(data stored in ACNUC7421 zone)

HOGENOMDNA: TOLAT_1

ID   TOLAT_1; SV 1; empty ; DNA; empty ; PRO; 3471292 BP.
XX
AC   NC_012691;
XX
PR   Project: 59395;
XX
DE   Tolumonas auensis DSM 9187, complete genome.
XX
OS   Tolumonas auensis DSM 9187
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Aeromonadales;
OC   Aeromonadaceae; Tolumonas.
XX
RN   [1]
RP   1-3471292
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Brettin,T., Detter,J.C., Han,C.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Spring,S. and
RA   Beller,H.;
RT   "Complete sequence of Tolumonas auensis DSM 9187";
RL   Unpublished
XX
RN   [2]
RP   1-3471292
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (14-MAY-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3471292
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Tice,H., Bruce,D.,
RA   Goodwin,L., Pitluck,S., Chertkov,O., Brettin,T., Detter,J.C., Han,C.,
RA   Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Spring,S. and
RA   Beller,H.;
RT   "Direct Submission";
RL   Submitted (01-MAY-2009) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001616.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085314
CC   Source DNA and organism available from DSMZ: DSM 9187
CC   Contacts: Harry Beller (HRBeller@lbl.gov)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3471292
FT                   /note="type strain of Tolumonas auensis"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:595494"
FT                   /country="Switzerland"
FT                   /isolation_source="sediment of freshwater lake"
FT                   /strain="DSM 9187"
FT                   /organism="Tolumonas auensis DSM 9187"
FT   gene            12..1397
FT                   /db_xref="GeneID:7883396"
FT                   /locus_tag="Tola_0001"
FT   CDS_pept        12..1397
FT                   /locus_tag="Tola_0001"
FT                   /gene_family="HOG000235659" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: asa:ASA_0001 chromosomal replication initiator
FT                   protein DnaA; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="GI:237806777"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:7883396"
FT                   /translation="MTASLWQQCLTRLQEELPSGEFGLWIRPLQAEFGDRSLTLYAANR
FT                   FILDWVRDKYLLRINSLFTEICGADAPTLHFAVGRRPTAATVQMNTAAAPVADVRIGPA
FT                   ITVPSWTSKQDAMPEINHKSNINETYTFENFVEGKSNQLALAAAHQVAENPGGAYNPLF
FT                   LYGGTGLGKTHLLHAVGNGIRARKPNAKVIYMQSERFVQDMVKALQNNAIQEFQRYYRS
FT                   VDALLIDDIQFFAKKERSQEEFFHTFNALLEGNQQIILTSDRYPKEIDGVEDRLKSRFG
FT                   WGLTIAIEPPELETRVAILMRKAEENKIHLPHEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ARFTGKPINIDFVREALRDMLALQEKLVTIENIQKTVAEYYKIKVADLLSKRRSRSVAR
FT                   PRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIAELREESNDIKEDYSNLIRT
FT                   LSS"
FT                   /protein_id="YP_002891217.1"
FT   misc_feature    12..1394
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    432..863
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    507..530
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    order(510..533,696..698,798..800)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    <675..1085
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    684..701
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    834..836
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    1119..1388
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Tola_0001"
FT   misc_feature    order(1188..1190,1212..1217,1236..1238,1254..1262,
FT                   1287..1301,1308..1310,1317..1322)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Tola_0001"
FT   gene            1416..2519
FT                   /db_xref="GeneID:7883559"
FT                   /locus_tag="Tola_0002"
FT   CDS_pept        1416..2519
FT                   /locus_tag="Tola_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: asa:ASA_0002 DNA polymerase III beta-subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:237806778"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:7883559"
FT                   /translation="MQFSISRDSLLRPLQLVSGSIGGRPTLPILSNVLLNVTEQRLSLT
FT                   GTDLEVEMIGLVPLAGAVAVGSITTPARKLLDICRGLPDGAQLDFVLEGERLILRSGRS
FT                   RYSLSTLPAADYPNIEEWNSVLEFDISQQELKRLMEATQFSMASQDVRFYLNGMLFETS
FT                   GQGLRTVGTDGHRLATCRREVLNEPQSDHQVILPRKGVLELARLLENDDRTIRLQIGLN
FT                   NLRAEAEGFIFTSKLVDGRFPDYRRVFPRQSDKILIAERELLKQAFSRAAILSNEKFRG
FT                   VRLHLTTNLLHITANNPEQEEAEELIDVQYDGPELEVGFNVSYVLDVLNALKCEQVKWY
FT                   LTDANSSALVEDASNDDAQYVVMPMRL"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_002891218.1"
FT   misc_feature    1416..2516
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Tola_0002"
FT   misc_feature    1416..2513
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Tola_0002"
FT   misc_feature    order(1485..1487,1632..1634,1653..1655,2010..2012)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Tola_0002"
FT   misc_feature    order(1635..1637,1644..1646,1722..1724,1728..1730,
FT                   2232..2234,2325..2330)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Tola_0002"
FT   misc_feature    order(1929..1931,1935..1946,2376..2378,2502..2513)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Tola_0002"
FT   misc_feature    order(1929..1931,1935..1940,2157..2159,2262..2264,
FT                   2301..2306,2385..2387,2502..2513)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Tola_0002"
FT   gene            2525..3598
FT                   /db_xref="GeneID:7883560"
FT                   /locus_tag="Tola_0003"
FT   CDS_pept        2525..3598
FT                   /locus_tag="Tola_0003"
FT                   /gene_family="HOG000269560" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: aha:AHA_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="GI:237806779"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:7883560"
FT                   /translation="MLHKLQIQHFRNLGQTEIYPSGGMNLLLGLNGSGKSSVLEAIHYL
FT                   SLGRSFRTHLTNRVIMQGEKAFTLFAQLELDEQSISIGLQKDRQGDTQLKIGGKSADKL
FT                   AQLASLLPLQLIHPEGYNLLTGGPQQRRAFIDWGVFHVEQAFFPLWGKVRRLLKQRNAL
FT                   LRQSSHYAPLAYWDQQLAEFSEALSVFRQQYCQALLPLVQQICQELLPEYTFQATFYAG
FT                   WQQEQGLHLLLQEGFERDRQLGHTAIGPHRADLRLRAEGVPVQDLLSRGQLKLLVCALR
FT                   LAQGLYLRQNSEKTCLFLIDDFASELDAEKRYVLAKRLQQCESQVFITAIDQQPLQEMM
FT                   QEFDCRLFHVKQGNITE"
FT                   /protein_id="YP_002891219.1"
FT   misc_feature    2528..>3019
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    2609..2632
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    order(2618..2623,2627..2635,2876..2878)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    2867..2878
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    <3245..3592
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    3326..3355
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    3413..3430
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    3437..3448
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   misc_feature    3506..3526
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Tola_0003"
FT   gene            3619..6036
FT                   /db_xref="GeneID:7883561"
FT                   /locus_tag="Tola_0004"
FT   CDS_pept        3619..6036
FT                   /locus_tag="Tola_0004"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: aha:AHA_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:237806780"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="GeneID:7883561"
FT                   /translation="MSENTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVM
FT                   DNSIDETLAGHCTDIVARIHEDGSVSVRDNGRGIPVDMHKEEGRSAAEVIMTILHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLLLTIQRNGNIYQQTYFLGEPDAPLAIIGTCEG
FT                   TGTEIRFWPSLSIFSDVTFRYEILARRFRELSFLNSGVSIRLIDERDGREDHFHYEGGI
FT                   RAFVEYLNQNKTPIHQKAFYFDLAREDGISVEVAMQWNDAYQENVYCFTNNIPQRDGGT
FT                   HLAGFRSALTRTLNTYMDKEGYSKKAKTSASGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQAMGEKLDEYLLENPGEAKIIVGKIIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKYQAILPLKGKILNVEKAR
FT                   FDKMISSQEVGTLITALGCGIGRDEYNPDKMRYHNVIIMTDADVDGAHIRTLLLTFFYR
FT                   QMPEIIERGYVYIAQPPLYKVKKGKQEQYIKDEESLLEYQTTLALDGAELYVNDSAPAI
FT                   SGAQLEKMVLEYRTAQHLITRLARRLPEAVLQQLLILPVLTTEALKDEAQAKAWVAQLQ
FT                   HNLDEHGNNGSQYTLSVHRHAEHGVYLPQILLRQHGVEKHYQLGFEFLNSPEYQQIVNI
FT                   GQQITNLIEPTGFLKRGEKVRPVTSFEEALQILLDEGKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPMTRRMLQVTIEDGMAADQLFATLMGDNVEPRRAFIESNALKVANLDI"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_002891220.1"
FT   misc_feature    3619..6033
FT                   /note="DNA gyrase subunit B; Validated; Region: gyrB;
FT                   PRK05644"
FT                   /db_xref="CDD:168149"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    3715..>3951
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    4276..4752
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    4432..4434
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    order(4606..4608,4615..4620,4624..4626)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    order(4624..4626,4630..4632)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    4873..5217
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    order(4891..4896,4903..4905,5113..5115,5119..5121,
FT                   5125..5127)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    order(4891..4893,5113..5115)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Tola_0004"
FT   misc_feature    5806..6000
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Tola_0004"
FT   gene            6230..7243
FT                   /db_xref="GeneID:7883562"
FT                   /locus_tag="Tola_0005"
FT   CDS_pept        6230..7243
FT                   /locus_tag="Tola_0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: psa:PST_0371 spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein,
FT                   putative"
FT                   /db_xref="GI:237806781"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:7883562"
FT                   /translation="MRYWLSMLLLSLAGYCPASELVVYTWEYYLAPEVKSRFEQETGIH
FT                   IAEVNYNSDEARNRLLSGGYPPEFDIVSIDSLSLNDPVWRALFTVMPASIRKQNTAIDP
FT                   VFTARCGDLSVPYMWGSVGIAYRRSQVSEPITRWQQLFTPEPTLSGRIVMVDDTFDLVS
FT                   VALKAAGFSINTHNKSELQAAYHLLQKQRPSVATYQLSFAAVSDQQFGKRIAAAMVYSG
FT                   DFYALQQNSEYKDWTYVVPEEGSPLWLDCMSILKTSQHKAEAQRFLTFLTRPDIALLNG
FT                   QTMGFTPALKKSYLPASMQNNAIIYPPVKQLQRSEFYNADVSKNELRSAIYFSVLK"
FT                   /protein_id="YP_002891221.1"
FT   misc_feature    6290..7240
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Tola_0005"
FT   gene            7240..9666
FT                   /db_xref="GeneID:7883563"
FT                   /locus_tag="Tola_0006"
FT   CDS_pept        7240..9666
FT                   /locus_tag="Tola_0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /transl_table="11"
FT                   /note="KEGG: psp:PSPPH_4065 GGDEF domain/EAL
FT                   domain-containing protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   histidine kinase HAMP region domain protein; SMART: EAL
FT                   domain protein; GGDEF domain containing protein"
FT                   /db_xref="GI:237806782"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="GeneID:7883563"
FT                   /translation="MKGLHRKLLLTLLPVVILPLLALGLQSMMKLGDMANRNMELRLTS
FT                   LATTINEHLNGELRRNTVELAQLPNAEALISYLATKVTGTQKVYMGTRVQRMFHQLLVG
FT                   NKGFLQLSLLNSDNKELLRVGEGINPFHDIAPSNLIFMQYWAAQAAASDQFNSLMYSPE
FT                   MDEYVYKQGLRFIRSGPEISRDGEPVQRYSLILTYSLRKFGEMFLKQQVQQGIYLLLLD
FT                   KSNTFIAGEAPLGWRSGGPETDEISLPGGDYLVRRLPLADGLILQALIPQKLMTAEATE
FT                   LRITTAIWLIISSLILLALLHVVLKRLILNPVSDLRNLMKQVATHEISEISLVLAEDEM
FT                   AELHNHFSGMLSQLEVSKRELERAAFIDPLTGIGNRSAFIRCLQNMVERHNEQPFHFYL
FT                   VQLKLHNLTWINNTFGAKTGDRALQLISRLLQQLLHEHILANAKCVCLARSGSDEFIFS
FT                   VPSYYPVDGNGQDTAALPDANAICELLAARFGQPVMLGSYSIKLRFSAGIVRFPDIANG
FT                   VEELMEGVSKARRLASRYQGNHWLQLDNEMVQHIREDRWLESELRQAIVGQQCFVVYQP
FT                   QYDIHSGHIVGAEALLRWRHPSYGMVPPDRFIPIAEVSGQIMDIDLWVLDQACQCLGKL
FT                   TAKGITDFRLAVNASGTELSNPAYPDAVRSTLLRYDIPPHRFGIEITETAIVELDEVAQ
FT                   MTVRALKEIGVEIELDDFGTGYTSLSHLTNLQLDVLKIDRSYIMQLESNPKLVDSILQL
FT                   ADAFSLRVIAEGVETIEQLKLLQQKRCHMAQGFLLSKPITEEELIALLFDDSLAD"
FT                   /protein_id="YP_002891222.1"
FT   misc_feature    8335..8808
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Tola_0006"
FT   misc_feature    order(8446..8448,8596..8598)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Tola_0006"
FT   misc_feature    order(8461..8463,8470..8475,8485..8487,8497..8499,
FT                   8584..8586,8590..8601)
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Tola_0006"
FT   misc_feature    order(8551..8553,8689..8691)
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Tola_0006"
FT   misc_feature    8914..9627
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Tola_0006"
FT   gene            complement(9727..10968)
FT                   /db_xref="GeneID:7883564"
FT                   /locus_tag="Tola_0007"