                   /transcript_id="XM_760760.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(669650..670041,670211..670460,
FT                   670545..670664))
FT                   /locus_tag="TP01_0326"
FT                   /gene_family="HOG000135753" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   protein carrier activity [goid 0008320]; go_process:
FT                   intracellular protein transport [goid 0006886]"
FT                   /db_xref="GI:71032423"
FT                   /db_xref="GeneID:3502531"
FT                   /translation="MIRLKSILIFLASWCFFHKIVSFGVKFTSCNYEEDYEQDFDMTPP
FT                   DSLERDEDFHDDIPYYNEWNEKMTDFHPKSLLSVIVPPKSSETFYETVFKQPTTIKGMF
FT                   FTTSKDDYLSVQVVVKSPVNQVLYTNDSPEGLFSVDANMVGDYEISLTNTHWMTPVSVT
FT                   FATGTDDHSILKTEHVENTFNRVKKLEEHIDNIYSQFRYFWTHNNRQMNATKKAQGRLL
FT                   LYALLQFTVILLCSLVSIWYVKKSVSNKRIL"
FT                   /protein_id="XP_765853.1"
FT   gene            complement(<670767..>677515)
FT                   /db_xref="GeneID:3502532"
FT                   /locus_tag="TP01_0327"
FT   mRNA            complement(join(<670767..673981,674139..676052,
FT                   676082..676246,676372..677361,677401..>677515))
FT                   /db_xref="GI:71032424"
FT                   /db_xref="GeneID:3502532"
FT                   /locus_tag="TP01_0327"
FT                   /transcript_id="XM_760761.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(670767..673981,674139..676052,
FT                   676082..676246,676372..677361,677401..677515))
FT                   /locus_tag="TP01_0327"
FT                   /gene_family="HOG000135752" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032425"
FT                   /db_xref="GeneID:3502532"
FT                   /translation="MRYNLHKLDFLSNSQHFNVIALLYTFFKIYSPFVLIILALIYHVF
FT                   SCFPKLPQHFLDRMPKSDSDYEPLADKEEMNEPDNKVPVTAPLPFFSLSNLPKFNNGEQ
FT                   DFSYDPDEAKKKVNLRPSAPISLFGSQGGVMNGFFSAPQGIHMHTPGAFQQNKIKNSAG
FT                   VGKGKVCDGGSNNVSDVGSAIEDGTMEMFRYDPQPIHGSKKESLTDSKLIQPHRILPMF
FT                   PFVPSISEEGLGKDFSRGKEHSRDFTKRDLKHIKHSLSRKTSEVHESFKGVTASAEIRE
FT                   ICQVKLWKKMIEKNKSLFKFPGNLKHRTSLQIPQQPKTDPAHLEELADAQRTDGKLESE
FT                   KLEADKKVNKTIKDMEMAWAINRFYTLADEVVVDLDLFDADDELDTELKALRKSLRKLS
FT                   NQKITVYPYQLMNYPSKISNNTNKNLFWLIDDDSSDEQDQPDDNQADQSEPAAHQEEQS
FT                   KLNTQELNTQELNPQELNAQELNTQESDVKDDLDVKDSDLQDQLDVNDSDLNDELDVKD
FT                   LDLQDELNLSEEFDVGDDLNGEPEELGAEQLEPVRVDQKESSEKVDIIDELELELELEN
FT                   ELDDIENELERELTKETLSVTETAEPIMERRDEVSELFGELKEFNMPRQSLNLYDYNYR
FT                   WTKYRNELKHKLTLSDFLEFENCMKNSYGYTGVTADSDAQSSKSDKKSEDDPNIGLLLK
FT                   LYKVSKTNLKLLLHYKNPEVIAMVNSVIYDLNSSNIVYTSVSEDADSKVDLLLNVPYKD
FT                   EHSDSLVDRLNDKGDKDDSVLLTGKESDVRRQWRKRLQTMSKETRLALVNMGKSLKYIE
FT                   NAFMNIESSRTYDSMVEYCEVNTFFKNCDYLDILNHSFDAHYLSQGPHEIGKDDEILNK
FT                   RELIHTRVARNLVNILPLVGNKAKIHFARFHKLDFRTALLSLISGNRKKSHEDQKWHLK
FT                   WQAHPPVKSIINMNYKDDDMVDGLQNHCSNYFVNSTDLSLTDDTRVVLLEYVEQYPLLL
FT                   NNIGMTSRIDTYINTSSNKDNSDQNQKENVLGNVVYTNEYELFGVNHTLKTNEMQSIVD
FT                   NTLFKAPIFYTINEVERKKNLNAENKGDSEESQVEQENNQPPPVNNKVLYNNNDITGLG
FT                   MPMFDFIITRSTNNPANQSAGEQTSNEELLYIRELDNSVLCTVGQCEPKITINNPKSKN
FT                   YLEDNKLLLKAWVLKTAMINPMTDMKRLRKVARKKFYPVIPEKEITGVLKQVESTSIFS
FT                   MRPQALEKMIQATIKPEVVCSLESTRAQKFRIKSRGIRRLMSHEGISVVCSILQQQENH
FT                   FNSSMSQAFEKLKSLKKKYYTRLSTLNIDQNIVTSKLQQFNIPLNQYTLYGLSSPTSDT
FT                   IDKANIKVIDNTNNADKVNNLNNIDKVNPNSVNNPNSVNNVNNNMNNVNNSMNNGLSGI
FT                   SVRVSYIEKILKLSSWNIANDVRMVLKGNGQFSLYGLGDPSNCGLAINLLKRQIYTNIN
FT                   TNMGSNIYNISIIGNNYEDLRKLSMDELSKRLLMYGVSEAVIKTLPRWDQVALVRQYRD
FT                   GFGVVKNFDDSNKFRIPPNEYQSQLRQIILKQKSALVHANADYANVDYANVDYANVDYA
FT                   DDYTEEKVDRIDSSDLMNVNKSGMDSGGNDSVEKVDDIEKEKEELRLLKESINMKKNLD
FT                   LVIEDSNLIPVLGLMWLRQSRKTPSEPFGSERAVFIYGQENVTKVLRWRKKCAEKKTHI
FT                   PNETIFVSNVNNNFGKRICRNCGQSGHIASNPKCPLYSGDKLKHDPLSRQTRKEPEVDT
FT                   SDDDLLTKPIALMRDTESLFHTVNTSFDSDVEFPLEPSETKRKRTADTFDHIHRLKYST
FT                   DPNILSGVAGVNGDDSGVLSTSDIRIINKIIISIEKENRYKPFMNRISETIAPNYYKVI
FT                   QKPVWLSLIKLRVKNKYYTTVSSLMTDILLLEINCKLYNSEHSQNAWLRHMSQILVDDL
FT                   TARISSHIQNKQQSKLIQQIHTKHINSYRNSLNTQNINNVNVNGVNMPNNVNVNGVNMV
FT                   NNVNVNGVNMVNNVNVNGVNMVNNVNVNGVSINTEGSSFNTQNTNFNTGDSFNTQQTSF
FT                   NTQEVSLDTQQTDLNTQQTDLNTQDTNFNTQEVNLDTQNTDLNTQDVNLNTEEMSLNTQ
FT                   QTDLNTEETSLNTREMNKISGN"
FT                   /protein_id="XP_765854.1"
FT   gene            complement(677448..678926)
FT                   /db_xref="GeneID:3502533"
FT                   /locus_tag="TP01_0329"
FT   mRNA            complement(join(677448..677898,678076..678163,
FT                   678239..678444,678522..678926))
FT                   /db_xref="GI:71032426"
FT                   /db_xref="GeneID:3502533"
FT                   /locus_tag="TP01_0329"
FT                   /transcript_id="XM_760762.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(677787..677898,678076..678163,
FT                   678239..678444,678522..678874))
FT                   /locus_tag="TP01_0329"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032427"
FT                   /db_xref="GeneID:3502533"
FT                   /translation="MKIILKLVYSCVFVFFKTLSTSFGVESSLSSKRLSFTLNSRKLHT
FT                   ENIENKEYLSSKTRFFSKLGNFDDSKFGQISESANLNKVFKEDKVTITNKQKEIDVDCL
FT                   MLFKAAKCYKQELEVDDFMLDIFIEDEKNMKRINFKQLGGDGPTDIISIRDDLLYLRSD
FT                   FHKNRSPQKPSQHYHLGEIFLCPGFIKGVIDSENKLGLKTPEKFEKSLNVGKRYDHEKE
FT                   EWFNKMAGMEDVLLDAFIDILPIDNPGVGP"
FT                   /protein_id="XP_765855.1"
FT   gene            <678732..>679146
FT                   /db_xref="GeneID:3502534"
FT                   /locus_tag="TP01_0328"
FT   mRNA            join(<678732..678855,678938..>679146)
FT                   /db_xref="GI:71032428"
FT                   /db_xref="GeneID:3502534"
FT                   /locus_tag="TP01_0328"
FT                   /transcript_id="XM_760763.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(678732..678855,678938..679146)
FT                   /locus_tag="TP01_0328"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032429"
FT                   /db_xref="GeneID:3502534"
FT                   /translation="MFSVCNFLELRVKLSLLLEREDSTPKLVDNVLKNTNTQEYTNYTS
FT                   NNKMALGRKSYIPESANSDLEIMIKIPDTTIAKNPNPTTLAITKVTNLYKLFHHLYCIH
FT                   LTVSIT"
FT                   /protein_id="XP_765856.1"
FT   gene            complement(<679218..680356)
FT                   /db_xref="GeneID:3502535"
FT                   /locus_tag="TP01_0330"
FT   mRNA            complement(join(<679218..679265,679296..679450,
FT                   679519..679679,679760..679826,679858..679896,
FT                   679927..680088,680184..680356))
FT                   /db_xref="GI:71032430"
FT                   /db_xref="GeneID:3502535"
FT                   /locus_tag="TP01_0330"
FT                   /transcript_id="XM_760764.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(679218..679265,679296..679450,
FT                   679519..679679,679760..679826,679858..679896,
FT                   679927..680088,680184..680313))
FT                   /locus_tag="TP01_0330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032431"
FT                   /db_xref="GeneID:3502535"
FT                   /translation="MEILLKIFKILYFSIFFSTLSPLVKYGISKHTNTVMLELGSLPDM
FT                   DQMLPNEESPSLSDYSEPLVAKKTTLENFPNPFMNPIECNRVNVQESYVCDPDKVLNNS
FT                   EADRLDELLSLERLNSIHHCEGFGDVPYKIGVALINRIPREDLSTLADELLDRWKLSHQ
FT                   KCEDGIIIVYTKQDPDVVIKWNKGVEPYLSTKVVSSIYPMCQNLLQNEKLAIAVEKCKI
FT                   FYLIISSVLGTSFVTKRVTGEILPPKETPQM"
FT                   /protein_id="XP_765857.1"
FT   gene            complement(<680440..>681673)
FT                   /db_xref="GeneID:3503598"
FT                   /locus_tag="TP01_0331"
FT   mRNA            complement(join(<680440..680577,680667..680964,
FT                   681030..>681673))
FT                   /db_xref="GI:71032432"
FT                   /db_xref="GeneID:3503598"
FT                   /locus_tag="TP01_0331"
FT                   /transcript_id="XM_760765.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(680440..680577,680667..680964,
FT                   681030..681673))
FT                   /locus_tag="TP01_0331"
FT                   /gene_family="HOG000135751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032433"
FT                   /db_xref="GeneID:3503598"
FT                   /translation="MMDLNSRKNSSESQSADSENEKALVVDTGAYCRSTYLDKSGCKIY
FT                   VTSGIKSEIEKYRQKNPLESSIRTVYTPIVREPSPEDVSFVRNFASLTGDLPFLSNNDI
FT                   GCIALTRRLQIETGDLSCLREAPMTLKIDKQTNNSKNKSKKDLNHIGFDCWIGSHNVNS
FT                   YNIQVKKSASKTVSCMTTDFAMQNVLIQMGLNVITLDGFVAKSIRRWGQMCRACYEVYP
FT                   NTCRQFCSKCGNATVERVPITVDSETSEIIARDTRKWINTRGTIYTQPKPATGRTDKPY
FT                   ITAEDQLLMPAFKNYMRNINRKNKDDPLSHFYAEDTKENNISSTTAVSSFTNVTVGLGR
FT                   GNPNSNRWIQRHKRSLKSK"
FT                   /protein_id="XP_765858.1"
FT   gene            <682018..>682790
FT                   /db_xref="GeneID:3503599"
FT                   /locus_tag="TP01_0332"
FT   mRNA            join(<682018..682071,682111..682208,682244..682343,
FT                   682439..682621,682677..>682790)
FT                   /db_xref="GI:71032434"
FT                   /db_xref="GeneID:3503599"
FT                   /locus_tag="TP01_0332"
FT                   /transcript_id="XM_760766.1"
FT                   /product="Bet3 transport protein"
FT   CDS_pept        join(682018..682071,682111..682208,682244..682343,
FT                   682439..682621,682677..682790)
FT                   /locus_tag="TP01_0332"
FT                   /gene_family="HOG000186184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Bet3 transport protein"
FT                   /db_xref="GI:71032435"
FT                   /db_xref="GeneID:3503599"
FT                   /translation="MDNYSKLGANAFAKMEKVNSELFCLTYGSMISQLVRDKEHSDAVN
FT                   EHLILMGKNIGSKLVDELLAKLGCVPCTDFRSTVEVIAKVGFKMFLGISGNVVEVDQEN
FT                   KVYNITFQENPLDQFVELPETLKDLNYSNIFCGVIIGALDQLQMKVQCYFVKDMLKGDD
FT                   VYEITIKLEEVFYHWFMYL"
FT                   /protein_id="XP_765859.1"
FT   gene            complement(<682902..>683880)
FT                   /db_xref="GeneID:3503600"
FT                   /locus_tag="TP01_0333"
FT   mRNA            complement(join(<682902..683270,683537..683731,
FT                   683764..>683880))
FT                   /db_xref="GI:71032436"
FT                   /db_xref="GeneID:3503600"
FT                   /locus_tag="TP01_0333"
FT                   /transcript_id="XM_760767.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(682902..683270,683537..683731,
FT                   683764..683880))
FT                   /locus_tag="TP01_0333"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   cell adhesion molecule activity [goid 0005194];
FT                   go_function: transcription factor activity [goid 0003700];
FT                   go_function: structural molecule activity [goid 0005198];
FT                   go_process: cell adhesion [goid 0007155]; go_process:
FT                   regulation of transcription, DNA-dependent [goid 0006355]"
FT                   /db_xref="GI:71032437"
FT                   /db_xref="GeneID:3503600"
FT                   /translation="MSVKSEVSVNERIYDICFKACGNTPPSDDATRNDFDAISCLNECK
FT                   AGIINLVMKKIYEPNESNKLKPAYTSPGRKNLKRFKKRLNKIGKPFKNALQRKEKEYDL
FT                   DIMDKSLRSINESLPPENRGLFLSFLGNIFKPIIRGISNLVAPPDPPPPPPPPPPPPPP
FT                   PPAQVVPPVEIAKVEVKNTEIQPEKPKEPEKPKEREKPKEPEKTEEPQDEEEDDGEDEE
FT                   EVEE"
FT                   /protein_id="XP_765860.1"
FT   gene            complement(<684125..>685369)
FT                   /db_xref="GeneID:3503601"
FT                   /locus_tag="TP01_0334"
FT   mRNA            complement(<684125..>685369)
FT                   /db_xref="GI:71032438"
FT                   /db_xref="GeneID:3503601"
FT                   /locus_tag="TP01_0334"
FT                   /transcript_id="XM_760768.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(684125..685369)
FT                   /locus_tag="TP01_0334"
FT                   /gene_family="HOG000135750" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032439"
FT                   /db_xref="GeneID:3503601"
FT                   /translation="MAFIKRVILLAIVSKLVSEFFITGNTTFAAYADPTADDSLSKAIP
FT                   DTTLPGGSGHEVDFTSETLMVPKRPLVKVETTVGPPFEPNPVLVKKLTDSVGPKGNVKL
FT                   ESIKEEDVIRIPGGKSPIESKKKSVVTVSKDMPSTSSGNNKKKKVTFSDETKVIEPLTR
FT                   GNFTTFGYTPYDDYTPDTKAEKIYRGGMVSVSDDESDDEEDAGPEPIHTPASYDGMHYV
FT                   KPYDLPKSNESNLEKLRKNARNTLSKAGKTLEKVADRTKVSTMRVVNEFRNKTSKSKAP
FT                   VEPELSSTTSNPTGLSSRYALSSSQFRGKLRNSSRDILSKQAQILKNIGGMTRQGVYRL
FT                   NAHLKTNSAVARKSCNSKFNLVKEKIKECGRKGSKPCKLRKDEGTEAPKVKGSMTMYFK
FT                   DQYGRLLSEDEIKYL"
FT                   /protein_id="XP_765861.1"
FT   gene            685875..>688003
FT                   /db_xref="GeneID:3503602"
FT                   /locus_tag="TP01_0335"
FT   mRNA            join(685875..686196,686227..686305,686398..686509,
FT                   686552..686689,686764..687017,687091..687403,
FT                   687516..687701,687733..>688003)
FT                   /db_xref="GI:71032440"
FT                   /db_xref="GeneID:3503602"
FT                   /locus_tag="TP01_0335"
FT                   /transcript_id="XM_760769.1"
FT                   /product="eukaryotic translation initiation factor 2 gamma
FT                   subunit"
FT   CDS_pept        join(686161..686196,686227..686305,686398..686509,
FT                   686552..686689,686764..687017,687091..687403,
FT                   687516..687701,687733..688003)
FT                   /locus_tag="TP01_0335"
FT                   /gene_family="HOG000229292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic translation initiation factor 2 gamma
FT                   subunit"
FT                   /note="go_function: GTP binding [goid 0005525];
FT                   go_function: protein-synthesizing GTPase activity [goid
FT                   0008547]; go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032441"
FT                   /db_xref="GeneID:3503602"
FT                   /translation="MTTNAEDHLLKQDLSTLDVTKLTSLTPEVISRQATINIGTIGHVA
FT                   HGKSTVVKALSGVHTVRFKHEKERNITIKLGYANAKIYKCTNPEHEPPSCYKSYGSSKI
FT                   DDPLCEKPGCGHKMELKRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQ
FT                   TSEHLAAVEIMRLKNILILQNKVELIKESQALLRQQEIKKFISGTAADGAPIIPISAVL
FT                   NYNIDVISEYLVTQIAVPKRNFTVPPQMIIIRSFDVNKPGEEIENLQGGVAGGSILYGV
FT                   LKVNDEIEVRPGIISKDQNGQITCTSIKSRVISLFAEQNNLQYAIPGGLIGVGTTMDPT
FT                   LTRADRLVGQVIGYINTLPDCFIEIEVTYYLLRRLLGIKVTDNDKNVKVSKLKKNEFLM
FT                   VNIGSTSVGGRVTGIKPDMAKFELTGPVCTRIGDKVAISRRVDKHWRLIGWGQINKGKS
FT                   LQLI"
FT                   /protein_id="XP_765862.1"
FT   gene            complement(<688387..>700281)
FT                   /db_xref="GeneID:3503603"
FT                   /locus_tag="TP01_0336"
FT   mRNA            complement(join(<688387..697844,697902..>700281))
FT                   /db_xref="GI:71032442"
FT                   /db_xref="GeneID:3503603"
FT                   /locus_tag="TP01_0336"
FT                   /transcript_id="XM_760770.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(688387..697844,697902..700281))
FT                   /locus_tag="TP01_0336"
FT                   /gene_family="HOG000135749" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032443"
FT                   /db_xref="GeneID:3503603"
FT                   /translation="MRTRHIYRYLYLYLILTYIQNFICSIDPLTPTTPTSGENETKSST
FT                   SDPSRQSGHGVFTFVDDSEDSETTQVAQEATESSTTVEYSQKSLSEDTSQDSQDNSHPE
FT                   PSQPEVSKHPISLDISQSDSADEYDCDKDNDVVTYTPKEGYVLNKIVKSSGKGSGDIWS
FT                   PDSETDYPTKVVTFLSGSDVISLTIYLSDDKIKRLFYFNGAWSPTTEVVLDVKKTDNTN
FT                   EYDCVKDNKIATYTLKDGYVSNKIIKSRTLGSDEIVWESETSFATKVVAFPSGSDVNNV
FT                   TIYLYDGEVQRFIYSDKKWIASTETTIDIKKTESTVDYECVTENNVVTYTSKGIVVFDK
FT                   IIKSSGKGSGDIWRAEADYATKVVTCLSGSDVTNVCIHLRNGEIVRLVNSDKTWIPSTE
FT                   MVLDIKKTDSTNEFVCVKTPSLVTYTAKEGFGFNKIKHDNDDVWEDEDEYCIKVECKVI
FT                   VKDISDVIIHQSDGDIERFIYSDKTWIPPTEIVLDIKKTDKTYHYNCVKTDNLVTYTAN
FT                   EGYGFNKIKHDKDYIWESGEEFCTKVECKIVGSDIAGVTIHLPGGAIERFIYFNGRWSA
FT                   PTEMVLDIKKTQSTVGYECVSGNNVVTYTAKKDYGFIKITRDKELVWEYDDSEQYCVKV
FT                   ELTPVSNFTNSSIHLNNGEIVKLVYSDKRWVSSAEIVLDIKNTDGTSEYDCIRVDTLIT
FT                   YTPKNGHEFGKIKHGNHDIWESGNEYPTLVRLKENADKKYMVLLFGSKKYQLLYSDGKS
FT                   EVWSDISYYRHNISNLKMFKRDRTELDSNTYKLELIELFYVYRYDDDDDFQPLKGVYVH
FT                   LVRNNLYIMNKGGKTKNLNVQQPDTSDKPKPDPSIKYYKPLKLDFGGLIGETDTYEIAG
FT                   SFGMSSFNSSKNHAFTKVSYSGKVVWEAKKSKQYAKTVITDGNHAAKIPYTFFTVVLLD
FT                   DTRMNYTKSGNEWVRTFVKSSSSDRQEPATPTKEASPESGKTEPTVSEVSKAKTEDDDK
FT                   ESFNPDVVKLFTMDSSENLVELSKSKYQTSKDRDECIYDLEKDAKCHSIKYQDKTVWEL
FT                   ESGSQNYPLYVTLRVDQNKFVVTFEDKFVTCTLEDGEWKGKVHSLKQGEALPESKEMTE
FT                   VNTTVLDLNDLQNTETYTYSKTDNVLTFTPKNSGVFSGVIRTTGESKVTWTVIWQIQGS
FT                   FELANSISFEDFGKGKQVLILDTRSGQKMLYKPNDGGFWKEVSEQPQNAFETTAALLAE
FT                   EDKVDMIEIDIKDTDGKGYDYLEENTKIERPRGPIARKSRPTKRPTRLNIFKKPRRIKI
FT                   YRPETNKYKNYSAKEGKGIRKVKDSDDAEDEEEEDDDDDDDDEDEDEDKEDLNDGFIWF
FT                   SPVRSQYATHVSFKDTVNRYLAILLKTGNPLIYNQSEDDEDWKEITAEVRGDFFKLSLF
FT                   HKDEDNKYRVFKSDQYTPSLLNLSYVFTFDKDVDCHKINYDGKTVWSYEVDKEFGSLKQ
FT                   VHFGLITQDLFIVNVNDVKKAIDKEKAVAGLDDSTQTEEAKEETETEKTEDTEGTKQKP
FT                   ETEQVQEQKQETPQKEPEKQLNFVQLDLSKTTTSNHIKYRRKNEFATFRAKPGCLFNKV
FT                   IKSASTGFSKEEVFWEAQEGSEKYVKMVRMKLTDNHSAFILNTGELILFHKPVNKDSWE
FT                   DITPTRNNFSGFKFLTFDQDICEYKELNSSGYTLGLNEFSYGVSFNVQCHLIKHENKLI
FT                   YNYETDQEFGTLKGLYLGLVSNKFFLTNLENDNKTLDLTKEVSPPKYKKQKATELKPDK
FT                   SVDQASSVDNIEVEELPELDSTVNIPSASLMTLNIESSDNTAKYQCSDNGIYKTFTARH
FT                   GNGFNEVKIGTKTFWKSHNNDYGIKVRLKESSTHEKYVVILLASKNYLVFHSPSKDKPL
FT                   IDYTDTNHSFYDIKLFSKDSNSSVYKQLDTFTYNVSLYHLSLGYSLKESVKCYLIKFGD
FT                   IVVYKYDDHRDFGYIKGVYHDIMRSNLYILNRDEQIKVLRELDRGKTVTIDMNKTESTD
FT                   EFECFKEKDRVIFTPTGTGVFDKLVRSSRLGADVVIWRANDVQEYSKKIVIIDVQTRKG
FT                   KTKNVALYLCSGDIKHLAYSDGKWIETPNKVSLYIKKTNSTDEFEFSKDKEFKTFQARH
FT                   VYLFNKIVDSASSDPSQEVVFEPPNPAYYSTKVVFKDSPNKQYLALLRTDDNFLLLNKP
FT                   DRDKPWQDVTLNRLNLSDLKMFYYDVDTSGYRLLKDNQYSKSLVNFFYWYEFNLLANCH
FT                   LIKFKSYIVWNHDSDPNFQFLKGVCLDLYNNHLFVVNNNDVSKKITPPNSTTPPDLVDY
FT                   EEEDSTTPDTSTEKQTPESLKSSESTESSEQPSTQHTLVELDLTKTETTRDYEYEKKDD
FT                   NYVFTAKSGVRFSKVKKGEHDLKESLRPSSPKVVANYGQAGKIMLYVYSNDKDFELHIV
FT                   NDPEPSSHDITALPSGSVTVQSQSSVFSEHLKLLALGDDGKSMELDDSKLKVEDLTHLV
FT                   NYTFEPDTKCSEIKYNNKTVWEYDKSRHGRYYPSNILLNTSTNFLLLESQGHYQYYFTY
FT                   YNDEWRCISGYKTQDLQPLYPDKLRIFTLNKFGTPVMDDATNFDKSSEGPLTTLKFKPE
FT                   SRCIDVKYEGDSIWSYNYKEHEDNYPTSLSVNTDEKVVIVDCAGIYRHGLSFSAGKFTP
FT                   FFSYKSNLTEPIDPAKLKMSTTDSNGNTVELEESKYLIEQPDTVYKFNPGVKCTCVKYG
FT                   ETEVWKHSESDHKDKFPTSISFNNLIRKYLVVESSGDYRNLLEFENNVWKPLGANDKLK
FT                   SQYSIYDKFDADKLTFFTIETKETSDGTVTSELVQIDYTKYTRENPSFASYKFKSGSLC
FT                   TEITYDSVPVWKYNENEHGDEFPTTVLLNIKKSYIVVESSYLYRYVYSYYDKKWKELPF
FT                   GFKTSNVSFDKFKLLTQDPKDYKKLVELDSSQYDIEYSPNVLAIKFNTNVKCTSIQYED
FT                   SFPWTYNRNEHAHRYPTAVIFNKSKSFLMVESSHYYRYLYVYQNKEWKPLPYGYTLKSH
FT                   SSSAITYDICKVKLFTYDKFNNNKRVEMTKAHYDKEESDTLVRYNMNYLTNCTCLMYDD
FT                   KVVWEHYDSEHGDKYPTTISLVKKKNYLVVESGYDYRYMFEFENGEWKLLPFSYKLKRK
FT                   VDAVEIDKFKLYSSDPSDPDQLVELKTTEYEKKDSYNSLVFTIKENVKCTFVKYDNTDA
FT                   WVHDSIEHAEFYPTRVVFTKNKNFLLVESGYNYRYLYTFHKGKWKQMPFGNKLKTTKAY
FT                   KFDANKLKLFSLDLSTRPYELDYSKFRRGEAGHILTHNLKPGVKCAEVRYDNISAWKHE
FT                   EDEYGSNYPTTIIFNRNNGFLIVESKDNYESYHSYYDNKWHSVYGYKASKLTKNKEFYR
FT                   LKLYETNEDGLSQPITGFHEEIIGPVITCNIFYGVKCTQVKYDELSVWSYDSDKNGNYY
FT                   PTSVVFNIANSTIKVECEDQYVHFSSFVNEEWKPFSGFRSKKTTGPSAVKLFKTGSSGN
FT                   YVLINSTKYNVNWDGENQVYEYDLSGVFCTLVKHDNNPVWTQRATDNQHPKSLTYNSDQ
FT                   KKFVLRFEREYIFCSFEDNEWKTTVRRYGTQLSKSEEQKAEQEEEESQEADEPTDPEKE
FT                   DKSDKSSEHSAPESKFDKASEHSDDRSSDSQSITSAGSTEQEKGKLTSKVKKAFSTGKK
FT                   EEKKHSGKTTETSEEPKKHSEKTTGSPQEPKQTSEQHDQSTEVSEPSQPYKVKGHKIPI
FT                   TLDISKLKSTSDYDYSSDADLKIFSAKDTHAFNKVQDSETVIWEAKDPTEYSLGVALKE
FT                   PTENEKDRYLSMIDSNANLSIFHKPDENKPWEDLSSTRHKISDVKLLKEDDSEFEDSDY
FT                   QLFLSYFSLGYEFVDDAECSKIEYNNEIIYNYKDDTAPGYPKVLYLELTKNNFYLSFAN
FT                   NKIKKLNVKQPKKAQSPSKPKEAKTAEPGPSATSPPDSTTSSESKPKDTQSEDSQLRGS
FT                   TQELME"
FT                   /protein_id="XP_765863.1"
FT   gene            <702403..>702990
FT                   /db_xref="GeneID:3502947"
FT                   /locus_tag="TP01_0337"
FT   mRNA            join(<702403..702615,702655..>702990)
FT                   /db_xref="GI:71032444"
FT                   /db_xref="GeneID:3502947"
FT                   /locus_tag="TP01_0337"
FT                   /transcript_id="XM_760771.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(702403..702615,702655..702990)
FT                   /locus_tag="TP01_0337"
FT                   /gene_family="HOG000135747" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032445"
FT                   /db_xref="GeneID:3502947"
FT                   /translation="MGLTIYSQYEFDVNNNIISHKLDICKYNKLNNTNDENKIANNIKD
FT                   RKIKKCAKGSRNVKLHLILIKKYNSYLNNKLKSSKDLDTKQPSYNGIPGKNNRISATEQ
FT                   GNKSINGKVIKKPDVTQYVDDIMKTVETKGVCDLDQIFPKGGTKLLTSQYFLNLLILLN
FT                   ENKLQLTLINNQIKLSLIS"
FT                   /protein_id="XP_765864.1"
FT   gene            complement(703008..703730)
FT                   /db_xref="GeneID:3502948"
FT                   /locus_tag="TP01_0338"
FT   mRNA            complement(703008..703730)
FT                   /db_xref="GI:71032446"
FT                   /db_xref="GeneID:3502948"
FT                   /locus_tag="TP01_0338"
FT                   /transcript_id="XM_760772.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(703127..703705)
FT                   /locus_tag="TP01_0338"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032447"
FT                   /db_xref="GeneID:3502948"
FT                   /translation="MFLLSNSLYRVLNLLLCQLYPAYKTFLFLYKSNNYYAASPNHPLT
FT                   NSGNTTTDTTPHTAREGSEGAGNEQVKTDGRLGERELCREAVSKESNLKCVYTAHHLLY
FT                   WAMYLTNSYFESLVPFMKRLPLYKEAKLVFFFWLGSDHFKGAGYLYHTYLQKLFLNVSD
FT                   YLMNFFNTHLDNATKENFKQFMNTYRYQT"
FT                   /protein_id="XP_765865.1"
FT   gene            complement(<703888..>704921)
FT                   /db_xref="GeneID:3502949"
FT                   /locus_tag="TP01_0339"
FT   mRNA            complement(join(<703888..703932,704313..704437,
FT                   704471..704619,704680..>704921))
FT                   /db_xref="GI:71032448"
FT                   /db_xref="GeneID:3502949"
FT                   /locus_tag="TP01_0339"
FT                   /transcript_id="XM_760773.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(703888..703932,704313..704437,
FT                   704471..704619,704680..704921))
FT                   /locus_tag="TP01_0339"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032449"
FT                   /db_xref="GeneID:3502949"
FT                   /translation="MSNKSQSFPNIYNVDNSSDEPNYDDYDPSKDFGNEIKPALSDLIS
FT                   KPTRRNDINRPMPHNADLYGSDLSDSTQDHVTVVFNWNYGGNEVYLVEYNEDENKNTRV
FT                   IKMIKSTNCFTTIQELPRKMFKYRYLVDNVYQYSPDDACVNTENGVINYIDITNFKSTD
FT                   YTIPRHHEQGKLQKLHVVVQMGQ"
FT                   /protein_id="XP_765866.1"
FT   gene            <705022..>705354
FT                   /db_xref="GeneID:3502950"
FT                   /locus_tag="TP01_0340"
FT   mRNA            join(<705022..705148,705227..>705354)
FT                   /db_xref="GI:71032450"
FT                   /db_xref="GeneID:3502950"
FT                   /locus_tag="TP01_0340"
FT                   /transcript_id="XM_760774.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(705022..705148,705227..705354)
FT                   /locus_tag="TP01_0340"
FT                   /gene_family="HOG000135746" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032451"
FT                   /db_xref="GeneID:3502950"
FT                   /translation="MENKKKIFIRGLSDDVDSNLLFSAFSQFGHITDLNIPKDKFTDKN
FT                   RGIAFIEYEDEEDAKHAIFNRHNSELYGRIIKVGYSHIN"
FT                   /protein_id="XP_765867.1"
FT   gene            complement(<705439..706520)
FT                   /db_xref="GeneID:3502951"
FT                   /locus_tag="TP01_0341"
FT   mRNA            complement(join(<705439..705448,705518..705631,
FT                   705675..705748,705804..705912,705945..706032,
FT                   706068..706279,706311..706398,706432..706520))
FT                   /db_xref="GI:71032452"
FT                   /db_xref="GeneID:3502951"
FT                   /locus_tag="TP01_0341"
FT                   /transcript_id="XM_760775.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(705439..705448,705518..705631,
FT                   705675..705748,705804..705912,705945..706032,
FT                   706068..706279,706311..706398,706432..706477))
FT                   /locus_tag="TP01_0341"
FT                   /gene_family="HOG000135745" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032453"
FT                   /db_xref="GeneID:3502951"
FT                   /translation="MNSDGYIPLDSDVTPESGDNQTNPHVIKSIFTAVLLHLIILVSYI
FT                   IKHIKDKTNKLFHIAIVLILYFLKLYTLRILNKSDPGVIPSHTGLSEYLETNVQAKLIN
FT                   VNGYDFLQKWCQKCKIYRPPRAKHCYICNRCIRRFDHHCYFLSNCIGHNNYKKFVFFIF
FT                   LIMVIKEYSFVLLFKIIQSLYSKKFSILHKDIYVFLFKNHFFLLIYTLYSLLCSLAFFY
FT                   MNALNKYLILKNLTTYEYTYKLNH"
FT                   /protein_id="XP_765868.1"
FT   gene            <706642..>711882
FT                   /db_xref="GeneID:3502952"
FT                   /locus_tag="TP01_0342"
FT   mRNA            <706642..>711882
FT                   /db_xref="GI:71032454"
FT                   /db_xref="GeneID:3502952"
FT                   /locus_tag="TP01_0342"
FT                   /transcript_id="XM_760776.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        706642..711882
FT                   /locus_tag="TP01_0342"
FT                   /gene_family="HOG000135744" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032455"
FT                   /db_xref="GeneID:3502952"
FT                   /translation="MYNSNDILNGEFNIQKCSHLTDKLESNTECNINNCNINRFNPRIS
FT                   VLYDILNNKCKLNKNWNFKVDLISYKSIDDINFLNNLNSFQSYLDTKYKKGKNVVENID
FT                   EIGDSNSVTLDDENEEILKYITYYFVEFVCEIERKLKIKNYKQKIVKLLLIIPNIKDYI
FT                   TNYVSDIVVQLPQNTLQIALYYNIYITLSLIIENNLGSLRLNTLSNTIINTYINNRKIH
FT                   LETDVFESAEDVVDFLCTGGSSNVVVNDGIVSKVDEVVLKCMNVILVNHLYSPETRVLI
FT                   VKLLKYFYNIIANNVLTNEHTTIVTCNFIYTLELLYDHFHISFYTILCNMSRDNSFKLV
FT                   KKVNYFNYLYIIKSILIFLSHSIKDLVDNEENLSLSPQLADDWIEILNNCYKIIISEVI
FT                   SDNNKYISNYILLQLIHLYLINVNKVALPYSESRSGDKYQFRKDLGEKLVKLYKLLLEN
FT                   DISDKKILNYLITTIKRIDINFDIGTISVVKESVSLEKVYDYYNKLENGSVKYTILVHN
FT                   GLKYIMYNTNTNDVIRPKVSLGHVLCKGVPFVSENKIDYKMITSDKLTMMEKLVVNTND
FT                   KLINLIPNYINVLIYINQIKTSETVNDSSSIESGVNGDQYKEVYAISKVLNKYDVSKVL
FT                   ENVESPELIQLKDLNFLLTILINNLKNITISTKTRSHCKLKPKLYSIPELSTSLLITGR
FT                   GTVDEIEVIVNDKYKLDKKTFYYNLYYNNINIVMNIIRFISNHKKFHEVFVLKFLLTHA
FT                   LDNINLCNHNYFIYLINNIISNIITRMALGGGNTKNNKITGSEDNEVSEQSLIREILVL
FT                   LYNKANNDIVVNILHNFIVKLHENLEARRLVRTQPLFSCLLHKLYTLFKEVSVDDKLLL
FT                   FNTTLKLQNLIEAIGGERFNDRDHEPDKEHHSVVLLNYIKENITLLNSVNTSKYEVNVY
FT                   YILLYLNLSGNYNNPRRNRMVNVILFDYLKRTLDVEVRAAIDDIRTDDILETILTIIRH
FT                   YYEKLNYYINNNVNILAIFNLLYHYIESSDNCGNENEVLVQTYRYLVCIMNKVINKYIS
FT                   YNNNMLFLDCRGYYIENSIERNGDGGKDTGDDEAKLKNYLIYKLMFEVIGLIRILVGKL
FT                   DVDLHRFNLLVINYIINIRNISIIDKFNNLLSITLNKFVNSSAGVSDYNSVIKVNNTVN
FT                   EVESGCESEDGVRLDEANKLFKDFINSFIVKHFSNSDVKSSKNGIDGFVKPKITVNCTA
FT                   ENKKLMFYIHYIINILLNNDYINIKVNDTISGDRKGNFDFDFEEFEVAVSEMDINIRCE
FT                   YISMIFMTIIKTINSKNAGNKVMMINNIISLLLEVINDVNFNVVINILRYIYRCVHSKY
FT                   INSTTLTNTIHSIKSIYDNSDSRFTINWKLNNSILLLLSTIISCHTLNTNGPISPNSFN
FT                   DKDVSKLDNHVNGNDSVNKLNIDRDVTDTILRLIKKYKNKYVILFIYYFHQINVILENN
FT                   KKDNSCAGLSSHETRVVGSVIKYCINNKLLSNDKLYVLVFKYCYRTRHKLLNYLLNDVK
FT                   DNYNEMIFYVKFHLIQILFPDQVNYDGRCDIPPDSLLIINIILLKLLNDWDIKIRNEVK
FT                   EKIKKAYIQGNEDEVINEEVYSYEYIILSDLHEYSKTLFYSISEYFISFYNTFIRSKLS
FT                   SNKGSISDETNDLSVIYEVEDEDDGGLNIIKNILLIIRNKEKNQRLINDLINKLYTYTS
FT                   CNSLKNTGEVLMNSCGNEDFINEFRVGNIILYALQHIRDDITGEIIINL"
FT                   /protein_id="XP_765869.1"
FT   gene            712064..>713469
FT                   /db_xref="GeneID:3502953"
FT                   /locus_tag="TP01_0343"
FT   mRNA            join(712064..712359,712397..712518,712620..712684,
FT                   712750..712852,712915..712983,713016..713117,
FT                   713167..713247,713278..>713469)
FT                   /db_xref="GI:71032456"
FT                   /db_xref="GeneID:3502953"
FT                   /locus_tag="TP01_0343"
FT                   /transcript_id="XM_760777.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(712086..712359,712397..712518,712620..712684,
FT                   712750..712852,712915..712983,713016..713117,
FT                   713167..713247,713278..713469)
FT                   /locus_tag="TP01_0343"
FT                   /gene_family="HOG000135743" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: DNA binding [goid 0003677];
FT                   go_function: N-methyltransferase activity [goid 0008170];
FT                   go_process: DNA methylation [goid 0006306]"
FT                   /db_xref="GI:71032457"
FT                   /db_xref="GeneID:3502953"
FT                   /translation="MLIILYTLSSLAHCFIISNITKTIPFYRSNSRLNVFIDADDNDEF
FT                   FDHDEVIEEKPPKFMKNKLNHAQKLHISRPINKSVKTRYKLQQFPKKQGVTKDGAYKFC
FT                   SNLRICGGSIRGRKLCIPPIYVRPAMAKVKISVFNYLNSLSMFSIDKETNVIDLYCGTG
FT                   SLGLESLSYGASKCTFVDTSLKCLKAVSLNSEKCNYEDKCRLIRCDSMELISSPHLYNI
FT                   NEKFDLMFVSPPYEEVVYSEILEYISNCNILNKDAIVIVEYPKELLALAHTINDKLFGL
FT                   KNKKYGRTVIAIYVYNPSSNKQPLIAKAVEEFSTDPKKKKRVAVEDNVLVMYNT"
FT                   /protein_id="XP_765870.1"
FT   gene            complement(<713490..>715631)
FT                   /db_xref="GeneID:3503526"
FT                   /locus_tag="TP01_0344"
FT   mRNA            complement(join(<713490..714031,714093..714305,
FT                   714362..714533,714568..714678,714713..715008,
FT                   715062..715182,715216..715334,715369..715504,
FT                   715554..>715631))
FT                   /db_xref="GI:71032458"
FT                   /db_xref="GeneID:3503526"
FT                   /locus_tag="TP01_0344"
FT                   /transcript_id="XM_760778.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(713490..714031,714093..714305,
FT                   714362..714533,714568..714678,714713..715008,
FT                   715062..715182,715216..715334,715369..715504,
FT                   715554..715631))
FT                   /locus_tag="TP01_0344"
FT                   /gene_family="HOG000135742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032459"
FT                   /db_xref="GeneID:3503526"
FT                   /translation="MVNKPTFTIIIVTSVVDHHTTYNIFSSDSEIELENHVDLIKDGEA
FT                   VVESVCMSCRRNGTTRILATKIPHFNDILVMSFECSFCNNKNNEILNIAKLQNHGVSYN
FT                   IHVNNLEGLNNQIVITNTSAVKLSNENFHIILVVISYITSIYSKFIQFELEFEIPKLDR
FT                   KGIVTTIEGLLTNIINNLSDHISSFDNTTPDNTNSVTDVNLNNKEFSKSLNDVVSVKVD
FT                   ENVYKLDEYVQKLEEIKDKLISYSKGFQSFTLFIDDPSGNSYVENDNNKLELSINKYER
FT                   TNEQLQQMGYLSQPDEQDSPSCPDGPDNSNEPDQSEDEDGLNDFFLVNCTNCGYKGKNQ
FT                   ICQIVIPGFDKCIIMSFVCDNCDYKTNELKPGGGVKKYGKVWHLKINSIDDIKRDIILS
FT                   NTCDITINELELFISAGSLSSLFTTIEGLINKIIENLQSTFPFLIGDSSPYNKDETSIT
FT                   NGDGESTPLVNGMYIDKSKIRSLISKLRDVIDDRNGSKDEINIAFNDPLDNTFIFTYTC
FT                   TNSQTTSEGIPDNNLDNIISKYNSTNEDTNCAVENSEESDNLNMGKPVLLDEKIIVDDN
FT                   LYYISYNRTDEQNEELGLI"
FT                   /protein_id="XP_765871.1"
FT   gene            <715681..>716948
FT                   /db_xref="GeneID:3503527"
FT                   /locus_tag="TP01_0345"
FT   mRNA            join(<715681..716894,716945..>716948)
FT                   /db_xref="GI:71032460"
FT                   /db_xref="GeneID:3503527"
FT                   /locus_tag="TP01_0345"
FT                   /transcript_id="XM_760779.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(715681..716894,716945..716948)
FT                   /locus_tag="TP01_0345"
FT                   /gene_family="HOG000135741" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676]"
FT                   /db_xref="GI:71032461"
FT                   /db_xref="GeneID:3503527"
FT                   /translation="MDVEYVSDNVNNNEDDEICPLCMELLDETDRNLFPCNCGYQVCLW
FT                   CLHYIRNTMGNKCPACRQDYNESNFKYINTNSTTTTRSDKNNRKKKVEANINNGANTNN
FT                   STTTTTNGVSVNNNTADKNSTQSPTTNTGVVDSNNVSIEVLKDIRVIQRNLVYVVGIPL
FT                   KLAKKEILKRYEYFGQYGKIQHIVVNKSNTYSNVNIPSYTAYITYSKKSEANYAIQCIN
FT                   TKQIDNKYLRASYGTTKYCSYFLKGLKCFNQDCYYLHKFTNSSEHYYKHGNNNNASLNN
FT                   KETDKDSTATAAKDANVKDTASTNNAEQHEAGPVVDNIFNVNIKYILNKYNNNNKLINI
FT                   VNVNHNKSLNSANNNVTNLYQWSFNNTNTPNTKLIGSGSNQPNYSLEHNTNSKDGSVDI
FT                   FNNNEL"
FT                   /protein_id="XP_765872.1"
FT   gene            complement(<717262..>718655)
FT                   /db_xref="GeneID:3503528"
FT                   /locus_tag="TP01_0346"
FT   mRNA            complement(join(<717262..717996,718029..>718655))
FT                   /db_xref="GI:71032462"
FT                   /db_xref="GeneID:3503528"
FT                   /locus_tag="TP01_0346"
FT                   /transcript_id="XM_760780.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(717262..717996,718029..718655))
FT                   /locus_tag="TP01_0346"
FT                   /gene_family="HOG000135740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032463"
FT                   /db_xref="GeneID:3503528"
FT                   /translation="MFNINCIKCVVYALSSNINHNIKLIYLNRLISVIINNRGKNRKGS
FT                   KNNHIMSVIIKELIKMISNNGSSNGEMCKVITDVLIYIHNTIGDKNIITNTLINELNGD
FT                   IKNLNHLLILLQNINKKNKTNVIVERIYILVLNNQTLLENLNNVKLIIFFILLTFNHLY
FT                   NGDEGVNNSLIQKLVNYNVNDREFYKNDENFHKFINFVLNLNDIPLINVVITIEILYIN
FT                   EDLKNYIKIGDKFLENLNYLSNDVVLYLLLYNISPNHHLMIDNVNRMLQHDLTKNQLIL
FT                   LYRFMNFIINNDLKVLNETFITNINMLLQKITDVKLLNLILLYTIKFKIDIIDPSILKC
FT                   VSGNNITVISLILLRKYEFEDDYFLEVINDLMRNDTFDVVNWSILLLLLINNSYYINTV
FT                   MFNIFLQHSISNESLKGDKRFNTFLSYLIDIKRWPLESVKDYVFENVLVPNLLN"
FT                   /protein_id="XP_765873.1"
FT   gene            complement(<718819..>720260)
FT                   /db_xref="GeneID:3503529"
FT                   /locus_tag="TP01_0347"
FT   mRNA            complement(join(<718819..719636,719701..719802,
FT                   719880..719985,720043..720065,720134..>720260))
FT                   /db_xref="GI:71032464"
FT                   /db_xref="GeneID:3503529"
FT                   /locus_tag="TP01_0347"
FT                   /transcript_id="XM_760781.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(718819..719636,719701..719802,
FT                   719880..719985,720043..720065,720134..720260))
FT                   /locus_tag="TP01_0347"
FT                   /gene_family="HOG000135739" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032465"
FT                   /db_xref="GeneID:3503529"
FT                   /translation="MCGLFQPTCQVRFTNVAIVRLKVKGERFEIACYKNKVFNWKSGIE
FT                   NDIEERCVNYSIGKLANNKQLLTAFNTTDINVIIKQILDKGEYQVSKEEREQLLKSIFN
FT                   DIITILHEITINPQTGNSLSRTMLENALKSSGFSISLNKSTKIQSLKALQTLQQKYPNL
FT                   IQRCKMKLKLNFQSSQYYQVLSFINNHNASNHLTDSSENFSASSESSSPQQRGGESADD
FT                   IIIESKNNDSMTVICFPNLYKNLENFIQNELDPPGNIQLVTLNIKQNVNNANLQRNLSS
FT                   ENSFENTNPFAEASPDTLTKLQMINMEQDKTELVTGESKDSNFTVPESSKGNKSISNGD
FT                   EKFKCKKCNVVLTSGEYKSHFKSNYHIFNLKRLLNNQTPITLDEYNMLVDN"
FT                   /protein_id="XP_765874.1"
FT   gene            <720485..>721228
FT                   /db_xref="GeneID:3503530"
FT                   /locus_tag="TP01_0348"
FT   mRNA            <720485..>721228
FT                   /db_xref="GI:71032466"
FT                   /db_xref="GeneID:3503530"
FT                   /locus_tag="TP01_0348"
FT                   /transcript_id="XM_760782.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        720485..721228
FT                   /locus_tag="TP01_0348"
FT                   /gene_family="HOG000135738" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032467"
FT                   /db_xref="GeneID:3503530"
FT                   /translation="MDNNINDITDELLCLPGYVRRNLLLIRDLDLKSTSLFNEANKLSQ
FT                   NLFNVENNKKVDAKTKKVVENHKSSAIANKALFDDIQNLRIKGIYYLQEKIDLNTQITT
FT                   MLKYEYENLKSKFDQLYSDMELKGQLPHDLKLFTNNKGRTFLYNNHLMTNGKENATDNN
FT                   AVDALGIENSFEGESFDHDHTLGVFDEVISMAESYMEKESDNGNPDDEEPLENGTLESV
FT                   REKVLSQLDITKMFNNVVNQQANKK"
FT                   /protein_id="XP_765875.1"
FT   gene            <721370..723167
FT                   /db_xref="GeneID:3503544"
FT                   /locus_tag="TP01_0349"
FT   mRNA            join(<721370..721852,721885..722139,722222..722533,
FT                   722572..723167)
FT                   /db_xref="GI:71032468"
FT                   /db_xref="GeneID:3503544"
FT                   /locus_tag="TP01_0349"
FT                   /transcript_id="XM_760783.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(721370..721852,721885..722139,722222..722533,
FT                   722572..723153)
FT                   /locus_tag="TP01_0349"
FT                   /gene_family="HOG000135736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032469"
FT                   /db_xref="GeneID:3503544"
FT                   /translation="MYNLIIRRFYTSIIAECGNITLKTMNNTLIKNIIKDNNLLNGLKS
FT                   EELVNVYYIINKHKFNLNNSLNKLLLTKLISTFQDMDTVNKLKLLNSLYLNNNSTLNIK
FT                   NTFNVNNVNSISKNLFNNDSTIDTSVLLENLKNKNNPREWRNLVIEYIKTYFLNHIEEL
FT                   SNIRYLCNFIFYISSTINNFTLSNYNFLIQRLNAFLQNSIKNYSNNIVGGVDVITVEGI
FT                   IQLLWSLQKNNIYHNQLLNNITQSFEEILNSGLSHVTLGHISLYCNSLLYFDKLDNHIL
FT                   DSVVSYINSNKLLDNVNDSDFVKLVNIVWCICINNSNNIESHIPTISNLLEKVNWDKFK
FT                   SLSSFKDLRKMNQVLTIVGDHLSSENCRLSPLPNDLINLITQSCSNNIDYKLNSKTQDK
FT                   FRRILQNLNISFKAEHVINNDIVVDFLLLNTTDSAEAVLADGGNAVFPDNELSQGNSNV
FT                   VIEIDGPYHYNILLDEEDCVHGDIIKYGNINLRLNGKTIYRNNILAKLGYKLISIPWFV
FT                   IHQYNNDNVYNYIKNVLKQYNINFKP"
FT                   /protein_id="XP_765876.1"
FT   gene            complement(723167..>724644)
FT                   /db_xref="GeneID:3503545"
FT                   /locus_tag="TP01_0350"
FT   mRNA            complement(join(723167..723486,723519..723631,
FT                   723673..723721,723762..723830,723859..724049,
FT                   724099..724262,724373..724418,724482..>724644))
FT                   /db_xref="GI:71032470"
FT                   /db_xref="GeneID:3503545"
FT                   /locus_tag="TP01_0350"
FT                   /transcript_id="XM_760784.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(723235..723486,723519..723631,
FT                   723673..723721,723762..723830,723859..724049,
FT                   724099..724262,724373..724418,724482..724644))
FT                   /locus_tag="TP01_0350"
FT                   /gene_family="HOG000135735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032471"
FT                   /db_xref="GeneID:3503545"
FT                   /translation="MFLFVFLILNFTHCTNNNSLNTNNTKRRVNETIDVSGYVKISDKL
FT                   YRATCNCPSHIKSLQDMIYRTNTLCRPSKIKVRTHNCDQVDKEIIDNFMYIPPNDFVYI
FT                   SEHHLSPMDSRNSSKSFFCPGGDLGMFMGVLMNIFKYNNNNNLLSESVVTDILKDYLMT
FT                   LSENVNFYYNIDETALNNMKSALNWDMIDLYNINFNYHDIVKKLLIENISDQYIKYLYE
FT                   LYDNKQIIIWSIYSFFNLLWDKSSEKLRINTYPAGPQNPSVFIKVDVNFGCEMAEVFPL
FT                   LDAPLKDKPLLIYSELPMIVKRNNLVKQIRDKFNLGIDDINLIYNNLYNVNFSLLNNFR
FT                   KSPAPITF"
FT                   /protein_id="XP_765877.1"
FT   gene            complement(<724723..>725187)
FT                   /db_xref="GeneID:3503546"
FT                   /locus_tag="TP01_0351"
FT   mRNA            complement(<724723..>725187)
FT                   /db_xref="GI:71032472"
FT                   /db_xref="GeneID:3503546"
FT                   /locus_tag="TP01_0351"
FT                   /transcript_id="XM_760785.1"
FT                   /product="40S ribosomal protein S18"
FT   CDS_pept        complement(724723..725187)
FT                   /locus_tag="TP01_0351"
FT                   /gene_family="HOG000039877" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S18"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_function: RNA binding [goid 0003723]; go_process:
FT                   protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032473"
FT                   /db_xref="GeneID:3503546"
FT                   /translation="MPISVTTSDQFQHILRVLNTNVDGREKVVIALTAIRGVGRRFATV
FT                   VCKEAGVDITKRAGELTQDEINKLVAIISSPAEFKVPHWFLNRQKDVKEGKHMHNASNL
FT                   LDSCLREDLERLKKMRLHRGLRHYWGLRTRGQHTKTTGRHGRTVGVAKKK"
FT                   /protein_id="XP_765878.1"
FT   gene            complement(725650..726545)
FT                   /db_xref="GeneID:3503547"
FT                   /locus_tag="TP01_0352"
FT   mRNA            complement(join(725650..725828,725908..726193,
FT                   726225..726545))
FT                   /db_xref="GI:71032474"
FT                   /db_xref="GeneID:3503547"
FT                   /locus_tag="TP01_0352"
FT                   /transcript_id="XM_760786.1"
FT                   /product="60S ribosomal protein L11a"
FT   CDS_pept        complement(join(725668..725828,725908..726193,
FT                   726225..726293))
FT                   /locus_tag="TP01_0352"
FT                   /gene_family="HOG000231312" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L11a"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032475"
FT                   /db_xref="GeneID:3503547"
FT                   /translation="MTEPNPMRDIRINKLVLNIGVGESGDRLTRAGKVLEQLTDQKPVF
FT                   SKCRFTIRSLGVRRNEKIACHVTVRGQKALDILERGLKVKEYELKKKNFSDTGNFGFGI
FT                   QEHIDLGLKYDPSTGIYGMDFYVQLVRPGYRVCKRRKCKTRVGKSHKVTKEEAMKWFQD
FT                   KFDGLIFN"
FT                   /protein_id="XP_765879.1"
FT   gene            complement(<726711..>728193)
FT                   /db_xref="GeneID:3503548"
FT                   /locus_tag="TP01_0353"
FT   mRNA            complement(join(<726711..727027,727135..727198,
FT                   727230..727387,727419..727590,727638..727705,
FT                   727773..727885,727945..728060,728125..>728193))
FT                   /db_xref="GI:71032476"
FT                   /db_xref="GeneID:3503548"
FT                   /locus_tag="TP01_0353"
FT                   /transcript_id="XM_760787.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(726711..727027,727135..727198,
FT                   727230..727387,727419..727590,727638..727705,
FT                   727773..727885,727945..728060,728125..728193))
FT                   /locus_tag="TP01_0353"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032477"
FT                   /db_xref="GeneID:3503548"
FT                   /translation="MSLFDEEIVTKNDLLGFDMPYGLVPRERYELWKLCGRISDPCAPF
FT                   SSQSLTTRMFVQRLFGHKYEITRDDFNYKIEYKMKFYTPGYGDIFFMDKIRCWKAYYLT
FT                   RDYQYGSEDLPTYTTMYPIARPEDNVPLSTVMLAVNAEINRQGVHPSLLDMLWDFFNKS
FT                   TSANSDSSDESNALDKVLNRDVVTYKLNWIIERLENRDEGEGISPDNFYRIFYEKAKEY
FT                   INNFDMDSFIRNQLKNLHIIDTHKMILMNNKALRTRNKILREAYNEDLKSLYAARIPRT
FT                   YKRYERTRLAGYYNMLNHMYEMRERRKVWVKPEKPKPEVPLTPEDKFFEKEFKKYALMD
FT                   KRKAQQKRREARRKKKKK"
FT                   /protein_id="XP_765880.1"
FT   gene            complement(<728264..>728985)
FT                   /db_xref="GeneID:3503549"
FT                   /locus_tag="TP01_0354"
FT   mRNA            complement(join(<728264..728777,728834..>728985))
FT                   /db_xref="GI:71032478"
FT                   /db_xref="GeneID:3503549"
FT                   /locus_tag="TP01_0354"
FT                   /transcript_id="XM_760788.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(728264..728777,728834..728985))
FT                   /locus_tag="TP01_0354"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032479"
FT                   /db_xref="GeneID:3503549"
FT                   /translation="MIHCINKCIIWFILLSSLIDFNIFCNFKLIYRINSTLISSNRSYF
FT                   KRIPISSSKQGTSDRIFYKQDIINKSYSFINNPVCLSHNEFVLYANKPKPTKKGTAPKP
FT                   KAGGKASSKGGGKSTQKAGGKGGGKGPGKGGTKAKASKASAKKSSPTKAELAMLRARSK
FT                   AKREKQRKEHIFGRAKVTLEQEDQEELEKEYRKRIAVTDTPSYTQKLSIDLILDVFYT"
FT                   /protein_id="XP_765881.1"
FT   gene            complement(<729267..>731189)
FT                   /db_xref="GeneID:3502891"
FT                   /locus_tag="TP01_0355"
FT   mRNA            complement(<729267..>731189)
FT                   /db_xref="GI:71032480"
FT                   /db_xref="GeneID:3502891"
FT                   /locus_tag="TP01_0355"
FT                   /transcript_id="XM_760789.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(729267..731189)
FT                   /locus_tag="TP01_0355"
FT                   /gene_family="HOG000135734" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032481"
FT                   /db_xref="GeneID:3502891"
FT                   /translation="MTESNLNSVPSRRSYKFEISASRESSNENTVHNNVQNNTNVARTG
FT                   SYYNAVAKYYTGMNRFLLLFLYCVTVVMCSSIYYNWSSLSRLLIRAGIYHWHCPKKSFI
FT                   AKLEGQIKCNKQFLKLANLLVLTRSVDMGVSALTGYIVDRFTLRYVMVGGGVSFFLAWI
FT                   CLGFNASHDSLIIIAFILFAISASCVMMATLNVMNLFWGHRALLICFTISFADDLSTFV
FT                   PVLLNWAFTITSADKSHIFFRYMSLSAIPLVLVGFFAMPLRSWNYYIKEYYTIYGRSIS
FT                   GLSRGSKLNKGTSSSSSRSHELNHTGGSSITHTSFESPYEGNMSSVEHLSNSRSLEQVV
FT                   TSGVNHKHVRRQLDETVLLDDRYEDHVTLLEHSDVEFEAPQRLRSIKVASTGSSCESNS
FT                   ISSFAMDSHTAVDTINVGDTILKRVANKATIRHIISVRFLLVLSCFTITNFTNIFMSNL
FT                   LLKNYSGRGKVLFTSEILLSLTCIPGFLLGVVFDYSVKYVNLFLNAVSMVAFGMLFTKN
FT                   MILGYVVALLHTIITSVDVTTLIVYVDLIFPIEYICTITGLAFSLDGLFLLCFTWLDTY
FT                   LLETETNFPIFFIFALLIIRMGLIIILHAIIDKDKSKKEDSQLSRQRSHTSTTSTPSSA
FT                   SMQVV"
FT                   /protein_id="XP_765882.1"
FT   gene            complement(<731773..>733761)
FT                   /db_xref="GeneID:3502892"
FT                   /locus_tag="TP01_0356"
FT   mRNA            complement(join(<731773..731961,732046..732218,
FT                   732288..732621,732688..732819,732883..>733761))
FT                   /db_xref="GI:71032482"
FT                   /db_xref="GeneID:3502892"
FT                   /locus_tag="TP01_0356"
FT                   /transcript_id="XM_760790.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(731773..731961,732046..732218,
FT                   732288..732621,732688..732819,732883..733761))
FT                   /locus_tag="TP01_0356"
FT                   /gene_family="HOG000135733" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: actin filament [goid 0005884];
FT                   go_function: structural constituent of cytoskeleton [goid
FT                   0005200]; go_function: microfilament motor activity [goid
FT                   0000146]; go_process: cytoskeleton organization and
FT                   biogenesis [goid 0007010]"
FT                   /db_xref="GI:71032483"
FT                   /db_xref="GeneID:3502892"
FT                   /translation="MDSSAYATLPRVVLENGSGYVKIGMAGNRKPPHVIPNCIGQPKKK
FT                   ASSYYIETHSSANSDEKDRSQSHSVSESSGFVSDSCYTLIEYFCNRPQINSLVYDPDRQ
FT                   RMVWDKYIGRSHLTKKDGLISPGNYLSVIPESTSICLTEANLCPAQSRQLSAEIIFEDF
FT                   GFPLACFLSSQTASAYFYQNFTPSRAKSDPVLYSYPDSVTLTSRSSPNNSQTSKQEHDQ
FT                   RNNFKDMNLSCCLVVDCGFGSTHAVPFVNGVPIQNAALRTNSGGSQCNSYLKNITAIRS
FT                   VNLEFNELVVQHMKEESCYVSLDFDLELKAAKRLIKLYGTHLLSHQYILPIYTSKSKTL
FT                   MSKHFTNYRKTKPPLLNENNEDLIKALVSGEITDIKQLEPTSTISENNTGSNTPNDTNN
FT                   EDGNDDAREGLKELNELNGEEYERDEDETQYVELFAERFSVPEIIFNPQDIKLNDCGIV
FT                   ELAYRSISLCPPAIQPLLTNNIFICGGTTKFRGFIKRFYKDLRPMIPQEWDIRLYSTDD
FT                   PMLASFYGARMWTNNDAVFLSSAITRSEYFENGASVIKIKEQPKSKTDYVL"
FT                   /protein_id="XP_765883.1"
FT   gene            733988..734623
FT                   /db_xref="GeneID:3502893"
FT                   /locus_tag="TP01_0357"
FT   mRNA            join(733988..734084,734184..734420,734463..734623)
FT                   /db_xref="GI:71032484"
FT                   /db_xref="GeneID:3502893"
FT                   /locus_tag="TP01_0357"
FT                   /transcript_id="XM_760791.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(734001..734084,734184..734420,734463..734597)
FT                   /locus_tag="TP01_0357"
FT                   /gene_family="HOG000135732" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032485"
FT                   /db_xref="GeneID:3502893"
FT                   /translation="MSYFISPVAQETITKLQYLLQNTLYTYAEIVSTLDQESSKELNEE
FT                   LSNVGIKSQVSDPDSNVTTDKNMDSKSINMEEFIAERVERLGVLNDQIQAHVDLLPDSS
FT                   ITREQIESTISILDTECVKTANELELLYAEYDKIYNKLKDAINLKHS"
FT                   /protein_id="XP_765884.1"
FT   gene            complement(<734652..737491)
FT                   /db_xref="GeneID:3502894"
FT                   /locus_tag="TP01_0358"
FT   mRNA            complement(join(<734652..735494,735583..735813,
FT                   735890..737020,737109..737491))
FT                   /db_xref="GI:71032486"
FT                   /db_xref="GeneID:3502894"
FT                   /locus_tag="TP01_0358"
FT                   /transcript_id="XM_760792.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(734652..735494,735583..735813,
FT                   735890..737020,737109..737375))
FT                   /locus_tag="TP01_0358"
FT                   /gene_family="HOG000135731" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032487"
FT                   /db_xref="GeneID:3502894"
FT                   /translation="MGSDCTIESPKLLNSTHEVDLPKDVTLDHKDLDYSLFNNIPNTSG
FT                   GYIVGEKPIFLRNSIICVINNQKCILYDSLSGNKLTQTHNNPDSLVGCKSFTYKDTYEL
FT                   LLCSSSDGTVLCYNIPQKIEDPVLPVLLKLKIKCRKLLTYELNVRNGNLVCLIINRKNH
FT                   IKLLHVEPNYELLVFSKDRDPINKQDDDKKVEFGSKNHFENTELLVIDSNNVDLVTANS
FT                   DLSRVAITNRTYFVLFEPGSGKCYFYEHHDVITSITLNENSVILGDLIGRIIVIDDTKS
FT                   SGTTNMLSFTDSRINFKKLSSMYHNKASNKNLFKNVSISQYHWHSHNVNSLCFYKDLLL
FT                   SGGEEAVLVVWDLKINDRKFVTNLGGPIFHITCAQNQIAVTLENNNVMIIDPVSLVVVA
FT                   SVTSLINTSRGCYLKLLDNHRICLVNDNIIQVYDYCDDKQVSTANINSVNYVSRQDQKF
FT                   GLYYTVENMCISYKYVLVALKRQLLTNETFKLLLQFFVNETLTSPSETTSKRTLMDINN
FT                   HKYVLNNTINDIHQDRVTSIKQLNSNGQFISSSLDGNLNVYTRISEGYWVTSQVITYKE
FT                   LPIHGLKVINNVVISNNENLLSIYRNDPSGMKLIKTIKADFGGIKKINIESLIVYKNNE
FT                   VDILNIRTNARENLLKLESTVNIRKVIYKPKDDFIVIVTKSPDSKLNLQVYSNKELIYE
FT                   KSLARGSLVKLVKPDYSIPLYCLLIFLNHDIEVLKLFKRDTKFEVVEQKDVSNYYFKKL
FT                   DRVNYNYLNEFIISLMSNTGAKVVKDKVKNRNILQYEKAKIKRIDLLNLVDSNQIPTPN
FT                   QIINQLVNNII"
FT                   /protein_id="XP_765885.1"
FT   gene            <738580..>740508
FT                   /db_xref="GeneID:3502895"
FT                   /locus_tag="TP01_0359"
FT   mRNA            <738580..>740508
FT                   /db_xref="GI:71032488"
FT                   /db_xref="GeneID:3502895"
FT                   /locus_tag="TP01_0359"
FT                   /transcript_id="XM_760793.1"
FT                   /product="mitogen-activated protein kinase 2"
FT   CDS_pept        738580..740508
FT                   /locus_tag="TP01_0359"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitogen-activated protein kinase 2"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_function: MAP
FT                   kinase activity [goid 0004707]; go_process: protein amino
FT                   acid phosphorylation [goid 0006468]; go_process: MAPKKK
FT                   cascade [goid 0000165]"
FT                   /db_xref="GI:71032489"
FT                   /db_xref="GeneID:3502895"
FT                   /translation="MRSDKVIKKSVHDYERNDSKENNLLDRANSSLLSKSKSKYLEAEN
FT                   SGFKNYVTKQALLQSRMSSVETDVPSTHYRSLISARKPEPQFNVYNQQENSVTAYNSSQ
FT                   TTNFNPNHITNYNSYNSYNPNYNTNFTSNFNSNYTSNNEKVPESSAPLKDNYTGVSSTK
FT                   YKPLKSSTIKKERPSIKPAQSDIKWDLGERYKFVDMVGSGSYGHVCRAYDSQLNKFVAV
FT                   KRIHKVFDDLIDCKRILREIAILNRLDHPNVVKILDILVPDNLETFDVLYVVLEIAASD
FT                   IKQLVRSPAFLNENHIRLLVFNLLSGVHYLHSVGIYHRDLKPANCLINRDCSVKICDFG
FT                   LARTTTFPEEFMDSTSYSGRQAEVSYSSRPVESISTSYSTSRSLPDYACGLGSSEKLIS
FT                   DTASGNATLNPYTNTVTVKGPMRQIYRRQLTGHVVTRWYRAPELILLQENYSFAVDIWS
FT                   VGCIFAELLNMMKVNVSDPCDRSPLFPGSSCFPLSPDNKNANPRTTRENDQLNLIFNVL
FT                   GTPSEEDINCIQKADVRRYVKFFAKRSFQDLRTKFKGASLESIDLLKKMLTFNPDKRIS
FT                   VFDALNHPYFKSISKPRNNFDSIPKVTLPFNDWVNMSESQLRYSFLREIQRYHKDFKIP
FT                   VKIIYRS"
FT                   /protein_id="XP_765886.1"
FT   gene            complement(<740686..>741607)
FT                   /db_xref="GeneID:3502896"
FT                   /locus_tag="TP01_0360"
FT   mRNA            complement(join(<740686..740970,741004..741073,
FT                   741119..741215,741296..741410,741440..>741607))
FT                   /db_xref="GI:71032490"
FT                   /db_xref="GeneID:3502896"
FT                   /locus_tag="TP01_0360"
FT                   /transcript_id="XM_760794.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(740686..740970,741004..741073,
FT                   741119..741215,741296..741410,741440..741607))
FT                   /locus_tag="TP01_0360"
FT                   /gene_family="HOG000282276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032491"
FT                   /db_xref="GeneID:3502896"
FT                   /translation="MVDSPLSKDISDQIDMDINRTFPHHRDYKVNSFGTMMLRNVLCAF
FT                   ANYMPSISYCQSLNYLTATLLIFMNEEEAFWSLVQIVNSRIHEKGFDLTGYYKDGMLDL
FT                   KRDVMVLDFILRKRMRKLHNHLRRNNIDLMWICAEWFLCLFAISLPTNTVFRVWDSLFL
FT                   EGDKVLFRVAFSLFKLNEQKILSLDSDRDLLLYCKKMSKSVLQHDEFLKIAFYQLSSFS
FT                   RKEIHQYRLIADHQLESVSPVE"
FT                   /protein_id="XP_765887.1"
FT   gene            complement(<741658..>742165)
FT                   /db_xref="GeneID:3502897"
FT                   /locus_tag="TP01_0361"
FT   mRNA            complement(join(<741658..741742,741774..741866,
FT                   741906..>742165))
FT                   /db_xref="GI:71032492"
FT                   /db_xref="GeneID:3502897"
FT                   /locus_tag="TP01_0361"
FT                   /transcript_id="XM_760795.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(741658..741742,741774..741866,
FT                   741906..742165))
FT                   /locus_tag="TP01_0361"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032493"
FT                   /db_xref="GeneID:3502897"
FT                   /translation="MNFTMEYHGVERPKKPLFKRASYHLFSLSKRLKNRNSFNIPFLDD
FT                   NFGPLKSKYDSYGFALDDNQFASGIEAYEKEFEVKKERRLKRWESIPLNDGFYDVTSDE
FT                   FKILVRKGIPDHLRSLLWRKMLGADTLESSNPGLYQKLKYK"
FT                   /protein_id="XP_765888.1"
FT   gene            complement(<742575..>743242)
FT                   /db_xref="GeneID:3502598"
FT                   /locus_tag="TP01_0362"
FT   mRNA            complement(join(<742575..742680,742757..743055,
FT                   743087..>743242))
FT                   /db_xref="GI:71032494"
FT                   /db_xref="GeneID:3502598"
FT                   /locus_tag="TP01_0362"
FT                   /transcript_id="XM_760796.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(742575..742680,742757..743055,
FT                   743087..743242))
FT                   /locus_tag="TP01_0362"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032495"
FT                   /db_xref="GeneID:3502598"
FT                   /translation="MKCLHKDLYNSLPGTCLINLQCCVERARARIMEILLKYNETKRFK
FT                   SSIFTDKVSEHLRRMRIRCETNVYKNGVLLDILESDQNLVWLCNSYHRFYATTFNMTAN
FT                   SKLLTKLIKAFGYKVSIINYYQWGRMKCKRTRFTFLRMARYYALKDRREYDSKYSGWSL
FT                   PYIWWNYGDRDRLHISHYDHFNP"
FT                   /protein_id="XP_765889.1"
FT   gene            <744873..>745853
FT                   /db_xref="GeneID:3502599"
FT                   /locus_tag="TP01_0363"
FT   mRNA            <744873..>745853
FT                   /db_xref="GI:71032496"
FT                   /db_xref="GeneID:3502599"
FT                   /locus_tag="TP01_0363"
FT                   /transcript_id="XM_760797.1"
FT                   /product="guanosine monophosphate reductase"
FT   CDS_pept        744873..745853
FT                   /locus_tag="TP01_0363"
FT                   /gene_family="HOG000165753" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="guanosine monophosphate reductase"
FT                   /note="go_function: catalytic activity [goid 0003824]"
FT                   /db_xref="GI:71032497"
FT                   /db_xref="GeneID:3502599"
FT                   /translation="MQVTYDFDDMMLLPRECTVLSRADCDVSAKLGKFTFKIPLMASNM
FT                   PTIMNETIAIELAKRNYFYVMHRFGINTFEFAHKMRSLGLYVSIAVGVKEESYKVVSDL
FT                   KESNLVPEFITIDISHGHNPRVKGMIEHIRANFGNETFVIAGNVTTPQGIKDMEDWGAD
FT                   AIKVGLGPGHACTTSPRTGFGSRGWQLSAVAECAKYATRAVVICDGGVSKSGDIAKAIH
FT                   MGADWIMSGYLFSGTIEAPGEVVVKDGVKYKPYYGSSSVVAKKVNHRIEGLELLVPCEN
FT                   SLFERLREIEEDLQSSVSFAGGNKLKDLRNVDHVLINSRPQNPHN"
FT                   /protein_id="XP_765890.1"
FT   gene            <746537..>747919
FT                   /db_xref="GeneID:3502600"
FT                   /locus_tag="TP01_0364"
FT   mRNA            join(<746537..746693,746761..746852,746884..746993,
FT                   747062..747800,747866..>747919)
FT                   /db_xref="GI:71032498"
FT                   /db_xref="GeneID:3502600"
FT                   /locus_tag="TP01_0364"
FT                   /transcript_id="XM_760798.1"
FT                   /product="proliferation-associated protein 2g4"
FT   CDS_pept        join(746537..746693,746761..746852,746884..746993,
FT                   747062..747800,747866..747919)
FT                   /locus_tag="TP01_0364"
FT                   /gene_family="HOG000168207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proliferation-associated protein 2g4"
FT                   /note="go_function: methionyl aminopeptidase activity [goid
FT                   0004239]; go_function: metalloexopeptidase activity [goid
FT                   0008235]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:71032499"
FT                   /db_xref="GeneID:3502600"
FT                   /translation="MSTEPVETELNNKHESHLDENDLSNSDIVTKYRTASNIANAALKN
FT                   VLAAVKPGVSVKSLCEVGDATMLEETNKLYNKKEHGRKVDKGVAFPTCVSVNELIDYFS
FT                   PMDDSLTVKEGDVVKVTLGCHIDGYVGLVSHTVYVGETVKGRAADVLKAAWLCCEAALR
FT                   KLKTGVSSHEVSKVIEKVAAEFNCTPLIGFYSHELKRHVVEGARYFSGSTKLEDKTEPI
FT                   TFGTKEAYSLNVVLTTGDHKPKTTELPTTVYRTDVQNRYTLKTSLGRSFMSQVNSKFPA
FT                   FPFHLKSFEDERALKVGLQESLRHNLLKPYFVTSVKPGDVVAHFRFTVLLLPTGTKKIS
FT                   GLPFEQLDKCNSELSVKDQDLLTLLSAPVNPKKKKATKEEESS"
FT                   /protein_id="XP_765891.1"
FT   gene            <748303..>749349
FT                   /db_xref="GeneID:3502601"
FT                   /locus_tag="TP01_0365"
FT   mRNA            join(<748303..748359,748516..>749349)
FT                   /db_xref="GI:71032500"
FT                   /db_xref="GeneID:3502601"
FT                   /locus_tag="TP01_0365"
FT                   /transcript_id="XM_760799.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(748303..748359,748516..749349)
FT                   /locus_tag="TP01_0365"
FT                   /gene_family="HOG000135730" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032501"
FT                   /db_xref="GeneID:3502601"
FT                   /translation="MSLNNSRPGINTQTHHISQGRSVRVSEPSERVTNRRMATQVIEMN
FT                   SRGYPTDRVNFESGETTHTSVEPVDLNSNRTTLSPRSYDPENNSVTVRESDFIQQLNLH
FT                   RMTQLQAGNRVQNSRVWSKLGIKHPRVYGKLFRILALLLLFILIGTATYWLLVLVVELT
FT                   DKKLSPSLITSNKKSKNYGGNNGLTGVNNQTELNAVELMNVIEELRKEIQKLKEVSYKN
FT                   SLAINGLSNGEYKVPGSEESLESAKRTKFGKGSAAVNMNSYGHRQDMKFAKKRDEDSEF
FT                   VPDIIEYQANISQQS"
FT                   /protein_id="XP_765892.1"
FT   gene            <749473..>751762
FT                   /db_xref="GeneID:3502602"
FT                   /locus_tag="TP01_0366"
FT   mRNA            join(<749473..749580,749629..749754,749948..750018,
FT                   750049..750091,750274..750794,750853..751129,
FT                   751163..751336,751508..>751762)
FT                   /db_xref="GI:71032502"
FT                   /db_xref="GeneID:3502602"
FT                   /locus_tag="TP01_0366"
FT                   /transcript_id="XM_760800.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(749473..749580,749629..749754,749948..750018,
FT                   750049..750091,750274..750794,750853..751129,
FT                   751163..751336,751508..751762)
FT                   /locus_tag="TP01_0366"
FT                   /gene_family="HOG000135729" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032503"
FT                   /db_xref="GeneID:3502602"
FT                   /translation="MSSDSDGFDLHIQALEEWYKNLSSESKSDLSLIKYKDLPKDKEKY
FT                   YKTIESYKEKCLALCLVGNVSFINSVIDSPLFKPTVEHSYIKITPLKKGEYYFKLLRAF
FT                   QTFKAHFDLMTMGVWCEFFDTKERFWKYVDFSGPKFDISTYSYSDSPKSEDKSDLNRAT
FT                   KKLRTENVNRNSNGVSKDREISFENNSETSYKGYLYIQRGRKMFIYNMNNKLEVKAIVV
FT                   FPSYNYKISRMLRVKDFPFELVNAAHSLKVSIINNKNYGTIGLNKNLFILSCNICGIVS
FT                   EITPKYVQECLLYQRRSSFIEWFDEFLLSLNQRRIRRLTSSFDKSGFDSFNLAERLDIH
FT                   VINANMLERVDAKLINILKKTYPIPRSKVHFTNHPIYVLKSQIKKNFILKENSVPITSF
FT                   GDDSVYLKENLVEIKTKLGWHKENRRVISGSNPVHTTHSRHRHVPENSVYIKSEYYENL
FT                   ENICKRNKIFFKRAFSSFHYEDGSVKAKINGVLIRASDLQSFLKLYDGILIDSLVMCRV
FT                   HRIDFRE"
FT                   /protein_id="XP_765893.1"
FT   gene            <752164..>752712
FT                   /db_xref="GeneID:3502603"
FT                   /locus_tag="TP01_0367"
FT   mRNA            <752164..>752712
FT                   /db_xref="GI:71032504"
FT                   /db_xref="GeneID:3502603"
FT                   /locus_tag="TP01_0367"
FT                   /transcript_id="XM_760801.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        752164..752712
FT                   /locus_tag="TP01_0367"
FT                   /gene_family="HOG000135110" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032505"
FT                   /db_xref="GeneID:3502603"
FT                   /translation="MMKFVTLAFVAALTSGIYVSAAELDLRKLGFVLYGKHGEGDKTAV
FT                   EVGVCPLGDLPDTVFLHKTFKKGDNFFTWVRPVHNKVTKVVSGSHLVWEAAASTKEVLL
FT                   DLHFFGKPAGKKFVHLELLHHLGGAVHVFLLFDGTAAAKVLSMAAFVAGVHALVPGLHE
FT                   LEGVPAHHLVSALALHAAA"
FT                   /protein_id="XP_765894.1"
FT   gene            complement(752848..754570)
FT                   /db_xref="GeneID:3502536"
FT                   /locus_tag="TP01_0368"
FT   mRNA            complement(join(752848..753045,753107..753260,
FT                   753334..753629,753661..753736,753797..753895,
FT                   753925..754015,754077..754154,754190..754329,
FT                   754388..754570))
FT                   /db_xref="GI:71032506"
FT                   /db_xref="GeneID:3502536"
FT                   /locus_tag="TP01_0368"
FT                   /transcript_id="XM_760802.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(752871..753045,753107..753260,
FT                   753334..753629,753661..753736,753797..753895,
FT                   753925..754015,754077..754154,754190..754329,
FT                   754388..754469))
FT                   /locus_tag="TP01_0368"
FT                   /gene_family="HOG000230622" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032507"
FT                   /db_xref="GeneID:3502536"
FT                   /translation="MDDEQDSTFINIKTNTPRPEKKRKKHKSNIHVELSNKNLDNVTDN
FT                   KVLKENKRPKKDTNKYNLNYVRLFKEIPQRIPFLGKPRDYTISVALPVSIMENIQSDDL
FT                   RAYVIGNIARTLTIYGVNEVVLYNDLDDKSSNWMEYFSLNLRYLETPQYLRKFLFPMDN
FT                   ALKFAGLQNPINAPHHLRSTEWLPYREGVVGLIRKDSTNTTLYADCGVFSSVKIHNKED
FT                   LKEFYGIEYMTDEDYDVYQRVTVRLDDESIDKCHKNWKEGKSLSQSETGSLSAYLVHPE
FT                   EPLKVAGLYWGYIVRECNTVVESLKGCPFNENARYDLKVGTSERGELYSLNTKLPKFKN
FT                   MLIYFGPVLGLEHVMQEPEKKFDKYFNFCNQQKSRTIRTEEALLIVLSLLSFTNTF"
FT                   /protein_id="XP_765895.1"
FT   gene            complement(<754708..>755782)
FT                   /db_xref="GeneID:3502537"
FT                   /locus_tag="TP01_0369"
FT   mRNA            complement(join(<754708..754918,754982..755040,
FT                   755112..755176,755219..755387,755452..755584,
FT                   755697..>755782))
FT                   /db_xref="GI:71032508"
FT                   /db_xref="GeneID:3502537"
FT                   /locus_tag="TP01_0369"
FT                   /transcript_id="XM_760803.1"
FT                   /product="60S ribosomal protein L13"
FT   CDS_pept        complement(join(754708..754918,754982..755040,
FT                   755112..755176,755219..755387,755452..755584,
FT                   755697..755782))
FT                   /locus_tag="TP01_0369"
FT                   /gene_family="HOG000284339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L13"
FT                   /db_xref="GI:71032509"
FT                   /db_xref="GeneID:3502537"
FT                   /translation="MFISKSLLARSLRSSFHEGNVNPFSKVQWVSRPFLKKNLPTVSPL
FT                   ATPHQSLGAITHMDTTAGNWHIIDASNKTVGSIASHVAVILQGKHLPTYQPNKVTGDNV
FT                   IIVNAIHVTMNGHSWDTKVYKFDRKAHPKGPKIITAKTIMANNPGMILNLAIKRMLPRN
FT                   KLRPFWYRRLFIYGGAIHPHWGIPQVVVPAPSHSNPLSNTVGNIQHNQSNSDSLTTTVG
FT                   AAGPSLSTDQLCYTLYPV"
FT                   /protein_id="XP_765896.1"
FT   gene            complement(<755868..>757636)
FT                   /db_xref="GeneID:3502538"
FT                   /locus_tag="TP01_0370"
FT   mRNA            complement(join(<755868..755948,756022..756141,
FT                   756202..756244,756286..756547,756583..756885,
FT                   756956..757030,757060..757180,757240..757320,
FT                   757385..757477,757511..>757636))
FT                   /db_xref="GI:71032510"
FT                   /db_xref="GeneID:3502538"
FT                   /locus_tag="TP01_0370"
FT                   /transcript_id="XM_760804.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(755868..755948,756022..756141,
FT                   756202..756244,756286..756547,756583..756885,
FT                   756956..757030,757060..757180,757240..757320,
FT                   757385..757477,757511..757636))
FT                   /locus_tag="TP01_0370"
FT                   /gene_family="HOG000135728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032511"
FT                   /db_xref="GeneID:3502538"
FT                   /translation="MVKEKKSVTFQLVSASNADNRSDKLPWQRTLVLKESQNDIWKNRS
FT                   SAQVPKDLLKNLDPHDFGIHDNLNKSQKQMLIKNIYGNFDTFKKFDKPTKKQTKQNVTE
FT                   DDLEGDCYFPKDGYDYEQHLATINPKYFIPAPKLTTDEPYVESGADFPDLTTSLEKKLD
FT                   PEVDEVLEALESDNELEAIDDDFVSQAIGCDEDLDEDDLLWGNYTPMIPTSILDNKINN
FT                   SDLMEDDNEDDDDMVENPLERGYMKDFNHYNALDKDKMTILDPIIPKDKIYEILENNEQ
FT                   FNDLSEESDLDDELEYESSESDQWYNNSYLSNHNIIRDVETVLTTYSNSTNHPKMILSR
FT                   KIKVPNPTPVKDNSTHKKLDIDTIQLPEVNTTRVKGESLEEKRERKLAVKRTKALIKEV
FT                   KRNNKEMLKEVRKKNAETNSRGCYDITNGVKYLKL"
FT                   /protein_id="XP_765897.1"
FT   gene            complement(<757776..>758260)
FT                   /db_xref="GeneID:3502539"
FT                   /locus_tag="TP01_0371"
FT   mRNA            complement(join(<757776..757835,757886..>758260))
FT                   /db_xref="GI:71032512"
FT                   /db_xref="GeneID:3502539"
FT                   /locus_tag="TP01_0371"
FT                   /transcript_id="XM_760805.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(757776..757835,757886..758260))
FT                   /locus_tag="TP01_0371"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032513"
FT                   /db_xref="GeneID:3502539"
FT                   /translation="MLLAEKLALLSYALEGHLIAKEDYVSQMRYYKTYLKDGILEIITE
FT                   FCIGKWYWSYWSCKPECRAKRNPQGSIYILSISTILKHPTDYSSFYVKYHTKDGPRDII
FT                   FKTVERSRDIWTDSIYLFIQNLRDYLDQFDNLKSLENFLD"
FT                   /protein_id="XP_765898.1"
FT   gene            complement(<758479..759202)
FT                   /db_xref="GeneID:3502540"
FT                   /locus_tag="TP01_0372"
FT   mRNA            complement(join(<758479..758771,758802..758942,
FT                   759024..759202))
FT                   /db_xref="GI:71032514"
FT                   /db_xref="GeneID:3502540"
FT                   /locus_tag="TP01_0372"
FT                   /transcript_id="XM_760806.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(758479..758771,758802..758942,
FT                   759024..759153))
FT                   /locus_tag="TP01_0372"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032515"
FT                   /db_xref="GeneID:3502540"
FT                   /translation="MLTKGLIAKALRNACSRSAELCFMECGRRVYKAIPTPSDYEPIAS
FT                   FCYYTGIHNHREFNLLINITDIDADFVKKHSLIEFEVGDTKVTAGAIPLSRGRKLSNLQ
FT                   CRALVKVRMCDNELRLKVYKKGLVGNTVVADITLNIDRDIIDAKFPKDKWYFLNHRAFP
FT                   IRYPLTDDPSKKDQIKLSFYKGNI"
FT                   /protein_id="XP_765899.1"
FT   gene            complement(<759455..>762706)
FT                   /db_xref="GeneID:3502459"
FT                   /locus_tag="TP01_0373"
FT   mRNA            complement(join(<759455..761145,761293..>762706))
FT                   /db_xref="GI:71032516"
FT                   /db_xref="GeneID:3502459"
FT                   /locus_tag="TP01_0373"
FT                   /transcript_id="XM_760807.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(759455..761145,761293..762706))
FT                   /locus_tag="TP01_0373"
FT                   /gene_family="HOG000135727" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032517"
FT                   /db_xref="GeneID:3502459"
FT                   /translation="MDSNQPVQRPNVFLPRRSNQPSQNEVNQGNTSDAPTIDTHHFSRA
FT                   TTLNPPTTNSNIPNVQSRGHPSPPPRLSQVTHNPPIPTRNKLISTPPPTFQQNVAETTA
FT                   NIQTNSVTSSHLQTNFVPSDDLQGKSVTSASMRPPEEFGKDLSLESLTSDTSSSILGDI
FT                   LGKNYVDSELERHVFTYAPFMPTRITQSSVPRPQPLSYNRESEILYETDKNYGLIPTFG
FT                   NHRILDTGSASPIYVTPTFTQLPVFGSTLSDLRLPFGVLVQPFAQNQDQKVPELDFLAF
FT                   MEKRSNVKRDLIRCRNCLAYYNSYMHTRSRTKTRVCNLCYTAFEITDEQLEALYRINSQ
FT                   YREESPLKKGSLDFVAPSHYYNKEPDPGGISNLINRATNIGVFKTQQPRQESFIYDTYS
FT                   VSPIPIEGASELDSYTSSLYQQPYNSDENESPSFKVSDGPDEATSSQNDQKTENKFPTY
FT                   AFLIESTSQANKLNEEFDLCIFVFDSAFYMFPMGSGSEFSVNVVAEVEENFKPCTISDV
FT                   CVRVTKDTRDWVKEYLEKILGIQTLRIAPNSCANFALNCVLRAMSSDNCYGTLSIYYVT
FT                   QPDIGLGTDPQTFPKSNFTLTDLQRYFYDSLLRMCYSAGICVDVYLCPPETRIPGDIAL
FT                   QYISQQTGGNCAYMPRFSHIFDYPKIYADVVRLFTVPAAYKCEFKLRCSKHIKVTELLC
FT                   GFNNSRAVSNLSTMVVPRIGPDLSIGFMLSLNHMVDNKTSLYIQCACLYTNTKGVHMVR
FT                   VHTHCIRVIASINEIFKNANPEAIMNLMSRKLAHGYIKSGKYNRDEHIRTLVESLTSYR
FT                   QICAPSTPKNQLILPDNLKFIPAYLNSFLKYDVKVEFGVEFAFEFVMKLLRILSASPQM
FT                   TFFMYTRTYCLHRSINEKGDAVPEQGFKFTLSGVPSSGSFIYSDGIYLMDDGYRLLLFV
FT                   GPHVKQILLKELFGPDYQFPHGNVNSTELIDTNTSANLLGLVEHVRSQHKGCPYAPLKI
FT                   IPYTSKNSKIIKTLLLEDELGEEPNYITFLVSLHKSILDSVDRLY"
FT                   /protein_id="XP_765900.1"
FT   gene            <763262..>765169
FT                   /db_xref="GeneID:3502460"
FT                   /locus_tag="TP01_0374"
FT   mRNA            join(<763262..763433,763715..763839,763872..763989,
FT                   764037..764207,764373..764568,764605..764708,
FT                   764747..764852,764884..>765169)
FT                   /db_xref="GI:71032518"
FT                   /db_xref="GeneID:3502460"
FT                   /locus_tag="TP01_0374"
FT                   /transcript_id="XM_760808.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(763262..763433,763715..763839,763872..763989,
FT                   764037..764207,764373..764568,764605..764708,
FT                   764747..764852,764884..765169)
FT                   /locus_tag="TP01_0374"
FT                   /gene_family="HOG000135725" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_function: ATP binding [goid 0005524];
FT                   go_function: helicase activity [goid 0004386]"
FT                   /db_xref="GI:71032519"
FT                   /db_xref="GeneID:3502460"
FT                   /translation="MTTASEDLKLNPLWVYRFSNYTNESSGVSADELLKTWNIHPHLRN
FT                   VIKEKRIKRFFPENKLLTLIIVPSRELVKQIYEVFSWFIDSSNSTYDLKGSLLKARVFY
FT                   GDRSFVKSHDLLVHDPPHIAISTPGVLVEYSVDFQKNEFYKTFEHLKWIVVDEVDTMLN
FT                   QSFYEWVDVVVDLVNKLKSKEPNQSLALPQKIQESIYKLPENLRQSYVVCSNRPVPLEF
FT                   LKLMAYLYQEVTGNVLVFFSKVEICHKISRLMQIYNLKHGGGFKATELTGRMSQKQRNN
FT                   AIKTYKYYNNNEQYDVASRGMDLSNTKVVVSYDFPNKLSSYIHRAGRTARGNKRGTFCV
FT                   FVSNKTEKKFHNFMNKLKINEEKLQKIELDVVLSKKKVEEISESYKLILEMTEKALELE
FT                   ASGNLEYGSDLSGSLELLKPVPEREE"
FT                   /protein_id="XP_765901.1"
FT   gene            765375..766964
FT                   /db_xref="GeneID:3502461"
FT                   /locus_tag="TP01_0375"
FT   mRNA            join(765375..765692,765801..765917,765963..766133,
FT                   766167..766245,766301..766420,766515..766698,
FT                   766748..766964)
FT                   /db_xref="GI:71032520"
FT                   /db_xref="GeneID:3502461"
FT                   /locus_tag="TP01_0375"
FT                   /transcript_id="XM_760809.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(765630..765692,765801..765917,765963..766133,
FT                   766167..766245,766301..766420,766515..766698,
FT                   766748..766949)
FT                   /locus_tag="TP01_0375"
FT                   /gene_family="HOG000135724" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032521"
FT                   /db_xref="GeneID:3502461"
FT                   /translation="MSILPILLFLFAQAISGMKPAGNTCRLPALNNTMNRCVQTLKDLS
FT                   NGLLSIPNNTVHKFHVKKSFDGGKNVVSVHLGKSDDLVKPMMYSNENSLDPNVKPKFQK
FT                   NYLNLDELSVNYTHKLDQDLSYTGNVVIDLPRTAQIFLKGVGGAEVKTVNVDTRDVLKR
FT                   LDFILRYRNTLVGGSYNFRSKEKSVELIQRLENLYRLYGKNMNVTPKLELMFDKNNKLS
FT                   TRACLVMKRDNLTITPIIYPNQKKCELAAEAKLTDEVKFGVFVSKDKNLYLNLSYESNW
FT                   GKHSWQQFSLRFVLSDVLKSYAYLQNELQL"
FT                   /protein_id="XP_765902.1"
FT   gene            complement(<767012..>767418)
FT                   /db_xref="GeneID:3502462"
FT                   /locus_tag="TP01_0376"
FT   mRNA            complement(join(<767012..767063,767103..767208,
FT                   767252..767342,767392..>767418))
FT                   /db_xref="GI:71032522"
FT                   /db_xref="GeneID:3502462"
FT                   /locus_tag="TP01_0376"
FT                   /transcript_id="XM_760810.1"
FT                   /product="small nuclear ribonucleoprotein F"
FT   CDS_pept        complement(join(767012..767063,767103..767208,
FT                   767252..767342,767392..767418))
FT                   /locus_tag="TP01_0376"
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small nuclear ribonucleoprotein F"
FT                   /note="go_component: nucleus [goid 0005634]; go_component:
FT                   small nucleolar ribonucleoprotein complex [goid 0005732];
FT                   go_function: pre-mRNA splicing factor activity [goid
FT                   0008248]"
FT                   /db_xref="GI:71032523"
FT                   /db_xref="GeneID:3502462"
FT                   /translation="MPKGQESSNPGAPLNPKPFLTSLAGKTVVVKLKWGMEYKGTLKSF
FT                   DSYMNLQLSDPEEWENGVLKGKLGNDILIRCNNMLYVRESSETATA"
FT                   /protein_id="XP_765903.1"
FT   gene            767612..769045
FT                   /db_xref="GeneID:3502463"
FT                   /locus_tag="TP01_0377"
FT   mRNA            join(767612..767745,767811..767925,767958..767993,
FT                   768064..768185,768276..768392,768432..768561,
FT                   768637..768722,768789..768875,768907..769045)
FT                   /db_xref="GI:71032524"
FT                   /db_xref="GeneID:3502463"
FT                   /locus_tag="TP01_0377"
FT                   /transcript_id="XM_760811.1"
FT                   /product="methyltransferase"
FT   CDS_pept        join(767647..767745,767811..767925,767958..767993,
FT                   768064..768185,768276..768392,768432..768561,
FT                   768637..768722,768789..768875,768907..768945)
FT                   /locus_tag="TP01_0377"
FT                   /gene_family="HOG000260965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase"
FT                   /note="go_function: S-adenosylmethionine-dependent
FT                   methyltransferase activity [goid 0008757]"
FT                   /db_xref="GI:71032525"
FT                   /db_xref="GeneID:3502463"
FT                   /translation="MNMSDDNLESSKNVEPENQTIEYPKKQLFRQRAHCNPLSDSFIPY
FT                   PENPRHVNWFKRYPSVYDNDHYLQFNTNDYPEDYTTSLEDENYPKVDFLDVGCGYGGLL
FT                   IYLSKLYPSKLSLGMEIRDKRTEPRRGLIVISLCVQYLNISVVRTNSMKFLPNYLGKNQ
FT                   LEKIFFCFPDPHFKRSNWRRRIVNYPLLSLYAYFLKPEGRLYIVTDVYELYAWMENALE
FT                   DHPLFEPLNDIDKGKDECYLTFDKETEEGKKNHKLQSTTYKNSGNSKSLSDLRW"
FT                   /protein_id="XP_765904.1"
FT   gene            <769325..>770044
FT                   /db_xref="GeneID:3502488"
FT                   /locus_tag="TP01_0378"
FT   mRNA            <769325..>770044
FT                   /db_xref="GI:71032526"
FT                   /db_xref="GeneID:3502488"
FT                   /locus_tag="TP01_0378"
FT                   /transcript_id="XM_760812.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        769325..770044
FT                   /locus_tag="TP01_0378"
FT                   /gene_family="HOG000135723" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:71032527"
FT                   /db_xref="GeneID:3502488"
FT                   /translation="MEFIIPIYLLISLWSLKVCESSDKFDPKSTKNSKATQTSDTTDTD
FT                   NDKNNGTSKDRNKGKGDHKNEDEGYGTGDSDSDVDRSDKCNKQGDVARPGEGNRPGGSG
FT                   NDKLPPQQKNNNLVGNAGKQLAKNMRSGDSNGDKGNEGNKSGGNGSDKGPHQNKIPDIG
FT                   FNPGGAKKLGGPPIKPEVIKVTIIDSEDEEEEKKKQEEKNKPKGYKMHTNEELEATQLG
FT                   GPAYFDDLEPKNECIIS"
FT                   /protein_id="XP_765905.1"
FT   gene            <770775..>771437
FT                   /db_xref="GeneID:3502489"
FT                   /locus_tag="TP01_0379"
FT   mRNA            <770775..>771437
FT                   /db_xref="GI:71032528"
FT                   /db_xref="GeneID:3502489"
FT                   /locus_tag="TP01_0379"
FT                   /transcript_id="XM_760813.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        770775..771437
FT                   /locus_tag="TP01_0379"
FT                   /gene_family="HOG000135722" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032529"
FT                   /db_xref="GeneID:3502489"
FT                   /translation="MKLILIVAMALEVSRVVICTPGDDLKKIDKRNNPSKMYHSLDITS
FT                   QISRNLFVFDKKEINGVIYNDVTVKPGVIIDEIYDGDSEIWRAKANRQLMKLMIIQEKK
FT                   SNTYIVLTKDKHERLAETYILVTRVLLSFDPFVDLDYPLPDYQPDSYEERGKNLRTSEA
FT                   QTEPQVRRPIKDTKAPFQNKEYMSELLPNFVTRAKFREMEEDDKVKDNSGTQTSGPK"
FT                   /protein_id="XP_765906.1"
FT   gene            <771958..>775561
FT                   /db_xref="GeneID:3502490"
FT                   /locus_tag="TP01_0380"
FT   mRNA            join(<771958..774322,774357..>775561)
FT                   /db_xref="GI:71032530"
FT                   /db_xref="GeneID:3502490"
FT                   /locus_tag="TP01_0380"
FT                   /transcript_id="XM_760814.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(771958..774322,774357..775561)
FT                   /locus_tag="TP01_0380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032531"
FT                   /db_xref="GeneID:3502490"
FT                   /translation="MRLLLLSIVILSFLKISNASDKNPAKDPDKSPDKKNVDPLHHSTL
FT                   HFRDVERLFATESTGEGDQTGPEPPEEAIGETEEEDYEEGEENEALVRSLLEDDTKTAE
FT                   KIKSDQMKALDLSVLFELNSIIEEVESETDGEPEEESHGDTDEPDSKKEGEGAEEKKKR
FT                   KKDDDSDSDGEEGGKKKRFKPKSTTDSDGKPKPESKGPPVPKPRTPKSDGDGKPKTDPK
FT                   KPPVPKPRTPKSDGDGKPKTETKGPPVPKPRTPKSDGDGKPKPETKGPPVPKPRTPKSK
FT                   TEPKPAQQPQPQPQPQPEQAPVPEPKKPEDKDSKGPEPMDTEPPKEPEDKDTKEPEDKD
FT                   TKETEDKDTKEPEPMDTEPSKEPEKPKEPDGKDPDDHPEEGKKPEPGEDKSDDTKGKDS
FT                   PKEQEKPKEPEPVPQPEPTPAPQPTPVPQPEPTPAPQPTPVPQPDPTPAPEKPEDKDTK
FT                   EDKKSDESKPMDQQDTKDPGKQEADPQPKDGEKKDETPTDQEDSGKKGKQESDPVKPME
FT                   TDPKPEPQPQPEDPKDKDTKGPETPQPQPEDPKDKDTKGPEPMDTEPPKEPEDKDSKGP
FT                   ETPQPQPEKPEDKDTKGPETPQPEDPKDKDTKGPETPQPQPEDPKDKDTKGPEPMDTEP
FT                   PKEPEDKDSKGPEDKKDDTKPQPEDPKDKDTKGPEDKKDDTKPQPEDPKDKDSKGTEPM
FT                   DTEPPKEPEDKDTKEPEDKDSKGTEPMDTESPKEPEKPKEPDGKDPDDHPEEGKKPEPG
FT                   EDKSDQKKEDTKVGTPEKPKPEGDDGLPEKPLPIDQSTPYVPKPDKGGLFQLKTPKLVF
FT                   LTDDENEGPEGPEGPDPLKKKRPFLLYDRPGKTPRRPKKRKIKHLYEDDGSDDDEDEDE
FT                   DEDEDEEKEGDDDDGSYKTTGKDKKDDDGSGGSGSGSGTTTTSGSGVVETKQSQGDGSG
FT                   SASGSGSGSASGSGSGSASGSGSGSASGSGSGSASGSGDKPKPVRRPLGLPGSSQSKLP
FT                   IKSSGPGRGPLKTPVATGPGKGGIGSTSGITPVSSGPLGDPFKTPVSMLPRKVGSKIPV
FT                   PSKPSKKPRSSSTSSSGKGTGASGSTKTSPKSGDESESKKKRSGGPTTVTIPRRPPFVV
FT                   PGGSKDITTRGTPRTSAPVTPKPEETPTPGKRRSETGTKGDPSRGGDGDTGSRRSARLL
FT                   TRGRRNPSPSPTRTGKQGRAGRR"
FT                   /protein_id="XP_765907.1"
FT   gene            775980..776738
FT                   /db_xref="GeneID:3502491"
FT                   /locus_tag="TP01_0381"
FT   mRNA            join(775980..776311,776433..776569,776607..776738)
FT                   /db_xref="GI:71032532"
FT                   /db_xref="GeneID:3502491"
FT                   /locus_tag="TP01_0381"
FT                   /transcript_id="XM_760815.1"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT   CDS_pept        join(776044..776311,776433..776569,776607..776669)
FT                   /locus_tag="TP01_0381"
FT                   /gene_family="HOG000028966" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="GI:71032533"
FT                   /db_xref="GeneID:3502491"
FT                   /translation="MMHVLLKPNNDEVRALYQNHKSFYEGDCGLDLFCVEDHTVEAHDT
FT                   SIINLGVRVSAFKKLEDGSTGKSVGWLMFPRSSMAKTPLRLSNSVGVIDPQFRGELRLS
FT                   LDNIKDFPYTVKKGDRLVQMVSYDGEPITFEVVDELDETLRGSKGFGSTGR"
FT                   /protein_id="XP_765908.1"
FT   gene            complement(<776790..>779081)
FT                   /db_xref="GeneID:3502492"
FT                   /locus_tag="TP01_0382"
FT   mRNA            complement(join(<776790..776939,777064..777860,
FT                   777998..>779081))
FT                   /db_xref="GI:71032534"
FT                   /db_xref="GeneID:3502492"
FT                   /locus_tag="TP01_0382"
FT                   /transcript_id="XM_760816.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(776790..776939,777064..777860,
FT                   777998..779081))
FT                   /locus_tag="TP01_0382"
FT                   /gene_family="HOG000135721" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032535"
FT                   /db_xref="GeneID:3502492"
FT                   /translation="MDTKTLAPKRSVIYLSPYVRNSINETPYFYKNTSNDTNGDTDHRN
FT                   DSRLVHSRKSISPTDSDKTSSTQPDDSPESNENGVKRGPGNSRRINREISNSWKKKVNK
FT                   HIGGQFDQSKRLFVSALWAYLEIKDSAKVDSDKFNCFRLLFGPENTKHKLFNNCSKNLK
FT                   SPNNLNNKKILNNNTNGNGNYIEEMEELTSDSKSSSTSSSDNEMESPILQNKSEDKPLV
FT                   DSDKASKTPNFDYLLDKSYPLSFEFKLLKKCISFFESHGLVAKVRKLPPESFTDDSTTS
FT                   RRTSRIPTITTTYPSYHFITRQRRHMIEQIMRSKSFLETEFNLHSDPRNSRSPFSLFEP
FT                   HPKTLSYLQDVVSDLNDHDFTGLFISVSTEPFKSNTQFGMIKRTKLVAWSLVEILETNE
FT                   RCLKCIWVHPLISANGTTDLLRAFIPFIIMSSFSVRPPEIDFNHKMMFYSWLSDFDLFP
FT                   RQALILLTSPYRFALEKHYDCSDRTQIHTCSTHSLYYNTYLYEHNSTDNPNSRSSSSSE
FT                   NYNSGDEDEYMDNMYKNYLGEYKSYISRDVKICQCHENPNWNDLEQVLFSCTEKTFLDS
FT                   IPRWLQLIKRNRSVYLEYDIRKVITQETYEMETPQEIKIAEFAGLDNKHVQDLMANLYG
FT                   SKWHQRFKQKYIKIFKSEEHTTKNHTQSDVEVVKIRRLSHS"
FT                   /protein_id="XP_765909.1"
FT   gene            complement(<779707..>780201)
FT                   /db_xref="GeneID:3502493"
FT                   /locus_tag="TP01_0383"
FT   mRNA            complement(join(<779707..779822,779865..>780201))
FT                   /db_xref="GI:71032536"
FT                   /db_xref="GeneID:3502493"
FT                   /locus_tag="TP01_0383"
FT                   /transcript_id="XM_760817.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(779707..779822,779865..780201))
FT                   /locus_tag="TP01_0383"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032537"
FT                   /db_xref="GeneID:3502493"
FT                   /translation="MMHLRFSSVFEKLNGILATIFVYLSSSAYGMIGVCWITPDTLQAS
FT                   GFAGDWGVAGALLSRFFLFPFLVHREYQNITNVVVSYICLFFLKTIGKGSSIVVLAHLL
FT                   SAISGLCMGLKRLLTDFVCSCALLVVPIFSIFMLFTSKGPDDHFYR"
FT                   /protein_id="XP_765910.1"
FT   gene            complement(<780279..>781135)
FT                   /db_xref="GeneID:3502494"
FT                   /locus_tag="TP01_0384"
FT   mRNA            complement(join(<780279..780329,780482..>781135))
FT                   /db_xref="GI:71032538"
FT                   /db_xref="GeneID:3502494"
FT                   /locus_tag="TP01_0384"
FT                   /transcript_id="XM_760818.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(780279..780329,780482..781135))
FT                   /locus_tag="TP01_0384"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032539"
FT                   /db_xref="GeneID:3502494"
FT                   /translation="MEDESYPSTSVIDMSNVDDIENMFEKLVSRQNRFTKEFENNIEIC
FT                   CTQLNKLKDISNNDTINLLNSLYNSKLTVDSLRLIQNDYEPCSVCKTVEHAPLNYKEES
FT                   RERIRKRSTDQSDDYFEFMSRTKSFRNTRFFFDFKGSAHPSDPESFKKEASNTFHNNKF
FT                   SDYFVFLINERPTTDTSTFKKFTFNSFKSFGARFLELIISFFPLFNITNFSNLIIILRM
FT                   RVNNLEHLVVSY"
FT                   /protein_id="XP_765911.1"
FT   gene            <781540..>782518
FT                   /db_xref="GeneID:3502761"
FT                   /locus_tag="TP01_0385"
FT   mRNA            join(<781540..782266,782293..782387,782417..>782518)
FT                   /db_xref="GI:71032540"
FT                   /db_xref="GeneID:3502761"
FT                   /locus_tag="TP01_0385"
FT                   /transcript_id="XM_760819.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(781540..782266,782293..782387,782417..782518)
FT                   /locus_tag="TP01_0385"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032541"
FT                   /db_xref="GeneID:3502761"
FT                   /translation="MINTSFSTDRTLVFYKFIRFSYLKSSSDSICLDSLNHNSIYPDLN
FT                   QRDYFFNSDSFVNSSDSFNSDFMCTLLCSKNSVSPLDVLRHLSMYYGFNPKSFQHFRVF
FT                   VLVPLTQYFPSLHNLTHLDKLSASSHTSKNNNSKVSDKFSNDDGKNINFDTITSPKDPI
FT                   NDKLVWVSANLNNSLYTLNGTVHLKIYLPDLNALNLIKPVDIIHDSSFNFDFKKSSETN
FT                   KNETKIKSSYEEHKEPVSSLVREEIIQKVGKWSHTADGKLKDIRTLLSTIQNVLWEDVE
FT                   CESMPLSFLVSDKDSIKSYYKFPLYT"
FT                   /protein_id="XP_765912.1"
FT   gene            complement(782708..>788771)
FT                   /db_xref="GeneID:3502762"
FT                   /locus_tag="TP01_0386"
FT   mRNA            complement(join(782708..782832,782862..782993,
FT                   783038..783130,783162..783370,783423..783462,
FT                   783527..783744,783812..784033,784182..786515,
FT                   786582..787874,787955..788598,788707..>788771))
FT                   /db_xref="GI:71032542"
FT                   /db_xref="GeneID:3502762"
FT                   /locus_tag="TP01_0386"
FT                   /transcript_id="XM_760820.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(782722..782832,782862..782993,
FT                   783038..783130,783162..783370,783423..783462,
FT                   783527..783744,783812..784033,784182..786515,
FT                   786582..787874,787955..788598,788707..788771))
FT                   /locus_tag="TP01_0386"
FT                   /gene_family="HOG000281341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_function: nucleic acid binding [goid 0003676];
FT                   go_function: DNA binding [goid 0003677]; go_function:
FT                   DNA-directed DNA polymerase activity [goid 0003887];
FT                   go_function: 3'-5' exonuclease activity [goid 0008408];
FT                   go_process: DNA replication [goid 0006260]"
FT                   /db_xref="GI:71032543"
FT                   /db_xref="GeneID:3502762"
FT                   /translation="MEPTYYTNQALNEPTLRISKKRLIGRYKVAFLFFLTRLILISCLF
FT                   PFSECVKTDLSQGSFSISKRGRQFPPPRTLCNIFKTFNTIHKFSPVDKLNMISVKSLKD
FT                   ISNLRNLIRFRYNKRDRNYRNRSFYKCLFVSNLNKPQMESGKIIDGGSFYSYPPTSYPN
FT                   MPSYNGSYGLDESNTFVSNHYRNMGEDIVEYLNRKKIEYNESPIKYTLKFCPFCPPHRF
FT                   KSDNLFKHEIFKNSGNSYCHRCGYKGSLFDFKAHMGDLPGAFDIASDPITSPFGAKKVQ
FT                   KDPDVTIEDVNKFEDNLYNNPEYACVLDYLTKTRGLKPHVLKKYHVGAGSFKFKSVTGK
FT                   LEQEKCVVFPWLSTPNKLYPNDEVETQTDDSEGFDYNREFTTDKLNVNRIKIRSIYDKS
FT                   KIKILPRGGAWGMFGGHLIQEAQEKDSIVLSEGELDAMSIYQETGRLTISLPNGANSLP
FT                   LALLPKLEKFNEIYLWMDFDAPGQSSISHFANKLGIQRVKVVHPLNTPTTTATTTKGTT
FT                   TSTKGAGTTTKGSKSTTATTQKTTSKMLKDANEVLLSGGVDMNNYFKNATVMTHSQILT
FT                   FSDIRQLVYNELSDPVTTCGIKSITMPGLSNLLKGHRRGELTVWTGSTGSGKTTLLSQL
FT                   SLDYCLQGVSTLWGSFEINNVRLAKTMLRQFSGRNLENNLNEFDYYANKFNELPLRFLK
FT                   FHGSTNIDIVLDAMDYAVYVYDVQHIIIDNLQFMLSNYSGPSQNSSFGGYSSSKDIYEL
FT                   QNRTIEKFRRFVTNKNIHLSLVVHPRKEADGIQLGLSSVFGSVKSTQEADNVIILQNIL
FT                   NESRCIDVKKNRFAGLLGRVYFKFDPVSLTAQEFKVTEYLNEYTTNNFTKPKVKKDQPD
FT                   TPTVPSGGFPINGTPETKPKVSLSNFKLNLPQVNGSNVSNEPIGIPNVGTMTSEDLQSR
FT                   PTPATSTNYKDKERNNVGLIGIDLLNLKPITQQINKIIQQNYTTSSNSNSDSSDSSGKP
FT                   EGEDTSGDDNTNSNLVGTNDNSNSSGKGGKLKTKSELVEEEYLSMRGLKITKNSSIKEM
FT                   RDFVKKNGLGELVKTAGKGIKKDAIYENIRSIIPQSAIITTKPTEEEVESVKEDSSVDT
FT                   TKVEDESSARSDVHSFGVSTSKSLLKLERVNVTPNNDITEFKLKYLSKLPKSLYKGEPP
FT                   SSSKPTPVTTGDQVSIPVDVYYSVNFDPLLIDGIIYVDSYDKLQSLEPLFKDPKAVGVD
FT                   IETTGLDHNTNQIRLVQLSVPNQPSLIIDLFKLSTNNPDAESVVPGRNELIKCEWLKKL
FT                   FKSKETVKVFHNGKFDINFLRVYGFEFEGPIFDTMVASKLLVASRYISCKLTHVSERYL
FT                   NIVLDKTQQYSDWSTLQLFEEQLLYSARDSFVLLPLYVILEHLLKINNLSDIASVENKC
FT                   ILATSDMELNGIQVDEDKLKFLQDELKQEHQEISNTLYSQLNQSEINLNSQKQVLEKLQ
FT                   ELKIMDKSKKKIISDTSESTLIRNMSNPIISSLREYRKANKALTAFTQKLPNHINPITK
FT                   RIYPNYNQLGAESGRFSCDGPNLQQVPRDKKFRECFVAPKGSKFVIADFSQIELRIAAE
FT                   IANDPKMIQAYQQKVDLHSLTASILKNKNINDVNKEERQLAKAVNFGLIFGMSINGLRM
FT                   YAETGYNLKLTQNEAKEIYTSFFNNFKGILNWHNSVKNSRPTMVRTLGNRLSVFESFSF
FT                   TRSLNYPVQGTSADITKETMARLVDLVKPLNAKIIICVHDEIILEVPEDNAEKALKMLI
FT                   DTMVKSGEKYLKKVPVEAMGSIGDSWADKS"
FT                   /protein_id="XP_765913.1"
FT   gene            <789515..>790468
FT                   /db_xref="GeneID:3502763"
FT                   /locus_tag="TP01_0387"
FT   mRNA            join(<789515..789617,789654..>790468)
FT                   /db_xref="GI:71032544"
FT                   /db_xref="GeneID:3502763"
FT                   /locus_tag="TP01_0387"
FT                   /transcript_id="XM_760821.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(789515..789617,789654..790468)
FT                   /locus_tag="TP01_0387"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032545"
FT                   /db_xref="GeneID:3502763"
FT                   /translation="MSKGKRRESSRISNDIYSHLSNPNDDESRYKIKRVKSRKKLRKIQ
FT                   RKEAKRLKHEKKLEWIKRRKNANNMINSSHKNVVKPVNTDANVQNNGLKSIYKPESNKG
FT                   LKSDKKVRFDSDHNIKSTPEDIEIEYLERQLLKNKPNVRDKNDTVKRGRKVDVLQELKS
FT                   EFLRDGFDEDFLDFLSNITTIADEENILDNEQLYPENNTLVKLRNYTLDQPDYQDLTDD
FT                   EVESEDERHEDEDEDELDVDDDEQIDEDGDEDNEEQLEEDEVFDPSDVIKKQIGMVNRL
FT                   SEGNYTVIVNQLCEMYSKIISKVI"
FT                   /protein_id="XP_765914.1"
FT   gene            <790551..>792617
FT                   /db_xref="GeneID:3502764"
FT                   /locus_tag="TP01_0388"
FT   mRNA            join(<790551..790640,790730..790988,791035..791171,
FT                   791201..791298,791337..791628,791700..791794,
FT                   791876..792002,792035..792124,792154..792416,
FT                   792539..>792617)
FT                   /db_xref="GI:71032546"
FT                   /db_xref="GeneID:3502764"
FT                   /locus_tag="TP01_0388"
FT                   /transcript_id="XM_760822.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(790551..790640,790730..790988,791035..791171,
FT                   791201..791298,791337..791628,791700..791794,
FT                   791876..792002,792035..792124,792154..792416,
FT                   792539..792617)
FT                   /locus_tag="TP01_0388"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032547"
FT                   /db_xref="GeneID:3502764"
FT                   /translation="MIINEVNVVISLVATQSALICSLSNYFNSSIVKRFVSKLLEKLES
FT                   NLELMLDSDLKQKSPVNENKLVVRNIIISICSIYYYEVIDIDVIFHLIKLLTKTNLNED
FT                   ILQLLLILLKYSGQSINKNSEILGYLNDLIEKYKKEHEEFSSNSLTNIDKLKMNHKFFF
FT                   LKSCLDRVKFIEEELKSNKKSKNVLEQFDHLKNMIKSKLNMDRVTINLESIINCNNNSD
FT                   GADGNNSGVTEFETKIAPKKNSRKDELIKKATKIGLNKDIQKTIFICIMDSISPENALD
FT                   NILKIKLKTQQFNEVINIVIYCYLVEKEFNYYYIKLLLILTSKLNLNVCKKYKRHINNN
FT                   IVLYFKNFESLTQNQFSLLSKLFYHMILNKISGLRLLNFINVNHFKTSSFKIFINKLFS
FT                   SIVTTEADDELEEYLIQELLSIKTEVSTINLTFDRNTLMIWRRFGPNTLKATVELRLRS
FT                   PTHLIFYSSHINVFLNHNPIIYYTNIGIKDYDLVFNISTAFSLASLMSPTM"
FT                   /protein_id="XP_765915.1"
FT   gene            complement(792535..>794628)
FT                   /db_xref="GeneID:3502765"
FT                   /locus_tag="TP01_0389"
FT   mRNA            complement(join(792535..792813,792996..793562,
FT                   793707..>794628))
FT                   /db_xref="GI:71032548"
FT                   /db_xref="GeneID:3502765"
FT                   /locus_tag="TP01_0389"
FT                   /transcript_id="XM_760823.1"
FT                   /product="ATP synthase F1 subunit beta"
FT   CDS_pept        complement(join(792551..792813,792996..793562,
FT                   793707..794628))
FT                   /locus_tag="TP01_0389"
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP synthase F1 subunit beta"
FT                   /note="go_function: ATP-binding and
FT                   phosphorylation-dependent chloride channel activity [goid
FT                   0005224]; go_function: ATP binding [goid 0005524];
FT                   go_process: ATP biosynthesis [goid 0006754]; go_process:
FT                   proton transport [goid 0015992]"
FT                   /db_xref="GI:71032549"
FT                   /db_xref="GeneID:3502765"
FT                   /translation="MGIRAGVPGLFGTISGFKVTPFCKSALKFQLNLNRLIFSTKSKLS
FT                   SKNHLNRNLVNSNIGSKLDNLLPTNINFTSPRRFHSKSQNVVNKSGDQSPVSDTGKMRK
FT                   GYISQVIGAVVDVRFDGPPPPILNALWVDNDGTKLSLEVAQHLGDGVARSIAMGATEGL
FT                   MRGQEVLDTGSPITIPVGTPTLGRIMNVTGDAIDGFGPIKSEHHLPIHRPAPSFEDQKS
FT                   DEALLITGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVANKHGGYSIFAGVG
FT                   ERTREGNELYHEMLSTGVIKRTIKPNGKGDEADFTGSKASLVYGQMNEPPGARARVALT
FT                   GLTVAEYFRDEQNQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDLGSLQE
FT                   RITTTKKGSITSVQAIYVPADDITDPAPATTFTHLDATTVLSRQIAELGIYPAVDPLDS
FT                   TSRMLSSHIVGERQYNVARAVQKILQDYKSLQDIIAILGMDELSEDDKFVVARARKVQR
FT                   FLSQPFQVAEVFTGKPGRFVELPDTIDGAEQILNGSCDDLPEMAFYMVGDIKEAKEKAV
FT                   EMLKTRS"
FT                   /protein_id="XP_765916.1"
FT   gene            complement(<794891..>796767)
FT                   /db_xref="GeneID:3502778"
FT                   /locus_tag="TP01_0390"
FT   mRNA            complement(join(<794891..795006,795138..795492,
FT                   795548..795848,795984..796441,796486..>796767))
FT                   /db_xref="GI:71032550"
FT                   /db_xref="GeneID:3502778"
FT                   /locus_tag="TP01_0390"
FT                   /transcript_id="XM_760824.1"
FT                   /product="serine hydroxymethyltransferase"
FT   CDS_pept        complement(join(794891..795006,795138..795492,
FT                   795548..795848,795984..796441,796486..796767))
FT                   /locus_tag="TP01_0390"
FT                   /gene_family="HOG000239405" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine hydroxymethyltransferase"
FT                   /note="go_function: glycine hydroxymethyltransferase
FT                   activity [goid 0004372]; go_process: glycine metabolism
FT                   [goid 0006544]; go_process: L-serine metabolism [goid
FT                   0006563]; go_process: one-carbon compound metabolism [goid
FT                   0006730]"
FT                   /db_xref="GI:71032551"
FT                   /db_xref="GeneID:3502778"
FT                   /translation="MIKICRKFTIFITCIIFVFNLVYPFRIPRKNNLLTLNTLSSLNAV
FT                   MPLPNHTEYKREFPLEDEVPLKEFDPEVYELLERERDRQRYSINLIASENYASRACMEA
FT                   LGSIFTNKYSEGLPGKRYYGGCRFVDDIENLCIKRCLEVFGLSDEEWGVNVQPLSGSPA
FT                   NLAVYCALLQPHDKLMGLSLESGGHLTHGYYNAKKKVSASSIFFSPLSYFLDPKTGLID
FT                   YDGLEKSAQAFCPKLIIAGASTYSRYIDYKRFREIADSVGAYLMADIAHISGLVAGRVH
FT                   PLPFEYCHVVTSTTHKSLKGPRSGIIFFNKKLLPDFGECINQSVFPTLQGGPHNNNIAA
FT                   LAVQLKQLSKPEWKTYAQRIVDNARVLAAELEKRDMPVVTGGTDNHTVIVSLRPFGVTG
FT                   SKAELVCDLVNISISKSTIPGDKSAFNPSGIRLGTPSLTSRGAFPQDMVFVADVIRKVV
FT                   DICVKVQEEKGKKLVDFKVGLDVNEDIIKLKNEVVEWISKFPYID"
FT                   /protein_id="XP_765917.1"
FT   gene            complement(<796966..>799113)
FT                   /db_xref="GeneID:3502779"
FT                   /locus_tag="TP01_0391"
FT   mRNA            complement(join(<796966..798741,798773..798936,
FT                   799011..>799113))
FT                   /db_xref="GI:71032552"
FT                   /db_xref="GeneID:3502779"
FT                   /locus_tag="TP01_0391"
FT                   /transcript_id="XM_760825.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(796966..798741,798773..798936,
FT                   799011..799113))
FT                   /locus_tag="TP01_0391"
FT                   /gene_family="HOG000135720" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032553"
FT                   /db_xref="GeneID:3502779"
FT                   /translation="MDINSRPITQDPSLKLKFLKPDPEKCMDRVPTLTKVDGLENVELD
FT                   ILNGWCSKFWKKIRYSGFFLDENLTKDLTNYLELNSTIAIDLDKADSYLAVQKLLYNGL
FT                   RLELENSAESARRDNSLDSVGTENGSANSVSQCKLFHKYYYSCRENPVALNNLVVLSNV
FT                   IWSLKKYKRDEFALTCLIDILLQSYMVALDSFISLGGVDVIRENFEFLALNGRLKKSSN
FT                   YLLKCMELLDKLDINFKILQTSKIGIPVNCIALGRAPPRLSKADYECSNDKVKLKATNL
FT                   IKKWKAIRDVSVPQKEQDHKPKKPVHSLEKHYSTESAGSLEHEGSFVLDIINTMVEQKE
FT                   KEKKRKLQIKNSHLPNKYKHKPNESADNGESKSASSVKVHKLVDKVENGKVNDPEISSS
FT                   VNTNKLASLMNFFKEYSNNSGNSDNASSSSDNTILQLNQDNTNVTQVSTTAVPETSTKL
FT                   VVDTLVTKLSDKPGNVEDNRLMMPPPPPPPPPFNNPKHTTVGVSFDDPNITNINRFTGY
FT                   PMVGQILPPGVVPPPPPKQPPPQHSYNTKPYTSINTSYPMYKTVNTDYNAVNTDYKTVN
FT                   TDYKTVNTDYKTVNTDYGMLNTDYGMANAEYKSVHFESQTNRFGTHKGNYTPEVVGQSS
FT                   LNSYESSFERNETASVKEPADRNLDFYRKPENNTSNDRQVTPPWK"
FT                   /protein_id="XP_765918.1"
FT   gene            complement(<799408..>800181)
FT                   /db_xref="GeneID:3502780"
FT                   /locus_tag="TP01_0392"
FT   mRNA            complement(<799408..>800181)
FT                   /db_xref="GI:71032554"
FT                   /db_xref="GeneID:3502780"
FT                   /locus_tag="TP01_0392"
FT                   /transcript_id="XM_760826.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(799408..800181)
FT                   /locus_tag="TP01_0392"
FT                   /gene_family="HOG000135719" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032555"
FT                   /db_xref="GeneID:3502780"
FT                   /translation="MSENRLNVKAFFSRKFFLLIYVLCMISVTQANGLKYNRGPLEESY
FT                   QNNNPSANENDLDDMDDEFTGTTYLEPANDNNSFLENNEDYDEDEDDEEDYEEEDIDLD
FT                   RFSDASLLEMESTSDEEDSNEGSGGNKLLNKINPKLMNGGFLKNYLDKIGESKAIKGIH
FT                   PKKAIANVKTTMKDLQQGYKKLKGKVYPRHKTYEPKSPNHSNHGGRSVDNMSGSNENRN
FT                   RGKTGYGRRFLNKLNGGDGAKPSRLSRIRSSLRSV"
FT                   /protein_id="XP_765919.1"
FT   gene            <800795..>801353
FT                   /db_xref="GeneID:3502781"
FT                   /locus_tag="TP01_0393"
FT   mRNA            join(<800795..800807,800868..801215,801310..>801353)
FT                   /db_xref="GI:71032556"
FT                   /db_xref="GeneID:3502781"
FT                   /locus_tag="TP01_0393"
FT                   /transcript_id="XM_760827.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(800795..800807,800868..801215,801310..801353)
FT                   /locus_tag="TP01_0393"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032557"
FT                   /db_xref="GeneID:3502781"
FT                   /translation="MFLACSGCICLINFPRGISNFYRIPKSLNFISHINFSPLPTTKTN
FT                   TRLFERRKYRLKIRAGGQFRIKPKTNHSVAKRFKITATGKLMYRRATTQHKQRHKRRGA
FT                   KARLHRNGIITSIRMILKCVVLLFILLCKV"
FT                   /protein_id="XP_765920.1"
FT   gene            complement(<801477..>804522)
FT                   /db_xref="GeneID:3502782"
FT                   /locus_tag="TP01_0394"
FT   mRNA            complement(join(<801477..801620,801714..801823,
FT                   801862..803065,803155..803243,803334..>804522))
FT                   /db_xref="GI:71032558"
FT                   /db_xref="GeneID:3502782"
FT                   /locus_tag="TP01_0394"
FT                   /transcript_id="XM_760828.1"
FT                   /product="coatomer beta subunit"
FT   CDS_pept        complement(join(801477..801620,801714..801823,
FT                   801862..803065,803155..803243,803334..804522))
FT                   /locus_tag="TP01_0394"
FT                   /gene_family="HOG000163444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coatomer beta subunit"
FT                   /note="go_component: protein phosphatase type 2A complex
FT                   [goid 0000159]; go_function: protein phosphatase type 2A
FT                   regulator activity [goid 0008601]; go_process: signal
FT                   transduction [goid 0007165]"
FT                   /db_xref="GI:71032559"
FT                   /db_xref="GeneID:3502782"
FT                   /translation="MSLHMGFTKKLELRTEKVKSVDLHPSEPWVASAMYNGSLTIYNYN
FT                   TQALVKKIEMSDAPLRCCKFVPRKQWIVAAGDKMCIWVYNYNSLEKVNVVEGHKDYVRY
FT                   LDLHSTLPYVISCSDDMTAVLWDIDKGWEKLAVFEGHSHYVMMAKWSPKDPNIFATCSL
FT                   DKTISFWRVTLTSTNQTLPPNPSNTANTSAAPVTSSANTVVSNVSSGKSKSSKGKGGNK
FT                   PYFTLTGHERGVNCIDFCSNLSFPYIISGSDDCTIRVWDYQTKLCLQVLKKHFKPVSCV
FT                   VYHPRLPIILSTGEDGDFNVWNSNLYKIKRSVNYGYGQLWHVASNTTDTALASDSGVCV
FT                   LELAGGKPLASMYSNKLVMVKSSDILTCNLTSSVTDLSNHDPSHSLNLSFRNIGSSEFF
FT                   PQEVSHHPNGRFICLCGDSEYIIYTSQGMKSKTFGKASQFVWSFEGDYATYDGFEVSVF
FT                   SEFTLREKLDLQQVQVQKLHGGRLLGVSTDVDILFYTWPPCMPVKRFSLQVDDIYWHPS
FT                   SNRLALASQLATYILSYNLDAPSSNRSSKFGGTYGEDLNENETEEFEEENFQFEKELVE
FT                   RITSAVWVNDTFLFVTSNSHLSMYLAGNTETLVYLDKHLHLVGYLPETQLVYLCDDSVY
FT                   GYHLPFSYLQFHSKLYHYTQVLNSVSKDEHSEFEDEELSIAKNELKQSLAKVDEKMREN
FT                   ASRFLQLFGEYELGLLCTDNPDLKFELHLKLGNVNQCLKLLLSESLNLTQSPDHTVNHQ
FT                   NADLGTVDLENVDMDTVSMDNVNVDVIMGLDDMLKRKWKRLGDYCLKSSQIKVAKLSYQ
FT                   YSNNMQNLLVLHTLTGDLEGVRYVAQTALLSKLHNVAFTAFYMLNDIDSCIQILHMVNR
FT                   HAEATFMARTYRPHLLKSSFNKWSDNLKNKVLPYNSEVYN"
FT                   /protein_id="XP_765921.1"
FT   gene            complement(<804759..>805354)
FT                   /db_xref="GeneID:3502783"
FT                   /locus_tag="TP01_0395"
FT   mRNA            complement(join(<804759..804950,805011..805121,
FT                   805193..>805354))
FT                   /db_xref="GI:71032560"
FT                   /db_xref="GeneID:3502783"
FT                   /locus_tag="TP01_0395"
FT                   /transcript_id="XM_760829.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(804759..804950,805011..805121,
FT                   805193..805354))
FT                   /locus_tag="TP01_0395"
FT                   /gene_family="HOG000135718" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032561"
FT                   /db_xref="GeneID:3502783"
FT                   /translation="MKVKSAIESENPETARIHAANSIFKRNEAMRFLELKSRLDILTAQ
FT                   VDSAIRTQRLTEELKKVLPQLNRFLRYKKLDSVDVITDFKKIFENMDVNESQMSENMSK
FT                   DSPFKPPQREVDALISRVAQEYELDMTEMLKKMKTQNESKPQSYNKPSLS"
FT                   /protein_id="XP_765922.1"
FT   gene            <805718..>808984
FT                   /db_xref="GeneID:3502819"
FT                   /locus_tag="TP01_0396"
FT   mRNA            <805718..>808984
FT                   /db_xref="GI:71032562"
FT                   /db_xref="GeneID:3502819"
FT                   /locus_tag="TP01_0396"
FT                   /transcript_id="XM_760830.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        805718..808984
FT                   /locus_tag="TP01_0396"
FT                   /gene_family="HOG000135717" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: ribonuclease activity [goid 0004540];
FT                   go_function: RNA binding [goid 0003723]"
FT                   /db_xref="GI:71032563"
FT                   /db_xref="GeneID:3502819"
FT                   /translation="MVLILTLASGSNCPERILFKLSRLKYISPYFRNYEINTLITNRLP
FT                   IYETLYNVHYTSNVKYTHTFFDPSSKKSGILKFNRSLSNPNLKYYNTASDSPQSSDLTP
FT                   SNSDTCINSEESKKHNIEISYEEYWNDADIEELEREHPELVVRGTVFIPAFATYESKLI
FT                   LTNSTNINLANTNINLNNNILKESEDHSGAKKKGTNELKIYGFISRNRAFHGDSVVAIK
FT                   SRRQKAVTHMPSQSPGAKIAYKETPGECRVIKILARSPNLSSFVSTFNLSEFFDNKLEY
FT                   VRCQPRDTRWPAFKVYKSDLNTDVTTVLNSYKSDCPNSKLDKNILCINRFVEWKKSELE
FT                   PKGGIIRVIGETGDPDSEMEGTLLFHGLDPKGFSEPVLANLNELIEEGNKTKWDNRKDM
FT                   NHLFVISIDPQDAKDLDDALSIELIPTNSPDSADGGIMYRIGVHVADVSHFVKENSLVD
FT                   LDARTRATSVYMEHLVYPMLPQQLSEDLCSLLPKKEKLCFSVFVDVCESGEGEKIGNDL
FT                   YIRDVNFVLSTITSKNRLTYDNAKTMLYGCLNVKRGGKELDLASYSFSYIEKMIEDLGI
FT                   SDETKLSLVRLYYLSQKLRYYRLKQLGAVHVDIDGSIKCHIPKLTGQNQKSDEPIDRYL
FT                   NNKGKLDRRYMLRVEKMPKESHELIEEMMLLANTQVAKFISEKIDLYFLRIHEDTSKAV
FT                   KSLIAQMLPKNLKNLIQVDKMNVTEVLSKCEHYMDPSAFQSLSFSVLQKFKEAIYSPIY
FT                   RDGNTQNTNTSNSVDTSNSVDTSNSVNSSNSVDTSNSVNSSNPVDSVNDVGRVEVRHWG
FT                   LALPVYLHFTSPIRRYPDLYTHRMLKDILYAKVRSDSVDLLSRICERCNLQKRRAFDAQ
FT                   KEYKNFAFNKYLQFLSFIAPKLDKAYLKTVSISQPFTLTQDSSDERKGGNSGVWGYLYN
FT                   DACVSSIVLNHQANSQEEAAVSESKIRKKKSKVNEMGEKRDMGKSSIVFYIPLLNEQRS
FT                   VSCDSLGVKPVNFNFDKKSKKRQRVKSSILSSYYQNSRELESEEEYGKGKSENQGTKAQ
FT                   GITVMMNTKRLHFYIYQKAKVLLIPGSKMWTVRLPIDYLK"
FT                   /protein_id="XP_765923.1"
FT   gene            <809208..>812386
FT                   /db_xref="GeneID:3502820"
FT                   /locus_tag="TP01_0397"
FT   mRNA            join(<809208..810849,810966..>812386)
FT                   /db_xref="GI:71032564"
FT                   /db_xref="GeneID:3502820"
FT                   /locus_tag="TP01_0397"
FT                   /transcript_id="XM_760831.1"
FT                   /product="alpha-aminoacylpeptide hydrolase"
FT   CDS_pept        join(809208..810849,810966..812386)
FT                   /locus_tag="TP01_0397"
FT                   /gene_family="HOG000257670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha-aminoacylpeptide hydrolase"
FT                   /EC_number="3.4.11.2"
FT                   /note="go_component: apicoplast [goid 0020011];
FT                   go_component: cytoplasm [goid 0005737]; go_function:
FT                   membrane alanyl aminopeptidase activity [goid 0004179];
FT                   go_function: metalloendopeptidase activity [goid 0004222];
FT                   go_function: aminopeptidase activity [goid 0004177];
FT                   go_process: proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:71032565"
FT                   /db_xref="GeneID:3502820"
FT                   /translation="MHIRFVKKLLSVSLIFACLYIVNCSNLTRNISRSLTPESCRFGQG
FT                   NSMPNRSLIKLRRFSFINKNQSFPNCLFTQSKLNFNYLARDSRTLVPVKDFISPFGTQS
FT                   TVFTGKGVIKEKGIFGDRADFSTMTATETQTMTESETSSVTLKPVKKFVEIFRKDYKPP
FT                   EFDVENVYLEFDLEDTETKVRSKLLMRRRPNTLPGNLTLNGDDLTCNFVAVDGVELKNV
FT                   PVSGYTLDVDGNMTVPSAFLPKDDSRTFTVETHVTINPKNNTKLVGLYKSSAAFCTQCE
FT                   PHGFRRITYYLDRPDVLSSFRVRVQADKKLYPVLLSNGNRVDSGDLGTRHFAEFVDPFP
FT                   KPCYLFALVAGNLASISTTFKTMSGRNVLVQLSSEPEDVGKLQWALESVVKAMKWDEEK
FT                   YGREYDLDEFHVFAVRDFNFGAMENKGLNIFNTALLLADVNTTTDAEFVRILSVVGHEY
FT                   FHNWTGNRVTCRDWFQLTLKEGLTVFREHQFCGDMSSTLSNRIREVQYLMSVQFPEDSG
FT                   PMSHPIRPESYISMDNFYTPTVYDKGAFVIGMYESLLGVDGFRRGMDLYFKRHDLSAVT
FT                   CDDFRLAMADANNKDLTQFERWYYQSGTPVVEVVRAERVDNKYKLVLRQSTPPTPKQPV
FT                   KQPFHIPLRLGLIGKSTGGDLLGNVLVELKEEQQEFEFGPVTEDCVLSLNRGFSAPVKV
FT                   KYEQSPEELLFLMLYDTDGLNRWNAAQSLATKVVLDLTKDPTAEVPKTYLEAYKKLLNS
FT                   DMDHNEKGLCMSMPDVDILASKMKPYDPGLLFASLRKLKQELGRTFRPTFTEMYKSLTL
FT                   REGQKDELTKEDMARRFLRNTVFSFLVSMRDMESVELALKHYRDAKVMNDKYTAFVQLM
FT                   HMEFQDRQKVVDDFYNFANGDAALVDKWFKAQAVSELESSLDTVKDLMSHKDFVLSNPN
FT                   RFNSLVTVFTYGENFHKDNGEGYKFLTDSILTVDPVNPHVSARCCTKLLKFAMLEPKRS
FT                   GLMKAQLERIFSTPNISPDLYEIAKKGLEFS"
FT                   /protein_id="XP_765924.1"
FT   gene            complement(<812887..>813964)
FT                   /db_xref="GeneID:3502821"
FT                   /locus_tag="TP01_0398"
FT   mRNA            complement(join(<812887..812987,813149..813566,
FT                   813666..813872,813911..>813964))
FT                   /db_xref="GI:71032566"
FT                   /db_xref="GeneID:3502821"
FT                   /locus_tag="TP01_0398"
FT                   /transcript_id="XM_760832.1"
FT                   /product="exosome complex exonuclease Rrp41"
FT   CDS_pept        complement(join(812887..812987,813149..813566,
FT                   813666..813872,813911..813964))
FT                   /locus_tag="TP01_0398"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exosome complex exonuclease Rrp41"
FT                   /note="go_function: 3'-5'-exoribonuclease activity [goid
FT                   0000175]; go_function: RNA binding [goid 0003723];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:71032567"
FT                   /db_xref="GeneID:3502821"
FT                   /translation="MCGRNIYYQRPQLIRQLTCINNDTLMSRIDYISIEGLRIDGRRKD
FT                   EPRNTKLFFGSETSVDYLNYDGVSEILQGLNKVQVLIKGPSELEVKGAKNVYGILEEKV
FT                   DIHCEILLSTEKKVKNSPNERLIKDLAMAVKSTYQEMIISHCYKTSSISIFINVIEYDG
FT                   SIKSTVLNAVGLALIDAGVSLKDIVSSSTVSYLDSTVLTGIHLFYYSLLDPNQMEINAS
FT                   TATLYNLYGLQVKSSTGRFQVNVRLLRFWLQDIHRIR"
FT                   /protein_id="XP_765925.1"
FT   gene            complement(813975..815305)
FT                   /db_xref="GeneID:3502822"
FT                   /locus_tag="TP01_0399"
FT   mRNA            complement(join(813975..814134,814166..814565,
FT                   814649..815033,815207..815305))
FT                   /db_xref="GI:71032568"
FT                   /db_xref="GeneID:3502822"
FT                   /locus_tag="TP01_0399"
FT                   /transcript_id="XM_760833.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(814016..814134,814166..814565,
FT                   814649..815020))
FT                   /locus_tag="TP01_0399"
FT                   /gene_family="HOG000281264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032569"
FT                   /db_xref="GeneID:3502822"
FT                   /translation="MDACLENRLKNFREEHGYDEDEDSSVYLKVRELILDGSTIKTITL
FT                   KEGERLEKFKNLSKLSLNGTGLTSLTNFPEMPSLKVLELTDNYISDPIVFTMIPKLFPN
FT                   LKILQMGGNHLKNPHDVKSLSVMPYLVVLGLAMNPMANEKNYRAVVFECLPNLEVLDQV
FT                   DSTGAEYNYSSDEALDDDLEGDADEDDLEGGDLEEEDGNYYTLSYIQLLVYYNNLYNLI
FT                   DVLKKFYEAEYKSDDDEDDDEFDPENQPDVEEDDFYEEDEDEEEEEADDDYDHKRPAED
FT                   DLENESTSSSRLKTE"
FT                   /protein_id="XP_765926.1"
FT   gene            complement(815407..>816753)
FT                   /db_xref="GeneID:3502823"
FT                   /locus_tag="TP01_0400"
FT   mRNA            complement(join(815407..815476,815583..815992,
FT                   816034..816194,816302..816337,816373..816480,
FT                   816570..816663,816697..>816753))
FT                   /db_xref="GI:71032570"
FT                   /db_xref="GeneID:3502823"
FT                   /locus_tag="TP01_0400"
FT                   /transcript_id="XM_760834.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(815446..815476,815583..815992,
FT                   816034..816194,816302..816337,816373..816480,
FT                   816570..816663,816697..816753))
FT                   /locus_tag="TP01_0400"
FT                   /gene_family="HOG000135716" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032571"
FT                   /db_xref="GeneID:3502823"
FT                   /translation="MPTPLEVYNKRIKKKEKEKRKKLRYEVRASKKLLEDPENLKKELD
FT                   ELTHKAIIGRIDQESLERKEKIEKLWEQYTKTKHQKDLEENYQSQSSDDIHSSSDSEES
FT                   SDDEKPKCVIEIEGEVKKKPVERRGFHDPEVPNDDFAKELFNNIPKLQTKVEGKTIAKG
FT                   NMAKRIKYDNKNNPVNMGGKMNYTPRPPDNTIAANIPYTLNPPPMTPSPLLPGVLPPVP
FT                   PPPQFPMVNLGTMPPQMNMFPPPVQPPPMMFPNPCVGPPSVTHKTEEPAETKEKIPLSK
FT                   YFVPSHLRLKRKNPEKN"
FT                   /protein_id="XP_765927.1"
FT   gene            complement(<816878..818581)
FT                   /db_xref="GeneID:3502824"
FT                   /locus_tag="TP01_0401"
FT   mRNA            complement(join(<816878..817585,817677..818581))
FT                   /db_xref="GI:71032572"
FT                   /db_xref="GeneID:3502824"
FT                   /locus_tag="TP01_0401"
FT                   /transcript_id="XM_760835.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(816878..817585,817677..818486))
FT                   /locus_tag="TP01_0401"
FT                   /gene_family="HOG000135714" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: ATP-dependent peptidase activity [goid
FT                   0004176]; go_process: ATP-dependent proteolysis [goid
FT                   0006510]"
FT                   /db_xref="GI:71032573"
FT                   /db_xref="GeneID:3502824"
FT                   /translation="MFMCRIFSIFCANVLIAASVNHISGVNCIFKDSRHTCLSPKFTFI
FT                   SSNSTSLTPSNKNPQIKYNYNNHKCDNAKFKYNSKNTGFDIEPENLTGVSTTDDYKSTA
FT                   ESLEKENVDFIDNLSNVTASTSQVDSSDNNYFDWQSITDLKNPSNSTDSSALNVANPDI
FT                   KTVVNNLDGEKRNDVEEGEKPLITGSGLNSELKVEDYEIGVSNGRLNEWPVEWVPGRKV
FT                   LSFFPILIDQYSVNPNPIQIGFEDTIRFRGKHVESTFNSILDNLNDKQIFGMCFLSPES
FT                   MQLAPLAVYAELISKETVVDGSGENLLVTGRVLGRALINRVLLDEPFIKALVSPYEDEP
FT                   ALHDADNIPKIVDEIVNLYDSCNTVEAEIMELLQQPYAHLRVKNRSKLMDVIDDRLNKF
FT                   NINNNVNQGFAQIAAYSAFDYHLNASERYDALAMQNTEDRLRFVRDTLKFKAKQLGVVK
FT                   NSPKDRLEDLVKQLKNFQNDRDSMYSFSESLSEAPNSESVAANSNSQ"
FT                   /protein_id="XP_765928.1"
FT   gene            <818674..>819087
FT                   /db_xref="GeneID:3502825"
FT                   /locus_tag="TP01_0402"
FT   mRNA            join(<818674..818775,818926..>819087)
FT                   /db_xref="GI:71032574"
FT                   /db_xref="GeneID:3502825"
FT                   /locus_tag="TP01_0402"
FT                   /transcript_id="XM_760836.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(818674..818775,818926..819087)
FT                   /locus_tag="TP01_0402"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032575"
FT                   /db_xref="GeneID:3502825"
FT                   /translation="MNKKVDMLISTLNRIKDVSLKFKNPSFNHYFSKKAEDCLEMVNNK
FT                   RENLTEEDVEKLINEYSELENVLNRQTTVQNLYYSDKTDVDK"
FT                   /protein_id="XP_765929.1"
FT   gene            <819423..>821550
FT                   /db_xref="GeneID:3502915"
FT                   /locus_tag="TP01_0403"
FT   mRNA            join(<819423..820215,820384..821115,821223..821328,
FT                   821436..>821550)
FT                   /db_xref="GI:71032576"
FT                   /db_xref="GeneID:3502915"
FT                   /locus_tag="TP01_0403"
FT                   /transcript_id="XM_760837.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(819423..820215,820384..821115,821223..821328,
FT                   821436..821550)
FT                   /locus_tag="TP01_0403"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   sodium:dicarboxylate/tricarboxylate symporter activity
FT                   [goid 0005311]; go_process: dicarboxylic acid transport
FT                   [goid 0006835]"
FT                   /db_xref="GI:71032577"
FT                   /db_xref="GeneID:3502915"
FT                   /translation="MVEDNDIEECVTPSNSYYSNFVPENNSNDSIKGVGEFKDIDLSDT
FT                   YTHYTISVENSAVNGGNNEKEGILEYILDSKLYLKHHDNLELSCITENINRNSKDFGHI
FT                   NRINPSLSGFGLGSISKYHRLLIIISFALSFISNFVGHFIREPLFTTKVNIQKSFGSST
FT                   LQLGYLDISYLTLYGIGHLVTPFVFSRSYVITFVSIFHLFLSITHFILFLAESLGWFIM
FT                   IYGVTGFSCSVLWLSIYNDLHTWLPLKHRFILLTIWCCSSELGLSLGTIMCAHIQTETR
FT                   WKILFMITSFINFVTGVLLFTCYRKPPRNSDEPNPLELTVPETKLFDPVNLSKDNINNI
FT                   KQYFKGMRDNNSDVSGVCKNMVEMSTKVVKGHLNVMKRIKYLFIYILGYTCLRSARNCF
FT                   AFWISFYLTTKLKYSIKSGIYATFVFQMGSCLGSLVAGALSKLLLKKYHLLSCAIASLF
FT                   SFLLCPFIYFIEPDSVWKTFTFVFIFGLATNCTDLLITTRGLKTLCESSQEGAEADDYS
FT                   VSLGTTFSISTFLSVLYGYISTYIAHHYGWDKMFLYLCVLMLLSTGAFGVPSRKEILGY
FT                   IQSIL"
FT                   /protein_id="XP_765930.1"
FT   gene            821525..822695
FT                   /db_xref="GeneID:3502916"
FT                   /locus_tag="TP01_0404"
FT   mRNA            821525..822695
FT                   /db_xref="GI:71032578"
FT                   /db_xref="GeneID:3502916"
FT                   /locus_tag="TP01_0404"
FT                   /transcript_id="XM_760838.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        821625..822680
FT                   /locus_tag="TP01_0404"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032579"
FT                   /db_xref="GeneID:3502916"
FT                   /translation="MGFSLRDLMKREKESRKRPSSSSGELNKDKIQKTSQENDKSGSVK
FT                   ENFKDNLKENVKDNSNVKVRDRLEENIPESDSKPEIGPETSKPEVTPANKEEPVKILPQ
FT                   TLSEDSADLNVVEETYVLLDDEDSVLSERSDNDENKSKVSQHEVKVDEERALDENRLVY
FT                   EQLNTAYCSNLEYEHESILKEVGVDSNLGLLDQFDSDNYGDSSKNSNVIVSSNFGVSNV
FT                   SVSKSENLPVGFFDDANVDAKARGKLTAKEAKDKIRELSKKRSTYLDEARYVQEKSVEN
FT                   HREKLRMENDLLDHEETLKLLKKKVSEIKNTLVVDTSDLKVEPENSKTDDKSLEYDLDY
FT                   DNLSWMSRSII"
FT                   /protein_id="XP_765931.1"
FT   gene            complement(<822796..>824851)
FT                   /db_xref="GeneID:3502917"
FT                   /locus_tag="TP01_0405"
FT   mRNA            complement(join(<822796..823244,823491..823600,
FT                   823677..824577,824713..>824851))
FT                   /db_xref="GI:71032580"
FT                   /db_xref="GeneID:3502917"
FT                   /locus_tag="TP01_0405"
FT                   /transcript_id="XM_760839.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(822796..823244,823491..823600,
FT                   823677..824577,824713..824851))
FT                   /locus_tag="TP01_0405"
FT                   /gene_family="HOG000135713" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032581"
FT                   /db_xref="GeneID:3502917"
FT                   /translation="MDGNEYIEAEFRVKDERFDASEIECKLAKFNEVALEHDSSINNSN
FT                   DALYGNFSPGNQTQKLCINSVYDVLNFLSQFTGSFSLIYISLHTGRIYILKDDYGFKSL
FT                   LVSFNTENKTVVISDKALNTNGKCYELPPFITLLFGKNLSMYLRPKSNIHKLTGKEFPQ
FT                   TLITDDLVNHVINNIHNELISSIKEICNVSGPKECVSILFSGGLDSTLISVITLSQTKF
FT                   SYYQLINVCFKDSADVSEFGVAPDRITSLLSYEELVNLFPNLDIRLVLIDVSSEDYSRD
FT                   EPEIFALTYPNNTHMDLNIGASLYYAGTLKGKLLSKEFFKSKDWSQMKSNISILKSINF
FT                   KVTISKKNSVKSGVFMELDESQAESDSNINLSEFLSELNKYCTDIVRLWKRNFGRDDRV
FT                   LNFRNLNALYPFLANNIVNSMLTLPFNPAVIVDFLDPPNWFKSLNIYRGIDANLLLNSE
FT                   FLSNSSGKSVSIFINKWILREIAYMNGLRMCCNFKKRAIQFGTKSAKIFNRLHNMSNRH
FT                   ASNKGSNILHLYISS"
FT                   /protein_id="XP_765932.1"
FT   gene            <825402..>828218
FT                   /db_xref="GeneID:3502918"
FT                   /locus_tag="TP01_0406"
FT   mRNA            <825402..>828218
FT                   /db_xref="GI:71032582"
FT                   /db_xref="GeneID:3502918"
FT                   /locus_tag="TP01_0406"
FT                   /transcript_id="XM_760840.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        825402..828218
FT                   /locus_tag="TP01_0406"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032583"
FT                   /db_xref="GeneID:3502918"
FT                   /translation="MSDSLKIKREPVDSISSADLSNNTPSERRVTLEQVVRCADDKRKY
FT                   ELLTLFSVELLKLESVEIDEFFSALTLLKLLIPPQNLLNTNNNVLEKTSEILLQYVKIL
FT                   RLNSEFDEVWGGIKDCNKLFQMYKLIHEEGCNYLLPNVKAGEFFNKFLCQLISSSSSVS
FT                   FFYSVVMLYRGKIEEIFSKYKGNNVSTEDVRVIISIMKTLLTVTKAFGSPPAPRELLCS
FT                   VSISVLKNTKAHLCTLYSYNLLAFLIKDVTDKSLLDKLFNGLSSLQIDQVTSLVKECNS
FT                   LANTSTWKFKHTFNTTTENTVNNNSTNNNIATVTNANTTFRKNNNSMNNASNEHMVESV
FT                   KRKLNAVDNNMDSNKRKKKDVPELPVNWYKELMSKFETNRGEGKSMVVDKNAWKWKNDA
FT                   LTNTLKMVEGVESVDLQPVEAQFISLFEGLFKYESAIPVVINSLNLYRVLLVKGNCDFL
FT                   SGGKSQLLAELLFEKLKESNRKVRDACVMALVESVKRCRLAVLSDSIKKSTLNISPTCR
FT                   ENLYNFLNCKLVSYLDHEFVQKLQQLLNSVSEYLKGLENDKVPKVRMAYNALVAVLDDF
FT                   NLIYNNISTISTSSTVVTEASKPVQEDNGKPAQEQVSKLPKEVPKLVRDVSSKPTQQVH
FT                   SESTQQDVTKPREEEAEKSNLDCTTTADSSATSEEFTSAGVPEGVPEVEVLDSVLMGLL
FT                   DNLTHIVDTNILATFKKYGSEGSNRVLEDGLRQLSVWLRGNEKLLKSVDYYVVKLISYL
FT                   YSKFTNVELLQEFFNQLLNYQLTDEAFNELVEVIKVNNALKLLNTLLSKDNANTNKLLN
FT                   PLNAYYYKDSTCLTHFISILHQYFSQSYVKLPSSVMVKVVNFVVYNVKSKLYIVGRMSL
FT                   ELLSAMNERSEVVCYLDKHLRNTLLYLKPSDTVKNACKESQTRVEKYVSKDLFNCMFKD
FT                   KSNIKRCL"
FT                   /protein_id="XP_765933.1"
FT   gene            <828353..>831615
FT                   /db_xref="GeneID:3502919"
FT                   /locus_tag="TP01_0407"
FT   mRNA            join(<828353..828402,828507..830721,830860..830961,
FT                   831035..831102,831240..>831615)
FT                   /db_xref="GI:71032584"
FT                   /db_xref="GeneID:3502919"
FT                   /locus_tag="TP01_0407"
FT                   /transcript_id="XM_760841.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(828353..828402,828507..830721,830860..830961,
FT                   831035..831102,831240..831615)
FT                   /locus_tag="TP01_0407"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032585"
FT                   /db_xref="GeneID:3502919"
FT                   /translation="MLLGKARKDLTSWLSYTMYEMKCEKVVLEIFDIMADYMSLKCEFD
FT                   EEESLLLLSAFVSYSFFGKYQLKALSVFSKLVKLFRNSFESLEFLFGAVDNCSEKWQQL
FT                   MSEALVRLVRNATPTESLVQFLKRKLDSCFTLESTHKRLIYQWINNFTSPILNTNNLVV
FT                   CGNTVDTVDRVSSVSTLDRVPSVSNVNTLNPAVNVNRLESTSTLDSLGSVDTVDTVNRV
FT                   ESANTVNRVDYMNTVSGLENVNTVPVVDNSELNRMETVCEDYEQAIEPLSTTGSASDAQ
FT                   FPIQYTSNFVTVSIQTDDSPINTSNTVDRVDRVDRVDRVDRVDRVDRVDRDDTSNSNST
FT                   VENVDPVVTVKNVGKVDVVKEMDMESAFEKSFEKTFEQTFEKIDCGNFDKNISALRHSV
FT                   KNKSVVLDNPDTTTDRVDNSKDTTVDKDEGSVVTSLQLPNNTPEATTTHDTVVKDTSVS
FT                   VMGKEPPINMVDKRVDSVEKEKMNDQVILDEDVTNDVESCKSLAKQIISSNSPPSNTRK
FT                   SNTVTLDSVSFDSVSFDTSNVHIVNENVGVENSALNSASLVNVDVEDGEFYEENGEVTT
FT                   ISCTSRYNQCNSPINIINTVNTSDTATNTTNSVDPVNTGNRVDNMVENLEEEGSDESYP
FT                   SVVVEYDSDSELACGDDFSLSLVESVLSHCSKVNKICLVSSYKEYKSLSSTLCQEDVAK
FT                   VCLDSCSEILKYKNVLKYLAVPLVEMTHNAILLMTKRIIDSTLARDNTHDTFVEPLILT
FT                   IEVFKSITMELNENFILQFCNVVTNLLSLPKQLFQNERLYCITSSLVSENGLKQSNHII
FT                   SKMLMVMVELSMESLKGEVDRLLMAKLRFTKILQMQLLINSSQNNSTSIVNTSNNSNNV
FT                   GNTSNIGSNRVNSGRMEDKEESGGMNELKSVHVDFIERLEKFANKSSAHSVEKVIQTSN
FT                   YIISTI"
FT                   /protein_id="XP_765934.1"
FT   gene            <832481..>835390
FT                   /db_xref="GeneID:3502920"
FT                   /locus_tag="TP01_0408"
FT   mRNA            <832481..>835390
FT                   /db_xref="GI:71032586"
FT                   /db_xref="GeneID:3502920"
FT                   /locus_tag="TP01_0408"
FT                   /transcript_id="XM_760842.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        832481..835390
FT                   /locus_tag="TP01_0408"
FT                   /gene_family="HOG000135712" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032587"
FT                   /db_xref="GeneID:3502920"
FT                   /translation="MLLLVKLLLLFGLLAARPPVHSVTLELTELDNDFSKTTLSYFVSS
FT                   TMVRFDVKDDKVVDKVTLDNLSVWSPPDDTEKLRCAKVIYNEFGPRLVLLDSKSKYGKH
FT                   ELLYYIYTLNGWVLLNSVNPFNISLQENEVEKEHKSPLHLVNGDVYTNFTHKLGKTDGT
FT                   VDTVKNSVVKTQQLPKAVDSGKSSDLSSLVLATTTSGNTSVNTVNSSNTVDGVDGVDIF
FT                   GISGVDLSNVPEPPVCRKCTYVVDGILYTIHYFHFKTKFRRVYYEGQQLYEVPKGKHLS
FT                   GSCVYSRNSKVIFVDFLLSSPGKTHFVYFEHTSAGFVKLPKEEFNERLQKYKSIPTTVD
FT                   LSTFNSKTYSVTTSKRLNKRKMDESVSKVDCMLYTPNDGYVIRRVIDGDLLVLESDNDI
FT                   LEVLYYNLGGQKLLSMILQEGANFQYEYYTYFGDLGKWSKSSEYFYYKLIDEYVKKSEG
FT                   KFSLDLKTTTNNKYLIVQKDGFLNHLSYFPTTSALVNVVYDHGRLVWTARKPRESCIFV
FT                   WHQYLYNLVYVVSTCDGQHTNYHYQKNGETWSFIAYEEFRRRFSFIYSTNDVLDLKDNF
FT                   VGFDVTENGNAFTIKPKHFHLISKVTYGSVVLWNSLPNLKCFSAKIIYGANSTQAYLYL
FT                   KDYEGRTFTTLYKTVDNDFTKWELSYSETATLDEVGTLPTNVKVENFKDKVENKVEDSV
FT                   GNALENAEKLEKLEYRLEKLEDNLEKVEEKSDNATVDTTDKVEENAEKEDKLDSKLELT
FT                   DKVENRDENTLENTVDKDENRDDNTVENTVDKVDNTLENTLDKDENTVENTVDKLDSKL
FT                   EATDKVDDKADVDKSVETVETTVDNGDKVVETVESIVKLVDVVDGYLGGVFDLQKMKKT
FT                   EYGDYVDARKYGLNYLLFTPHPGYPVRDLRDGLETIWKSSTQECVALSVFLRDDAPVMV
FT                   ELFVKCSVEVSRKFFQLKFNRWYPVDSHTYDILTDSLQN"
FT                   /protein_id="XP_765935.1"
FT   gene            complement(835669..836936)
FT                   /db_xref="GeneID:3503112"
FT                   /locus_tag="TP01_0409"
FT   mRNA            complement(join(835669..836292,836371..836936))
FT                   /db_xref="GI:71032588"
FT                   /db_xref="GeneID:3503112"
FT                   /locus_tag="TP01_0409"
FT                   /transcript_id="XM_760843.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(835711..836292,836371..836850))
FT                   /locus_tag="TP01_0409"
FT                   /gene_family="HOG000135711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032589"
FT                   /db_xref="GeneID:3503112"
FT                   /translation="MNLIVELINYTNKYLNELDLLTYVLPLPFTDDNILTQKCLLSKLL
FT                   SNSSYLSKGQLYHTLLHIINLINSHTTNATLNAVDTTVATPNTVDTGNTISKSKTNKNM
FT                   LDYNKYINVYDTVYKRNVEERVLNKRSTRLMDKSLEEVDSFTEIHTPEEIANSIFELLK
FT                   MICDPLSVGFILIIGCKLLGNAVAESEVTSIIPLAGGVVQLLDPEEHCIKGVWCDPNLP
FT                   PKAQSELCKILFLRLLSHAFNFPFPGTNTTQRFKHISILNVYGILFPKCLYNFLVKSLK
FT                   FGRHYETGASGGSHEDSATNPCKCLRLSGSEDSHLFWGISESRLKTSYSSIKSQLPISP
FT                   SNDIHKYLHSIYT"
FT                   /protein_id="XP_765936.1"
FT   gene            <837067..>837496
FT                   /db_xref="GeneID:3503113"
FT                   /locus_tag="TP01_0410"
FT   mRNA            join(<837067..837234,837314..>837496)
FT                   /db_xref="GI:71032590"
FT                   /db_xref="GeneID:3503113"
FT                   /locus_tag="TP01_0410"
FT                   /transcript_id="XM_760844.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(837067..837234,837314..837496)
FT                   /locus_tag="TP01_0410"
FT                   /gene_family="HOG000281836" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032591"
FT                   /db_xref="GeneID:3503113"
FT                   /translation="MGLGESLKNIALFPLKFLRYKTASNVKRERVIKLGILCRKSWVLF
FT                   PPIMLYQYLRQTDRDHFTTELFYKNSSSDDSKAFYDPDKPKHLRNWKIQSDLALLSLVA
FT                   NQKFNQTEENDE"
FT                   /protein_id="XP_765937.1"
FT   gene            <837750..>838061
FT                   /db_xref="GeneID:3503114"
FT                   /locus_tag="TP01_0411"
FT   mRNA            join(<837750..837906,838000..>838061)
FT                   /db_xref="GI:71032592"
FT                   /db_xref="GeneID:3503114"
FT                   /locus_tag="TP01_0411"
FT                   /transcript_id="XM_760845.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(837750..837906,838000..838061)
FT                   /locus_tag="TP01_0411"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032593"
FT                   /db_xref="GeneID:3503114"
FT                   /translation="MLLFLLIINTFCKIIYTFDVNDVSNKLYREISKNFTIQHKSQTDK
FT                   QFQLNPKYVKRVELVLREKYGGKPKLY"
FT                   /protein_id="XP_765938.1"
FT   gene            <838123..>839192
FT                   /db_xref="GeneID:3503115"
FT                   /locus_tag="TP01_0412"
FT   mRNA            join(<838123..838205,838219..838258,838290..838355,
FT                   838435..838500,838534..838827,839088..>839192)
FT                   /db_xref="GI:71032594"
FT                   /db_xref="GeneID:3503115"
FT                   /locus_tag="TP01_0412"
FT                   /transcript_id="XM_760846.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(838123..838205,838219..838258,838290..838355,
FT                   838435..838500,838534..838827,839088..839192)
FT                   /locus_tag="TP01_0412"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032595"
FT                   /db_xref="GeneID:3503115"
FT                   /translation="MFRQMLNDYYQKYYIYYKFYTLHYTSYMDKEDVKIFDDSLQNHIT
FT                   NNFNEDYVNDYSKLDDHQESGNELETARVIIRLIKREFEKFENVKNECIVPNLGRFSQI
FT                   RSLARDLPVPSGTDTPCRTQASCDKLAMLMNLCSYIRTGVGFAYDIYATMIHVLGNMLS
FT                   VLCGCIFVGPAHVCLLKNFPVKITTNLCRIYGGNYHLITLLQISDLAQSSPNLF"
FT                   /protein_id="XP_765939.1"
FT   gene            complement(<839347..840063)
FT                   /db_xref="GeneID:3503116"
FT                   /locus_tag="TP01_0413"
FT   mRNA            complement(join(<839347..839870,839988..840063))
FT                   /db_xref="GI:71032596"
FT                   /db_xref="GeneID:3503116"
FT                   /locus_tag="TP01_0413"
FT                   /transcript_id="XM_760847.1"
FT                   /product="60S ribosomal protein L6"
FT   CDS_pept        complement(join(839347..839870,839988..840033))
FT                   /locus_tag="TP01_0413"
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L6"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032597"
FT                   /db_xref="GeneID:3503116"
FT                   /translation="MKSLFTSQVLKIPPEVSVDVKSRRVTVKGKYGELTRSFTHLPIDL
FT                   SLSKDKKSVVVRLWFGSRSKIAALRTCLSHIENMMTGVSRKYQYKMRLVHAHFPINSNV
FT                   SDDGKVVEIRNFLGEKKLRVVRVLPGVHVTKSESVKDELVLTGVDVESVSRSAALIHQS
FT                   SLVRKKDIRQFLDGIYVSEKGNVDEA"
FT                   /protein_id="XP_765940.1"
FT   gene            complement(840387..841637)
FT                   /db_xref="GeneID:3503117"
FT                   /locus_tag="TP01_0414"
FT   mRNA            complement(join(840387..840483,840515..840581,
FT                   840824..840994,841138..841637))
FT                   /db_xref="GI:71032598"
FT                   /db_xref="GeneID:3503117"
FT                   /locus_tag="TP01_0414"
FT                   /transcript_id="XM_760848.1"
FT                   /product="40S ribosomal protein S15"
FT   CDS_pept        complement(join(840550..840581,840824..840994,
FT                   841138..841489))
FT                   /locus_tag="TP01_0414"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S15"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71032599"
FT                   /db_xref="GeneID:3503117"
FT                   /translation="MFSVRNVINWNYLKTSKLYISNVKVFRIKGLPFEKVKAPKTEWYK
FT                   RAESEFLSERAQIPTGYVGRWNELDLANLDERVRKILSLRCASGREIRRARTFMIMKHL
FT                   QKEPFDTGSLSVQLGCVSEKILNLRSHLIRHPRDNSRKRAMSILLSRRHKLMKKLYQQD
FT                   FKLYQHTCEFLSCKSDWCGWR"
FT                   /protein_id="XP_765941.1"
FT   gene            <841675..>843408
FT                   /db_xref="GeneID:3503118"
FT                   /locus_tag="TP01_0415"
FT   mRNA            join(<841675..842670,842761..>843408)
FT                   /db_xref="GI:71032600"
FT                   /db_xref="GeneID:3503118"
FT                   /locus_tag="TP01_0415"
FT                   /transcript_id="XM_760849.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(841675..842670,842761..843408)
FT                   /locus_tag="TP01_0415"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032601"
FT                   /db_xref="GeneID:3503118"
FT                   /translation="MECIIRELELLLLDPCNDLNDSRIDKIKQTSENNVIDKVNKIIDL
FT                   ILSVKNVDLYSSLILLEELFGKPVLINCNITLWDKSNYFNYINDSFTSFLENSNDFIDF
FT                   QLNSFVLLCTIVLCINVVVRANWIGPKFSLQNSQKTLSDHFRHHITQQENGNTCANSDG
FT                   FGEKTSISRQNIELIKNLDVNNSEKCYLLGKLYEDLCGKVVLKSPELTLTDSDLDEKSK
FT                   EFLKQLLNEFVIDGETVYEGTLALQYLYTSIILLHLLDEYIYKNEKAHGNSVNSSAKDT
FT                   SKVDILKSKEIWRNRIGYIYQLIIEDSGLILCPTLYHCSITNFLHFLTLSQVMDEEFSV
FT                   FNIDVTNTDVSYVKNVLMRNVDVGMEFDDYFKSLLLIELLQRLPIYNLNRLYEPVSQKL
FT                   TNYLNFSFEFTGKLGIRRKFQSFSIPQLVISYSKPFSTHSSTVSNSLQSNKSVENSEID
FT                   KSLGNSEINGKLEDKISVGLNEINEENDIFETPRLDEDENSEDLNDLEQLFLLSRGLNI
FT                   IATTSQHDQLSLQFLNTISSTIIQRIFNIN"
FT                   /protein_id="XP_765942.1"
FT   gene            <843482..>843760
FT                   /db_xref="GeneID:3503178"
FT                   /locus_tag="TP01_0416"
FT   mRNA            join(<843482..843584,843672..>843760)
FT                   /db_xref="GI:71032602"
FT                   /db_xref="GeneID:3503178"
FT                   /locus_tag="TP01_0416"
FT                   /transcript_id="XM_760850.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(843482..843584,843672..843760)
FT                   /locus_tag="TP01_0416"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032603"
FT                   /db_xref="GeneID:3503178"
FT                   /translation="MLMSLWLRCKTEYNRTKTIERATMQLNNILKSYYDDGNRNEYFFQ
FT                   ISYPAIWNIKREIGKFQL"
FT                   /protein_id="XP_765943.1"
FT   gene            <843876..>845387
FT                   /db_xref="GeneID:3503179"
FT                   /locus_tag="TP01_0417"
FT   mRNA            join(<843876..843956,844022..844113,844204..844468,
FT                   844618..844719,844761..844817,844914..>845387)
FT                   /db_xref="GI:71032604"
FT                   /db_xref="GeneID:3503179"
FT                   /locus_tag="TP01_0417"
FT                   /transcript_id="XM_760851.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(843876..843956,844022..844113,844204..844468,
FT                   844618..844719,844761..844817,844914..845387)
FT                   /locus_tag="TP01_0417"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032605"
FT                   /db_xref="GeneID:3503179"
FT                   /translation="MYKELHMWEDVIKCLILTQQKQQATELINERIKIMATPLLYCFLA
FT                   DISNDIQHYHTAWELSNERCGRAVRSIGVKYYNDGDYEKALEYLEKSLQLNPMNESVQF
FT                   LVGCCYLKSLKIESAITAFSRVVSINPDNSDAWANISSAHFKMKNYQSAKIAITQALKN
FT                   NNTRWQFWDILLRISANLNDVKYTCNCIQTLINLGMKDKIEVWMVKYLVDSSGDELNSS
FT                   VVEETLRLIVSNITESAGVWSEYSRYLSSKKDYVGALESKFKQYRKVEQNIQINLNNTN
FT                   DQLNGSHEKFNPLELELVEVLRSMVELVNKVDDDGYKERVLDSLNGIKLRILKRAPEDN
FT                   QLHVNQINDLINLLKH"
FT                   /protein_id="XP_765944.1"
FT   gene            complement(<846312..>847498)
FT                   /db_xref="GeneID:3503180"
FT                   /locus_tag="TP01_0418"
FT   mRNA            complement(join(<846312..847270,847384..>847498))
FT                   /db_xref="GI:71032606"
FT                   /db_xref="GeneID:3503180"
FT                   /locus_tag="TP01_0418"
FT                   /transcript_id="XM_760852.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(846312..847270,847384..847498))
FT                   /locus_tag="TP01_0418"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032607"
FT                   /db_xref="GeneID:3503180"
FT                   /translation="MIVAGSLVLMLIGIPRNWTPNQVLSHLIGSHFKLTNSQQILCDEY
FT                   ESDLESDDINRLQLKSTFKKDCQSLGIKKFFLLFGDGTNAVNEIPPYFPVSLNPEEGKK
FT                   FPSNDSQDGRKFVPNDVPEGLGLILFESEDYALKFWSVLGTSLIQAYPSTMRLCPDPSG
FT                   WRIYSEAISYTFTTELLNSPATVSRVKNDTIDLLSVLTTSNPSPPYNSNSPVSTTINTN
FT                   ISSAGSNPGANGKPRGTLIYVCAYIYSQEEANMVAKSLGEFGVKCMYHKPSKIMSLQFP
FT                   DENTLQTLSFGHKIFTTPTGSRVQCCFIRCKGKALPILKRANLDHLSNLYDPKKNTQLK
FT                   PNKFKPPSQGILIVDQL"
FT                   /protein_id="XP_765945.1"
FT   gene            complement(<847593..>848672)
FT                   /db_xref="GeneID:3503181"
FT                   /locus_tag="TP01_0419"
FT   mRNA            complement(<847593..>848672)
FT                   /db_xref="GI:71032608"
FT                   /db_xref="GeneID:3503181"
FT                   /locus_tag="TP01_0419"
FT                   /transcript_id="XM_760853.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(847593..848672)
FT                   /locus_tag="TP01_0419"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032609"
FT                   /db_xref="GeneID:3503181"
FT                   /translation="MWRSPNPRMDEDKRINESKASQSHKFPYKPSDNNPRPRDHNDSNH
FT                   SHNINFNFNNKHNSDKHLKRDFNKKSDNYNKSENYNKSDNYNKSENYKSDYNKSDNYNK
FT                   SENYSKSDHYNEKHLKRDFNKKSDNYNKSENYKRDNYRGEKRRYYQDYENSRKKSHKYS
FT                   SHSHSGRDKKSEIGRSKRRETVVNEEINSPRTPLSDVHSPSNKFSPPPLPPFEPPTNTR
FT                   NLNDSKFPNKSNKSDKQDKSETPLTFVQYYENKMNEGKYKEFGPDPRLTDQLYGSKMVT
FT                   KFEIPTLNSNVSLESTLDSPRFTLKVKYDSVYTFDQFFKTPLERINGSLLSPRPKINDE
FT                   WWLKGILSYYSIYCILCLL"
FT                   /protein_id="XP_765946.1"
FT   gene            complement(<849521..>852637)
FT                   /db_xref="GeneID:3503182"
FT                   /locus_tag="TP01_0420"
FT   mRNA            complement(<849521..>852637)
FT                   /db_xref="GI:71032610"
FT                   /db_xref="GeneID:3503182"
FT                   /locus_tag="TP01_0420"
FT                   /transcript_id="XM_760854.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(849521..852637)
FT                   /locus_tag="TP01_0420"
FT                   /gene_family="HOG000135710" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032611"
FT                   /db_xref="GeneID:3503182"
FT                   /translation="MLVFYNANFSKIRVLNLIFIISLFVNYCNSFLYSKNGKISHLPLT
FT                   HQFKSRNNLPKFKCSPDSTNYVDKRPYAYSENVIGLLSTPEKRIEIIRSLYDSISKGKS
FT                   RFSSLLYVTNSHEDLVNVHNVISNDLNNDSGIFNGINIIFNESVKLYKNFTITLSDYSA
FT                   LSECLTNFGGIDLRKKALTLNCDLVRGRRINSFKSILKKVLESYFTNLDPFTNIFSDKN
FT                   LRIHLDDDFLVPANEFIDSNFKTVEQFVDLFNLRNTGENLLEHTDKPRGKSEIQMNDEK
FT                   LVIFNNFGVNYDMKNSKVNCSLYDDLILRLGPNCTFIGLSSSIYNVNNVANWLNALSKP
FT                   TKVITLSKVPTFNLLTKYGHLNPFDTSTKNIANNAIIDPVNTNTNTDDSVDTNNSVGAS
FT                   QTGDGVENVVDPKKMYDMFKKKNNKTKLTSLNPSLDELVIRSIIEALETRGITTYNQLV
FT                   TVVPSARRFFRQYLRILRRSPAYLDSKNRLYNLLKLIVNVRENKYFSKFIKNFHLYPLV
FT                   NVLHDPSPPILFEYIKQRGLYPTVVYCFNDMERISRLFYGYLNSLAGEDIGGNPQNEVN
FT                   SDGSSFEPFNDIILSSEKIEGAKHYIFLDKLEMQEWKLFTPSNEFLYTLTAGSDLVTFT
FT                   VHFHTLFHTIKSLISPIYFNYSHFNNANNRSSSLTTPNTTRPVVTHKATETSNTHNTTH
FT                   PVVTHNATDTGKISNVAYNGEFGSYLKECKEKYERMFPDYFALKELIDSSENRLKAMNV
FT                   DTFKLMQINSRLTKSREFFETMSNSLLSKLSFRGYSVYILIKSLRNKISIIQGADNQQY
FT                   STVPKSSYLVNNFARNELMGFYPNGRGNVLLKNVKTGNYIITTFLFLKDVMSIREQTSE
FT                   DSVNVYDILKDLANVKTRKIKVDNDLRKYINAENMVISVVSKDYVRIRKLSLLLPAFLK
FT                   NLIDEHITSYNESFNSLMDLINNNRNTVNGVTSVNSTLSSDEMENNVNNDDEMENIINN
FT                   DDEMENNVINDGVMKLVDEYLNLRKRYKRRNLEDVIKNYQFKNAFYGRS"
FT                   /protein_id="XP_765947.1"
FT   gene            852847..852919
FT                   /db_xref="GeneID:3503183"
FT                   /locus_tag="TP01_1242"
FT   tRNA            852847..852919
FT                   /db_xref="GeneID:3503183"
FT                   /locus_tag="TP01_1242"
FT                   /product="tRNA-Thr"
FT   gene            <853273..>857769
FT                   /db_xref="GeneID:3503184"
FT                   /locus_tag="TP01_0421"
FT   mRNA            join(<853273..856089,856186..>857769)
FT                   /db_xref="GI:71032612"
FT                   /db_xref="GeneID:3503184"
FT                   /locus_tag="TP01_0421"
FT                   /transcript_id="XM_760855.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(853273..856089,856186..857769)
FT                   /locus_tag="TP01_0421"
FT                   /gene_family="HOG000135709" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:71032613"
FT                   /db_xref="GeneID:3503184"
FT                   /translation="MDILKNNQGVQIEEIYSLHCIYYPVKILNYGGLRSDRFPVDCMSE
FT                   CAYASLLEKSKFSTNIKLNESSIKGSVRSELLRFCFKISPFITTELSNSVYSLVDVTFP
FT                   KHYPNKPPFIVLKMTIPMNNELKKRLKLKLTKEINRLTGQHCLFEISIFLADFMAKVNS
FT                   DREILFEDSTAREFTQDYRSVSSDSSHSSNSSNSYITNTVTNISNTVDGANKTEYINSE
FT                   RILEESVDNLVQVGVNKQHKEFEFPVWSIQSIVQAPIWYENFEEEDENSSDLQLEKATK
FT                   TPSKVGFAKKQTHRLVISEVTSESSIRSKESEDQKIRSVTNIELYFTLESEVNLKLIKK
FT                   LLLEYTGDTYFRFQMDFTSVETVNSSISSSLLSVKHGLDQNLYYIKAFHLPSLCPYTNL
FT                   SNLNVSNLLHLFRVKRRIILNEMISRVSHLSKLEHNSLCRYYQSWLEKKPDPSIIEFLI
FT                   HNIDTLLKYRSFSSLYNSNTNNSVESSVVTSKQFGNTSDHSSNTQGSLESHTDNTSNSV
FT                   ENAQNELLILLLKYFPGLGEHYLYEIVTERNLYVQAQNINCHTLRHEIETNSLWKDEKL
FT                   IWRFIRHLLDVLAYLHQNNVYHQSLSLDNIYVHNDLYGTGRGLKVSEFGITGLARKLLK
FT                   LENECDRKFCDCKRYKKSLKTQLYLSHPSNYNLTPTTLSNITSNFTSNIHSRLYSIDFD
FT                   NLNIPNTVNNNTGNAVNNSISSINSVEGISSSVNLENSVQLLNNQLKGGLLNNGMMGMS
FT                   SALASIKSSELDELQFEHNWDQMAAVQEDMFALGLIIFSMWHPPVEESALYELLCYVIG
FT                   TQTFPDYFLQTTPSIIITTLKRLLTRERRPTAVELLRETLVPPVVDIYMYKQYLRKLEN
FT                   PQSDESLDALKFLMHRDWKSDVSKYKHDSTLETMTHNSYVTDTLERFMRSRGVIIRPPL
FT                   PLQIKTPDNNDLLLGIDESNTVFSVGGSVRQSLLRSFELYAGDDSGIGVKQFSVGDVFD
FT                   EEKCITESVFSITMKIEGDSGVPKSAGKKSLDYKNLDDNCILMISTQVDLILIAIQSVL
FT                   SLNFNLDTFLTITFQPLIIDFLGIVLETNTEVATEIFLKLQSTDINEYTFNILLKEYSI
FT                   NKSGQLKGLVDLLSGRFNIILGLKKLHFHVINSKIPKLYKRDFIALYQQLAQLDTESYN
FT                   NETTDFNIEPVSHSPEMTSYRQETTINGDNKEFESNNEVQGINEYEKYYKRMLYMIELA
FT                   VMLKKLSLDSYCCIECVLGVYYTEVCEFNTNFPFFHLFVVDDRKNLVMTGGCYGTTLSF
FT                   LEPSNVPKVVHFDLQYFLDDLIRLSVNHSGGVEGFTVKPTVSDTVDVVITCQTSKLLPA
FT                   AASIANKLIDAGLSCECRAVPLILTSDFNHRLRTIKSIKARVHLQKSSNPSEEQLDSVK
FT                   TSQTQVEKAKSAQTNSENDILEDEEDKTHHGILYHVEPINGSFGQARKIYNEVALVHFI
FT                   IGQLT"
FT                   /protein_id="XP_765948.1"
FT   gene            <857783..>859251
FT                   /db_xref="GeneID:3502856"
FT                   /locus_tag="TP01_0422"
FT   mRNA            join(<857783..857876,858374..858392,858460..858538,
FT                   858657..858827,858858..858922,859029..>859251)
FT                   /db_xref="GI:71032614"
FT                   /db_xref="GeneID:3502856"
FT                   /locus_tag="TP01_0422"
FT                   /transcript_id="XM_760856.1"
FT                   /product="peptide chain release factor 1"
FT   CDS_pept        join(857783..857876,858374..858392,858460..858538,
FT                   858657..858827,858858..858922,859029..859251)
FT                   /locus_tag="TP01_0422"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide chain release factor 1"
FT                   /note="go_function: translation release factor activity
FT                   [goid 0003747]; go_process: translational termination [goid
FT                   0006415]"
FT                   /db_xref="GI:71032615"
FT                   /db_xref="GeneID:3502856"
FT                   /translation="MYFNFIFAVFLLVIVKCADSLNFLKTNKFDRNRNFSPNTEGLEDR
FT                   FLREGGVHQVKRVPMTEKSGRMHSSTATVAVLPSEMAKGRGTNNFEDVLEAVEINPSDI
FT                   EWKTCRASGPGGQNVNKVETAVSLYHKPTGIKVECSEERSQGKNKELALKKLREEIARI
FT                   RIEEMFSEARVRRKSQVHFIQNYSTLHIYKLIIPSYTISLNELTLLYMVISIE"
FT                   /protein_id="XP_765949.1"
FT   gene            <859736..>860101
FT                   /db_xref="GeneID:3502857"
FT                   /locus_tag="TP01_0423"
FT   mRNA            <859736..>860101
FT                   /db_xref="GI:71032616"
FT                   /db_xref="GeneID:3502857"
FT                   /locus_tag="TP01_0423"
FT                   /transcript_id="XM_760857.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        859736..860101
FT                   /locus_tag="TP01_0423"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032617"
FT                   /db_xref="GeneID:3502857"
FT                   /translation="MTVVADTGVNLDLSESLNKFGNSVYDPAEFNCIRLDVRVRKSLDS
FT                   TLRLAFSEEFESVSDIKVVEATKVTRIPFIMNTFHPYSDCPTHQTTWNNGKIPSLPVIS
FT                   SILSLGLSQLSNYTIYS"
FT                   /protein_id="XP_765950.1"
FT   gene            <860161..>860673
FT                   /db_xref="GeneID:3502858"
FT                   /locus_tag="TP01_0424"
FT   mRNA            <860161..>860673
FT                   /db_xref="GI:71032618"
FT                   /db_xref="GeneID:3502858"
FT                   /locus_tag="TP01_0424"
FT                   /transcript_id="XM_760858.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        860161..860673
FT                   /locus_tag="TP01_0424"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71032619"
FT                   /db_xref="GeneID:3502858"
FT                   /translation="MALTGARSLLSAAVALEKVCRALRRRINGKARVRNIVCSNILAVY
FT                   TYPHKIILPLFHKACKDSIYDPHRFSGVRVRVQIKSPQTFFSLISILNRFNFSSKYTEP
FT                   TQDTETKPEPDEFDDAEEEVEEIVENFVVPNVTSRPKTHKYKASKIGIHRFVDSTIKDN
FT                   RKVRKGF"
FT                   /protein_id="