(data stored in ACNUC8465 zone)

HOGENOMDNA: THPAR1_3

ID   THPAR1_3; SV 1; empty ; DNA; empty ; INV; 39579 BP.
XX
AC   NC_007758;
XX
DE   Theileria parva strain Muguga apicoplast, complete sequence.
XX
OS   Theileria parva strain Muguga
OC   Eukaryota; Alveolata; Apicomplexa; Aconoidasida; Piroplasmida;
OC   Theileriidae; Theileria.
XX
RN   [1]
RP   1-39579
RX   PUBMED; 15994558.
RA   Gardner,M.J., Bishop,R., Shah,T., de Villiers,E.P., Carlton,J.M., Hall,N.,
RA   Ren,Q., Paulsen,I.T., Pain,A., Berriman,M., Wilson,R.J., Sato,S.,
RA   Ralph,S.A., Mann,D.J., Xiong,Z., Shallom,S.J., Weidman,J., Jiang,L.,
RA   Lynn,J., Weaver,B., Shoaibi,A., Domingo,A.R., Wasawo,D., Crabtree,J.,
RA   Wortman,J.R., Haas,B., Angiuoli,S.V., Creasy,T.H., Lu,C., Suh,B.,
RA   Silva,J.C., Utterback,T.R., Feldblyum,T.V., Pertea,M., Allen,J.,
RA   Nierman,W.C., Taracha,E.L., Salzberg,S.L., White,O.R., Fitzhugh,H.A.,
RA   Morzaria,S., Venter,J.C., Fraser,C.M. and Nene,V.;
RT   "Genome Sequence of Theileria parva, a Bovine Pathogen That Transforms
RT   Lymphocytes";
RL   Science 309 (5731), 134-137 (2005)
XX
RN   [2]
RP   1-39579
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (26-JAN-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-39579
RA   Gardner,M., Bishop,R., Shah,T., de Villiers,E., Carlton,J.M., Hall,N.,
RA   Ren,Q., Paulsen,I.T., Pain,A., Berriman,M., Wilson,R.J.M., Sato,S.,
RA   Ralph,S.A., Mann,D.J., Xiong,Z., Shallom,S.J., Weidman,J., Jiang,L.,
RA   Lynn,J., Weaver,B., Shoaibi,A., Wasawo,D., Crabtree,J., Wortman,J.R.,
RA   Haas,B., Angiuoli,S., Creasy,T.H., Lu,C., Suh,B., Silva,J.C.,
RA   Utterback,T., Feldblyum,T., Pertea,M., Allen,J., Taracha,E.L.,
RA   Salzberg,S.L., White,O., Fitzhugh,H.A., Morzaria,S., Venter,J.C.,
RA   Fraser,C.M. and Nene,V.;
RT   "Direct Submission";
RL   Submitted (03-JUN-2005) Parasite Genomics Group, The Institute for Genomic
RL   Research, 9712 Medical Center Drive, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AAGK01000009.
CC   A circular contig was obtained after assembly of the shotgun
CC   sequences, but the in vivo conformation of this molecule has not
CC   been validated experimentally.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..39579
FT                   /organelle="plastid:apicoplast"
FT                   /strain="Muguga"
FT                   /mol_type="genomic DNA"
FT                   /organism="Theileria parva strain Muguga"
FT                   /db_xref="taxon:333668"
FT   gene            88..1595
FT                   /db_xref="GeneID:3882229"
FT                   /locus_tag="TP05_0045"
FT   rRNA            88..1595
FT                   /db_xref="GeneID:3882229"
FT                   /locus_tag="TP05_0045"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(1678..1925)
FT                   /db_xref="GeneID:3882230"
FT                   /locus_tag="TP05_0047"
FT   tRNA            complement(1678..1925)
FT                   /db_xref="GeneID:3882230"
FT                   /locus_tag="TP05_0047"
FT                   /product="tRNA-Phe"
FT   gene            1905..4680
FT                   /db_xref="GeneID:3882231"
FT                   /locus_tag="TP05_0046"
FT   rRNA            1905..4680
FT                   /db_xref="GeneID:3882231"
FT                   /locus_tag="TP05_0046"
FT                   /product="28S ribosomal RNA"
FT   gene            4697..4769
FT                   /db_xref="GeneID:3882232"
FT                   /locus_tag="TP05_0048"
FT   tRNA            4697..4769
FT                   /db_xref="GeneID:3882232"
FT                   /locus_tag="TP05_0048"
FT                   /product="tRNA-Thr"
FT   gene            <4789..>5406
FT                   /db_xref="GeneID:3882233"
FT                   /locus_tag="TP05_0001"
FT   mRNA            <4789..>5406
FT                   /db_xref="GI:71025924"
FT                   /db_xref="GeneID:3882233"
FT                   /locus_tag="TP05_0001"
FT                   /transcript_id="XM_757577.1"
FT                   /product="ribosomal protein S4"
FT   CDS_pept        4789..5406
FT                   /locus_tag="TP05_0001"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S4"
FT                   /transl_table="11"
FT                   /db_xref="GI:71025925"
FT                   /db_xref="GeneID:3882233"
FT                   /translation="MIYNIKKLKTLRKFNLTNIYELTTKTNIIFKKKKHIYKEYKLPTN
FT                   IKILKILYDVKDKKLKYSFNKFLFVNIYKFLKILKSRLDFVLFNNNLFSTINQSKQNIS
FT                   HKHIFLNNTIARHPSYCVKNLDIIHLYNISCDQIIKKLIYNHIIRNITINKICRKTCKP
FT                   ILIKQIILKFDMNNLNNTMCNKNFKIQINKTKTSDYYIKHKI"
FT                   /protein_id="XP_762670.1"
FT   gene            5491..5559
FT                   /db_xref="GeneID:3882282"
FT                   /locus_tag="TP05_0049"
FT   tRNA            5491..5559
FT                   /db_xref="GeneID:3882282"
FT                   /locus_tag="TP05_0049"
FT                   /product="tRNA-Gly"
FT   gene            5623..5693
FT                   /db_xref="GeneID:3882283"
FT                   /locus_tag="TP05_0050"
FT   tRNA            5623..5693
FT                   /db_xref="GeneID:3882283"
FT                   /locus_tag="TP05_0050"
FT                   /product="tRNA-His"
FT   gene            5750..5821
FT                   /db_xref="GeneID:3882284"
FT                   /locus_tag="TP05_0051"
FT   tRNA            5750..5821
FT                   /db_xref="GeneID:3882284"
FT                   /locus_tag="TP05_0051"
FT                   /product="tRNA-Met"
FT   gene            5864..6113
FT                   /db_xref="GeneID:3882285"
FT                   /locus_tag="TP05_0052"
FT   tRNA            5864..6113
FT                   /db_xref="GeneID:3882285"
FT                   /locus_tag="TP05_0052"
FT                   /product="tRNA-Lys"
FT   gene            6171..6242
FT                   /db_xref="GeneID:3882286"
FT                   /locus_tag="TP05_0053"
FT   tRNA            6171..6242
FT                   /db_xref="GeneID:3882286"
FT                   /locus_tag="TP05_0053"
FT                   /product="tRNA-Asp"
FT   gene            6248..6320
FT                   /db_xref="GeneID:3882287"
FT                   /locus_tag="TP05_0054"
FT   tRNA            6248..6320
FT                   /db_xref="GeneID:3882287"
FT                   /locus_tag="TP05_0054"
FT                   /product="tRNA-Glu"
FT   gene            6332..6413
FT                   /db_xref="GeneID:3882288"
FT                   /locus_tag="TP05_0055"
FT   tRNA            6332..6413
FT                   /db_xref="GeneID:3882288"
FT                   /locus_tag="TP05_0055"
FT                   /product="tRNA-Tyr"
FT   gene            6427..6498
FT                   /db_xref="GeneID:3882289"
FT                   /locus_tag="TP05_0056"
FT   tRNA            6427..6498
FT                   /db_xref="GeneID:3882289"
FT                   /locus_tag="TP05_0056"
FT                   /product="tRNA-Pro"
FT   gene            6534..6608
FT                   /db_xref="GeneID:3882290"
FT                   /locus_tag="TP05_0057"
FT   tRNA            6534..6608
FT                   /db_xref="GeneID:3882290"
FT                   /locus_tag="TP05_0057"
FT                   /product="tRNA-Ser"
FT   gene            <6625..>7158
FT                   /db_xref="GeneID:3882291"
FT                   /locus_tag="TP05_0002"
FT   mRNA            <6625..>7158
FT                   /db_xref="GI:71025926"
FT                   /db_xref="GeneID:3882291"
FT                   /locus_tag="TP05_0002"
FT                   /transcript_id="XM_757578.1"
FT                   /product="ribosomal protein L4"
FT   CDS_pept        6625..7158
FT                   /locus_tag="TP05_0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L4"
FT                   /transl_table="11"
FT                   /db_xref="GI:71025927"
FT                   /db_xref="GeneID:3882291"
FT                   /translation="MFSDNTIFSQLILNIKFGLTIKNKLIYCFNIFINKFLNSNKKILY
FT                   DIKKNIKNNMFNFRNKLNFNKSKKNIVSKKRTGKSRSGSSSSHTLRKGLLWFGLRNIKL
FT                   KEKKFNKNLLNSLLIDNKNIITINNLEIIKFIYYITYNNNNLFKISSINTFYLNSIHNY
FT                   KHLINNKKCINIVY"
FT                   /protein_id="XP_762671.1"
FT   gene            <7169..>7909
FT                   /db_xref="GeneID:3882292"
FT                   /locus_tag="TP05_0003"