(data stored in ACNUC8465 zone)

HOGENOMDNA: TRBRU1_1

ID   TRBRU1_1; SV 2; empty ; DNA; empty ; INV; 1193948 BP.
XX
AC   NC_005063;
XX
DE   Trypanosoma brucei TREU927 chromosome 2, complete sequence.
XX
OS   Trypanosoma brucei TREU927
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
XX
RN   [1]
RP   1-1193948
RX   PUBMED; 16020726.
RA   Berriman,M., Ghedin,E., Hertz-Fowler,C., Blandin,G., Renauld,H.,
RA   Bartholomeu,D.C., Lennard,N.J., Caler,E., Hamlin,N.E., Haas,B., Bohme,U.,
RA   Hannick,L., Aslett,M.A., Shallom,J., Marcello,L., Hou,L., Wickstead,B.,
RA   Alsmark,U.C.M., Arrowsmith,C., Atkin,R.J., Barron,A.J., Bringaud,F.,
RA   Brooks,K., Carrington,M., Cherevach,I., Chillingworth,T.-J., Churcher,C.,
RA   Clark,L.N., Corton,C.H., Cronin,A., Davies,R.M., Doggett,J., Djikeng,A.,
RA   Feldblyum,T., Field,M.C., Fraser,A., Goodhead,I., Hance,Z., Harper,D.,
RA   Harris,B.R., Hauser,H., Hostetler,J., Ivens,A., Jagels,K., Johnson,D.,
RA   Johnson,J., Jones,K., Kerhornou,A.X., Koo,H., Larke,N., Landfear,S.,
RA   Larkin,C., Leech,V., Line,A., Lord,A., MacLeod,A., Mooney,P.J., Moule,S.,
RA   Martin,D.M.A., Morgan,G.W., Mungall,K., Norbertczak,H., Ormond,D., Pai,G.,
RA   Peacock,C.S., Peterson,J., Quail,M.A., Rabbinowitsch,E., Rajandream,M.-A.,
RA   Reitter,C., Salzberg,S.L., Sanders,M., Schobel,S., Sharp,S., Simmonds,M.,
RA   Simpson,A.J., Tallon,L., Turner,C.M.R., Tait,A., Tivey,A.R., Van Aken,S.,
RA   Walker,D., Wanless,D., Wang,S., White,B., White,O., Whitehead,S.,
RA   Woodward,J., Wortman,J., Adams,M.D., Embley,T.M., Gull,K., Ullu,E.,
RA   Barry,J.D., Fairlamb,A.H., Opperdoes,F., Barrell,B.G., Donelson,J.E.,
RA   Hall,N., Fraser,C.M., Melville,S.E. and El-Sayed,N.M.;
RT   "The Genome of the African Trypanosome Trypanosoma brucei";
RL   Science 309 (5733), 416-422 (2005)
XX
RN   [2]
RP   1-1193948
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (29-DEC-2005) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1193948
RA   Haas,B., Blandin,G. and El-Sayed,N.;
RT   "Direct Submission";
RL   Submitted (12-APR-2005) The Institute for Genomic Research, 9712 Medical
RL   Center Dr, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AE017150.
CC   On Dec 29, 2005 this sequence version replaced gi:33945204.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1193948
FT                   /mol_type="genomic DNA"
FT                   /isolate="927/4 GUTat10.1"
FT                   /note="single VAT derivative of TREU (Trypanosomiasis
FT                   Research Edinburgh University) 927/4 (GPAL/KE/70/EATRO
FT                   1534)"
FT                   /db_xref="taxon:185431"
FT                   /organism="Trypanosoma brucei TREU927"
FT                   /chromosome="2"
FT   gene            complement(1683..4172)
FT                   /db_xref="GeneID:3655286"
FT                   /locus_tag="Tb927.2.100"
FT   mRNA            complement(<1683..>4172)
FT                   /db_xref="GI:84043365"
FT                   /db_xref="GeneID:3655286"
FT                   /locus_tag="Tb927.2.100"
FT                   /transcript_id="XM_946380.1"
FT                   /product="retrotransposon hot spot (RHS) protein"
FT   CDS_pept        complement(1683..4172)
FT                   /locus_tag="Tb927.2.100"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein"
FT                   /note="go_component: nucleus [goid 0005634]"
FT                   /db_xref="GI:84043366"
FT                   /db_xref="GeneID:3655286"
FT                   /translation="MSRANSPAAPQGNNANQQVADNFGAAVRRPRDENVPPPPAAAQPP
FT                   QIRQRTEERPNWTMDSKVRNVLLEDYAGLRNMTLHDFLLKKFLNTYNTENVAMDVFVQS
FT                   PRDYILDARILERIQRLDEFEEYKELYNQFSEMKRKARYLDEKEISTLSQWEEKGTVEI
FT                   REFVGPVARGRLDAAVIAAKRAEKRAVLAADGSELRGLYDSICNAKWSYVMSGYDEEPL
FT                   GLKVFDGRPPRMWTKEEVDVSHVPKTMNEPLPRHGNLEIAVLTSQVGWPYTSFEKNPND
FT                   YDINHKKGVGYVFNSDVYIRRETLRVWHKVKERLNQWLMGEVAINPMFHVVIGTPGIGK
FT                   SFSVGSLLLYKLLHYEASQLQIIIYVVRGKAYVFHKPIGGRAGYVTFYSNYENAFTVVE
FT                   QIVRDSSSGEDIKGYLIFDVDKDHHAPVKPPVGCAGIALSSPNVRQFHEWSKQNTASHI
FT                   YINCDTLKDLEAIHISRWGKIAPAYGWSPPVAKEKIEREWQEIQGRILFVGPLLRHIGN
FT                   LVSYDSQWTLIRGYINKLNDTYMNDYAEIFQNAAMWQTDKASHKLVRVVRVKEEELLSD
FT                   TYRCRPLSSYTGQAILDFLRPWLLNKYAAMSALLSNRALTAHLFEKSGIEALSHEDTLI
FT                   ELARELQGLSFARNQIPQSVLQVLQEPRLIGPSIEVPEDVPIVAGAEIQYMKLYKPQSR
FT                   SFPVVDAFFFVENQKTFVGLQFTISDKHPCSVGGLLKMKRYLRSYFQGWDNFSNDMVWE
FT                   IIYVQRVDSEKITKPQPCSMTNREDGQDNEGEKRFWEQEVRQFSVSLSNHITALYVELK
FT                   ARGNNNNGVNNRGGNNA"
FT                   /protein_id="XP_951473.1"
FT   gene            9292..9531
FT                   /db_xref="GeneID:3655291"
FT                   /locus_tag="Tb927.2.150"
FT   mRNA            <9292..>9531
FT                   /db_xref="GI:84043367"
FT                   /db_xref="GeneID:3655291"
FT                   /locus_tag="Tb927.2.150"
FT                   /transcript_id="XM_946381.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        9292..9531
FT                   /locus_tag="Tb927.2.150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:84043368"
FT                   /db_xref="GeneID:3655291"
FT                   /translation="MEPTNAPAKWMCSFAMSRQFVLRLLKLLDRRNLTTMCSRQTHENG
FT                   ELAGISPSTQQLLSTGISGLWMVQKAHHFVDSSE"
FT                   /protein_id="XP_951474.1"
FT   gene            11173..11535
FT                   /db_xref="GeneID:3655292"
FT                   /locus_tag="Tb927.2.160"
FT   mRNA            <11173..>11535
FT                   /db_xref="GI:84043369"
FT                   /db_xref="GeneID:3655292"
FT                   /locus_tag="Tb927.2.160"
FT                   /transcript_id="XM_946382.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        11173..11535
FT                   /locus_tag="Tb927.2.160"
FT                   /gene_family="HOG000111131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:84043370"
FT                   /db_xref="GeneID:3655292"
FT                   /translation="MFQLVSTAELNKACVSYRGGVSMCLRFPFCHCVWAHAVTLIENSG
FT                   HYHRWVARGESEDWDYSNGFVVVCPVPLENIAANEREGKCHLAFHAATSMHHDFMLVAL
FT                   RGKAVKAKVSFRFKEM"
FT                   /protein_id="XP_951475.1"
FT   gene            <11937..>16118
FT                   /db_xref="GeneID:3655293"
FT                   /locus_tag="Tb927.2.170"