(data stored in ACNUC8465 zone)

HOGENOMDNA: TRBRU1_3

ID   TRBRU1_3; SV 1; empty ; DNA; empty ; INV; 1590432 BP.
XX
AC   NC_007277;
XX
DE   Trypanosoma brucei TREU927 chromosome 4, complete sequence.
XX
OS   Trypanosoma brucei TREU927
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
XX
RN   [1]
RP   1-1590432
RX   PUBMED; 16020726.
RA   Berriman,M., Ghedin,E., Hertz-Fowler,C., Blandin,G., Renauld,H.,
RA   Bartholomeu,D.C., Lennard,N.J., Caler,E., Hamlin,N.E., Haas,B., Bohme,U.,
RA   Hannick,L., Aslett,M.A., Shallom,J., Marcello,L., Hou,L., Wickstead,B.,
RA   Alsmark,U.C.M., Arrowsmith,C., Atkin,R.J., Barron,A.J., Bringaud,F.,
RA   Brooks,K., Carrington,M., Cherevach,I., Chillingworth,T.-J., Churcher,C.,
RA   Clark,L.N., Corton,C.H., Cronin,A., Davies,R.M., Doggett,J., Djikeng,A.,
RA   Feldblyum,T., Field,M.C., Fraser,A., Goodhead,I., Hance,Z., Harper,D.,
RA   Harris,B.R., Hauser,H., Hostetler,J., Ivens,A., Jagels,K., Johnson,D.,
RA   Johnson,J., Jones,K., Kerhornou,A.X., Koo,H., Larke,N., Landfear,S.,
RA   Larkin,C., Leech,V., Line,A., Lord,A., MacLeod,A., Mooney,P.J., Moule,S.,
RA   Martin,D.M.A., Morgan,G.W., Mungall,K., Norbertczak,H., Ormond,D., Pai,G.,
RA   Peacock,C.S., Peterson,J., Quail,M.A., Rabbinowitsch,E., Rajandream,M.-A.,
RA   Reitter,C., Salzberg,S.L., Sanders,M., Schobel,S., Sharp,S., Simmonds,M.,
RA   Simpson,A.J., Tallon,L., Turner,C.M.R., Tait,A., Tivey,A.R., Van Aken,S.,
RA   Walker,D., Wanless,D., Wang,S., White,B., White,O., Whitehead,S.,
RA   Woodward,J., Wortman,J., Adams,M.D., Embley,T.M., Gull,K., Ullu,E.,
RA   Barry,J.D., Fairlamb,A.H., Opperdoes,F., Barrell,B.G., Donelson,J.E.,
RA   Hall,N., Fraser,C.M., Melville,S.E. and El-Sayed,N.M.;
RT   "The Genome of the African Trypanosome Trypanosoma brucei";
RL   Science 309 (5733), 416-422 (2005)
XX
RN   [2]
RP   1-1590432
RX   PUBMED; 16020724.
RA   El-Sayed,N.M.A., Myler,P.J., Blandin,G., Berriman,M., Crabtree,J.,
RA   Aggarwal,G., Caler,E., Renauld,H., Worthey,E.A., Hertz-Fowler,C.,
RA   Ghedin,E., Peacock,C., Bartholomeu,D.C., Haas,B.J., Tran,A.-N.,
RA   Wortman,J.R., Alsmark,U.C.M., Angiuoli,S., Anupama,A., Badger,J.,
RA   Bringaud,F., Cadag,E., Carlton,J.M., Cerqueira,G.C., Creasy,T.,
RA   Delcher,A.L., Djikeng,A., Embley,T.M., Hauser,C., Ivens,A.C.,
RA   Kummerfeld,S.K., Pereira-Leal,J.B., Nilsson,D., Peterson,J.,
RA   Salzberg,S.L., Shallom,J., Silva,J.C., Sundaram,J., Westenberger,S.,
RA   White,O., Melville,S.E., Donelson,J.E., Andersson,B., Stuart,K.D. and
RA   Hall,N.;
RT   "Comparative genomics of trypanosomatid parasitic protozoa";
RL   Science 309 (5733), 404-409 (2005)
XX
RN   [3]
RP   1-1590432
RA   Ghedin,E., Blandin,G., Bartholomeu,D., Caler,E., Haas,B., Hannick,L.,
RA   Shallom,J., Hou,L., Djikeng,A., Feldblyum,T., Hostetler,J., Johnson,J.,
RA   Jones,K., Koo,H.L., Larkin,C., Pai,G., Peterson,J., Khalak,H.G.,
RA   Salzberg,S., Simpson,A.J., Tallon,L., Van Aken,S., Wanless,D., White,O.,
RA   Wortman,J., Fraser,C.M. and El-Sayed,N.M.A.;
RT   "Sequencing, closure, and annotation of Trypanosoma brucei chromosomes 2
RT   through 8";
RL   Unpublished
XX
RN   [4]
RP   1-1590432
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-OCT-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [5]
RP   1-1590432
RA   Haas,B., Blandin,G. and El-Sayed,N.;
RT   "Direct Submission";
RL   Submitted (12-JUL-2005) The Institute for Genomic Research, 9712 Medical
RL   Center Dr, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000067.
CC   On or before Oct 11, 2006 this sequence version replaced
CC   gi:71751548, gi:71905129, gi:71854477, gi:71854474, gi:71852593,
CC   gi:71854476, gi:71854464, gi:71854479, gi:71749682, gi:71904710,
CC   gi:71854486, gi:71854463.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1590432
FT                   /mol_type="genomic DNA"
FT                   /isolate="927/4 GUTat10.1"
FT                   /note="single VAT derivative of TREU (Trypanosomiasis
FT                   Research Edinburgh University) 927/4 (GPAL/KE/70/EATRO
FT                   1534)"
FT                   /db_xref="taxon:185431"
FT                   /organism="Trypanosoma brucei TREU927"
FT                   /chromosome="4"
FT   misc_feature    1..162891
FT                   /note="sequence corresponds to BAC RPCI93-5D20"
FT   gene            complement(1682..3133)
FT                   /note="synonym: Tb04.5D20.30; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative C-terminal domain of an
FT                   RHS1, interrupted by a RIME: pers. comm. Frederic Bringaud,
FT                   CNRS/BordeauxII University."
FT                   /db_xref="GeneID:3656532"
FT                   /locus_tag="Tb927.4.100"
FT                   /pseudo
FT   repeat_region   complement(3133..3392)
FT                   /transposon="RIME-B"
FT   repeat_region   complement(3393..3640)
FT                   /transposon="RIME-A"
FT   gene            complement(3639..4715)
FT                   /note="synonym: Tb04.5D20.40; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative N-terminal domain of an
FT                   RHS1, interrupted by a RIME: pers. comm. Frederic Bringaud,
FT                   CNRS/BordeauxII University."
FT                   /db_xref="GeneID:3656533"
FT                   /locus_tag="Tb927.4.110"
FT                   /pseudo
FT   misc_feature    5813..5834
FT                   /note="AT_rich"
FT   misc_feature    6355..6378
FT                   /note="AT_rich"
FT   misc_feature    6761..6782
FT                   /note="AT_rich"
FT   misc_feature    7141..7161
FT                   /note="AT_rich"
FT   gene            <12267..>12638
FT                   /note="synonym: Tb04.5D20.94; hypothetical protein"
FT                   /db_xref="GeneID:3656534"
FT                   /locus_tag="Tb927.4.120"
FT   mRNA            <12267..>12638
FT                   /db_xref="GI:72387489"
FT                   /db_xref="GeneID:3656534"
FT                   /locus_tag="Tb927.4.120"
FT                   /transcript_id="XM_839076.1"
FT   CDS_pept        12267..12638
FT                   /locus_tag="Tb927.4.120"
FT                   /gene_family="HOG000137411" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387490"
FT                   /db_xref="GeneID:3656534"
FT                   /translation="MLWWKQCACRNSEHPTTGYRSVNDSVQLMEIRQTSTPLNCKLLRA
FT                   YQFLPYEVPFPPHTFASQQWREGENVEVHYALYQTCLCMYLTSPDMSLTVTNMLPTLGI
FT                   HEHDVHKISRTLCTSWRST"
FT                   /protein_id="XP_844169.1"
FT   gene            13666..16569
FT                   /note="synonym: Tb04.5D20.100; receptor-type adenylate
FT                   cyclase GRESAG 4 (pseudogene), putative"
FT                   /db_xref="GeneID:3656535"
FT                   /locus_tag="Tb927.4.130"
FT                   /pseudo
FT   gene            <17401..>17667
FT                   /note="synonym: Tb04.5D20.110; hypothetical protein"
FT                   /db_xref="GeneID:3656536"
FT                   /locus_tag="Tb927.4.140"
FT   mRNA            <17401..>17667
FT                   /db_xref="GI:72387491"
FT                   /db_xref="GeneID:3656536"
FT                   /locus_tag="Tb927.4.140"
FT                   /transcript_id="XM_839077.1"
FT   CDS_pept        17401..17667
FT                   /locus_tag="Tb927.4.140"
FT                   /gene_family="HOG000137393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387492"
FT                   /db_xref="GeneID:3656536"
FT                   /translation="MFPFVFPFPFSFRWGYTTLVGTRFTSSFSNYEGNCVLFATLPLVI
FT                   SPTGFTPRSRVYTTCGGNITLGKTNYEKNGNTFQNIPSSLQNS"
FT                   /protein_id="XP_844170.1"
FT   gene            <18000..>18425
FT                   /note="synonym: Tb04.5D20.120; hypothetical protein"
FT                   /db_xref="GeneID:3656537"
FT                   /locus_tag="Tb927.4.150"
FT   mRNA            <18000..>18425
FT                   /db_xref="GI:72387493"
FT                   /db_xref="GeneID:3656537"
FT                   /locus_tag="Tb927.4.150"
FT                   /transcript_id="XM_839078.1"
FT   CDS_pept        18000..18425
FT                   /locus_tag="Tb927.4.150"
FT                   /gene_family="HOG000111131" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387494"
FT                   /db_xref="GeneID:3656537"
FT                   /translation="MFQLVSAAEVNKAHVSYPGGVSMCLRFPFCHCVWAHAMTLIEISG
FT                   QYHRWVARGENEDWDYSNNFVVACVVLLENIATNEREGKCHLTFHAATSMHKNYMLVAL
FT                   QGKVVKAKVSFRFREVQRLPDTTVRNYCCCVLQALGQ"
FT                   /protein_id="XP_844171.1"
FT   gene            18596..22942
FT                   /note="synonym: Tb04.5D20.130; leucine-rich repeat protein
FT                   (LRRP, pseudogene), putative"
FT                   /db_xref="GeneID:3656538"
FT                   /locus_tag="Tb927.4.160"
FT                   /pseudo
FT   repeat_region   23392..23435
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    25055..25086
FT                   /note="AT_rich"
FT   repeat_region   26051..26124
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <26181..>26354
FT                   /note="synonym: Tb04.5D20.150; hypothetical protein"
FT                   /db_xref="GeneID:3656539"
FT                   /locus_tag="Tb927.4.170"
FT   mRNA            <26181..>26354
FT                   /db_xref="GI:72387495"
FT                   /db_xref="GeneID:3656539"
FT                   /locus_tag="Tb927.4.170"
FT                   /transcript_id="XM_839079.1"
FT   CDS_pept        26181..26354
FT                   /locus_tag="Tb927.4.170"
FT                   /gene_family="HOG000137410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387496"
FT                   /db_xref="GeneID:3656539"
FT                   /translation="MVRETLICFDRADAQSSKGFRKVLGNFNHIFLLLNYFSKMLFFFC
FT                   IALTFKTIWTAL"
FT                   /protein_id="XP_844172.1"
FT   misc_feature    26462..26484
FT                   /note="AT_rich"
FT   gene            <26747..>26995
FT                   /note="synonym: Tb04.5D20.160; hypothetical protein"
FT                   /db_xref="GeneID:3656540"
FT                   /locus_tag="Tb927.4.180"
FT   mRNA            <26747..>26995
FT                   /db_xref="GI:72387497"
FT                   /db_xref="GeneID:3656540"
FT                   /locus_tag="Tb927.4.180"
FT                   /transcript_id="XM_839080.1"
FT   CDS_pept        26747..26995
FT                   /locus_tag="Tb927.4.180"
FT                   /gene_family="HOG000137408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387498"
FT                   /db_xref="GeneID:3656540"
FT                   /translation="MQGALSGEGGADSNIQNNLFSHMAERTDAVVKHTLQSEKSISPGA
FT                   DTLQRCEHKTLHLRTGGFSLFICLFVFESIPHISVQH"
FT                   /protein_id="XP_844173.1"
FT   repeat_region   26937..26960
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   gene            27790..28422
FT                   /note="synonym: Tb04.5D20.170; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative"
FT                   /db_xref="GeneID:3656545"
FT                   /locus_tag="Tb927.4.190"
FT                   /pseudo
FT   repeat_region   complement(30723..30773)
FT                   /transposon="VAS"
FT   repeat_region   complement(30728..33265)
FT                   /transposon="VIPER"
FT   misc_feature    30928..30949
FT                   /note="AT_rich"
FT   gene            complement(<34907..>36946)
FT                   /note="synonym: Tb04.5D20.250; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656546"
FT                   /locus_tag="Tb927.4.200"
FT   mRNA            complement(<34907..>36946)
FT                   /db_xref="GI:72387499"
FT                   /db_xref="GeneID:3656546"
FT                   /locus_tag="Tb927.4.200"
FT                   /transcript_id="XM_839081.1"
FT   CDS_pept        complement(34907..36946)
FT                   /locus_tag="Tb927.4.200"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS1, chimeric gene between RHS5 (N-terminal) and
FT                   RHS1 (C-terminal): pers. comm. Frederic Bringaud,
FT                   CNRS/BordeauxII University; go_component: nucleus [goid
FT                   0005634]"
FT                   /db_xref="GI:72387500"
FT                   /db_xref="GeneID:3656546"
FT                   /translation="MNQNGGSVGDTRNILNGWLNGAYRPMKRQASRENENPSETGKGKS
FT                   LEEKLYDYIYNATWSYVMSGYNEEPLGMKVFDGRPPRMWTKEEVDVSHTLETMNEPLPR
FT                   HGNLEIAVLTSQVGWPYTSFQPQEKDYDINHKKGVEYVFKSDVYIRRETLRVWHKVEER
FT                   LNKWLMGEVTVNPMFHVLIGTPGIGKSFSTAPFLLYKLLHYESSQLQIIIYVVRGKAYV
FT                   FHKPKGGRAGYVTFYSNYEQASTYIDHIVRDSCGAEDIKGYLIFVVDKDHHAPVKPPVD
FT                   FSGIALSFPDARQFHEWSKQNGATHIYINCDTLKDLEAIHISRWGKIAPAYKWSPSDAK
FT                   EKIEREWQEIQARIRIVGPLLCHIVDLRSYEKRAQAMQNTILKLERGDTEYFRSVIRNR
FT                   AFWETHEASHKLVMVVRVKEEDFLLCDTYRCKPLSSCTGEAISDRLKPFIQEKSALVSE
FT                   LLSNRTLAAYRFKQSGIEVLSHEDALIELAKELRGLSLSEDQIPQSVLQVLQEPRLIGP
FT                   SIVVPEDVPIVAGTEIQYMILCKPQSGNFPVVDAFFFVENQKTFVGLQFTISDKQYCST
FT                   SGLFKMKKYLRSYFKHWDNFSNDMVWEIIYVQRVDSEKITKPQCCEGTIEGEGQNNKVE
FT                   ERFWREKVRQFSVSLSNHITALYVELQVRGNNNNGVNNRGGNNA"
FT                   /protein_id="XP_844174.1"
FT   repeat_region   37779..37798
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   38298..38332
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   gene            complement(39136..40569)
FT                   /note="synonym: Tb04.5D20.255; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative C-terminal domain of an
FT                   RHS2, interrupted by a RIME. Chimeric pseudogene between
FT                   RHS3 (N-terminal domain) and RHS2 (C-terminal domain):
FT                   pers. comm. Frederic Bringaud, CNRS/BordeauxII University."
FT                   /db_xref="GeneID:3656543"
FT                   /locus_tag="Tb927.4.210"
FT                   /pseudo
FT   repeat_region   complement(40569..40819)
FT                   /transposon="RIME-B"
FT   repeat_region   complement(40820..41067)
FT                   /transposon="RIME-A"
FT   gene            complement(41068..42102)
FT                   /note="synonym: Tb04.5D20.260; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative N-terminal domain of an
FT                   RHS2, interrupted by a RIME. Chimeric pseudogene between
FT                   RHS3 (N-terminal domain) and RHS2 (C-terminal domain):
FT                   pers. comm. Frederic Bringaud, CNRS/BordeauxII University."
FT                   /db_xref="GeneID:3656549"
FT                   /locus_tag="Tb927.4.220"
FT                   /pseudo
FT   gene            complement(43034..45070)
FT                   /note="synonym: Tb04.5D20.269; DNA-directed RNA polymerase
FT                   III subunit (pseudogene), putative"
FT                   /db_xref="GeneID:3656544"
FT                   /locus_tag="Tb927.4.230"
FT                   /pseudo
FT   gene            complement(46048..48507)
FT                   /note="synonym: Tb04.5D20.280; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative RHS4. Chimeric
FT                   pseudogene betwen RHS2 (N-terminal domain) and RHS4
FT                   (C-terminal domain): pers. comm. Frederic Bringaud,
FT                   CNRS/BordeauxII University."
FT                   /db_xref="GeneID:3656541"
FT                   /locus_tag="Tb927.4.240"
FT                   /pseudo
FT   repeat_region   48495..48541
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cagaga"
FT                   /rpt_type="tandem"
FT   gene            complement(<49436..>51463)
FT                   /note="synonym: Tb04.5D20.290; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656542"
FT                   /locus_tag="Tb927.4.250"
FT   mRNA            complement(<49436..>51463)
FT                   /db_xref="GI:72387501"
FT                   /db_xref="GeneID:3656542"
FT                   /locus_tag="Tb927.4.250"
FT                   /transcript_id="XM_839082.1"
FT   CDS_pept        complement(49436..51463)
FT                   /locus_tag="Tb927.4.250"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS5: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University; go_component: nucleus [goid 0005634]"
FT                   /db_xref="GI:72387502"
FT                   /db_xref="GeneID:3656542"
FT                   /translation="MNQNGGSVGDTRNVLNGWLNGAYRPMKRQASRENENPSETGEGKS
FT                   LEEKLYDSTYNAKWSYIIIDDGTQPLGMTLVDGMPNEGLMWKDEELNVVPKIEETLEQK
FT                   PERTEGVELLVLTSEMGWPYTGFARGSNSDIFIRREELRVWNVVRSGIELWRTQRVIPG
FT                   CLYLPRSYVAIGNPGIGKSQNLGSFILYKLLHYDAEELPVVAYFRGVAAYIFEKSDNGG
FT                   VGRVREYSKEAAITFMKVISSNTRGYIIYDFVNKGEQPPADVAPKWGSILISSPNLRNF
FT                   DSWQKQRKGAFIVVNCWEMSEMRAFFSRMGLKLFPQATHVELREKWNMYENRVERVGPS
FT                   LRYVFDEVMYGQELTAVDGELGSIVAGNKYGIYTKVLDNCGEWRDNDASHKLVKIVRIK
FT                   AREGNSFDTYVCVAHSESIKKRILNVVFSGIAEEWALTTGMMRNASAIGLYFEENAIKY
FT                   LCSPRVLTCFVSLITKLPANERARRMRTRKSILQHVRDDLLKVGRTNTVPGDINWAESE
FT                   GAPVELYVPCIPNYPVADAFFIVDDKEAAQASGTTGKKTIVLLQFTVASRHDTKTDEFI
FT                   HLLQSLLPSAEGGGHQNEATVEQLEEITEMFHWEIIYVQHFESTAMRSEQKCEITQGKA
FT                   KHRSHQFVKGFWKNNVQQYHVQYEDNIVIKMLAVAAAGRR"
FT                   /protein_id="XP_844175.1"
FT   misc_feature    53836..53860
FT                   /note="AT_rich"
FT   misc_feature    54010..54030
FT                   /note="AT_rich"
FT   gene            complement(<54845..>56518)
FT                   /note="synonym: Tb04.5D20.300; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656550"
FT                   /locus_tag="Tb927.4.260"
FT   mRNA            complement(<54845..>56518)
FT                   /db_xref="GI:72387503"
FT                   /db_xref="GeneID:3656550"
FT                   /locus_tag="Tb927.4.260"
FT                   /transcript_id="XM_839083.1"
FT   CDS_pept        complement(54845..56518)
FT                   /locus_tag="Tb927.4.260"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS3. Chimeric gene between RHS1 (N-terminal domain)
FT                   and RHS3 (C-terminal domain): pers. comm. Frederic
FT                   Bringaud, CNRS/BordeauxII University; go_component: nucleus
FT                   [goid 0005634]"
FT                   /db_xref="GI:72387504"
FT                   /db_xref="GeneID:3656550"
FT                   /translation="MRRPRDEHVAPPPAQPPQMPQRYKRFSDCKMNSTVRDFLLEEYAT
FT                   LPKMNLHDFLNQCFSNTYNTVNVSMETFVKNPEDYIKDAEILEDIQGLYEFREYKRIVE
FT                   KLPETEMWINYLKEEKIYTISDWVNGATPEVKNSISPVARGRLNAVQYAVTESEVWFLP
FT                   RVSVKSCRDVYDSFYNAKWSYVMSGYDAEPLGMKVFDGRPQRIWTEAELNITPKTADVD
FT                   ARVKEGSNGLEIFVLTSEKGWPYNRFVLGYTERCKTICKHVYIRREIMRVWYIIQRGLK
FT                   AWWMEATAEGPPIHIIIGTSGIGKTCGLGSFLFYSLLHFNEGMLDVVAYFLEDSAFLIY
FT                   NREGEERGTVDEYERWESAVAAINKMKSESKGHIVMDTRYAMEQLYTQLPSDVWSVTFL
FT                   TFPKSDHFDEWSANKGGHQIIMNCDDVRDMKAFMAWKKLSIHTGEKVSNRRRYELKREI
FT                   EDEWKIVEERINLIGPLPRYIFGLGCYEWHLKSVYDALRAMKKSDKYCYNDIIEHTADW
FT                   RNDEVMNKLVKIVRVKGNVGGVESYKCQALSLMIRNMMMN"
FT                   /protein_id="XP_844176.1"
FT   misc_feature    56993..57022
FT                   /note="AT_rich"
FT   misc_feature    59245..59291
FT                   /note="A-rich"
FT   misc_feature    59853..59873
FT                   /note="AT_rich"
FT   gene            complement(<60277..>61950)
FT                   /note="synonym: Tb04.5D20.310; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656548"
FT                   /locus_tag="Tb927.4.270"
FT   mRNA            complement(<60277..>61950)
FT                   /db_xref="GI:72387505"
FT                   /db_xref="GeneID:3656548"
FT                   /locus_tag="Tb927.4.270"
FT                   /transcript_id="XM_839084.1"
FT   CDS_pept        complement(60277..61950)
FT                   /locus_tag="Tb927.4.270"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS3. Chimeric gene between RHS1 (N-terminal domain)
FT                   and RHS3 (C-terminal domain): pers. comm. Frederic
FT                   Bringaud, CNRS/BordeauxII University; go_component: nucleus
FT                   [goid 0005634]"
FT                   /db_xref="GI:72387506"
FT                   /db_xref="GeneID:3656548"
FT                   /translation="MRRPRDEHVAPPPAQPPQMPQRYKRFSDWKMNSTVRDFLLERYAT
FT                   LPKMNLHDFLNQCFSNTYNTVNVSMETFVKNPEDYIKDAEILEDIQGLYEFREYKRIVE
FT                   KLPETEMWINYLKEEKIFTISDWVNGATPEVKNSISPVARGRLNAVQHAVTESEVWFLP
FT                   RVSVKSCRDVYDSFYNAKWSYVMSGYDAEPLGMKVFDGRPQRIWTEAELNITPKTADVD
FT                   ARVKEGSNGLEIFVLTSEKGWPYNRFVLGYTERCKTICKHVYIRREIMRVWYIIQRGLK
FT                   AWWMEATAEGPPIHIIIGTSGIGKTCGLGSFLFYSLLHFNEGMLDVVAYFLEDAAFLIY
FT                   NREGEGRGTVDEYKRWESAVSAINKMKSESKGHIVMDTRYAMEELYTQLPSDVWSVTFL
FT                   TFPKSAHFDEWSANKGGHHIIINCDDVRDMKAFMAWKKLSIHTGEKVSNRRRYELKREI
FT                   EDEWKIVEGRINLIGPLPRYIFGLGCYEWHLKSVYDALRAMKKSDKYCYNDIIEHTADW
FT                   RNDEVMNKLVKIVRVKGNVGGVESYKCQALSLMIRNMMMN"
FT                   /protein_id="XP_844177.1"
FT   misc_feature    62032..62052
FT                   /note="AT_rich"
FT   misc_feature    62425..62454
FT                   /note="AT_rich"
FT   misc_feature    64705..64729
FT                   /note="AT_rich"
FT   misc_feature    65287..65307
FT                   /note="AT_rich"
FT   gene            complement(<65711..>67384)
FT                   /note="synonym: Tb04.5D20.320; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656547"
FT                   /locus_tag="Tb927.4.280"
FT   mRNA            complement(<65711..>67384)
FT                   /db_xref="GI:72387507"
FT                   /db_xref="GeneID:3656547"
FT                   /locus_tag="Tb927.4.280"
FT                   /transcript_id="XM_839085.1"
FT   CDS_pept        complement(65711..67384)
FT                   /locus_tag="Tb927.4.280"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS3. Chimeric gene between RHS1 (N-terminal domain)
FT                   and RHS3 (C-terminal domain): pers. comm. Frederic
FT                   Bringaud, CNRS/BordeauxII University; go_component: nucleus
FT                   [goid 0005634]"
FT                   /db_xref="GI:72387508"
FT                   /db_xref="GeneID:3656547"
FT                   /translation="MRRPRDEHVAPPPAQPPQMPQRYKRFSDWKMNSTVRDFLLEEYAT
FT                   LPKMNLHDFLNQCFSNTYNTVNVSMETFVKNPEDYIKDAEILEDIQGLYEFREYKRIVE
FT                   KLPETEMWINYLKEEKIFTISDWVNGATPEVKNSISPVARGRLNAVQHAVTESEVWFLP
FT                   RVSVKSCRDVYDSFYNAKWSYVMSGYDAEPLGMKVFDGRPQRIWTEAELNITPKTADFD
FT                   ARVKEGSNGLEIFVLTSEKGWPYNRFVLGYTERCKTICKHVYIRREIMRVWYIIQRGLK
FT                   AWWMEATAEGPPIHIIIGTSGIGKTCGLGSFLFYSLLHFNEGMLDVVAYFLEDAAFLIY
FT                   NREGEGRGTVDEYKRWESAVAAINKMKSESKGHIVMDTRYAMEELYTQLPSDVWSVTFL
FT                   TFPKSAHFDEWSANKGGHHIIINCDDVRDMKAFMAWKKLSIHTGEKVSNRRRYELKREI
FT                   EDEWKIVEGRINLIGPLPRYIFGLGCYEWHLKSVYDALRAMKKSDKYCYNDIIEHTADW
FT                   RNDEVMNKLVKIVRVKGNVGGVESYKCQALSLMIRNMMMN"
FT                   /protein_id="XP_844178.1"
FT   misc_feature    67858..67887
FT                   /note="AT_rich"
FT   misc_feature    70134..70158
FT                   /note="AT_rich"
FT   gene            complement(<71146..>72819)
FT                   /note="synonym: Tb04.5D20.340; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656552"
FT                   /locus_tag="Tb927.4.290"
FT   mRNA            complement(<71146..>72819)
FT                   /db_xref="GI:72387509"
FT                   /db_xref="GeneID:3656552"
FT                   /locus_tag="Tb927.4.290"
FT                   /transcript_id="XM_839086.1"
FT   CDS_pept        complement(71146..72819)
FT                   /locus_tag="Tb927.4.290"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS3. Chimeric gene between RHS1 (N-terminal domain)
FT                   and RHS3 (C-terminal domain): pers. comm. Frederic
FT                   Bringaud, CNRS/BordeauxII University; go_component: nucleus
FT                   [goid 0005634]"
FT                   /db_xref="GI:72387510"
FT                   /db_xref="GeneID:3656552"
FT                   /translation="MRRPRDEHVAPPPAQPPQMPQRYKRFSDWKMNSTVRDFLLEEYAT
FT                   LPKMNLHDFLNQCFSNTYNTVNVSMETFVKNPEDYIKDAEILEDIQGLYEFREYKRIVE
FT                   KLPETEMWINYLKEEKIFTISDWVNGATPEVKNSISPVARGRLNAVQHAVTESEVWFLP
FT                   RVSVKSCRDVYDSFYNAKWSYVMSGYDAEPLGMKVFDGRPQRIWTEAELNITPKTADVD
FT                   ARVKEGSNGLEIFVLTSEKGWPYNRFVLGYTERCKTICKHVYIRREIMRVWYIIQRGLK
FT                   AWWMEATAEGPPIHIIIGTSGIGKTCGLGSFLFYSLLHFNEGMLDVVAYFLEDAAFLIY
FT                   NREGEGRGTVDEYKRWESAVAAINKMKSESKGHIVMDTRYAMEELYTQLPSDVWSVTFL
FT                   TFPKSAHFDEWSANKGGHHIIINCDDVRDMKAFMAWKKLSIHTGEKVSNRRRYELKREI
FT                   EDEWKIVEGRINLIGPLPRYIFGLGCYEWHLKSVYDALRAMKKSDKYCYNDIIEHTADW
FT                   RNDEVMNKLVKIVRVKGNVGGVESYKCQALSLMIRNMMMN"
FT                   /protein_id="XP_844179.1"
FT   misc_feature    73294..73323
FT                   /note="AT_rich"
FT   misc_feature    75547..75593
FT                   /note="A-rich"
FT   misc_feature    76151..76171
FT                   /note="AT_rich"
FT   gene            complement(<76576..>78294)
FT                   /note="synonym: Tb04.5D20.350; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3656553"
FT                   /locus_tag="Tb927.4.300"
FT   mRNA            complement(<76576..>78294)
FT                   /db_xref="GI:72387511"
FT                   /db_xref="GeneID:3656553"
FT                   /locus_tag="Tb927.4.300"
FT                   /transcript_id="XM_839087.1"
FT   CDS_pept        complement(76576..78294)
FT                   /locus_tag="Tb927.4.300"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS3. Chimeric gene between RHS1 (N-terminal domain)
FT                   and RHS3 (C-terminal domain): pers. comm. Frederic
FT                   Bringaud, CNRS/BordeauxII University; go_component: nucleus
FT                   [goid 0005634]"
FT                   /db_xref="GI:72387512"
FT                   /db_xref="GeneID:3656553"
FT                   /translation="MSRANSPAAPQGNNANPQVPNNIEGPMRRPRDENVAPPPAQPPQM
FT                   PQRYKRFSDWKMNSTVRDFLLEEYATLPKMNLHDFLNQCFSNTYNTVNVSMETFVKNPE
FT                   DYIKDAEILEDIQDTDEFQLLRADIYLSEEKIFTISDWVNGATPEVKNSISPVARGRLN
FT                   AVQHAVTESEVWFLPRVSVKSCRDVYDSFYNAKWSYVMSGYDAEPLGMKVFDGRPQRIW
FT                   TEAELNITPKTADFDARVKEGSNGLEIFVLTSEKGWPYNRFVLGYTERCKTICKHVYIR
FT                   REIMRVWYIIQRGLKAWWMEATAEGPPIHIIIGTSGIGKTCGLGSFLFYSLLHFNEGML
FT                   DVVAYFLEDAAFLIYNREGEERGTVDEYERWESAVAAINKMKFENRGHIIMDTRYAMEK
FT                   LYTQLPSDVWSVTFLTFPKSAHFDEWSANKGGHQIIMNCDDVRDMKAFMAWKKLSIHTG
FT                   EKVSNRRRYELKREIEDEWKIVEGRINLIGPLPRYIFGLGCYEWHLKRVYDALRAMKKS
FT                   DKYCYNDIIEHTADWRNDEVMNKLVKIVRVKGNVGGVESYKCQALSLMIRNMMMN"
FT                   /protein_id="XP_844180.1"
FT   misc_feature    78300..78330
FT                   /note="AT_rich"
FT   misc_feature    79102..79126
FT                   /note="AT_rich"
FT   misc_feature    79435..79455
FT                   /note="AT_rich"
FT   gene            complement(<80881..>100722)
FT                   /note="synonym: Tb04.5D20.370; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656554"
FT                   /locus_tag="Tb927.4.310"
FT   mRNA            complement(<80881..>100722)
FT                   /db_xref="GI:72387513"
FT                   /db_xref="GeneID:3656554"
FT                   /locus_tag="Tb927.4.310"
FT                   /transcript_id="XM_839088.1"
FT   CDS_pept        complement(80881..100722)
FT                   /locus_tag="Tb927.4.310"
FT                   /gene_family="HOG000260982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387514"
FT                   /db_xref="GeneID:3656554"
FT                   /translation="MAQSEMAAGGTNHQLVASVEGPFALAVPTSLTDIPPEVLLSEAHV
FT                   RELPAAQEDSVSTDSYSSVPHHQQMLPETTRAPPRRRRALRPSISREENDERNIKHTVV
FT                   VPEMYRFSKRQVHGNVWDINSELDPCENINVYPERGISLSLDNLVRYSPADLFSRAWPL
FT                   VPAPVKGASFAPFAQLPELPDILNVHHPDTEEVARFIRFTAVEFARRQRTLSPLFLRCL
FT                   LVKAAASSETTQAELVSLTGGTCFDEPVRSAWEDENSCDDDGDDIEDDQSVSRSGVPVS
FT                   DVDTVSSFDWAIAVVSDSLHPRVPMQVVRMLHKVIDRCGINSTNETLRSWGMRRVFRIL
FT                   LQQVEQESCSFSGGGGDSRWLFGAIELLFKLVLASKDIDSLLSIFRWVYRHPDLADRVT
FT                   LKGIRPWITSIETYARPRMRVLFPTSWVKCHDVSLAHSLGMEISRSVIGACVVSRNGEL
FT                   HGVVLTTRGIYKVLLVPPYNLVCKNENISLTGCRGVFLENNQIAVQSKTVGVVTFYDAE
FT                   TLQVRRVLEACKTNGNSGVYVYSGMDRFVIPHFHPNKSAPFYAKFSASMSVHGTVGPPT
FT                   LLIPPEAESLSVQFFLCPVRAEQCTSMGLVHVRCFNKEWLSVKVAINSKTSLLSICFGH
FT                   DEDLRVEVHEPLRSEWALWSATLQNTNGVFTWNVYKDAVMIKSCAVRCKVANLSTSTTG
FT                   SVDLLRGSFSGFISNIQIWHRAQCINDMLTSAKGRLSPASQCGLLCSFKMNEGSGCCLR
FT                   SSDGAITWKGVISWGPPPKVPFGCDVTEKEAIPYTPLGDYYVVTNTFETAIVEDGFCTW
FT                   MDANGRILEQCTADVHPKELYFLCGFTSRMYSVICDVSSGLSLRWVDTQAPPAMHVREL
FT                   ESMRDEETVSEKFLELEGDKGIVTPFSLSNLILHRLNAVLVAEGRCCGGTQYTPQFFSW
FT                   NSTSLRTVSRLIDISQDLILRVKQPLGRNSSSLLLLCVCGRLLTQQLTWIKRGCPPHLV
FT                   AIIVDMFETLSRLEPEDRGILMETQFVFKELHRVLVMECVSYDYLLERILSTERLTDIK
FT                   DLLVSDYIPSLVTSVLEKDLKKPFMAFLNRLKEACLAESQLILTGKGASFRPSCVLLPT
FT                   LLSILSRKANPQWHLVAIALLNSLCKGTMRLFNGLFSNVASGHTGGTEELNLLKQTAIG
FT                   VVVFPVVHYLVDLLLDSSIARDVLTLLNETRNVLYPYADILPAQYVNHNLTETHRIFVP
FT                   AACTHTTSLDLRYARSIEVLHEHPTTRETNKVRVALVTNEGRRTFVTMRDEHLTIECGG
FT                   RVEVTVTNTKKEESLITVNARVMLQTELSYWISDICLALGQAILHNTQQLLLKGLPDTV
FT                   VFPQNSIFRGGLSEEVLKKHNVPGMSDEVLLDKEDQKELTDLFEGFGDLLSQWQELYRK
FT                   KHVPYQDRLEYVMRAFCAAHAWHLRRTKNVSLLKHVEKSLDFMRKKSYLILEALQQGDE
FT                   KAMLDRARFLLDTLNPRDRLESAMAEQQQTEEPVTRVSSPTSVHSVANVRTTLSKSAHV
FT                   SHERTESWNVSALGRFTSSLSDLSKHCHEEVGSMNRPRIPLLTSDAISELVATNTESIS
FT                   TLVFKFLLNGCNGVTNEDLVRALVEKARYASNNKAVLRLQEKLLSSHQLDEDMSWLIVN
FT                   SHLFYREFIRSRRREYSNEASNNVRTNSGYSEATLEDLTEVHYIEPIIGCGFQRELELQ
FT                   RATCSFFHCVIHRNFSRIVEAKLQCEASRGMEALSLCAVLCHPWDSVDLSAINPSKVFR
FT                   VLKTYILAPIADTVVTPLNGSSTDIAWHRFLQDRGLFNLLYRSVIVPNSLQPAADGATV
FT                   VEGDTLGVHVEGADICFLARNQWRAFKAEEAFDMSPAQRDCYAALAGGCVLADMAEVLY
FT                   FEITLELALNEEVFVCIGVTSSSISSCESVGKDCSAAFCSDGTVRYSNANVEFSTPWSV
FT                   GDVIGCGIMAPSSSLFFTRNGEFLGIATECTFSTIIPFVAVQTDGMLVKLIVNFGENAP
FT                   FEFDMASLHSSCRTQTVSPVMISDASFIAVHYLVTVCLKNLQRLGQPGFNANGDSICAL
FT                   LEEASVFLRDVVVELVTSLKHLYSDESTHLLKRQRLHIGGVLLTRLFRIVNVVIDSFRC
FT                   SLVSRSAHLEILRICSITLSEAHDHWVKARAARSLGHMARTLRQDCFAEAVEALRGSMS
FT                   PDVIVNSLTELARAKIYPECSQRAFIPRWTGGRTRVTGGGAFYGEKPLPARGTHKVGFR
FT                   IRRQMQMGHGVGASLGGCYYIGLSHGHTPVTTMASLISRDDVYILQDADDGDQVPHLLL
FT                   RRQTIPRNSQRRVYGCDEVVWVELNADVGEITYYRENMVRIGLAFANIHRVDDLYPFVF
FT                   HFNEDAVCDIIADPSQVKESCELLLSSLRRGVAVSVLQQLHVTPYFGPAISDWIYSFFV
FT                   RSSYDLEKCIVALAILGGERSGLFCQHKTHGPVVVDSISESASRAVVYLEADPDGRQFS
FT                   TDVADLKPSFVMPALFSVSEGESLRCCGWLTSGLRRILFEASAVVPLMNDEKEQRMDIA
FT                   ENFVKTITDAMNMEYTALQIIRHETTNQKGSVTLLRRNAPVSATQSTSSSFRMVNGQQP
FT                   MSRTPVVIDRRFSTKSLFTPSPSIGVTSAAHYSAVRGNVVLEDVFSFAVSITIAESKGT
FT                   LMYIGVTAETEEPAEPQAIVRCENIWALCNRDSEGTNNTNCFVEPGMIYSAGQLLFDSD
FT                   DVVIIKVNRQEGTASFSRVRGGKCVDFGVLFEKIPEEKKLRPFVLTGPDSVVVFSFLDC
FT                   HTFPARNTYPPSNISALTRSTPPVLCASCGSEMLEAWYEGEGGICLCSECFNSWRYPKC
FT                   MFHFTDHNDNLTDYLLSQHSPKELVVGSIVGFMETAAFAWMRDKSVNVQIDGSTCIATD
FT                   GAAFAVLDDFSTYGDSRVDVTVSHVAGVDGFSFGGLHSFDLLWCVNNLLQTSVSIKSNM
FT                   ILISPTVIPNSSKVVVSMLFLDEDIEPSPVDASAIFVGVTSEECDYRVMTSAEFERRIA
FT                   HGNIWGTWSDSKTKAATPRSVYLSVDMTKGSIMLSSSLRGLHLHPTVATCNCPIEEDTN
FT                   LRVIVFTRTPCQVTSTGGWVSVNDDALDINSSSVAVGLIPSNCIGPDIGIMGCNNLLFD
FT                   TLSYTMAQCGTAWKVAPRIAEEGTGILFSIGDTITVERVDREVAAYRNGLLIATYTIPP
FT                   ETLLHRPRLVAYLSTRGMTATVVPPLFGKAHLGRVVRTCGSGVGVVKCLCPCQGKREYV
FT                   VRKRDVRHCALSADAAAIVVGAKVAFKAGSLVQPKRGLVTSIGGNTVNVCDETDKRVCF
FT                   SLDKNSIYVLDNEGPHKVLQPPYPALKAPDGSVTRVFVVGSTKFRLLRNESYNGIMFDV
FT                   RAEDSVVLTGLTVLTHASGRHRVEVFFKKGSHQMHERTSGSWTKIFSNFVKMRAGRQFS
FT                   VTFHGIRIEGGSTFALYINATHNFGVGHYAKEGGCSGAVSSEMDSDGTLTVLMGRTSES
FT                   STPFTDVSSNSCGFCGSIVYVRSEEAQALAVEETDSVVWREWDERNNDGCSDHLPLVSR
FT                   PQMSTLSERAEFVVTVFDGPVVLRELLLPVFVQPYVGHTIGPMSFHVSLYCADVNDSTE
FT                   GVTSRERNWVWVHHEVLLPKECSHRIVMNKLQLKMKRGTYVFSAVCERTMGMVRERGRE
FT                   RIRCFFTCSEQGHCVSNTFFSVRGLVGNILAVPANPMSVSEVLSAISTGGHLSQNNSAS
FT                   YNGIMFDIRSKQDVLLEEIFCISQTTADNINVRVFWKEGSMKGAEKVPSKWKEVATRYL
FT                   YLADKQTFSPGPLNLQLRANQMYALYVNTTSSCGVRFYNSSDGHVGDVGDEFESDGVLT
FT                   IYVGKKSEGIVPFLEIPSEPRAFRGRVTYRLIVQRRLLGRNMAVFPAVQGFVITRLLTA
FT                   LVAFASGPFSVTQPFEDTGVIESLGKLVKARPGNVGRQEISEDLLSGVVNGNLTDALGD
FT                   GVVTLPFGVNGVAYFNSLCKGDLAVIALGSGEFSAGELVRLVSDPDIKSQVAVEVGRGG
FT                   TPVCVTVPVDCLVPVIECGWCHQPFAVESVCQATGTVHFPALREEEHLISILARYIAQR
FT                   WNLSFDAGSACASSLVRHTRSTNFAADRIIKARRHDSISGRALDSGSVEYMLSPELLHE
FT                   DGWNEKCCSFACPFVYNENLAAFVSLLFTPLGDSWGVAFVTDLPLRLSSKSRPKLLQVS
FT                   LHIVFGDDIEQDILYEPATYYAAHGGPLHEQLGVFAPSQYCFFVKRRGCDCLRLSICEM
FT                   TFPPPTPFMSSVSHPWRWAGGYDTVELKPSEACELEGVFSTGAWPVNKPRFWKLGAVSA
FT                   TSANVFFLEVLVQLFRPIFKINWEGSRNSVIHRSFSLARDEELTLAFTADNDFVVYDED
FT                   DNVRCHVSYREHVGSSLKGISPKIAVMNVGPHPTSLYLHSPREVIDRGISTRSRSWSEG
FT                   VVEYTPVWTLCNPSKVVISNKGRTASCNDASGQAVIGSPLPTVGLSGFVVQITRSDRAG
FT                   GDSLGSGHFAGIVVSTFDQLEPHFVKLREQVDQVWIVQDVLDGDSLPTQERIPPIDSSG
FT                   NTMFLAGTKLHFLLDRDNGTLSLARNNESPRVVFHNIPSNLSVSPFVRLDHANASATLA
FT                   TFYGGALGAGKFRAPPSVVLASHPITPTILRRIPFRVVVSTYTVLRHVLYSLPSDRVTA
FT                   IELIWCDHCGNSKLAYRLSNALKQLAEVGAFSREMIRVEDKKLEEFCGQTAVRRVVDAL
FT                   SSPLDKPHVFIPGTADEGDTFIRLPSAYEVIGRVGGSSMVRLLYFDDNTTSKRTLHIFS
FT                   HDDPEITVTSFNVVTKHPCVMYQEDIMQSLDSSKSFGVITHGWFDGTLNSLDMERFSKQ
FT                   QQKSIVMSLLAALEHWHLHSLIHGNIHPKNVYVKTGRGATVTCAVWNVYTLRRYDHFAS
FT                   PQLQRQGTRDMKGDLWSCAQLLRMFSTFLICEEGFRSAAGMLEKGNMTISYILDQLREF
FT                   ADDAKKSAGEETIFLQTGRQACIPGNSCSGIMFDVIAKRNKVNIVKVYFVSDTTSTATV
FT                   TLFMRNGTFRGVEEQGGEWQVVMRRDMELARGVEAKVEGFESITISPGEHVAFFLHTTN
FT                   HSSIMFYTVSEDGRPGLSNVALEDKYIGITAGRVTTCTLPFSSIQKEKQLLHGGITYTI
FT                   PSQSCGYRSYLCQRVNARDLQFNRPVGGPVTVESLGRGLILCESGEQRLIFLGGTRMEW
FT                   VQWETVSRVSFDDSPAWRQLEDDLRGVICGRYLSLGSLNPPHMQSSKLQFNRRICNQCA
FT                   VTDRLTTEGDFFWWVSDPIRTSCIVSVKEISSVQGSSLFVSSSEGTDGEDLSKVESLDG
FT                   KKHIFIYVDELGRCVTSLEDGGYRIVKKLQDDLSQAALFLVYGPVPTCEDIFPLSVFVN
FT                   ARSYNCDFTQFEDDTAVFSYDTSVPLEHNLLFNGFALKCCAVPHETPKFSVASCVTYRS
FT                   DVSAVSLPFCDVPQTKEDAERDLSPILERQNHRRRLLLKFQRQQPWVEEEVTFSASPQH
FT                   VTISNGCVQHVSSIGPQSCTVTKPVIEGLKLHEIELLVCTSVQFPARVTFQHPPTAWFV
FT                   DVPIPIIPVHGESLILPTSSVKCVRLYIRVIPWAKRALVVVNGETVYEVLQGRDCPADM
FT                   QLSFTLSAPGTSVKVVHWRVLHKEDSPVQRSAMDTIWTQLMIDRISPNVSQGMGSLGQH
FT                   SWNTPAIGIQSGGESSLIPQVEEAMVSYAKKLIGTVIMSCNSSDTLKTLQHLLPYTTLR
FT                   NDLSSLTALVRAEVRRSSFFLLAAAYACLAAPFAAQSAENVEVSVNLIYVSLSLDGVIH
FT                   LLSTSFGSTLMLLLLRTATAHVRAVRNVALRCVLQLLKMSNCPLPSHEALCASLAPLLA
FT                   VISSMCQRGKMSCTFVQLGILLVSELLQRYQLERPSLPAPGRQSCVPYAIVICTKLAIE
FT                   AVTSKPPRPLPEAFTRGQQESHRISFELLTGPTSPEGYCSCYGVFSQTFRCTFGSKKFE
FT                   VVLNSARCGNVVVGWNMDASLPGSLAAGTSDKDQSSASTLLPSCGYLIKPNGKIHLCLS
FT                   RKKESQPLQVRAKGGDIVLVTCLYHEQAVIFNLQRESKNETTTRFETFPNEMLALPVFF
FT                   AERREDATFHGEQLLTEASTGMDVSQLYSRFQEHPHRLDTEVVAQSFEFYAELSLFCQT
FT                   FSISEKLLVSPNGDASLTVPSHDLVEYTHLLSFLGADVLGNDVPIERLVPYVKRLQIFD
FT                   TLTAVFSVVVDIRRSTELFEMWKKLKSLCSAESSKKIQNETMRPFRNRTGHKGKVTIHT
FT                   MHARASVRYGFYPTLMRSVFGQLFAQLQRSPISIFYVSPMFTVKLAGFGSTDVGGPYRD
FT                   ILSQLATEIMSTHPSGKFQQNPLFKDCGCDGQLAVMPNATMALEFQLFPMFEFFGKFLA
FT                   ACFITKDLLAVEFPPLFWKLLLSEETSLRDLRAMDRDIMRQLTPEALAERTAEELEERF
FT                   PGLQESWLRFCSENSHLRMREELPPVDLRTAGILAEHIASIEVHKYDVVISHIRHGFGQ
FT                   VIPLYTLNAFRWQQVELIICGTPKLSCQALRDVCEVSLPSNDSQMFDEVIETMCDKDRM
FT                   LLLRFTTGQTRLPLKENIKVKRGGTRDSLPTSNTCFFTLRIPAYSSIDVMRDRILYAIR
FT                   HCEAIDTDGLAQEHIVLDA"
FT                   /protein_id="XP_844181.1"
FT   gene            complement(<101307..>102563)
FT                   /note="synonym: Tb04.5D20.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656551"
FT                   /locus_tag="Tb927.4.320"
FT   mRNA            complement(<101307..>102563)
FT                   /db_xref="GI:72387515"
FT                   /db_xref="GeneID:3656551"
FT                   /locus_tag="Tb927.4.320"
FT                   /transcript_id="XM_839089.1"
FT   CDS_pept        complement(101307..102563)
FT                   /locus_tag="Tb927.4.320"
FT                   /gene_family="HOG000258694" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387516"
FT                   /db_xref="GeneID:3656551"
FT                   /translation="MRKSALKLLPLYVLFGQLVALLNSFTGVSTTKLINNNASYPVLQS
FT                   LTAYAFIFTFYGPLYLFLFLRHRHETFKNFTLLYRPWKYFFLGLVDSQANFVIVKAFQY
FT                   TDLVSAQLLICFSIPCVLVLSYFILKMRFSITHITGCVVATGGLVLLILLDADGISRTE
FT                   VGPNALKGDLLCLLAASLYAVSNVFMEYLIKPGNSNVQFPSAGGGSTPRDRIAESNCET
FT                   TINEHKHEGETVNVSPRLTATEVAGEGESRDVPAYIPVIESISFMSCFALVIATIQFFV
FT                   VEWDGFNSRTQVWTSEDWLYQMLFGFSMLLVYTGIPALFFMKSAVFGNVSLLATSVYGI
FT                   IWNVVFFRIYPTPVFFAAYVLIIIGVLVYALSDVRWRWCPRANYPCGDTPLLANSDATQ
FT                   RGGENMERSLATGNRNGLP"
FT                   /protein_id="XP_844182.1"
FT   gene            complement(<102940..>104079)
FT                   /note="synonym: Tb04.5D20.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656555"
FT                   /locus_tag="Tb927.4.330"
FT   mRNA            complement(<102940..>104079)
FT                   /db_xref="GI:72387517"
FT                   /db_xref="GeneID:3656555"
FT                   /locus_tag="Tb927.4.330"
FT                   /transcript_id="XM_839090.1"
FT   CDS_pept        complement(102940..104079)
FT                   /locus_tag="Tb927.4.330"
FT                   /gene_family="HOG000258844" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387518"
FT                   /db_xref="GeneID:3656555"
FT                   /translation="MPRTFYRRTATLCVSAAVATFTRRSSVWLQELSSPVSGSEQLLAC
FT                   MDFLDAHKGQWRIESTSFPPPAKLESVGNEPGLQVLRLSTTYTAVSNGGRGVPVLRLIG
FT                   YLPGVAPEEVHRHMTDLKLRRQWDHNYTMFCRWDDGTRKFIDPLGLIRRPMEHVTRKTP
FT                   VCEGDRCLLLPDVTSCVVDSGWFAHRVGNSLLEKFGIAERLFIYQRRSLCYTKQGGADA
FT                   NPLRMYDVLYSGDGEMLNHARTQSERFAEWMRSCSGGRKVSLVSMNYQHVLIVPISDVT
FT                   AQVWKQPDRLSFGGSMVSEENTKAVYNLFMETTSHFKETRKLDGTLVVMTSANDASIPS
FT                   HIPMWLQRKLTSVFSTYVYQQLLEAILSKRRDLNSEGKF"
FT                   /protein_id="XP_844183.1"
FT   gene            complement(<104394..>105083)
FT                   /note="synonym: Tb04.5D20.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656559"
FT                   /locus_tag="Tb927.4.340"
FT   mRNA            complement(<104394..>105083)
FT                   /db_xref="GI:72387519"
FT                   /db_xref="GeneID:3656559"
FT                   /locus_tag="Tb927.4.340"
FT                   /transcript_id="XM_839091.1"
FT   CDS_pept        complement(104394..105083)
FT                   /locus_tag="Tb927.4.340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387520"
FT                   /db_xref="GeneID:3656559"
FT                   /translation="MRLTSRGSHNSSQVVYLLDTREFITDCSTVRQVTHFAHVHRLGSP
FT                   LWLSCELASALGLTLRYMCSPLNIWSPLTGESFVQLASSPALARDTLYKFPINKEFLAP
FT                   GGVLPHNSGEGSLMALSAAASSDGKPRWYNIPKDVSHLFVLPKNLCQLSVPVHRGGFRP
FT                   RPFNLWVSTVIAVRMGGLAEAVKTVRTPSSFMTLVNADQMYPSALLAEKELECVLLMRK
FT                   EGRLGEM"
FT                   /protein_id="XP_844184.1"
FT   gene            complement(<105871..>107397)
FT                   /note="synonym: Tb04.5D20.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656558"
FT                   /locus_tag="Tb927.4.350"
FT   mRNA            complement(<105871..>107397)
FT                   /db_xref="GI:72387521"
FT                   /db_xref="GeneID:3656558"
FT                   /locus_tag="Tb927.4.350"
FT                   /transcript_id="XM_839092.1"
FT   CDS_pept        complement(105871..107397)
FT                   /locus_tag="Tb927.4.350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387522"
FT                   /db_xref="GeneID:3656558"
FT                   /translation="MKSANVPTENVLSQVTHLTPVDVSELLVRRGGVEPVISPPRAGVY
FT                   FGQLPHGFGRMVSETKNHCLHWSSHDVTRSPAVCFPVVGDILRREKRSEMIQLTHKDGA
FT                   TSFFAPQKRERGRIEALLFLGSAEGGHTQMFRPVHNSWSFHAQMLTGTERNGLCTTSQF
FT                   MELFLKKLVMWVFYYLARTSATYITIYNLEMAFPILTAISLQDRRYLVEEAANRFALGM
FT                   LSYYDDRIICRQRPPVNAVLLLSTEELRSVTSVEQASAAFIYRCQMKHNTILSALQYII
FT                   EYWGKRSTVFRSSVIQQAVSIILSHVSCTYSLLPALGAKSWIRTCTFRHMLLLLSQRGE
FT                   TLATSIVSTLRSSRPLKASRCAEFSKMLEQLVLTEPLAVGPVSDTSEMHEVEDVFFLES
FT                   VTLESNPNTKTVWKAEKNTFRFASVPSADIPSVSDKQLIGNSADLLFATALYSCGRLQF
FT                   SLPLLKCAHAKAETCLKLHLGGDLFVDSDSDSEKVVWRSLRMGKRRRKGY"
FT                   /protein_id="XP_844185.1"
FT   misc_feature    107815..107837
FT                   /note="AT_rich"
FT   repeat_region   107969..108030
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   107981..108030
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<108154..>108996)
FT                   /note="synonym: Tb04.5D20.430; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656562"
FT                   /locus_tag="Tb927.4.360"
FT   mRNA            complement(<108154..>108996)
FT                   /db_xref="GI:72387523"
FT                   /db_xref="GeneID:3656562"
FT                   /locus_tag="Tb927.4.360"
FT                   /transcript_id="XM_839093.1"
FT   CDS_pept        complement(108154..108996)
FT                   /locus_tag="Tb927.4.360"
FT                   /gene_family="HOG000260526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387524"
FT                   /db_xref="GeneID:3656562"
FT                   /translation="MEPDTDAAQRLKEEQEIRERDLKRQKEKEERERRAAAEREAEENR
FT                   RREAEERRIEEEKRRKRQEEEWRRLGSDIIQDLPPIPPSVVNDGLVDMWYLDDVTSKPQ
FT                   LCLASLKKGRKRDAPVPTLQQLKELGIIYFNVSLNDFSVVRQIVKERNYKHTDEVKLSQ
FT                   TCKDEQFLERWYQEHYNEDEQIRIVVDGSCFIDVRSKQDKWIRIHAKTGDLFVFPPGLY
FT                   QRGTLDEDDFVALYRIFRDSTRFAPIFRSNPRAESQKVRLNYLMLLKKGNVGKELGFR"
FT                   /protein_id="XP_844186.1"
FT   misc_feature    109024..109085
FT                   /note="T-rich"
FT   misc_feature    109290..109358
FT                   /note="T-rich"
FT   gene            complement(<110516..>111736)
FT                   /note="synonym: Tb04.5D20.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656560"
FT                   /locus_tag="Tb927.4.370"
FT   mRNA            complement(<110516..>111736)
FT                   /db_xref="GI:72387525"
FT                   /db_xref="GeneID:3656560"
FT                   /locus_tag="Tb927.4.370"
FT                   /transcript_id="XM_839094.1"
FT   CDS_pept        complement(110516..111736)
FT                   /locus_tag="Tb927.4.370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387526"
FT                   /db_xref="GeneID:3656560"
FT                   /translation="MVIDGDLVALETLLQANRRLQTHLRERIDDIAHRLASMAALIRAL
FT                   RAEGVRPKIVNRTTPLMRADQDIVFKFYYCNMVYAPPLFGRLQHNVLPLLSKPRWGHRA
FT                   VQHLKRQADCLGLGANAESYTKQWHTVADALNYDSSRVKPVSAFQCYLHFRHTMATSQE
FT                   PFSHEEDVIIYKHVPEPGMWKQLERKILEKCGRRRSAFQLAGRHQKLLSCDYQCTDFSE
FT                   DVLKQAVSLIDDDGDLTSRALIDFVMKLNAGHKLPWVTVEAIARAARDYGQSLLTEDEH
FT                   LRRSIHLVLLSDADYTTSSEAKALLVRTLHWNLMVSNAERFCVKYRYSQISLEEAANRL
FT                   SSSVSDVRNRILSAVLLRHNSVYNTHFANVSMTLFGNRDAAMICFVVSREYERSRKRML
FT                   PSIRIHL"
FT                   /protein_id="XP_844187.1"
FT   misc_feature    112242..112298
FT                   /note="T-rich"
FT   gene            complement(<112862..>113863)
FT                   /note="synonym: Tb04.5D20.460; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656561"
FT                   /locus_tag="Tb927.4.380"
FT   mRNA            complement(<112862..>113863)
FT                   /db_xref="GI:72387527"
FT                   /db_xref="GeneID:3656561"
FT                   /locus_tag="Tb927.4.380"
FT                   /transcript_id="XM_839095.1"
FT   CDS_pept        complement(112862..113863)
FT                   /locus_tag="Tb927.4.380"
FT                   /gene_family="HOG000260524" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387528"
FT                   /db_xref="GeneID:3656561"
FT                   /translation="MSEEHANDSTLRVKVATINDKGEEVYASSLSHDGTYLAAVFGDGA
FT                   LVIFNPSTFSALDSSAAGKGYDNVPCTAVQWLESSEGGLYRLVSVSSAGGVFIWQWDGA
FT                   ALHRTNRVPEKGNEITCLAVSPECDMFITAGSDRTVRLYDADGTLKANLQMAHDESGVS
FT                   RLAHTSRIFSVRFVSQGVAVSGGWGGPLQVWDLKANEARVEIRGAQVSSDGIELITGTN
FT                   CVLVASRRQKEQLQVFDCVSGQELADDSARLSMALGELIPLSSRLCKTSGLVWTITSSP
FT                   SKVLVTSYSTGQLIASYDSAYDLMNISIFEGLPNNAYISCAEGKLLFATVKQ"
FT                   /protein_id="XP_844188.1"
FT   misc_feature    113955..113977
FT                   /note="AT_rich"
FT   gene            complement(<114260..>114610)
FT                   /note="synonym: Tb04.5D20.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656557"
FT                   /locus_tag="Tb927.4.390"
FT   mRNA            complement(<114260..>114610)
FT                   /db_xref="GI:72387529"
FT                   /db_xref="GeneID:3656557"
FT                   /locus_tag="Tb927.4.390"
FT                   /transcript_id="XM_839096.1"
FT   CDS_pept        complement(114260..114610)
FT                   /locus_tag="Tb927.4.390"
FT                   /gene_family="HOG000260523" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387530"
FT                   /db_xref="GeneID:3656557"
FT                   /translation="MRDEQKEYATISGVWTRLILFSTLATAVIYVAVGLFACRRLIRTN
FT                   WQWILIAVVYFAVGLIHAFFSLSLLCLAIGCVFWVFGAEPMSLLEILTYTTIMVVHMCF
FT                   FAMGKKTILHAL"
FT                   /protein_id="XP_844189.1"
FT   misc_feature    114690..114726
FT                   /note="A-rich"
FT   repeat_region   114946..115005
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    115238..115271
FT                   /note="AT_rich"
FT   misc_feature    115437..115458
FT                   /note="AT_rich"
FT   gene            complement(<115494..>116648)
FT                   /note="synonym: Tb04.5D20.490; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3656565"
FT                   /locus_tag="Tb927.4.400"
FT   mRNA            complement(<115494..>116648)
FT                   /db_xref="GI:72387531"
FT                   /db_xref="GeneID:3656565"
FT                   /locus_tag="Tb927.4.400"
FT                   /transcript_id="XM_839097.1"
FT   CDS_pept        complement(115494..116648)
FT                   /locus_tag="Tb927.4.400"
FT                   /gene_family="HOG000260522" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="similar to Polyadenylate-binding protein
FT                   (Poly(A)-binding protein) (PABP). (Swiss-Prot:P31209)
FT                   [Schizosaccharomyces pombe]; go_function: RNA binding [goid
FT                   0003723]; go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72387532"
FT                   /db_xref="GeneID:3656565"
FT                   /translation="MESMPSEEPIEVFTEIYKPTLSVDVTAEPPEDTSTGTTPQTSVTP
FT                   HVSTNIFVAGVPPTWDENNLYQRFKEFGEIVSTKLVRQRHFAFVMFRKPESAHAAINAM
FT                   HLTHPTPNSPVKLHVSIAMHDEGVDDLPNDRIFIRGLAQWTTKEHLKQSFAPYGTIVEA
FT                   AVLTNHLGQCKGSGFVQFSSVEEATAAIEAKKNIRIEGLDSELEVKYSETAEVRQLRQE
FT                   RNKNRQKYSPKYRQRLSPFPFFPQVPVGPPMQTFPMIGVPTSVPVFYPPPPTATAVPSP
FT                   HVIYPTLVTSPPLPMFTTAPTIFEAKTEAFPSSGDVHLSGVSLSEPVLSSLLQRYGDVS
FT                   AMELLEDGAAAIRMADRNMHTLIVQELNGLVFSNGQLLVARLYA"
FT                   /protein_id="XP_844190.1"
FT   repeat_region   117271..117297
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<117385..>118335)
FT                   /note="synonym: Tb04.5D20.500; cell differentiation
FT                   protein, putative"
FT                   /db_xref="GeneID:3656556"
FT                   /locus_tag="Tb927.4.410"
FT   mRNA            complement(<117385..>118335)
FT                   /db_xref="GI:72387533"
FT                   /db_xref="GeneID:3656556"
FT                   /locus_tag="Tb927.4.410"
FT                   /transcript_id="XM_839098.1"
FT   CDS_pept        complement(117385..118335)
FT                   /locus_tag="Tb927.4.410"
FT                   /gene_family="HOG000192069" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell differentiation protein, putative"
FT                   /note="70% similar to SP:Q92368: Cell differentiation
FT                   protein rcd1. {Schizosaccharomyces pombe}"
FT                   /db_xref="GI:72387534"
FT                   /db_xref="GeneID:3656556"
FT                   /translation="MHQTQAYLPYGFYQPQQAAAKQQPPVSEDMRRMFQYLEGLYKPET
FT                   RENSILELAKDRESYHHLGPALWYGVGIMSVLLQEIISVYPLLSTPHLLAKGMANRVSS
FT                   VLTLLQAVAFHESTRRMFLDSQMCLFLYPFLRGMNEGTEGLRLTSLGVIGALVKTDDHD
FT                   VVQYLLNTEIFPLCLNIMESGTEFSKTLATFIVQRLLNSEGGLKYVCLTPERFTAVATV
FT                   LGKLVESKDCSTRLLRYIIRCYLRLSENQRGREALSRCLPQALRNATYKQALESNTGLV
FT                   RNLLQLLVNIGDAGATKLHESLLAGGKPQGGDASA"
FT                   /protein_id="XP_844191.1"
FT   repeat_region   118355..118374
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    118866..118941
FT                   /note="CT-rich"
FT   misc_feature    119064..119096
FT                   /note="A-rich"
FT   gene            complement(<119854..>127092)
FT                   /note="synonym: Tb04.5D20.520; phosphatidylinositol
FT                   3-kinase tor, putative"
FT                   /db_xref="GeneID:3656563"
FT                   /locus_tag="Tb927.4.420"
FT   mRNA            complement(<119854..>127092)
FT                   /db_xref="GI:72387535"
FT                   /db_xref="GeneID:3656563"
FT                   /locus_tag="Tb927.4.420"
FT                   /transcript_id="XM_839099.1"
FT   CDS_pept        complement(119854..127092)
FT                   /locus_tag="Tb927.4.420"
FT                   /gene_family="HOG000260521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylinositol 3-kinase tor, putative"
FT                   /EC_number="2.7.1.137"
FT                   /note="go_function: phosphotransferase activity, alcohol
FT                   group as acceptor [goid 0016773]; go_process: intracellular
FT                   signaling cascade [goid 0007242]"
FT                   /db_xref="GI:72387536"
FT                   /db_xref="GeneID:3656563"
FT                   /translation="MSLGYDARKVEALIRTIAVSSKCDVIYAAEVVKQAKDNQRKNQQE
FT                   YENLVSCLLFCLENFDVVEGGTAEVKCALVTLATLLQLDLTANQVSQCNSYLSICLTHV
FT                   QDVSVAFVASRAFGETLVTSMTSDFVQEQVEGAFLAIDLKENITHAQRVCALLMLQEVV
FT                   TKIPMRILDMLDSLFEKLWGMLASSDAMIREISHLLFMDCGKLLCSRSPVNRKKTVDSL
FT                   LHQLKFNLAAKSRESNMAGLLAFETVVMTSVGTASQPRYEDMSIMLVPYVMTGGSTNIA
FT                   ELRELLFRCLIVLCRYSTTLFITNQLKDTVGFALKSIENGYQVAASFNMLSEIIVLVTD
FT                   VAFRPFVNETCNAVRYVSGKSSKPCWEAVRCFSVICHVCPPVDVESYIEPCIENIFRWG
FT                   LSLPLIESMPHIIASSSAKYRSRLEEGLLDMISVTLCGLPFRQQPGSKGTITMKVESEP
FT                   TESQITVALDALVQFGFSDSELMGDFLRDSVLPLIDSESVSVRTAAVRTICTLLIPPGV
FT                   KGELTMARRICVDVILSRMLVVGLSNPDPVVRKGILSSFTEPFYPFLKEVQFVTSIYAA
FT                   LGDEDISCRVAATVLLCRMTFHDPSHILPIFRKQIVQILHTVSTSDNTGAVQSGLQLLD
FT                   AAASNAPQFVMNFADGIIKALGHHFSTVNIHSSILQHLLRCCTSVAHAAHFFGNTDAIF
FT                   RVEVDRAYMLLKALPLDSESVELRLWCLRFLSATLGPQIEGRSPYEVYPHLYQQLSGIV
FT                   KNNDEDLDVRLEALRCAGVIGALDISIFHSTVVNRTCRHEEMKRNEPSTLSHAMCCRVV
FT                   IRSIASLLDLSEKRFSGGKDNVLRVGIQTILNIAESCPDSRGEIAVVIPPVVRAVSELS
FT                   ACRLLGTLLHELTQIIRYVGVAALSHAHLLYNLIDESWVKSSKYRFLAVRLALTLVTLE
FT                   ADGKAESRRSNMRMSPIKFDALNDIESSESLRYAIIEYILKHTQTLKTCVETVVTNLLR
FT                   AAQRCPIDFALSVITTLRVVCFRLHVDEFAGLIVRGLLSCLKTRLSTSMRATEQNAFVS
FT                   RIMGVFCVLMTVLQSEFVKYSSEVLRTLKTLRVSNNELITLHGTLMKGGVCTLSKGFVT
FT                   EHQKQVVRLLKECEGIALRHVSDLDKVLSTRGNVDEKGWNSDDGERPLPFSEKLIISTT
FT                   RTAPLTKEEWLRWLNDFSCVIMQESPYRVFRCISLPLTANTSPLVDCSPQFTQDIAPHA
FT                   FRALWNFASASVRSSLADFFFQVLQQAMESSAVPDEVVSALLTVAEYMDNVGMALPIAP
FT                   SILSRCAWGRGMLAKALYWCEAAYRKDPRGTAKYLFSLYRELQQSGLLMVTGHSESLKL
FT                   LQGCIDNERSESDGSDEYSVKWLSRQESLRRMCGVGGRSRSDANSSFNGEDVKLDPEME
FT                   NEVNTLYALSEAGDYDAVLEQWKVLFQKYNGRDEQKREENTLFYVSQCAADASIRLQAW
FT                   DTLEDTTRWQLNDTVSYHVSRAALSIHKRRYEEATSAINEGRKLLLEDLSGLLHQSYTR
FT                   AYEGLVIAQKLSELEEIVTVKRAEVVSSTHHLSRVLRLWSQRIEMMSSTVSAWKEVLGV
FT                   RGLLIPPGEDVATRLRFVNLCRREKAKQHERFILCQLLGYRCPTSEQLMHSNANPRVVM
FT                   QYISFLSANGELGPKSSYGLERDLLKRMIDTHSRNENAFLLSSAYARLGSSAELSEAVQ
FT                   CYKAATTYCPKWFHAWRMFAESNAEMLDVTFSDATCAAAIEGYIQSIKLGNSDSTIIQD
FT                   VLKLLTLLSRHCDQESGLKELRKRVFEVSPRAWKLVVPQLIARLDSGSDGSCELVAEIL
FT                   TTVSFDCPLSLIYPLNLCAMSNSRRRRKYANIILDKLQSKHPLVVNQGRILVDELVRTS
FT                   DLLHEQWYHMLECSATAFFDRNDYKGMLDVLLPLHEKLHLSTDTIVEAEFTCKFGNKLD
FT                   RAQEWLQSYLRTGSIADLHSAWNIYHAVYQQIDKQIRSQSKLHLSFCSPKLFEARNLAV
FT                   GLPDAMPSEDCAVRCTASFNGTLTVIGSKQRPKRLSVTTVDGETQKYLLKGREDLRLDE
FT                   RVMQLFRLVNTLMMTDSRTCKNPGFQIQRYSVTPLKDTVGLIGWVSGCDTLHTLVTKYR
FT                   KFRGIPPELELRMMNQIIVCDRPKTYDHLTMISKVEVMEFLADHTSGHDVRKAMWASAS
FT                   NCEMWLEQRQVFTTSSATTCMVGYILGLGDRHPNNVMIQRTSGLFVHIDFGDCFEVAMT
FT                   RQMFPERVPFRLTRMIRNALDVFGVDGPFRSIAETAMCVLRDGSRSVLAILEAFIQDPL
FT                   ISWRLLNHMKKEPGDSTVHKNIDEQSEAVGPRMSSVAFPGAPVRDDMFTVDSKLTRCAS
FT                   IPDDDVVHKGVKVFQRVRSKLKGEEFLRTKGDTKSTDPKVQVARLIVEATDITNVAQSW
FT                   AGWYPFW"
FT                   /protein_id="XP_844192.1"
FT   repeat_region   127849..127912
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   gene            complement(<128072..>128728)
FT                   /note="synonym: Tb04.5D20.530; proteasome beta 7 subunit"
FT                   /db_xref="GeneID:3656564"
FT                   /locus_tag="Tb927.4.430"
FT   mRNA            complement(<128072..>128728)
FT                   /db_xref="GI:72387537"
FT                   /db_xref="GeneID:3656564"
FT                   /locus_tag="Tb927.4.430"
FT                   /transcript_id="XM_839100.1"
FT   CDS_pept        complement(128072..128728)
FT                   /locus_tag="Tb927.4.430"
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome beta 7 subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="identical to GP:12656357: 20S proteasome beta 7
FT                   subunit {Trypanosoma brucei}(PMID:11309374); 100% similar
FT                   to GP:12656357: 20S proteasome beta 7 subunit {Trypanosoma
FT                   brucei}(PMID:11309374); go_component: proteasome core
FT                   complex, beta-subunit complex (sensu Eukaryota) [goid
FT                   0019774]; go_function: endopeptidase activity [goid
FT                   0004175]; go_process: protein metabolism [goid 0019538]"
FT                   /db_xref="GI:72387538"
FT                   /db_xref="GeneID:3656564"
FT                   /translation="MASGGSVIGLKYNGGVLLASDTLLSYGSLAKWPNIPRIKIIGPHT
FT                   AVCATGDYADFQDMTEQLESHVERQRRYINDVLRPDEIFCYLHRHIYHKRSNFEPCLCS
FT                   FVVCGCQGGVPFLGGIDSVGTQWRDDCVATGYGAYIAIPLLRKALEKPGGLSREEAVEV
FT                   IKNCLRVLFYRECRAINKFQIADATNDAVEIGKPFEVETNWEYEGFCFEKTAIIR"
FT                   /protein_id="XP_844193.1"
FT   repeat_region   128775..128823
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   129066..129113
FT                   /rpt_family="polypurine"
FT   repeat_region   129597..129631
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tgaa"
FT                   /rpt_type="tandem"
FT   misc_feature    129692..129720
FT                   /note="AT_rich"
FT   gene            complement(<129797..>130135)
FT                   /note="synonym: Tb04.5D20.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656566"
FT                   /locus_tag="Tb927.4.440"
FT   mRNA            complement(<129797..>130135)
FT                   /db_xref="GI:72387539"
FT                   /db_xref="GeneID:3656566"
FT                   /locus_tag="Tb927.4.440"
FT                   /transcript_id="XM_839101.1"
FT   CDS_pept        complement(129797..130135)
FT                   /locus_tag="Tb927.4.440"
FT                   /gene_family="HOG000260520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387540"
FT                   /db_xref="GeneID:3656566"
FT                   /translation="MTGWNQKMAKMAFRRSKFRRLAWGDGDPYPYTPRATFRYQWDDWP
FT                   LWEKIWHIGIGIVGVEFAMWAYYSKLNSRMDWAREEALRRMRLRREAQELMILEGEKFD
FT                   SDIQPDRR"
FT                   /protein_id="XP_844194.1"
FT   misc_feature    130159..130180
FT                   /note="AT_rich"
FT   misc_feature    130207..130327
FT                   /note="A-rich"
FT   repeat_region   130679..130705
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<131219..>134797)
FT                   /note="synonym: Tb04.5D20.570; coatomer alpha subunit,
FT                   putative"
FT                   /db_xref="GeneID:3656572"
FT                   /locus_tag="Tb927.4.450"
FT   mRNA            complement(<131219..>134797)
FT                   /db_xref="GI:72387541"
FT                   /db_xref="GeneID:3656572"
FT                   /locus_tag="Tb927.4.450"
FT                   /transcript_id="XM_839102.1"
FT   CDS_pept        complement(131219..134797)
FT                   /locus_tag="Tb927.4.450"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coatomer alpha subunit, putative"
FT                   /note="go_component: Golgi membrane [goid 0000139];
FT                   go_component: cytoplasm [goid 0005737]; go_component:
FT                   ER-Golgi transport vesicle membrane [goid 0012507];
FT                   go_function: transporter activity [goid 0005215];
FT                   go_process: ER to Golgi transport [goid 0006888]"
FT                   /db_xref="GI:72387542"
FT                   /db_xref="GeneID:3656572"
FT                   /translation="MLTRFDVRSSRVKGISFHKTRPWVLCGLHNGTVQIWDYRVNTSVD
FT                   KYDEHSGAVRGVDFHDTQPLFVSGGDDYLVKVWNYKARRSLFTLKGHMDYVRSTFFHHE
FT                   QPWIVSSSDDFTVRIWNWQNRSSLACLPGHTHYVMCARFHPRDDIVVSASLDRTIRVWD
FT                   ISSLRVRKQQPGIAQDLLGTSDVGLKYSLEGHDKGVNWVCFHPTQPLIASASDDRTVRV
FT                   WRISSTTCTEEVQLRGHTNNVSCVVYTKDYLVSNGEDRTIRVWDVKTRCSVMLFRRESD
FT                   RYWMLAALLEKNLLAAGHDSGVHVFKLFRERPASTMNGNVLHYVHGNVLHSYNMESKTE
FT                   SKFSLSRNLHPPLTLSCNPVDNMAVVFYDKDGGCASTLTIPKPGCTVDADVKKRLGILA
FT                   ALFYAPNKCAFLDKNKNIILCNAHGDGEKVIKHEKNLKALFPGPAGYILRQTEEGMELF
FT                   HVAQQSVAAEVPITETKYVVWDKDFTKVAFLGITTVHVMTRRLRSITFFSEPSIRIKSA
FT                   AFDEQRNILYYTTSDHLKYCNLRNGECGIIQCLPSPIYLVRASGDTVWALSRNGKVVVM
FT                   ELNNPELNFKLKLQQQAYRDVIKIIRQKQLRGQALVGYLHKHGHDEVALYLVSDPLTRF
FT                   NLAVECGAMDVAKTAALELNQPALWRRLAEAATSYGDIHLALLAHTKTGNFHGASFLSL
FT                   ITGNMSALDHMVNTVRDENFGLHYGMYLDDAHQRVKTLTNTGQLPLAYVAAKSTGLDEL
FT                   AASLLEKMDPDVAERMRQTEVKVRLEAPTVTPVTDNWPMLQVEESVFSRFLREPNLLSG
FT                   AGVGIEEEEYAEAGAGWDDVDGLPNSDDGSGGLDGVEGSEAAEGDGWGDDLEIEIPAEQ
FT                   TAGGVEGAPYVVPTERPPLTQHWVETSSFPAFHVAAGSFSTALGLLRRQIGLGDPAPLK
FT                   THMLDLWATVNASRPSWLIPSAMFPLTTYPSEEQRGAASHSPLLPDYIPQLTERLRSGY
FT                   SAFVGGHFADAQLHFVTALHQAVFTTCRGEKQFTTLREIVTTASEYARALNVQLHCRST
FT                   DGASKLSLELSLYFTHFKLQRNHLALALGQAMSKAYKLKNLKIAASVARRLLDQDPPKQ
FT                   KAAQASAIVAEAERNPTDAEPVDYDERNPFVLCSVSHRPMYKGTVDPIRCGYCFSPAMP
FT                   KHKGEICPVCRIAFLGADCSGLANRT"
FT                   /protein_id="XP_844195.1"
FT   misc_feature    134847..134868
FT                   /note="AT_rich"
FT   gene            complement(<135156..>136127)
FT                   /note="synonym: Tb04.5D20.580; Alkylated DNA repair protein
FT                   (alkB homolog), putative"
FT                   /db_xref="GeneID:3656567"
FT                   /locus_tag="Tb927.4.460"
FT   mRNA            complement(<135156..>136127)
FT                   /db_xref="GI:72387543"
FT                   /db_xref="GeneID:3656567"
FT                   /locus_tag="Tb927.4.460"
FT                   /transcript_id="XM_839103.1"
FT   CDS_pept        complement(135156..136127)
FT                   /locus_tag="Tb927.4.460"
FT                   /gene_family="HOG000256421" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Alkylated DNA repair protein (alkB homolog),
FT                   putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_process:
FT                   DNA repair [goid 0006281]"
FT                   /db_xref="GI:72387544"
FT                   /db_xref="GeneID:3656567"
FT                   /translation="MEDPVRCECQKHAQDDGYSQGELLPLTAFRQVEKRYKLYRYDRRT
FT                   SRRLQVPETDFSDVVDFRNLEANTAANLACISTRECHEDDRLVKCCTFAGVPGMEVFPN
FT                   FLTDAEQQEFCRAALLEYGDSRRHPNHLSTHASEPRETTRYEPPMRWATVGFSYQWSSK
FT                   SYCKEKYSHFPRRLRKCVERIARLCNVSQPYEPQTSIVNYFPVGAMMMAHQDVSEEVLQ
FT                   QPLISISLGCSCVFLMGTESRDDTPCAFWLRSGDVIVVSGASRTAYHGVPRIMDDCPQY
FT                   LCPQNETEEEEGEFYWREQMRHLRVNINVRQVYPDRCEFLNE"
FT                   /protein_id="XP_844196.1"
FT   gene            complement(<137456..>138145)
FT                   /note="synonym: Tb04.5D20.620; snoRNP protein gar1,
FT                   putative"
FT                   /db_xref="GeneID:3656571"
FT                   /locus_tag="Tb927.4.470"
FT   mRNA            complement(<137456..>138145)
FT                   /db_xref="GI:72387545"
FT                   /db_xref="GeneID:3656571"
FT                   /locus_tag="Tb927.4.470"
FT                   /transcript_id="XM_839104.1"
FT   CDS_pept        complement(137456..138145)
FT                   /locus_tag="Tb927.4.470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="snoRNP protein gar1, putative"
FT                   /note="go_component: small nuclear ribonucleoprotein
FT                   complex [goid 0030532]; go_function: rRNA binding [goid
FT                   0019843]; go_process: rRNA processing [goid 0006364];
FT                   go_process: ribosome biogenesis [goid 0007046]"
FT                   /db_xref="GI:72387546"
FT                   /db_xref="GeneID:3656571"
FT                   /translation="MARGGGGFGGSRGGGFGGGRGGGGRGGGFGGGFGGGRGGGGRGGG
FT                   GGGGRSMEPDPPEQIVPIGTLLTASEGDLVYKVTASDSVPRFNAFVYGANKAKIGKIEE
FT                   ILGNTSDVMFSVKTVPGIQAESISAGDTIYISPTQISPLRMFTDPPKPRGRGGRGGGRG
FT                   GRGGDRGGRGSFGRGGRGSFGGGGGGGGGGRGGFGRGGDGGGYRNFGGGGGGRGGRGGF
FT                   GGRGRGF"
FT                   /protein_id="XP_844197.1"
FT   repeat_region   137493..137671
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ccg"
FT                   /rpt_type="tandem"
FT   repeat_region   137999..138136
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ccg"
FT                   /rpt_type="tandem"
FT   repeat_region   138306..138367
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   138313..138367
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   gene            complement(<138428..>139126)
FT                   /note="synonym: Tb04.5D20.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656570"
FT                   /locus_tag="Tb927.4.480"
FT   mRNA            complement(<138428..>139126)
FT                   /db_xref="GI:72387547"
FT                   /db_xref="GeneID:3656570"
FT                   /locus_tag="Tb927.4.480"
FT                   /transcript_id="XM_839105.1"
FT   CDS_pept        complement(138428..139126)
FT                   /locus_tag="Tb927.4.480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387548"
FT                   /db_xref="GeneID:3656570"
FT                   /translation="MVTGDMSTTVTGLDPHKMARRASRFVSSVKASTGTASSTGRTEME
FT                   RYFENFASMDSAEGLETIGPKGIQHLCEDLAIKRDSFEMYTLIWKLGITRGGCIPRSDW
FT                   LNMVYNYNIEVPVELKRRLREWVKDARGPSFVEFYSELYDYIRGDSARMMLPETAARAW
FT                   DVLFRGDQQVAQWIRWYTGFYDCEVTRDIWRHVALFFNTGENATPYRKEDAWPTAFDLF
FT                   AEWRETCETP"
FT                   /protein_id="XP_844198.1"
FT   misc_feature    139125..139145
FT                   /note="AT_rich"
FT   gene            complement(<139981..>141627)
FT                   /note="synonym: Tb04.5D20.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656575"
FT                   /locus_tag="Tb927.4.490"
FT   mRNA            complement(<139981..>141627)
FT                   /db_xref="GI:72387549"
FT                   /db_xref="GeneID:3656575"
FT                   /locus_tag="Tb927.4.490"
FT                   /transcript_id="XM_839106.1"
FT   CDS_pept        complement(139981..141627)
FT                   /locus_tag="Tb927.4.490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387550"
FT                   /db_xref="GeneID:3656575"
FT                   /translation="MSKRKRCMADVVGYLDSFMACKRTAESPPLSQSSDGEAMQLSLRS
FT                   DTSNENCSSSSGGSVPGPDTMHIPTVNEARVRLVKRADSPRLRGSVFETEMNFFCREEE
FT                   NIADMCVYLAEVASSSRTPEALMALVLYFMEHEPDMVMQSLKRAGLQSQLLSALCKSSA
FT                   RSVTDNKEGLYIRFVGHLLTLCDDEVLSDASLVKFFLLSSEKRAEEAAATPAGSKHWSQ
FT                   RAHCPTPPKQRRQDDSALKSAVDKFCRGKSDDTATSLALKALLHIIFRYNQATSFPGEA
FT                   NPCLVFAELGGFEVVTPMLNDADCKDVLHLLEVVTLCERLCPSYDAALQELVILLIRLV
FT                   AREDTKCENDVLTIALRVLVNGTSLVPHALRDSNRRRERSQLAEFSTKRLMSDNTPLNV
FT                   AAFILCSAVNIVKWEVASRCDEFARCLVNCPDFLSRIAELTLQCYNAEETERNVVSGYY
FT                   ALLLAVLSLIDTPKVQLRVPVITAVAQATKGTETGKAVESKPMKLIVAILQEFLLFQST
FT                   AGSLTKSGLVSMSTIIESVVKCNGIEISSDS"
FT                   /protein_id="XP_844199.1"
FT   gene            complement(<142454..>143746)
FT                   /note="synonym: Tb04.5D20.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656569"
FT                   /locus_tag="Tb927.4.500"
FT   mRNA            complement(<142454..>143746)
FT                   /db_xref="GI:72387551"
FT                   /db_xref="GeneID:3656569"
FT                   /locus_tag="Tb927.4.500"
FT                   /transcript_id="XM_839107.1"
FT   CDS_pept        complement(142454..143746)
FT                   /locus_tag="Tb927.4.500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387552"
FT                   /db_xref="GeneID:3656569"
FT                   /translation="MKRYFLIDESTGRIMRLLTGENIIRRGAEIAVKGANVVCVGTTCI
FT                   NVSRTHAIIKLCENGEAWLRDCESTNGTFLHSDTGVSVRLEPGFFYQLKRGNHVTFGDL
FT                   KLRFEWDVIAVCGGRVPVYDSNANLMDSSQGSGMNGASNDLLRLEGTVCSSICASCSLA
FT                   GTDATPPLPVTLTAASDEKTCAVVSVQLDCGVLCKPLCELENVVPYLSESTGAGRKRSR
FT                   SVIKNTTDRLSKVKSLPSSATVKSETTARGSRLKPKSKSKGRVKVCFSGMCGEATLAAK
FT                   FLAKKHCWSIVDNVCMADLLIINHPPVRTPKFIIAVARGIPVVTEEFFACGDMRQVRQF
FT                   APSLVHNNCTYDAGRLFQVITSNVGKPALLGRRFSLEKVPPAWRRTARNILTGCGAVVF
FT                   TKGTKSKSVISLTGATLTALYDDILRGKVPA"
FT                   /protein_id="XP_844200.1"
FT   gene            complement(<144166..>144603)
FT                   /note="synonym: Tb04.5D20.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656574"
FT                   /locus_tag="Tb927.4.510"
FT   mRNA            complement(<144166..>144603)
FT                   /db_xref="GI:72387553"
FT                   /db_xref="GeneID:3656574"
FT                   /locus_tag="Tb927.4.510"
FT                   /transcript_id="XM_839108.1"
FT   CDS_pept        complement(144166..144603)
FT                   /locus_tag="Tb927.4.510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387554"
FT                   /db_xref="GeneID:3656574"
FT                   /translation="MCVDTHTYIFVYVLTYFCLFLLPFHFSSSHQFDTRYKREGMEVAA
FT                   MSQASLLKDRLLNQGANHFVIFTSVGEVLEWSGDFQNEEKRLLAYTVAQQASTLLRPGE
FT                   ELKRISMVFDNVAYVITTIAGPNEHFGIVVKRAVSDALEQS"
FT                   /protein_id="XP_844201.1"
FT   gene            complement(<144882..>145493)
FT                   /note="synonym: Tb04.5D20.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656576"
FT                   /locus_tag="Tb927.4.520"
FT   mRNA            complement(<144882..>145493)
FT                   /db_xref="GI:72387555"
FT                   /db_xref="GeneID:3656576"
FT                   /locus_tag="Tb927.4.520"
FT                   /transcript_id="XM_839109.1"
FT   CDS_pept        complement(144882..145493)
FT                   /locus_tag="Tb927.4.520"
FT                   /gene_family="HOG000260513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387556"
FT                   /db_xref="GeneID:3656576"
FT                   /translation="MNKQLLQTLPLAKGKDIHNRIAKLALYKECIALASSVSDPLVRQH
FT                   TIVEVREKWLLSRGDGGQTLQLQLASALDRIAYGRMCVSKQRLRLIPNASEKYDWGVVN
FT                   PLEHHAQRIQRREERESPDAFPHGAGRRDFVPMTNWGYGNMDPDAVMRHKELTDRQHFM
FT                   GPHWRNKPKPVLLEDLSFEEQMYVQFQGKPKMKKTPKKHY"
FT                   /protein_id="XP_844202.1"
FT   gene            complement(<145985..>147517)
FT                   /note="synonym: Tb04.5D20.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656573"
FT                   /locus_tag="Tb927.4.530"
FT   mRNA            complement(<145985..>147517)
FT                   /db_xref="GI:72387557"
FT                   /db_xref="GeneID:3656573"
FT                   /locus_tag="Tb927.4.530"
FT                   /transcript_id="XM_839110.1"
FT   CDS_pept        complement(145985..147517)
FT                   /locus_tag="Tb927.4.530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387558"
FT                   /db_xref="GeneID:3656573"
FT                   /translation="MSPLDLLQQVESSYFVHASEVPLPKADVRAAFENIATSKEGYEVL
FT                   FTVTGRGTEPHSTVVYLCSGAAAAEWTRETLNEASVEVYALRKRGPASAFQPRKTRPAL
FT                   VPRNGVVQRERKLVPVLVNDDFPPPVKKERSPEPKPSVKEAPSPPPPTEEPMKRLEEEN
FT                   VVKNVEEEEKNRMDEMERGKNPAPVSLSGAAAEGAPKLIPKESGGKKQQTLLGMPVGGA
FT                   KRDRLIEDSKKASPKAKKPRAQSKKEAKVGEATTSLMKLAKASKKSSLTGSSSAAAAAN
FT                   GCNTDNAKSSRDILDDEEQSDGSSRGNRSPHRDEGLLDDPEPVLEVAFTPAENDEIILC
FT                   DNAPPMIFCAPEPTSSPLKRDPHRTQAANGNAALSAHPKLTGFFQPEVIAFQKEYSREL
FT                   ETDTVFEGGEYICSDRVVYRHVKTGAVLSEEEYHKKSAELMRTCVATEQKSTHDAGSKN
FT                   PLAVGGGGKASAKVAVERRGPPKVERQGATPQKNLMSFFGAVALKPSADTNR"
FT                   /protein_id="XP_844203.1"
FT   gene            complement(<148745..>150292)
FT                   /note="synonym: Tb04.5D20.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656577"
FT                   /locus_tag="Tb927.4.540"
FT   mRNA            complement(<148745..>150292)
FT                   /db_xref="GI:72387559"
FT                   /db_xref="GeneID:3656577"
FT                   /locus_tag="Tb927.4.540"
FT                   /transcript_id="XM_839111.1"
FT   CDS_pept        complement(148745..150292)
FT                   /locus_tag="Tb927.4.540"
FT                   /gene_family="HOG000260510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387560"
FT                   /db_xref="GeneID:3656577"
FT                   /translation="MSFRHFSRRSRVKWTRARRRVLIFLVLILMVPVCVCCGLLYKTLG
FT                   SSSRVGEAPTPISKKTAEDSQVAAVDYILPQEYVEALRTFANNLLLKEIEGDPWQPSGK
FT                   FTDIIAKPGLGVPLPYNLATVNSSKRGEWEACDRRNAEFTVERDELCKAYLSNLNNMRY
FT                   IKAMSSKLLYGRTIKFRITYAHNGIKALVKVSQGRFYFEASSEVAAFSVDRALNLSRVP
FT                   TTVLVALPVEHMQAAAATSPLLSQWASNTIFEDKNIKEDFVSCTNSSRHPPFRASLCAY
FT                   VSVQLWMHDVHPALETFLELPYKYDNAFAKKYFIPGSSFWPPKSARLRAIGELNDRFIF
FT                   DFIIGNSDRGMNDHNNFVYGGCGRETVCDRPMKDKRIKGLAKYAFLDHGSGFYSRADPS
FT                   NNPFSGNVANISICRFRRGTYDALKAYDEPDSLYRTLPLVAHVRKVLHPFVFNMLGLTI
FT                   FFTMQSRLEKVLRVVEQCLKKYSPEEVFSLPAYWEINIPEEWEGLDELPDFVDPDDD"
FT                   /protein_id="XP_844204.1"
FT   gene            complement(<150746..>151180)
FT                   /note="synonym: Tb04.5D20.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656568"
FT                   /locus_tag="Tb927.4.550"
FT   mRNA            complement(<150746..>151180)
FT                   /db_xref="GI:72387561"
FT                   /db_xref="GeneID:3656568"
FT                   /locus_tag="Tb927.4.550"
FT                   /transcript_id="XM_839112.1"
FT   CDS_pept        complement(150746..151180)
FT                   /locus_tag="Tb927.4.550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387562"
FT                   /db_xref="GeneID:3656568"
FT                   /translation="MYGNKGPPRKYSTPRGVDETSNAKKTCQKCGSKAHWTFECKGVTP
FT                   SRGAATTRLSRTQQLRWGIKQQRQEFVPEPTEWEAYKERVKGVERQLVAEARAEVSQKK
FT                   QRLEDRTGVKRESEEQSDMKVIIKEEDNTHNAKKTFKTEE"
FT                   /protein_id="XP_844205.1"
FT   gene            complement(<151603..>164301)
FT                   /note="synonym: Tb04.5D20.720"
FT                   /db_xref="GeneID:4443143"
FT                   /locus_tag="Tb927.4.560g"
FT   mRNA            complement(<151603..>164301)
FT                   /db_xref="GI:72387563"
FT                   /db_xref="GeneID:4443143"
FT                   /locus_tag="Tb927.4.560g"
FT                   /transcript_id="XM_839113.1"
FT   CDS_pept        complement(151603..164301)
FT                   /locus_tag="Tb927.4.560g"
FT                   /gene_family="HOG000258250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, putative"
FT                   /note="CH3-like dynein heavy chain, likely role in
FT                   intraflagellar transport : urated by B. Wickstead, Univ. of
FT                   Oxford; go_component: dynein complex [goid 0030286];
FT                   go_function: microtubule motor activity [goid 0003777];
FT                   go_process: microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:72387564"
FT                   /db_xref="GeneID:4443143"
FT                   /translation="MVSAEKDISDVCVDVAGETLKQLGASVSSTNRRSDVVELQIAVGS
FT                   EKCPPIAAALFSGFVKAACGSEAGTTKVGLTDVNIDARENFTVLRFAEAVRVRDLDFNE
FT                   LPGDSPPITSVVEVTYMRYLIKHSELQVFQVSDFPKCLTPRGGQRLDTVVAGYVLFSLQ
FT                   SSEEDDTKVLLYMKSLRRVLGGMCTSSFAETVLSQAWGNMDSVEPSHVTDMLEDAQMAI
FT                   TDFWNDSDQDTAIRTKVVFLMKTVGSNLREYFAKKTLDAGGVFSGSKNITEVALGCCDE
FT                   WVNMCKRLTTVDWGSSWGTAFEDVQLITVRDRLSVVVSIRDLVDEIVELLTAADKLQSL
FT                   RTETLWETFDSLDIFATTPAVEQLWTNCLDAFYRRLQPVEHRCASALSDFFGERGNLAP
FT                   QTILNEVVKFRQLIRRPAVSKELVNERDALLAKLNERLQSIRMEFERRSESVEDDVALD
FT                   EEDRRCQAGRFMPGVVNNMIWLRQLRGRTSDMISMCKSLLNDLQNAGEFLRSANTLMEE
FT                   IDDYVIETFKQWTMDVEGSKHVLMLDANAPLMDIAGDGSVRVNYPERLVQLIREVRIFR
FT                   SLGFRISTAIQEMVDQGIRFYRNGVALKQVASTYNSMKENIIPCTQAMLLEPALAFENI
FT                   ITASGDRKLTWRNTDDAERFIGKLRRASQALTDANRRLHKLHREIESIVIELFSIDLLR
FT                   LRERWTGKVRLIREKMETSGFNNMESWKQFWDMQIYKALEHQYQLGLESLHEVVAEIKA
FT                   DITYDPDTGLATLRPNIDVIRGQYYQRIKDFITFPLRFRGCGNSDIFGAMPGNNERGIF
FT                   AVMKHAAQLFKKVQQELKRFHPLLVIGRCGKGGNPSLEDIVGHTLKEVQHWEQSVRLLK
FT                   QKGKEINAEELFIKCGCITICTAGVKGTVEDHLHKLSQVLHVTLRDSAQKNLSRIEEYI
FT                   AEVTTALGARLTKLEEIGAANLQHAKLMEKRPAVEVEFHHLHNKNVLLQSMANKSDFDF
FT                   RGVKQRWDEVTRRLDAFEREMEKQVDSLKMSVEDTVSAWMKNLERFSNQWHEVKPKTVD
FT                   TPNAMKIVTERREQFKALKAEGEECIQQCKYFQLDEPDIEELEDLERDIEEYVQMWDIL
FT                   VKFQEELDVLRAEPWIIMRAKCYRFEDFGRHWEEQLRTFSSSPITVHIRTLLDSWMRCL
FT                   PVLKYLRGDGFTPSHWGEMFSLIGVRGVTQDTLKFGDVIDQHETLLRREADLKKLHARA
FT                   QGEAQIREALDDVRSWGNNAKFTLIPHPDREGVKLITEWKDTMSALSDNQALLMSMKES
FT                   PYFGIFANDANKWEERLACLDEYLRNMSQIQRKWVYLEPIFRRGALPQEQERFSRIDKE
FT                   YLQVMKVVAADSRLVSLAGHTEFKDVLYTVLEQLDRCQRALNQFLEAKRDSFPRFYFIS
FT                   DDDLLEILAHSRNPSVIQSHLKKLFMGVHSVRFDDAKEHILQINSLEGEVVPIEESVLI
FT                   TEEVEEWLGRLDLAVKDTLKLHLVRCVDKVNIGAYSSQILSTAGLITFTKQTEDAIRDA
FT                   KSGGLKKHRANLQAQLRELTTYAGGNSDVVIGLKVKALIMDLIHNIEVVDALIDAGIEK
FT                   DTDWLWRKQLRFYMDYSDSCVLRMVGAEFRYSYEYQGNAPKLVHTPLTDRCYLTLTQGM
FT                   QLGYGGNPYGPAGTGKTESVKALGNAMGRQVLVFNCDEGIDFKSMGRIFTGLVKCGAWG
FT                   CFDEFNRLKVDQLSAVSQMIQVIQEAIKNGEPRCHLMGKEINVDSNAGIFVTLNPAGKR
FT                   YGGRSKLPDNLKQLFRSVAMSVPDNELITRTILFSEGFENAVDLARKTVEVFKLSRDLL
FT                   SFQTHYDWGLRSMKAVLRLGGTLIHEYLTERACGKVNPSPEEIFEKESEIIIKSLRVNT
FT                   LSKLTFDDALLYNNLIADIFPGAPIKEIDYAELRPAIEESVKELKLQLVEAQIQKVLQL
FT                   YEALRQRMGVVLVGPGGSGKSTLLLILRRALQRLGKVIPQYIMNPKALPRTQLLGYMDN
FT                   DTREWFDGVLTEAARKVVKEETSVLSWIVCDGDIDPEWVESLNSVLDDNKLLTMPNGVR
FT                   IQFGDNVNFIFETHSLEFASPATVSRTGIIYLSEEDVDPKMMVTSWLVEQPEDVRDKLE
FT                   RWINDYFYKAIDALLATGKLIVDTTRTGLVASGLSQLQGCTGKAQFALALVYGLGSYLT
FT                   EEYRKDYAKEIHSMMSERLPDPKNPLDVYYDESSNCYRTFDVEPCTDLSVEDLYRDPMV
FT                   ATVDCQRNVKILQAWMKPVRPGIYRPFILVGPEGCGKKMLLTNLFGKTPGTRVTAVNCS
FT                   AQTEATHVIQKLKQMCQVYNTNQGRVLRPKEVERLVLLLKDMNLPKPDKYGTVQLHSLL
FT                   QQIVLYNGFYDTDLEWISLERVQIVGSMNPPGSMGRHPVAPRFLAMVSVLAMSYPSREA
FT                   MQNIYTEFFNIMIQSGRLQLNLPGKGAVDIARIMTTVYEAVASRYTVNVASHYMFNPRD
FT                   VTSWVLNLLNYNPEDVTNAIGYEGRRIFVDRLVTTEERSKISKVIHDNLIFLVGHKSGL
FT                   SEKETTSFVSWMDTSPIGKKKLTPIANEELKKPAEDFVLGYSREFADLDVQLIPEVCVW
FT                   MARVDRVLSQERGNLLLVGRSGVCAAGIVRLAAYGLRMELVTLGITREYSMKQFNAELK
FT                   TIMMKAGVEGQHVVLLLEDHNFTVNSSFLETINSLLASGEVPGLFAQEELDAMTAPLKE
FT                   DALGEGMSAYAYFVDRIARMLHVCVVMDPTNPNYEPQCRSNPALFTRCNVYWVGTWHTD
FT                   SFKLIPRLLMRDVFKSIDSRDNKKDFSLTTEIVHVHKEYINTFSPQHFKGLCLTYESIF
FT                   KEKSRMISEGITRLQTGVSKLDEAQENVDQIATDVVEKRKLMEVKQKEADDALQEIKTN
FT                   MEAASDQKKNIQKIRKDLEKEQKAIEERKSVIEERLSGIQPTLDAALSAVRSIRSEHLS
FT                   ELKSLKQPPPAVQDVMEAVIITIGGGGGGDTNWASIRKILAGDIKEQIINFNIAGFTEA
FT                   TRLRVTQFMQNHENSFKREVIGRASKAAAPMAEWIKAVLEYSSVLQTMGPMQAELKEYE
FT                   VSLASRSEKKRKYEEKLTKLEERVEGLKRNFGERTAEAERLKDHAEQAERLYACAHDLL
FT                   AKLTSEHDRWVSQIKVIRENQVLLPKRCLLAAAFILYLGNATEDGRRTALNVWKERLKD
FT                   VDNFEFFTFMRPESMQLHYKSEGLPGDELSMDNAVIIQEQVTTPLIIDSSGQALSWLVN
FT                   HLKGKGLSVEVCSVSEERFVSSLELALRFGKSFILTDVDGIEAFMYPLFRKELRTEGTK
FT                   RVIQFGDRRTVDYADGFQLYLVTNSTDLWIPPDVLSYLTPVNFSITQNGLEGQFLGATI
FT                   QHEQPELEKEKLAVLQKEERLKMQLSDLEESLLKDLAESKGSLLDNKTLIDSLNEIKTQ
FT                   AAEISVALETSKKVQEEIDTKRNVYRPFAKTASEIFFIVKSLKALSHMYQFSFSFFMGI
FT                   FNDTLHHHAEDRTDIDTKIDALTKTFVRSVVSSVCTSLFKEHRTVFGIHLARSLYPNDC
FT                   TAAEWDFFLDRAIAPEAKKSEVRVPTWVLPDSRDLYRSFAVLFEDLTPKLSLHEADVWL
FT                   QWMRSSNPEVSYPKFISQLSRFQRLLVVKTLRPDRLMAAVRSTACDMLHVKSYGDNNTL
FT                   AQLLTRTEANTPILLITTTGADPSQELQAIAHQKVGRDHFHQLAMGGGQAEEAVRLLRA
FT                   CAESGDWLFLKNLHLVIPWVTALQKELNVLKPDSKFRLFLTSEAHDDFPSIFLSQCLKI
FT                   TFEAPPGVQQNLLHTYQDWESGPYDAKGTLHTQLLFITASFHAILQERRSYIPQGWTKA
FT                   YEMTSADLKSASDIVLQQAKGETDWRAIRGLMEDAIYGSRLENEYDMRVLREYTDQFFN
FT                   PNVLSSAKQQMNLFAKVKVPASGKHGDCLKVISELPENDIPFVFSLPPNADRVVQLSKV
FT                   RALTDDLQLLIEARGESSMSREQWANKLRPILQVWEELMRPNPDLLQQTVSIARDASPI
FT                   LGFMGAEMTSSLRLVSIVDESMKDLGKVLEGQALLREDRRAEASTMIAGEVPAQWDNYY
FT                   QGSPRILPWLQSLLHRATSIAKLFELATNGNLLKSSLNISTMFRPHTFLHALRQETAHS
FT                   LHEPLVALRLVTSISTPPEGKTVPVCLEGLMLQGAVLDESNVLQSIEAADEAALFPMPK
FT                   TYVGWMTTMPDSVTTVGVPLYTNGTKEMFLAELHLPCASELAAKAFILAGVALVLEP"
FT                   /protein_id="XP_844206.1"
FT   gene            complement(<151603..>162891)
FT                   /note="synonyms: Tb04.5D20.720, Tb04.5E12.1195; dynein
FT                   heavy chain, putative"
FT                   /db_xref="GeneID:3656578"
FT                   /locus_tag="Tb927.4.560f"
FT   mRNA            complement(<151603..>162891)
FT                   /db_xref="GI:71751480"
FT                   /db_xref="GeneID:3656578"
FT                   /locus_tag="Tb927.4.560f"
FT                   /transcript_id="XM_819729.1"
FT   CDS_pept        complement(151603..>162891)
FT                   /locus_tag="Tb927.4.560f"
FT                   /gene_family="HOG000258250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, putative"
FT                   /note="CH3-like dynein heavy chain, likely role in
FT                   intraflagellar transport (curated by B. Wickstead, Univ. of
FT                   Oxford) Should be merged with annotated gene Tb04.5E12.1195
FT                   on overlapping BAC to construct the complete gene;
FT                   go_component: dynein complex [goid 0030286]; go_function:
FT                   microtubule motor activity [goid 0003777]; go_process:
FT                   microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:71751481"
FT                   /db_xref="GeneID:3656578"
FT                   /translation="PGVVNNMIWLRQLRGRTSDMISMCKSLLNDLQNAGEFLRSANTLM
FT                   EEIDDYVIETFKQWTMDVEGSKHVLMLDANAPLMDIAGDGSVRVNYPERLVQLIREVRI
FT                   FRSLGFRISTAIQEMVDQGIRFYRNGVALKQVASTYNSMKENIIPCTQAMLLEPALAFE
FT                   NIITASGDRKLTWRNTDDAERFIGKLRRASQALTDANRRLHKLHREIESIVIELFSIDL
FT                   LRLRERWTGKVRLIREKMETSGFNNMESWKQFWDMQIYKALEHQYQLGLESLHEVVAEI
FT                   KADITYDPDTGLATLRPNIDVIRGQYYQRIKDFITFPLRFRGCGNSDIFGAMPGNNERG
FT                   IFAVMKHAAQLFKKVQQELKRFHPLLVIGRCGKGGNPSLEDIVGHTLKEVQHWEQSVRL
FT                   LKQKGKEINAEELFIKCGCITICTAGVKGTVEDHLHKLSQVLHVTLRDSAQKNLSRIEE
FT                   YIAEVTTALGARLTKLEEIGAANLQHAKLMEKRPAVEVEFHHLHNKNVLLQSMANKSDF
FT                   DFRGVKQRWDEVTRRLDAFEREMEKQVDSLKMSVEDTVSAWMKNLERFSNQWHEVKPKT
FT                   VDTPNAMKIVTERREQFKALKAEGEECIQQCKYFQLDEPDIEELEDLERDIEEYVQMWD
FT                   ILVKFQEELDVLRAEPWIIMRAKCYRFEDFGRHWEEQLRTFSSSPITVHIRTLLDSWMR
FT                   CLPVLKYLRGDGFTPSHWGEMFSLIGVRGVTQDTLKFGDVIDQHETLLRREADLKKLHA
FT                   RAQGEAQIREALDDVRSWGNNAKFTLIPHPDREGVKLITEWKDTMSALSDNQALLMSMK
FT                   ESPYFGIFANDANKWEERLACLDEYLRNMSQIQRKWVYLEPIFRRGALPQEQERFSRID
FT                   KEYLQVMKVVAADSRLVSLAGHTEFKDVLYTVLEQLDRCQRALNQFLEAKRDSFPRFYF
FT                   ISDDDLLEILAHSRNPSVIQSHLKKLFMGVHSVRFDDAKEHILQINSLEGEVVPIEESV
FT                   LITEEVEEWLGRLDLAVKDTLKLHLVRCVDKVNIGAYSSQILSTAGLITFTKQTEDAIR
FT                   DAKSGGLKKHRANLQAQLRELTTYAGGNSDVVIGLKVKALIMDLIHNIEVVDALIDAGI
FT                   EKDTDWLWRKQLRFYMDYSDSCVLRMVGAEFRYSYEYQGNAPKLVHTPLTDRCYLTLTQ
FT                   GMQLGYGGNPYGPAGTGKTESVKALGNAMGRQVLVFNCDEGIDFKSMGRIFTGLVKCGA
FT                   WGCFDEFNRLKVDQLSAVSQMIQVIQEAIKNGEPRCHLMGKEINVDSNAGIFVTLNPAG
FT                   KRYGGRSKLPDNLKQLFRSVAMSVPDNELITRTILFSEGFENAVDLARKTVEVFKLSRD
FT                   LLSFQTHYDWGLRSMKAVLRLGGTLIHEYLTERACGKVNPSPEEIFEKESEIIIKSLRV
FT                   NTLSKLTFDDALLYNNLIADIFPGAPIKEIDYAELRPAIEESVKELKLQLVEAQIQKVL
FT                   QLYEALRQRMGVVLVGPGGSGKSTLLLILRRALQRLGKVIPQYIMNPKALPRTQLLGYM
FT                   DNDTREWFDGVLTEAARKVVKEETSVLSWIVCDGDIDPEWVESLNSVLDDNKLLTMPNG
FT                   VRIQFGDNVNFIFETHSLEFASPATVSRTGIIYLSEEDVDPKMMVTSWLVEQPEDVRDK
FT                   LERWINDYFYKAIDALLATGKLIVDTTRTGLVASGLSQLQGCTGKAQFALALVYGLGSY
FT                   LTEEYRKDYAKEIHSMMSERLPDPKNPLDVYYDESSNCYRTFDVEPCTDLSVEDLYRDP
FT                   MVATVDCQRNVKILQAWMKPVRPGIYRPFILVGPEGCGKKMLLTNLFGKTPGTRVTAVN
FT                   CSAQTEATHVIQKLKQMCQVYNTNQGRVLRPKEVERLVLLLKDMNLPKPDKYGTVQLHS
FT                   LLQQIVLYNGFYDTDLEWISLERVQIVGSMNPPGSMGRHPVAPRFLAMVSVLAMSYPSR
FT                   EAMQNIYTEFFNIMIQSGRLQLNLPGKGAVDIARIMTTVYEAVASRYTVNVASHYMFNP
FT                   RDVTSWVLNLLNYNPEDVTNAIGYEGRRIFVDRLVTTEERSKISKVIHDNLIFLVGHKS
FT                   GLSEKETTSFVSWMDTSPIGKKKLTPIANEELKKPAEDFVLGYSREFADLDVQLIPEVC
FT                   VWMARVDRVLSQERGNLLLVGRSGVCAAGIVRLAAYGLRMELVTLGITREYSMKQFNAE
FT                   LKTIMMKAGVEGQHVVLLLEDHNFTVNSSFLETINSLLASGEVPGLFAQEELDAMTAPL
FT                   KEDALGEGMSAYAYFVDRIARMLHVCVVMDPTNPNYEPQCRSNPALFTRCNVYWVGTWH
FT                   TDSFKLIPRLLMRDVFKSIDSRDNKKDFSLTTEIVHVHKEYINTFSPQHFKGLCLTYES
FT                   IFKEKSRMISEGITRLQTGVSKLDEAQENVDQIATDVVEKRKLMEVKQKEADDALQEIK
FT                   TNMEAASDQKKNIQKIRKDLEKEQKAIEERKSVIEERLSGIQPTLDAALSAVRSIRSEH
FT                   LSELKSLKQPPPAVQDVMEAVIITIGGGGGGDTNWASIRKILAGDIKEQIINFNIAGFT
FT                   EATRLRVTQFMQNHENSFKREVIGRASKAAAPMAEWIKAVLEYSSVLQTMGPMQAELKE
FT                   YEVSLASRSEKKRKYEEKLTKLEERVEGLKRNFGERTAEAERLKDHAEQAERLYACAHD
FT                   LLAKLTSEHDRWVSQIKVIRENQVLLPKRCLLAAAFILYLGNATEDGRRTALNVWKERL
FT                   KDVDNFEFFTFMRPESMQLHYKSEGLPGDELSMDNAVIIQEQVTTPLIIDSSGQALSWL
FT                   VNHLKGKGLSVEVCSVSEERFVSSLELALRFGKSFILTDVDGIEAFMYPLFRKELRTEG
FT                   TKRVIQFGDRRTVDYADGFQLYLVTNSTDLWIPPDVLSYLTPVNFSITQNGLEGQFLGA
FT                   TIQHEQPELEKEKLAVLQKEERLKMQLSDLEESLLKDLAESKGSLLDNKTLIDSLNEIK
FT                   TQAAEISVALETSKKVQEEIDTKRNVYRPFAKTASEIFFIVKSLKALSHMYQFSFSFFM
FT                   GIFNDTLHHHAEDRTDIDTKIDALTKTFVRSVVSSVCTSLFKEHRTVFGIHLARSLYPN
FT                   DCTAAEWDFFLDRAIAPEAKKSEVRVPTWVLPDSRDLYRSFAVLFEDLTPKLSLHEADV
FT                   WLQWMRSSNPEVSYPKFISQLSRFQRLLVVKTLRPDRLMAAVRSTACDMLHVKSYGDNN
FT                   TLAQLLTRTEANTPILLITTTGADPSQELQAIAHQKVGRDHFHQLAMGGGQAEEAVRLL
FT                   RACAESGDWLFLKNLHLVIPWVTALQKELNVLKPDSKFRLFLTSEAHDDFPSIFLSQCL
FT                   KITFEAPPGVQQNLLHTYQDWESGPYDAKGTLHTQLLFITASFHAILQERRSYIPQGWT
FT                   KAYEMTSADLKSASDIVLQQAKGETDWRAIRGLMEDAIYGSRLENEYDMRVLREYTDQF
FT                   FNPNVLSSAKQQMNLFAKVKVPASGKHGDCLKVISELPENDIPFVFSLPPNADRVVQLS
FT                   KVRALTDDLQLLIEARGESSMSREQWANKLRPILQVWEELMRPNPDLLQQTVSIARDAS
FT                   PILGFMGAEMTSSLRLVSIVDESMKDLGKVLEGQALLREDRRAEASTMIAGEVPAQWDN
FT                   YYQGSPRILPWLQSLLHRATSIAKLFELATNGNLLKSSLNISTMFRPHTFLHALRQETA
FT                   HSLHEPLVALRLVTSISTPPEGKTVPVCLEGLMLQGAVLDESNVLQSIEAADEAALFPM
FT                   PKTYVGWMTTMPDSVTTVGVPLYTNGTKEMFLAELHLPCASELAAKAFILAGVALVLEP
FT                   "
FT                   /protein_id="XP_824822.1"
FT   misc_feature    162892..331120
FT                   /note="sequence corresponds to BAC RPCI93-5E12"
FT   gene            complement(<162892..>164301)
FT                   /note="synonyms: Tb04.5E12.1195, Tb04.5D20.720; dynein
FT                   heavy chain, putative"
FT                   /db_xref="GeneID:3656579"
FT                   /locus_tag="Tb927.4.560"
FT   mRNA            complement(<162892..>164301)
FT                   /db_xref="GI:71905127"
FT                   /db_xref="GeneID:3656579"
FT                   /locus_tag="Tb927.4.560"
FT                   /transcript_id="XM_824941.1"
FT   CDS_pept        complement(<162892..164301)
FT                   /locus_tag="Tb927.4.560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, putative"
FT                   /note="CH3-like dynein heavy chain, likely role in
FT                   intraflagellar transport (curated by B. Wickstead, Univ. of
FT                   Oxford) Should be merged with annotated gene Tb04.5D20.720
FT                   on overlapping BAC to construct the complete gene;
FT                   go_component: dynein complex [goid 0030286]; go_function:
FT                   microtubule motor activity [goid 0003777]; go_process:
FT                   microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:71905128"
FT                   /db_xref="GeneID:3656579"
FT                   /translation="MVSAEKDISDVCVDVAGETLKQLGASVSSTNRRSDVVELQIAVGS
FT                   EKCPPIAAALFSGFVKAACGSEAGTTKVGLTDVNIDARENFTVLRFAEAVRVRDLDFNE
FT                   LPGDSPPITSVVEVTYMRYLIKHSELQVFQVSDFPKCLTPRGGQRLDTVVAGYVLFSLQ
FT                   SSEEDDTKVLLYMKSLRRVLGGMCTSSFAETVLSQAWGNMDSVEPSHVTDMLEDAQMAI
FT                   TDFWNDSDQDTAIRTKVVFLMKTVGSNLREYFAKKTLDAGGVFSGSKNITEVALGCCDE
FT                   WVNMCKRLTTVDWGSSWGTAFEDVQLITVRDRLSVVVSIRDLVDEIVELLTAADKLQSL
FT                   RTETLWETFDSLDIFATTPAVEQLWTNCLDAFYRRLQPVEHRCASALSDFFGERGNLAP
FT                   QTILNEVVKFRQLIRRPAVSKELVNERDALLAKLNERLQSIRMEFERRSESVEDDVALD
FT                   EEDRRCQAGRFM"
FT                   /protein_id="XP_830034.1"
FT   misc_feature    164434..164507
FT                   /note="T-rich"
FT   misc_feature    complement(164434..164507)
FT                   /note="A-rich"
FT   gene            complement(<165137..>166933)
FT                   /note="synonym: Tb04.5E12.1190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656581"
FT                   /locus_tag="Tb927.4.570"
FT   mRNA            complement(<165137..>166933)
FT                   /db_xref="GI:72387565"
FT                   /db_xref="GeneID:3656581"
FT                   /locus_tag="Tb927.4.570"
FT                   /transcript_id="XM_839114.1"
FT   CDS_pept        complement(165137..166933)
FT                   /locus_tag="Tb927.4.570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387566"
FT                   /db_xref="GeneID:3656581"
FT                   /translation="MAELFCINTVKGKEDMFQLTTGFCESALTAPLSGDSRGETFTLRW
FT                   PNPSLQVIDIQRFPERVVQSSTQSLFYLALSDTLSLIWLVIPPSTGMEELVSTFQIEIG
FT                   YCVKLREYTLVAARNGRNVVVPLSITHSNTVYPLLGNPVFNSNLFRLSANALVYRYTNT
FT                   CSSSSATWQSTPLGDYGARTIRQVVTAEGKGFNDCVVYLRVVWKNKIRQVASSGILGRF
FT                   AVDCVGVDADGDAVSVSFFGSSVISDMFDVGDCIRCRNPAFVDKGESGYSEKLNVFDWS
FT                   STPGCCAGAEHLIPKHPRYVFFSCSVQYLVECCEVGDIVSVYGEVAAFSPTTLVNTRYG
FT                   HVGRSVVELRDLNSLQHSIEVTLWGDMGAIVVPVVGEQWCFSNFLVRIFGGRITASSRC
FT                   VSSAFVMSPKGRVDVASNERPEEQPPHTSKQEEVAGGTHNADIVQLVFDLDEISESLPV
FT                   LAKVKGVKHPLTYTACSACGRKVGNETSVCSSCPEASVEERFLVQLELSDGIRSARAFG
FT                   LESVGKELFGFDTSTLLRYRKDSPNFERLITHELIGLPALFWLEQSLGGVTQVKRCQRV
FT                   DMARCAAVVLGAVEQIMSEGGL"
FT                   /protein_id="XP_844207.1"
FT   gene            complement(<167194..>168474)
FT                   /note="synonym: Tb04.5E12.1180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656580"
FT                   /locus_tag="Tb927.4.580"
FT   mRNA            complement(<167194..>168474)
FT                   /db_xref="GI:72387567"
FT                   /db_xref="GeneID:3656580"
FT                   /locus_tag="Tb927.4.580"
FT                   /transcript_id="XM_839115.1"
FT   CDS_pept        complement(167194..168474)
FT                   /locus_tag="Tb927.4.580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387568"
FT                   /db_xref="GeneID:3656580"
FT                   /translation="MVNGVVPSQKTKAAECCGEESMVQQDLIAWRQKMREECRQRLRAA
FT                   TTRAGLMRAPSQKSTFSGPSTQSKLGERECSVRCRNSHKQLEKSEMSELQRYSLELCEA
FT                   QGPPQGGKENLPWFMAPVSVWNKQMKRYCGTKGEGSIVKKEPYPQHKETVRAAASLSVP
FT                   SKQQGSAFHVYKDELAVCTTAYKKSSMFSSSPLRRKLLRRIGARTKSKHSTNVQAEGQK
FT                   TTEVSHSQQNKDTSGTERTGANAFKNPPRSQHRRTVSEVTLTHAKAVDASNVEFPPRGK
FT                   VYRSGLRSSSAGTIRYGIASRPVEASCCSKGAVVSTPVSGDMCHSKLEKTTKELSLDRT
FT                   GALSPLTDAVVSSETPTCNTSFESVSNFTGELTRGEPSPMFAQLLDRLAFPLPSHGAVV
FT                   ESSAAVPAPRELCPQPYPFDVSRRMTH"
FT                   /protein_id="XP_844208.1"
FT   gene            complement(<169130..>171586)
FT                   /note="synonym: Tb04.5E12.1170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656582"
FT                   /locus_tag="Tb927.4.590"
FT   mRNA            complement(<169130..>171586)
FT                   /db_xref="GI:72387569"
FT                   /db_xref="GeneID:3656582"
FT                   /locus_tag="Tb927.4.590"
FT                   /transcript_id="XM_839116.1"
FT   CDS_pept        complement(169130..171586)
FT                   /locus_tag="Tb927.4.590"
FT                   /gene_family="HOG000260506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387570"
FT                   /db_xref="GeneID:3656582"
FT                   /translation="MRPTLYFLLLKLCLICGLIVPIQAIHEDEQGLRDWILRFVGQVEG
FT                   AALHPKLKLNNVYIRSAQGAVAALSLDSGELLWRKVFSEPRVCIGVTGGSVFVSSRSGA
FT                   VHVLNAGTGAVETTFKLLLPAGADVESCKSITNSKARFAAFDGKNAHIFELDMNSDDEE
FT                   VKTLGQFPIGEDVKGLRLSDAHLWVVRRLSADRYSLKGAVEITGVDAVGGIDVTSSAEA
FT                   VAYSSHKVTLVRHGPQRETNGAVEQEVIDCSGCAASVMTNPAGVFQGYVIGQADPNGFM
FT                   VKFPAKSIHVPLKGGTKGAPAILLAVQGDGDGAWALVRAPNDHLVVVRENGGVKWERWE
FT                   GLSRLAAVVVLDSSSKEDRFGLSKEALGISTRGVVYMIPLAEMGSNMKVLVDVSKTVLE
FT                   MTTAASVENIAFEKLEVSGADTATLFASFGVVKIRVILNVVTGAVVEATKHEDSLIVAP
FT                   TFDVKRSLAVNGKIPHSKLHVFSLNMTTGTIKGYLASSSPSVTPLWTVQLPFPIIAVAT
FT                   GEDALRTSLVNNIRVFPNKSSGMEEVRRKFPTRNVLAVAYYEPVDDEMPTLVVTAVDVV
FT                   TGSVLASMRHRNVEGPVHILIVEHAVLYHFMDVEKMRHSLGVWEMFETEVGPVLFKDTG
FT                   ATPPQVISSFFSRHKRVFSSRATWPPVVVGSVLGMHGGGVAKMSVTTSFGAIARKSLLF
FT                   VFTSGRVASVGLNRLLAGGQVSLGDGAGQLTHVIIPSTAIVTHRYRAARPTLIATRPTN
FT                   LESSCHVLVSGMDLFYVRTSSGKEFDLLNSDFNKTLLIALTCSFGVLSLVARYFAMRKG
FT                   VRQLWR"
FT                   /protein_id="XP_844209.1"
FT   gene            complement(<172087..>173040)
FT                   /note="synonym: Tb04.5E12.1160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656583"
FT                   /locus_tag="Tb927.4.600"
FT   mRNA            complement(<172087..>173040)
FT                   /db_xref="GI:72387571"
FT                   /db_xref="GeneID:3656583"
FT                   /locus_tag="Tb927.4.600"
FT                   /transcript_id="XM_839117.1"
FT   CDS_pept        complement(172087..173040)
FT                   /locus_tag="Tb927.4.600"
FT                   /gene_family="HOG000260502" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387572"
FT                   /db_xref="GeneID:3656583"
FT                   /translation="MNVINRMLSRGHVAASASLPIKERPFPVNYGLSTFKWHLDSRKPS
FT                   KAILLHDLFGSSAYWQMLLHESLGRLPCSGLTPLVPLELFAVDFRGHNHSKSLPCPEEG
FT                   RAFTMACAADIMLLQQQVLRADAKLVGIGFGALVACQAALHSPESGIDSLVLIVNGPSD
FT                   LLACEPARYSLPSFISDIPKEISSVADLEHHLHKRVPNEAERALILSTVEQREGTVGFK
FT                   FNETLFQFRGPLCGFSDVGPENIFTKPVTVIQCGSEEFSGEAKSDFMKHFPKAKFVLFE
FT                   GDRSGGISGLSAQGPAVTRTLLEAMELLGETTGGEE"
FT                   /protein_id="XP_844210.1"
FT   gene            complement(<174021..>175436)
FT                   /note="synonym: Tb04.5E12.1140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656584"
FT                   /locus_tag="Tb927.4.610"
FT   mRNA            complement(<174021..>175436)
FT                   /db_xref="GI:72387573"
FT                   /db_xref="GeneID:3656584"
FT                   /locus_tag="Tb927.4.610"
FT                   /transcript_id="XM_839118.1"
FT   CDS_pept        complement(174021..175436)
FT                   /locus_tag="Tb927.4.610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387574"
FT                   /db_xref="GeneID:3656584"
FT                   /translation="MSENPAQPPLEFYVANAERVFAENDKVLFFSHWTYKMMTRSFLES
FT                   YQNPPLIFPNSTQSNFIKGDGYIDYCTWHRYSDFEWFATQMLTEFPGIIFPPIPEKEVN
FT                   GTIDKLTAHFDGVSGLDAKKNSLVRQRLRRLQLTLNAISHIGAIHECELMKAFTTLDED
FT                   GWRKFRDSWEAARKNSLLSIVKMKCLGLLGKLSSFAMVREQEGPVSSRLSSILVQHGEM
FT                   VRLLQMCGAVVEKMTRRFVGEPSKRRSTRNICKRTAGAPLPAAACHEGCFVRYEANGGR
FT                   EGVVKSIDRNTAVIEWNDREGGMSRVPVADLRYPSSGVSDPVMLALHAITEQIDSHLMY
FT                   LSKKEEAEGLREVGDLLWFASHLSISCINAATQLKKMESNALAQPAPGRDDTEGEAHRE
FT                   SLKQRVADGYTRFTEQYEKFCIPHQAQVLAAVAHKLGRIGTFLFIDEGWSARILQISSA
FT                   LTVPTFPPEEGSQ"
FT                   /protein_id="XP_844211.1"
FT   misc_feature    175792..175817
FT                   /note="AT_rich"
FT   misc_feature    complement(175792..175817)
FT                   /note="AT_rich"
FT   gene            complement(<175884..>183395)
FT                   /note="synonym: Tb04.5E12.1130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656591"
FT                   /locus_tag="Tb927.4.620"
FT   mRNA            complement(<175884..>183395)
FT                   /db_xref="GI:72387575"
FT                   /db_xref="GeneID:3656591"
FT                   /locus_tag="Tb927.4.620"
FT                   /transcript_id="XM_839119.1"
FT   CDS_pept        complement(175884..183395)
FT                   /locus_tag="Tb927.4.620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387576"
FT                   /db_xref="GeneID:3656591"
FT                   /translation="MAYVSNAVKQQLRASRSSYTAEAVHAAYKMLQEFEESSEGDPSLE
FT                   RNVSSELYILCTEAAIEKKEWALAGACLKKYTGRRAQTKALEARALYCDALVALSGVPH
FT                   SLRGRAKLAAHIRCATKIVSGIKIVLEEWPKEPETLIAGIDYLWLSIQDVCGRIISNSM
FT                   LDILVLVVTLHEKLSLGGIHTQLQWIVRYAVCLRATGRVQDALNQIVSGAELVAKTGSE
FT                   RLQLQFYRIQVAFTASTSSNRTKQDNTRPVFQALAAVYSFFCGATDDSSAKQELIQATE
FT                   KLLGDPEKKEVKQKGRKAAEAEAAFRDPAIISDVLSEVALALAMCGADDTCNTILPKLL
FT                   NGDNARARLFTEYAKAIMRARDCGSLAASKALDAGYLTKNMAEKLFACIGHVEDVIDAA
FT                   RTSVDVSESMYAIEVGCVVLWNLCLPLLQPQTRGRLRLTLSRIVMLLRLCNSRLNRLFV
FT                   RAAYESALAEFEEENMNATIEQIDKALAVEQLSGSADNTSAYPMEFALLWLRRRAVVRK
FT                   AHEGTSFISDGDHIVHLIEQARLASANRVPLLQAAADRLPPITRTESVAETRTKNVSVN
FT                   GEKNKGGKSRKQDVVRETVDERVPFTFEDFSTPNVYYLLLKEASTTNDPAVDEIIIKAA
FT                   EGLARIAVPDNGFARDLLAMKAEAHLVMSELLEKRGQTSPRALGDATHEDGMSHISKAA
FT                   QLGARLSAAGYGGGWIVLNACTALINQNTEMFKKGLFLPAAATLRDLSLALGQVNADPM
FT                   GEYKLFDSIGFGYVMSLVQTYISAKGEVNGELHCESLAETMRKTYLYPICEAHNSVLKQ
FT                   AAEACHQIMSKWSLPSRRKNFSLILPCINRLLDRTHETSTHPQEQLLFLLGRLNGPIEL
FT                   DERRHLVNTECLDMLRADPSVELCARLASHSVQIPQNERVTLEICRTADRLYHEGKLGW
FT                   GTKSLITVNSGRDKSLASTVVSTQQPSPSVMYLGNLKGSVVANSNGGMQPKPSDMDWYW
FT                   YADILLHEATLFLHLGVGADRTHRLEFEKRVLVAITNSAVAASRSIPEAQITQITKAYR
FT                   ALCRVATSISRASYRVLQSGLRILLSPPILRIVNKFLRSRTNGRCDAEFDDLCTLTSTL
FT                   GGYLFTSLLEDENYDEGIKQMHELLRVLPSRYHGSLCAYEAQLRTKLRLSTSELHEKAR
FT                   TVDAEVEAAVCVAVAKNAHDISEGMRAWNQALKILEGKPVQRADLVLSMAEWLAGRNAV
FT                   TKSELISLLMNGLSDLERVDSMLLSAWLNKSAGRRNTDVSPALRHALTGTMVGRTFAIA
FT                   QSLTCTNVVPVDKQKDLPSLLETLTALRLLYFLFVVAPITPCASRPFVYKRCCASTLLY
FT                   YVLSCWKVVAVLLQIHRGEDIRGVKVDPLHLPETLYEWRGFHANPQHAIIIRDLCKDGL
FT                   ALNTHRLWGMLLDVCDYLLEDGMELYVFLILSWVEFCIYWRYDESDPRGRAAVRAVRLK
FT                   GFISAARCGWAEVCDAYNVEPPDAECWSSVNEVLLSTETPALSVPWPSSGPLDFSNFVG
FT                   STHRFILSEAEDLFTLGRVQEALLWKAKVKQCASRTGDRGALARCHLLEARASILRGRW
FT                   DPPTSEEASAEDSTEEETKTEDMGDGEGTGLPTSLTVAAWTELQLVHIDGFLSCDKVAE
FT                   AVAFVRQLLTRLLWRLEEVGEGDIEKDTTEMCHKVLLQRCAPRFVAFLRRPFDTLFPGG
FT                   PREGDVKGLLDEVCSQLDQYADWKSRLVSLRVRQILRPCVDDVLATGKGGVDKALPERL
FT                   FNEYSEILKVADMLQSEVNAVVPVLALGGDVTTCPSAAAAYDEVLVMCARNCLERKLLK
FT                   NFISQRFSALSVADLGIPTGGPVELEGYVASYMRDPALYEQSRMLNDSANAALPSQEGI
FT                   CGHDNEVASSLSHFGIPLNYMVNTSTPHIEALLYRAMGGVGTVSSVQMEASIIAALSEF
FT                   SRRLTAATRAMESPEASVNTTFSGDVNERENAFLTAQWSKITISVPHPSVPRRMSVAER
FT                   RAAKLASIHVEDPNRLAANAWIEINSNLQMLLLAAVRQARHMFEYKQMAKCYIYLAHNF
FT                   MLSGNFNAAGTAIEYAETAAMYGFVSDLVTSLTHTTPEAELIRLVNKTKMDAPYLVNTK
FT                   AFDSLRNNLMEISSMWRRFDLVGAWPAEPNKADPLLSDICTLSAVREGTTSYFLVAFRR
FT                   QDGEVCSRRAELDMGALRECTSQIEELKRLKKVEVAAGPSAGERSPDAKWGSVFHSYLE
FT                   KVRTVVFPLLGDFSDLFSSQRAASCSLYLCLDPILQPLPFEQLPELSSFMAVHRELSVL
FT                   NLRQKTALRTGKPQSNGVAYIIDPFGENEEALQYIFGGGRTKTSNAEIVTFVKDGQGSS
FT                   SRPSLAYVHRIFANKAYANVLVSACGSFSDIIKPSVIAELSLDHLQTVLIAMATNDASY
FT                   CREQGCDTCRAYMDFFYEKNYVVSILLLARGVHHVLSNIFTLTASECNVFSKRCLSFVG
FT                   GGGGKALAEAVKGSNGDAAGPSTQLHISYGVIHHNVKAK"
FT                   /protein_id="XP_844212.1"
FT   repeat_region   183593..183621
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(183593..183621)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(183597..183621)
FT                   /rpt_family="tandem"
FT   gene            complement(<183833..>184738)
FT                   /note="synonym: Tb04.5E12.1110; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656585"
FT                   /locus_tag="Tb927.4.630"
FT   mRNA            complement(<183833..>184738)
FT                   /db_xref="GI:72387577"
FT                   /db_xref="GeneID:3656585"
FT                   /locus_tag="Tb927.4.630"
FT                   /transcript_id="XM_839120.1"
FT   CDS_pept        complement(183833..184738)
FT                   /locus_tag="Tb927.4.630"
FT                   /gene_family="HOG000260500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387578"
FT                   /db_xref="GeneID:3656585"
FT                   /translation="MQFIYSLFTPSERLLSREMVRNEIARTKLSAARLQHEAEKEFMEK
FT                   EMQKIDNEMRAKEESYAAQAKPLLDDFNDISLAQHYYQEVGTTLASQVHLVSQRVEREL
FT                   EEFGYTSKKLISVGLNYEALKHKMKAGLPFNEELSAVLKDAESEDVNLVAAPLKYINSI
FT                   PSPAVVRVTAFNLGRAIVEAGKAPAAEPVRGILDFFKFRTSLSPTMLVSRQLRALKSEA
FT                   EFLRFVERGEYHRALSLAEDVYAGLKREGVKDAAVLDEAFGAFRRTVLPTVAGDMLLRY
FT                   CAASLCAARFACVENMLKEQ"
FT                   /protein_id="XP_844213.1"
FT   gene            complement(<185080..>186468)
FT                   /note="synonym: Tb04.5E12.1100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656590"
FT                   /locus_tag="Tb927.4.640"
FT   mRNA            complement(<185080..>186468)
FT                   /db_xref="GI:72387579"
FT                   /db_xref="GeneID:3656590"
FT                   /locus_tag="Tb927.4.640"
FT                   /transcript_id="XM_839121.1"
FT   CDS_pept        complement(185080..186468)
FT                   /locus_tag="Tb927.4.640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387580"
FT                   /db_xref="GeneID:3656590"
FT                   /translation="MDAVVNSEVQQLREELEKAKHRMQVWKEKTQVGVTELRNRIIELT
FT                   TELEESRAANDQLSQQLQNAKSVATAAASTSGAVPECSSFAESHYFSHVGAWVTASSDA
FT                   LVEILLDKSDAALDIAVGTWRELEKHKRRTAQTLRMQKKTTEALEQELAGLRETLTGAQ
FT                   AELVERKSAIERRDQALETLQNRLETLEEAKASFEASQAAMASRPNAEQINAFEERLEE
FT                   ERENMRHEFTVRESIIFDQHRDEMERLMSRYEQDMAELRAELEERALETAETGNKHLGE
FT                   GAQARGQSEQRDDAAYGELLDHLKSLQEELRGAQEENQKLTQELAAVKRTHSGVGGPVL
FT                   GSCSVKDFNGQNKPSTLPEALSRIAELEGDVSRLSDELCATRRRLVATRHQSNTTKDQE
FT                   NSLVFDGQLATYLRFTVVQLLCSSGDTNVAKNLFPVLTTLLRFDKSNLSEIYKKNPGWV
FT                   KRRF"
FT                   /protein_id="XP_844214.1"
FT   gene            complement(<186963..>187700)
FT                   /note="synonym: Tb04.5E12.1090; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3656593"
FT                   /locus_tag="Tb927.4.650"
FT   mRNA            complement(<186963..>187700)
FT                   /db_xref="GI:72387581"
FT                   /db_xref="GeneID:3656593"
FT                   /locus_tag="Tb927.4.650"
FT                   /transcript_id="XM_839122.1"
FT   CDS_pept        complement(186963..187700)
FT                   /locus_tag="Tb927.4.650"
FT                   /gene_family="HOG000260498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72387582"
FT                   /db_xref="GeneID:3656593"
FT                   /translation="MRRSAVRLVYEKFEGTIAGDKGYMTYQQACSIFGFEMSDRLEVTE
FT                   IKKRFNKLVMRFHPDHGGTSEQFQLLREAHKLLLAHRHDKGESNRAGGTDVNFRRMNYD
FT                   NMTNTIHRETAGNPEYRSFSLQDFAFFLALVIFVVSFYAYRAFHTQLQILRSRWSYTES
FT                   MLHDEGGHKDVRGWHPWRTDRMTRDVMDEIGHLQQSISREMLEEKRSLSPLVHMPWQSG
FT                   GPFANYTVARQPIGAVLEDADGQ"
FT                   /protein_id="XP_844215.1"
FT   gene            complement(<187983..>190046)
FT                   /note="synonym: Tb04.5E12.1080; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656589"
FT                   /locus_tag="Tb927.4.660"
FT   mRNA            complement(<187983..>190046)
FT                   /db_xref="GI:72387583"
FT                   /db_xref="GeneID:3656589"
FT                   /locus_tag="Tb927.4.660"
FT                   /transcript_id="XM_839123.1"
FT   CDS_pept        complement(187983..190046)
FT                   /locus_tag="Tb927.4.660"
FT                   /gene_family="HOG000260497" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387584"
FT                   /db_xref="GeneID:3656589"
FT                   /translation="MPPKTVKVIGRGGKDDRKDDKPKKLKPAQIAINKAVETADKLYKL
FT                   HERERLKMEQTDRVALQKFSLDKAAEKERLRLDQDVYTAFEDELVEQEQLAYKECEKHR
FT                   LWSLIPEASRLPPIRSQSAINTFLSVWRDSEEHYSHYSPPVEVNIKRDNSNSSLRVHRF
FT                   HQGELGIPPAARRKMLNEELNRCVMAYDLVETIRLEADRCLTLGKTEDLKFFGENIGNV
FT                   YEQVMFAFDFVTIHTLLNYDVILDGPDSEFLTVAVPSANPVAKFGLWVKVKETTRSFAS
FT                   LVFPVVSMRLDPKSSALPKLPKALGLSKENVALRVIQLRFDPYGCRGSGGREYYALPCV
FT                   IKIDLLSFTERPKQSGDWLYRSETEEAHKLHVVPYPPPVLEATDENPALRVSFEVPSTI
FT                   VMRQPTLLIGKWVEKTKEWEPCSHTSSSPDSTGPERMCSFATGEFGTFTILQGKGFDVP
FT                   YEQWRLQPVSFDQVMMVLEGRHRGEGSDREFRILICDAKCKLISPGDPELAALRADWLE
FT                   PATLVRLLSQAGFNFMLRDEDAEFIEDIVPKSSELEEKVYADIAQFCLFYIIASSRHNK
FT                   CGEDADLALFRMSKQVYLGTEDSPDLTAEADGEWHSIRYQTHCCAFSAFRERDDVPDLR
FT                   ILEDHETHLNLYTLLLKEKGEEVRLMALHRTNFLLRRCVYQLLRLIRPLTWG"
FT                   /protein_id="XP_844216.1"
FT   gene            complement(<191591..>193549)
FT                   /note="synonym: Tb04.5E12.1070; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656592"
FT                   /locus_tag="Tb927.4.670"
FT   mRNA            complement(<191591..>193549)
FT                   /db_xref="GI:72387585"
FT                   /db_xref="GeneID:3656592"
FT                   /locus_tag="Tb927.4.670"
FT                   /transcript_id="XM_839124.1"
FT   CDS_pept        complement(191591..193549)
FT                   /locus_tag="Tb927.4.670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387586"
FT                   /db_xref="GeneID:3656592"
FT                   /translation="MDFVEVLPDAQDPLLQRLQMKHAELRVKQVMELKKTLEIEHSAMS
FT                   KKIHKLPTTLDLVSDEISFTLNEIAVRCEEYAVPHVGQLLKDVHTMMNQQLREAYRHVE
FT                   AGYRSAFHKMEEANEVQYRQQKSASSLGVSPQKPDKSPPHQAPANVECPPMAKGKNGKR
FT                   GTGMKGTSEVRVLSVTEAMSATTGLFAESIAVSLRCEVVRIYLYDEYGNLNCCARFPFS
FT                   ATKGDPLAGTNLELILAKEVHRTVCQSCIAVNGRKRQEITMIERDRKEADEEIEQSGWK
FT                   AMNSCLIFPVISNERGKQTHGMIHAMNKQGTSVNLVGEFDETDENFLFTAACLLGCLLS
FT                   RYPGKCFMRPVGNLIHQHLGLHPVHGNDTSFLPQLIEDEVEDAAIAGNKALQMRPRVLV
FT                   HRAPINVIYQARAERRKTRKLEVLHMVDRALSSVEFDLNALEELWRVGHEENRIMYEHC
FT                   QHTNEQLNTLQVLLQNVLDGIGASRNMGTLEEVRRYLRALELHARQENTLQIKELISKA
FT                   LLHSDIEEIPPQLKEEVKSGRLTLEEAIQMERRLEAVESKLKFGASPVPQVRIYSYNPQ
FT                   LRREQARFFNANAEKRERLFNYANMAGDGPGYKGKTVSAVTKEVNLNPSLRLCFGTTDY
FT                   ASRRPFRLQGGRSVSPR"
FT                   /protein_id="XP_844217.1"
FT   gene            complement(<193834..>194913)
FT                   /note="synonym: Tb04.5E12.1060; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656594"
FT                   /locus_tag="Tb927.4.680"
FT   mRNA            complement(<193834..>194913)
FT                   /db_xref="GI:72387587"
FT                   /db_xref="GeneID:3656594"
FT                   /locus_tag="Tb927.4.680"
FT                   /transcript_id="XM_839125.1"
FT   CDS_pept        complement(193834..194913)
FT                   /locus_tag="Tb927.4.680"
FT                   /gene_family="HOG000260494" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387588"
FT                   /db_xref="GeneID:3656594"
FT                   /translation="MGLRVCSASGNVEVPHGAVDHARLLCKVVEGDNPESIKRKRIRGV
FT                   VRKIEGEYTNWLGECGRGDCFLMLTSLAKSARYLGRKVQQGTAGFKQDDEWSGVSPFFS
FT                   PGVNDWLCALLQRSASFVTGPEECMVLLTVAVDLELGDTQTLRQLCGWVTGKQYTLRAS
FT                   LEELVCVLRLISLLVKRCRMPIPSLDNMLFRLLGATLDSRQSLTVLSSMVRLRERSSVD
FT                   VVRCISRRATVTVNSYTVRDVIYALEAISLLNCCHEAYAGAVLDRCTVLCVELKPTELG
FT                   SVCKYVALLNVSRANNSIALACARELRRLLPALLSRTEALLGRFSLRDARCVLRCLEQH
FT                   NVRHSVVFSRLTPLVSDLK"
FT                   /protein_id="XP_844218.1"
FT   misc_feature    195345..195368
FT                   /note="AT_rich"
FT   misc_feature    complement(195345..195368)
FT                   /note="AT_rich"
FT   gene            complement(<195568..>196566)
FT                   /note="synonym: Tb04.5E12.1040; geranylgeranyl transferase
FT                   type II beta subunit, putative"
FT                   /db_xref="GeneID:3656595"
FT                   /locus_tag="Tb927.4.690"
FT   mRNA            complement(<195568..>196566)
FT                   /db_xref="GI:72387589"
FT                   /db_xref="GeneID:3656595"
FT                   /locus_tag="Tb927.4.690"
FT                   /transcript_id="XM_839126.1"
FT   CDS_pept        complement(195568..196566)
FT                   /locus_tag="Tb927.4.690"
FT                   /gene_family="HOG000180334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="geranylgeranyl transferase type II beta subunit,
FT                   putative"
FT                   /EC_number="2.5.1.-"
FT                   /note="similar to Geranylgeranyl transferase type II beta
FT                   subunit (EC 2.5.1.60) (Rabgeranylgeranyltransferase beta
FT                   subunit) (Rab geranyl-geranyltransferase beta subunit) (Rab
FT                   GG transferase beta) (Rab GGTasebeta). (Swiss-Prot:P53611)
FT                   [Homo sapiens]; go_component: CAAX-protein
FT                   geranylgeranyltransferase complex [goid 0005953];
FT                   go_function: catalytic activity [goid 0003824]; go_process:
FT                   protein modification [goid 0006464]"
FT                   /db_xref="GI:72387590"
FT                   /db_xref="GeneID:3656595"
FT                   /translation="MFGAPNTLLADLHLRFLTKLDDHKDKMKYWTSQHLKMNGVFWCLG
FT                   AMKLLGHDDILKREELVDFVVKCWNSDGGFGGNIGQDSHMLYTLSAVQLLCLLHATDAI
FT                   DAEKCARWVASMQLPDGSFQGDEWGEVDTRFVYVAMNCLQLLGKLELINVKAAVEWMLR
FT                   CQNWDGGFGLAPGAESHAGQIFCCVGSLRIAGALDRIDKEQLAGWLAMRQLPSGGLNGR
FT                   PEKKADVCYSWWVVSSLSMLGYTEWIDRHALFRFVLACQDSEDGGIADKPGNQADVYHT
FT                   FYGLCGLSLLGYEDYPLRDINPVYAMPYDVLESLGVPESAGLHVGRKRTCA"
FT                   /protein_id="XP_844219.1"
FT   gene            complement(<196848..>197600)
FT                   /note="synonym: Tb04.5E12.1030; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656586"
FT                   /locus_tag="Tb927.4.700"
FT   mRNA            complement(<196848..>197600)
FT                   /db_xref="GI:72387591"
FT                   /db_xref="GeneID:3656586"
FT                   /locus_tag="Tb927.4.700"
FT                   /transcript_id="XM_839127.1"
FT   CDS_pept        complement(196848..197600)
FT                   /locus_tag="Tb927.4.700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387592"
FT                   /db_xref="GeneID:3656586"
FT                   /translation="MMRRQTYVWSIFTGASAAYRWFPPRRECFRFAGAEANSAGGGAGA
FT                   SSGVHQTVAVNAAPEGFWRCLFSSWQQGLVASIGAVTGIGAVGFFLYVSMKDDTVHHTA
FT                   AVASEALGDARLRERATNLSKEVVESVLKDQKSVELVVGLVVRVLQEDDSMIAVSSFLR
FT                   SLFEDHYTQEVTKKFVLMTLLDPWIQEQVRLIAKDLVKGLLRDPEVKKALVEFLSDSAA
FT                   TSLHDERLHYNMAHAVRSVAKRAVSPFT"
FT                   /protein_id="XP_844220.1"
FT   repeat_region   197646..197690
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(197646..197690)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   197953..197994
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(197953..197994)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    198593..198660
FT                   /note="CT-rich"
FT   misc_feature    complement(198593..198660)
FT                   /note="GA-rich"
FT   misc_feature    198865..198895
FT                   /note="AT_rich"
FT   misc_feature    complement(198865..198895)
FT                   /note="AT_rich"
FT   repeat_region   199133..199159
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(199133..199159)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    199398..199420
FT                   /note="AT_rich"
FT   misc_feature    complement(199398..199420)
FT                   /note="AT_rich"
FT   misc_feature    199676..199744
FT                   /note="T-rich"
FT   misc_feature    complement(199676..199744)
FT                   /note="A-rich"
FT   misc_feature    199917..199945
FT                   /note="AT_rich"
FT   misc_feature    complement(199917..199945)
FT                   /note="AT_rich"
FT   repeat_region   200519..200561
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(200519..200561)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<200857..>201681)
FT                   /note="synonym: Tb04.5E12.980; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656587"
FT                   /locus_tag="Tb927.4.710"
FT   mRNA            complement(<200857..>201681)
FT                   /db_xref="GI:72387593"
FT                   /db_xref="GeneID:3656587"
FT                   /locus_tag="Tb927.4.710"
FT                   /transcript_id="XM_839128.1"
FT   CDS_pept        complement(200857..201681)
FT                   /locus_tag="Tb927.4.710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387594"
FT                   /db_xref="GeneID:3656587"
FT                   /translation="MTIFYEYPRALGEGTELFDFNRVPVTPLQRPLFSEVLPSALNLNN
FT                   VSTTNRDHERENGRRLLPSPPRRVLLLGNVKDMSMQLITSILAKGCDVRVLQSSYSDEA
FT                   LLLRLRKECEEYPGHLLLFHSDELSHAVLDCDAVVDVKGSETPTGRLSLLRSAQSLFEA
FT                   IRASQRAAPRVILMAPVPPEYIRRAETWLFLTRIESTREAGTEEEAELLRANDMPYAIT
FT                   HYINTTEVPTGRGGTSSPSLSSNSILNMRSVAKECVERLFSCGGSGGFPPFG"
FT                   /protein_id="XP_844221.1"
FT   gene            complement(<203012..>203329)
FT                   /note="synonym: Tb04.5E12.970; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656588"
FT                   /locus_tag="Tb927.4.720"
FT   mRNA            complement(<203012..>203329)
FT                   /db_xref="GI:72387595"
FT                   /db_xref="GeneID:3656588"
FT                   /locus_tag="Tb927.4.720"
FT                   /transcript_id="XM_839129.1"
FT   CDS_pept        complement(203012..203329)
FT                   /locus_tag="Tb927.4.720"
FT                   /gene_family="HOG000260492" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387596"
FT                   /db_xref="GeneID:3656588"
FT                   /translation="MLRRLVPRVMMAPMGGATALCTSRGYNMLVFRDPKRRPQLSDEER
FT                   AKVVVNQAEWPEEFKDFDPDDPYKNSPEIIKGMSSWNLFLWGVECAFIYQFYELVFPKS
FT                   I"
FT                   /protein_id="XP_844222.1"
FT   repeat_region   203468..203497
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(203468..203497)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<203661..>205139)
FT                   /note="synonym: Tb04.5E12.960; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656596"
FT                   /locus_tag="Tb927.4.730"
FT   mRNA            complement(<203661..>205139)
FT                   /db_xref="GI:72387597"
FT                   /db_xref="GeneID:3656596"
FT                   /locus_tag="Tb927.4.730"
FT                   /transcript_id="XM_839130.1"
FT   CDS_pept        complement(203661..205139)
FT                   /locus_tag="Tb927.4.730"
FT                   /gene_family="HOG000260491" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387598"
FT                   /db_xref="GeneID:3656596"
FT                   /translation="MATVANEFATLDEGVLPILVVRKNGKTIAVVRDNSLQGTFLPFYL
FT                   PTCETLHVSRTEELQEARESGVLNVAAVEWPVVAKLRMALGILKEERYWLLFSRGGVSN
FT                   EGLTSHMFKGDEEGVHDAVSWLSGFQLSGPCDILLASEPSVTNGPANGDVGRLRLKKED
FT                   EDVNERVVFGESATDVARYIGDLLRAHLFQNVTAPTAVFWPPQLVHPVNIHYGMANRRV
FT                   LEHDALLLPILSLFRVEKRLKNWDAVKGLQVSAGCDMPRTGQAWEKHLVRNIHKSLKEY
FT                   IPVSGGEVYITSGSYDYYHYLIDGFKDSGWGCAYRSLQTILSWFQYEGLMQGAIPSIHT
FT                   IQEILSVKDTDKMNRKGFVGSKDWIGSFEIMIVLQHYIPGLDCTIRRMESGAELETNPE
FT                   IQALLAEHFRGKRSCPVMIGGSSYAHTILGVDMNLATTEARYLIADPHYASNETSTKTV
FT                   VSKGYVGWKEARNFFEANSWYNLCIPQVATFDPR"
FT                   /protein_id="XP_844223.1"
FT   gene            complement(<205463..>206758)
FT                   /note="synonym: Tb04.5E12.950; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656600"
FT                   /locus_tag="Tb927.4.740"
FT   mRNA            complement(<205463..>206758)
FT                   /db_xref="GI:72387599"
FT                   /db_xref="GeneID:3656600"
FT                   /locus_tag="Tb927.4.740"
FT                   /transcript_id="XM_839131.1"
FT   CDS_pept        complement(205463..206758)
FT                   /locus_tag="Tb927.4.740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387600"
FT                   /db_xref="GeneID:3656600"
FT                   /translation="MLLLRATLHRKWYAPGDNIKAEVEFQCLANEPNSALKSRFRDVGN
FT                   SFGAPVIDNSSISITASITGRVVCTCVVDSRLLQYALAWDKGNVAQHCPELVDESTSSD
FT                   CRVYKLCCSDDFALAQDIPLRLGETKAVSVTFAVPDSLPPSYKGRCLRFCHTLLLKVSY
FT                   HGEGEPTSSSNVRIPISVFSPQSVLSPLLLPLCFPMDNFNFRVRICVPDPPQPFGVDEH
FT                   ELNDVVGSGLSCRRPNFIASHLAKQRTPLEFPLSFAGDVVLTVVVSSTTVMIGSSLRAA
FT                   FLPRDGCTSRVVMVQGVLEMLECTFPEHLQRGVTCHELPGEESRLVVTQTSVVEEFEWN
FT                   LIGRSSVPISIPFSNINYYASMQTDAVTTCWQLRLRFLWCSASRLKEFSSGFRSQLPVE
FT                   EEQPELVVPLTVVPPPNPGHIPRKGITLEVIF"
FT                   /protein_id="XP_844224.1"
FT   gene            complement(<207428..>207865)
FT                   /note="synonym: Tb04.5E12.940; 50S ribosomal protein L7Ae,
FT                   putative"
FT                   /db_xref="GeneID:3656601"
FT                   /locus_tag="Tb927.4.750"
FT   mRNA            complement(<207428..>207865)
FT                   /db_xref="GI:72387601"
FT                   /db_xref="GeneID:3656601"
FT                   /locus_tag="Tb927.4.750"
FT                   /transcript_id="XM_839132.1"
FT   CDS_pept        complement(207428..207865)
FT                   /locus_tag="Tb927.4.750"
FT                   /gene_family="HOG000055227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L7Ae, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387602"
FT                   /db_xref="GeneID:3656601"
FT                   /translation="MAENEQQEVVAYDYDRELYRCPISWPITSEKAKMTKKLYVLIKKT
FT                   VVNNKKDVIKGIKDVTKALRKGQKGILVLGADASPYDVISHLPLLAEESDVPYVWVPSR
FT                   QDLGTATQCKRATSVVLLKPTAELRPNYDKMILAIEDLNTA"
FT                   /protein_id="XP_844225.1"
FT   gene            complement(<208684..>211089)
FT                   /note="synonym: Tb04.5E12.910; gamma-adaptin 1, putative"
FT                   /db_xref="GeneID:3656598"
FT                   /locus_tag="Tb927.4.760"
FT   mRNA            complement(<208684..>211089)
FT                   /db_xref="GI:72387603"
FT                   /db_xref="GeneID:3656598"
FT                   /locus_tag="Tb927.4.760"
FT                   /transcript_id="XM_839133.1"
FT   CDS_pept        complement(208684..211089)
FT                   /locus_tag="Tb927.4.760"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gamma-adaptin 1, putative"
FT                   /note="similar to Adapter-related protein complex 1 gamma 1
FT                   subunit (Gamma-adaptin)(Adaptor protein complex AP-1
FT                   gamma-1 subunit) (Golgi adaptor HA1/AP1adaptin gamma-1
FT                   subunit) (Clathrin assembly protein complex 1 gamma-1large
FT                   chain). (Swiss-Prot:P22892) [Mus musculus;]; go_component:
FT                   Golgi apparatus [goid 0005794]; go_component: Golgi trans
FT                   face [goid 0005802]; go_component: clathrin coat of
FT                   trans-Golgi network vesicle [goid 0030130]; go_component:
FT                   clathrin-coated vesicle [goid 0030136]; go_process: protein
FT                   complex assembly [goid 0006461]; go_process: intracellular
FT                   protein transport [goid 0006886]; go_process: endocytosis
FT                   [goid 0006897]; go_process: vesicle-mediated transport
FT                   [goid 0016192]"
FT                   /db_xref="GI:72387604"
FT                   /db_xref="GeneID:3656598"
FT                   /translation="MNSQKLRELISAVRQCKTSSEERALISKESAIIRESFRGSKPHVR
FT                   TRNMLKLLYISMLGYPTEFGQVEVVSLIAQSDYAGKRVGYLTIQMVLGENDEVLTLSEN
FT                   HIKKDLGSGQPLLQSMALNVVANIASEPMSRDMFDDILRLFACPDSYIAKKACLAAVRI
FT                   IKKVPDYAEVFLQECTNVFHENNQAVLLCKLTLVNACLLQSDVEEHLKKYRLATNGAVR
FT                   LLKQLVLSSRVTAQDIGGVADPFLQVKLLQFMKIVGKGSPVVSETINDVLAQVLTNTDG
FT                   STKAGSAVQYECVKTIYAVESDEALRSLGVSTIGRFLASNDNNLRFVALQSLLDYAARD
FT                   AEAVRGHQDIILDCLKDADVSIRRRALELTVALIDETNVRLLVPDLLTYLTVCSDEMRE
FT                   EVVRHLCQLIETKAPNAEWRVELSLRLLRLGRQHVSVGFATRLIGLLTNETVELQTTAT
FT                   NALWEGEGSPFDAIHHLRKAFLVAAVWCIGEYADLLVSKKGVSEEKIATRIADIINNTE
FT                   YKLIKSYGLTALVKVASRYPSTKNTAVAVFANHTTSFDCELQQRACEYTTILESFPQEA
FT                   AFSFERMPPITVTVKDEGRIQAQPLQVVNLPPEFLQKKDTVSLDDLFGGGTAPAGGAPK
FT                   GAVVNTSDIDDLFGSKPAPAPQAVSGLSALDGLMMGSAPAFPAATGFPAATAFPTAEKS
FT                   VFECEDFSVSMGAVVQGTIAISLSILSRLASPMENLSIQVAVPKTSSLEVAPLPMTAVP
FT                   PFGRIVQSLTVDNSRSDKNPRLVMLRVKVLYTVAGASRSQMLQVSQEV"
FT                   /protein_id="XP_844226.1"
FT   repeat_region   complement(209024..209069)
FT                   /rpt_family="tandem"
FT   misc_feature    211101..211143
FT                   /note="T-rich"
FT   misc_feature    complement(211101..211143)
FT                   /note="A-rich"
FT   gene            complement(<212180..>216040)
FT                   /note="synonym: Tb04.5E12.890; ubiquitin-protein ligase,
FT                   putative"
FT                   /db_xref="GeneID:3656599"
FT                   /locus_tag="Tb927.4.770"
FT   mRNA            complement(<212180..>216040)
FT                   /db_xref="GI:72387605"
FT                   /db_xref="GeneID:3656599"
FT                   /locus_tag="Tb927.4.770"
FT                   /transcript_id="XM_839134.1"
FT   CDS_pept        complement(212180..216040)
FT                   /locus_tag="Tb927.4.770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /EC_number="6.3.2.-"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_function: ubiquitin-protein ligase activity [goid
FT                   0004842]; go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72387606"
FT                   /db_xref="GeneID:3656599"
FT                   /translation="MFLSLDVTPSRAPYDLLSDLCTLLIIAGDSTDVPLQPLIRAIDMA
FT                   LTKGSSSGDVMVMAARAIVIILDRLSGSLFSLDTRNGLDTFRKCFSTVVSMVDMQKRES
FT                   LHFEKSSEGELKEEVLQCLSLSSKCCELAVVVPSTEEQIQFCLAAVDGSKRTSCKVLHH
FT                   SIGLMRQKELKSATDCRALEQLVHHHLMALFHLDIDHEWDELLRTVVEGILTYRAWCAP
FT                   RVLSPDRQGGKHRRGSEEGGASSSSTHITSLRNMMVTLLQIGERIAGSGTASSRVQLTL
FT                   ACLASVIETHLLPREACESAMLWLAQLLLRSEVRSASFSNPFNSGSDSVAVNAEQPWID
FT                   STPTLPNLRWVVPSLLWSALVLLAKLCGANFNFQSEYIWAWRGRDDEYHLYIKKVRRRL
FT                   TTMYFSAERSRIVAPGRHVIDLQTMTDNFAHGDTASRVHFQPIPCAISFDGGLAIPTRG
FT                   MMLKKKVCAAVQDALRPLSFGHTQVASLARSIRFYIICSGDPTNTMDVITAFCSLPADQ
FT                   KEPTVGEICATLLKRDKRWASVLQEAGVADTPAAECLARDGGKKNRIESSTSEVKRGAD
FT                   CLREVQRSPGNVLAFLRTTSSSELLAFVQGLEKSPYGEEQMMALCEEMKKDDVLASRMR
FT                   TVAQTYVLRVLHHTASCKPVGEDLAERVRSTSYTVNICSAGDRIKGKGAPRCPNGHALR
FT                   VHFSVNWRCDSCAFANAFGSLACRDCNYDLCSNCVDEKLSRMETNSSAVVGDVIQSWKA
FT                   LKLKRSPSTSSTSSQKRKSGCSGNAGEVMLFTSSGVVPASRPVSLLEGNDVHIAPVGGE
FT                   CRCCIPCPPFVACSAAHNIAEHSSLRVFLHTFLATRPQRWVDTAVELSIVNALESRGED
FT                   IFLSGVSGIPSRVVLILQEVAPYISLAFKRNMAHFLAVGCCRFGLYHLQDVGVNVRGTV
FT                   TGSIASNGLAFKVTVKRNTESITNTLYKVFLEYPTLRNKVEFNFEGEEGTGEGPTQELY
FT                   AELSRRYRSMSELWHHRDDGVCIAFPSMQQVHPKRFFVLGASCGRAFADGYTMDISLLP
FT                   VVWPLIRSQTPSVEVLWHLLEEVEPALANSYKCVLQATDAELEQMGLEDEETGEALTVS
FT                   TAKFYVEKCVERRLTNAVSNLHWFARGLASVVDLDAFWFFTDDEMSAIICGFSAEDSEE
FT                   KLFSEEALRAAVMEAHGYSTGSQEVETFISLVGDEFTREQQQLFIEFLTGCPQLPLNGL
FT                   DGLGRKITVVRKELEGRGEQTLPSCNTCFLYFKLPPYSTRKIMKERLLVAITEGRRNFS
FT                   LS"
FT                   /protein_id="XP_844227.1"
FT   misc_feature    216114..216137
FT                   /note="AT_rich"
FT   misc_feature    complement(216114..216137)
FT                   /note="AT_rich"
FT   misc_feature    216209..216238
FT                   /note="AT_rich"
FT   misc_feature    complement(216209..216238)
FT                   /note="AT_rich"
FT   repeat_region   216445..216465
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(216445..216465)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   216536..216571
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(216536..216571)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(216541..216571)
FT                   /rpt_family="tandem"
FT   gene            complement(<216685..>216942)
FT                   /note="synonym: Tb04.5E12.870; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656602"
FT                   /locus_tag="Tb927.4.780"
FT   mRNA            complement(<216685..>216942)
FT                   /db_xref="GI:72387607"
FT                   /db_xref="GeneID:3656602"
FT                   /locus_tag="Tb927.4.780"
FT                   /transcript_id="XM_839135.1"
FT   CDS_pept        complement(216685..216942)
FT                   /locus_tag="Tb927.4.780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387608"
FT                   /db_xref="GeneID:3656602"
FT                   /translation="MYALDYRNQPLKCFLLGWPSLITAWAGVLWFVLCMWECLNRPIER
FT                   SERSVMDPMWYRALIPPLVPPVIVVAAYFSWLGWKIFTHN"
FT                   /protein_id="XP_844228.1"
FT   repeat_region   216991..217013
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(216991..217013)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttta"
FT                   /rpt_type="tandem"
FT   gene            complement(<218135..>218797)
FT                   /note="synonym: Tb04.5E12.850; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656606"
FT                   /locus_tag="Tb927.4.790"
FT   mRNA            complement(<218135..>218797)
FT                   /db_xref="GI:72387609"
FT                   /db_xref="GeneID:3656606"
FT                   /locus_tag="Tb927.4.790"
FT                   /transcript_id="XM_839136.1"
FT   CDS_pept        complement(218135..218797)
FT                   /locus_tag="Tb927.4.790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387610"
FT                   /db_xref="GeneID:3656606"
FT                   /translation="MANISPNSDGDSFVGADTAKQLSDIQKKLNDLKQRREELEEQRRR
FT                   ILGASDQSSSRPRSLRGPTQNRRRHSQPSQRTLPLRPPRPPISDHSIRIPNEKERQQTA
FT                   QRTPYLEMKESMRRSWSRDSSLVMGSFLMEDNPRARTFTRERRFIPPPECNGIYFLGTE
FT                   MELMIRNKNVAPSQRSGRRDNTPYRWNDIIDGVTPGPGAYTPLFSKVSKPSRRAQLF"
FT                   /protein_id="XP_844229.1"
FT   repeat_region   complement(219003..219034)
FT                   /rpt_family="tandem"
FT   repeat_region   219007..219034
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(219007..219034)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<220373..>228160)
FT                   /note="synonym: Tb04.5E12.820; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656597"
FT                   /locus_tag="Tb927.4.800"
FT   mRNA            complement(<220373..>228160)
FT                   /db_xref="GI:72387611"
FT                   /db_xref="GeneID:3656597"
FT                   /locus_tag="Tb927.4.800"
FT                   /transcript_id="XM_839137.1"
FT   CDS_pept        complement(220373..228160)
FT                   /locus_tag="Tb927.4.800"
FT                   /gene_family="HOG000260485" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387612"
FT                   /db_xref="GeneID:3656597"
FT                   /translation="MSNIESPRSSRPFGDSASALTRQFGLVFSNLQNAPDDRPRRVEEC
FT                   LSALLDILVAHALELSEHCLIDYIFQLLCDTFGVSISKGVKSLRVVFDVHLGDPHELRC
FT                   RCFTLLVRKVCETTNEADCNTILQEMGEVLRENVRSTSDLLGKHFGRAITTMQSSSVTR
FT                   AKAVGCQTVATMVDAGAVVIKRSPALLDLLNTPCSPPCLIHEIMESNDNWHRQALTRLL
FT                   VNIAESHCIEVTASMAEQMASTMTSHLSSATEEKHITGLLTVIDAISASSTLQTVPWSL
FT                   EAVASFVVQRDWRVYTEDVRVRAARATGKILPLLVKDEKLYDLVMKNLLSYISGGDEAV
FT                   ALSALTTFRSVIKSLNNIESHAVLTVDAVSDFIAKSPFNQLAFEILDYLRTQCGEQCVF
FT                   GVYDLLERADVLNSVEKVAALLHFMGNRAPSNVDWLEECNIDLSPDSDVDVLVRSLSFL
FT                   ETLRYTEALESAVGLVFHKHTDVRRAAVGTVVSLCEVLLSPDKGGSCQGSHVDATITQL
FT                   NSRVKIAVESLLDVAVTDRQMEIRYYTLKRLSPVFEPYLVQLDNIDALFMSRNDVCRGV
FT                   RDQAMLLLYRLHSLQPDILHAQLLQLQEYMLREIDVKDGSISSTVYHAFLLQMAAENGT
FT                   ILLSPSTVETSVLRRLEKQPFVSKSLSVALLNLLRAVLDHSGPRNHCDAKQLIQPVLAI
FT                   VNGSTSSTRRKAAIEALCSILATVPITEQSTHVSVYRALSRIIRGEAEESEAVIYSAMK
FT                   CLSVIGAVDPTKARYIVKALQEGEIAEEEEVATPALALYKPRLRIHLHMDERYPCIVLY
FT                   LLVKTLQHSADVEQQASVISVIHSMIHEVPGRQKAMLLTQFLPQLQAWLADPEKVHLYE
FT                   VILLLMSDLATLLQRFKDVIPASTGLELLKSVRLFCLLPQASQKPLNAGVVELLDRVGR
FT                   GLSPEEMRDHRWAVEFIHQRLLQDKRDLALVVRAVKSLDSFLAILHERDFQVLLPHVLG
FT                   CIEPADAATPNVPGLKKKEVNTACFEFLNQIMAKQPLLMKDFCSQIIHTITWYIEESDC
FT                   QDEMEMGLRTLAFLVGIVQRPARRFIKPIQRLVQQCGLPEDMFTNLLKSAADGLLKARA
FT                   PLSGHDNLNPELPLTLVSDQPSLSKEDFQQVMKRVLRLGDHDFEVISVTHSEGNTVVYF
FT                   RFVQGEDLLLNFRSFTSKAQESQSTLSRNLGILKLVQNAMSYCQVDDSLLENISRMPVA
FT                   NKKKREQSWMAWLHNTSVVMLKNSPIQPLRCTAQLAADNTGLSRDLFPFAAAAFIGKLN
FT                   AQQQEVIIKAFTRALEVSPNDIKQAIFDFAEFIESERGKLNPEMILLVEKLTFVVERDN
FT                   EERKFGINYDEVSGDVVVSHLEPGGPGALAGVPVGARLLALNGKRLVTTHEVVGAVKGL
FT                   NRIELTLECPNGGKRGLSFDCLMDIDVLARVALNSKMYARAIFLNEILFAQLLSELSGQ
FT                   VSDRQNAAVRHALEVAERLIEFYNHLGLTMVAKGLVKKMSEKFSSNIIAPEQFGFDEVG
FT                   ALEQLNWWGEALSRYKSRMNVADGTLDTSAFLGALRCYDALGETITMQELIATNWELLD
FT                   RDAQLEVAPLKAKAALWLGRWDEFDEVVGQPGVMERLDMVERCASLFRQKHYGELLDYV
FT                   DEHRKSLFDSFFESFTESYNRSYDTLVELQHVRHFEELVSFVKSGSERRKMLRELWHKR
FT                   VTLMSSRPAHIKTLITINSLVLSPQEDLPSQVVCVRALTKHHWTSLADHTLSTLLHPNG
FT                   LNTRLANLDPDVIHVYMKHCYVTRGKQETYTLLSDILNNVQLTATSNRAEAWGCCWLLL
FT                   GEWTVQLFPDCGTKAIETLRTATQLCPENCAAFHSLGILHYDLSRDPNTSQETQTKHHI
FT                   ESITALFKAVALSRRESNGVMEDVLRILSIWFSHSTVNEVNEAIQEGIKSVPCYVWLNV
FT                   IPQLVARIGITGAKARSILTDLLVSIGSNFPHALLYPLTVTEKSPEVMRRQAAERVLKG
FT                   IRVTNGPMVEEASLISNEMVRIAILWTEKWHNCIQLAAGKPENVSEIRNILRPLYEEMK
FT                   KESTPNEQHFVKVHGSTLRRAWAALQKGESQEAWVLLKQVYCELHKAVGERRLQMDDLS
FT                   PTLVKINKSNVPVPGTFVLGQQLITIQKFHSRVYVMPSKQRPRRFGVDGSDGSKYRFLL
FT                   KGHEDLRQDERVMQFIELINTIFSSDSLSNAMGLIIPQYAVIPLTDNVGIIGWVENTET
FT                   IYKMLERWRKDHNISIYKEVSMIVEKGKLVNITEYHHRNKQERKQLLSHVMASTPDDEL
FT                   RRIIWDKNDTCEHWLQYRGTYGHTLAIMSIVGYVLGLGDRHLNNLMLQDKGSVVHIDFG
FT                   DCFEVAMHRSLYSEAVPFRLTRLLVPALGITGVDGVFRLTCELVMKILRRHSENLLSIL
FT                   EAFIYDPLINWRLTTVAEGENSASLLEAPVAGGEASPFAEPDGLIDGPPMQLSRSVLKV
FT                   REQAPGTTLEQTGEEETRNTQGDLALARVRAKLTGEDFADGCHVVAGQPSRREVSEDPN
FT                   DPFSWWSQGLAESSRDVYMTDGRALPSWSSFRTVNNQENLQNVASQVDRLIEEATSLDN
FT                   LAEAYITGWAPFW"
FT                   /protein_id="XP_844230.1"
FT   gene            complement(<228897..>230348)
FT                   /note="synonym: Tb04.5E12.800; expression site-associated
FT                   gene (ESAG) protein, putative"
FT                   /db_xref="GeneID:3656603"
FT                   /locus_tag="Tb927.4.810"
FT   mRNA            complement(<228897..>230348)
FT                   /db_xref="GI:72387613"
FT                   /db_xref="GeneID:3656603"
FT                   /locus_tag="Tb927.4.810"
FT                   /transcript_id="XM_839138.1"
FT   CDS_pept        complement(228897..230348)
FT                   /locus_tag="Tb927.4.810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene (ESAG) protein,
FT                   putative"
FT                   /db_xref="GI:72387614"
FT                   /db_xref="GeneID:3656603"
FT                   /translation="MPKLFLLLYVTLFYHVSQSLGRIIALPTGSDAGSIELSGEPFPSG
FT                   DVALVVNDTAIANIMPTVVKMVNNMLGKYTIPSREVNGIQLGDIPITGIKIGNISLEIK
FT                   HPNKLVLNVTDIVADAEDTTFSKSLVITSCRGKVRASVAVSSASLVLGLSVDDDEKLKI
FT                   TVDDMNVRFAKLNLTPKLVNWCMVFDNFIIKFIKQQEGSIMGNLQGEIPRAAMGPLEEK
FT                   LNDFIATAPLVFPESPKITDGELQVLVTIVAPSPGGGSNSSAKTPLLDVPFPERSFGVV
FT                   ASFTAVNTVLVPLVNKSIVKFTKKFAQEFNTSLISAMYPEAYLLCPDCPFMVSVKAETA
FT                   VHLEPVGLDSLILHLLGIRLALEMKPPEGDPIPAMRLLCNTTVSLSSLYFDSSGAIPLE
FT                   MDLLDLAIDVETSNIGAIDQLTLNDILSRELRDKVIPAVNEKISTITIFDNTTEPLLNV
FT                   TSESITFALNVPRGNSSNETSLTTV"
FT                   /protein_id="XP_844231.1"
FT   gene            complement(<230926..>232071)
FT                   /note="synonym: Tb04.5E12.790; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656604"
FT                   /locus_tag="Tb927.4.820"
FT   mRNA            complement(<230926..>232071)
FT                   /db_xref="GI:72387615"
FT                   /db_xref="GeneID:3656604"
FT                   /locus_tag="Tb927.4.820"
FT                   /transcript_id="XM_839139.1"
FT   CDS_pept        complement(230926..232071)
FT                   /locus_tag="Tb927.4.820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387616"
FT                   /db_xref="GeneID:3656604"
FT                   /translation="MSRKCRKRPSTTGSPSRYRGERRNRIAVRRQTRQSRSFRGDEPTS
FT                   PVRSPQSSYVTIAGSAFSCSDDDESSELSDFDVINDVIQDALLESSDSSDYDDDDGNMS
FT                   ILQELRPFLFCSLYTVEDRRRRSRKEVTAPPVRRVSTRRSQGKRKGVLLPQGGGPPGAP
FT                   LCFVVDLDETLVAARGGCAHLRPHLKELFDVCHEEGCEVVVWSAGTASHVNELVQAITT
FT                   VVQRRAWYHHIISRHHRWFKEDCGGVKDLSLLGRPLDRVLCLENNPLSVHRQPRHSILV
FT                   EDYVQPANSDDTLRFVAGVLRRIASRLRSAGERGGDVAQLLSVDSGLVELVIPINPQLS
FT                   VTDPLVNNLYSIHSRGLRYSPQSVFTQRCYGGQRPFPASGS"
FT                   /protein_id="XP_844232.1"
FT   repeat_region   232653..232686
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(232653..232686)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<232773..>233255)
FT                   /note="synonym: Tb04.5E12.760; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656605"
FT                   /locus_tag="Tb927.4.830"
FT   mRNA            complement(<232773..>233255)
FT                   /db_xref="GI:72387617"
FT                   /db_xref="GeneID:3656605"
FT                   /locus_tag="Tb927.4.830"
FT                   /transcript_id="XM_839140.1"
FT   CDS_pept        complement(232773..233255)
FT                   /locus_tag="Tb927.4.830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387618"
FT                   /db_xref="GeneID:3656605"
FT                   /translation="MVCCHFFTRTSHLLLCFAAGCLFSSIFDYFLLVHSLFFLLYLTAL
FT                   PFFLLHLVANYFVSQGDSFMEKENKSICWRPKNALIECIVSTKCFEEKQSVEDCVAASE
FT                   CFMERRNWTLCKVNAVNPRYRLRGNPYDVATEDQKKIEARNERIKRRELEEEGIVS"
FT                   /protein_id="XP_844233.1"
FT   gene            complement(<233778..>235016)
FT                   /note="synonym: Tb04.5E12.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656610"
FT                   /locus_tag="Tb927.4.840"
FT   mRNA            complement(<233778..>235016)
FT                   /db_xref="GI:72387619"
FT                   /db_xref="GeneID:3656610"
FT                   /locus_tag="Tb927.4.840"
FT                   /transcript_id="XM_839141.1"
FT   CDS_pept        complement(233778..235016)
FT                   /locus_tag="Tb927.4.840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: ATP binding [goid 0005524]"
FT                   /db_xref="GI:72387620"
FT                   /db_xref="GeneID:3656610"
FT                   /translation="MRCLFASATPRCSNRALKKFLEVPLRPMDLRDMKGNDRQHIRAAV
FT                   EQLTARTARSYRAFASQILKRNLDRETAAQLVPLESICKSEFERCVALTEMVDPYLQQP
FT                   ESDKVCDVGSTLSSEISDGEGVDKALEFSEDAQDSVQTRFIDLLEGLRPRENLLDVAVN
FT                   EKCINSPDVNYWIYCFCRRRVSWRVIHEHLLHLVGPGRFGPVIRVDPCVASLLQHAGMV
FT                   VIDLYTRVVQAAHGGSLAITVEERPNLFTTLPAGQLATSSITVSPTARPGCGPQAQPSD
FT                   VVRSVEGHLAYVFREIIKNACVALMSKATDMELKVYFATNDTHVIVDVVDTADGVSLEV
FT                   AGKFWQFGWSTNTSLCQLISGFGLGLPVSKVYMDLWNGRIDIYTTPGSGTTVRVTFPKA
FT                   PVEVLLPEMSAPW"
FT                   /protein_id="XP_844234.1"
FT   gene            complement(<235465..>236031)
FT                   /note="synonym: Tb04.5E12.740; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656607"
FT                   /locus_tag="Tb927.4.850"
FT   mRNA            complement(<235465..>236031)
FT                   /db_xref="GI:72387621"
FT                   /db_xref="GeneID:3656607"
FT                   /locus_tag="Tb927.4.850"
FT                   /transcript_id="XM_839142.1"
FT   CDS_pept        complement(235465..236031)
FT                   /locus_tag="Tb927.4.850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387622"
FT                   /db_xref="GeneID:3656607"
FT                   /translation="MRNNIEAAGVHLADCTLLWCRHETKTEEERLAADVQRRISLLGEE
FT                   YPPTARDIAKQEASPHVRVDGEIVATNLALRYLTRAEEERKARFEEERRQREEREALGK
FT                   KQDEIRHIIIDNWAFGMEELEKLQWIEHGVVKGKERRRLYVDWYDSGVQQHLVDEARLW
FT                   SDLEQVIGREREAGRKAYELSKGKP"
FT                   /protein_id="XP_844235.1"
FT   gene            complement(<236536..>237438)
FT                   /note="synonym: Tb04.5E12.720; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656611"
FT                   /locus_tag="Tb927.4.860"
FT   mRNA            complement(<236536..>237438)
FT                   /db_xref="GI:72387623"
FT                   /db_xref="GeneID:3656611"
FT                   /locus_tag="Tb927.4.860"
FT                   /transcript_id="XM_839143.1"
FT   CDS_pept        complement(236536..237438)
FT                   /locus_tag="Tb927.4.860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387624"
FT                   /db_xref="GeneID:3656611"
FT                   /translation="MGHTEHRAAFNRREVVELQQRLTSFLLIFTAVAIAFVVLVASMQT
FT                   RVATCQTQASMAIHSMYGRFGSNNSTVLDTIVASLGISGVRVVPVEVAASHQAIKLDVF
FT                   DTSQATLQSAGFRLARQSGLASVVLWKLLYIDHSLCDPERTISMEALPNVDYEKASYRV
FT                   KAITVDNTRLFLYETNVATKDKDRITTFSQLQSVFPGFNSKVGTPHMILTKSLSIEPEF
FT                   VAELYRGSTSLSVELRVEKIQQVDNHTPIWRILVVARSPQAEQNFHRVHKVVANALAGV
FT                   GALCNKEGCGTSIVDEFFL"
FT                   /protein_id="XP_844236.1"
FT   gene            complement(<238338..>251684)
FT                   /note="synonym: Tb04.5E12.710; dynein heavy chain,
FT                   putative"
FT                   /db_xref="GeneID:3656608"
FT                   /locus_tag="Tb927.4.870"
FT   mRNA            complement(<238338..>251684)
FT                   /db_xref="GI:72387625"
FT                   /db_xref="GeneID:3656608"
FT                   /locus_tag="Tb927.4.870"
FT                   /transcript_id="XM_839144.1"
FT   CDS_pept        complement(238338..251684)
FT                   /locus_tag="Tb927.4.870"
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, putative"
FT                   /note="go_component: dynein complex [goid 0030286];
FT                   go_function: microtubule motor activity [goid 0003777];
FT                   go_process: microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:72387626"
FT                   /db_xref="GeneID:3656608"
FT                   /translation="MIVPSLVTFLKLLKHVYKPLVEDVEAESGKTRFIATKKAVNKYLY
FT                   TEVLNWVQRIEMQMTGFRSQVCAERRLMIPQMLLSMDNSDAGISSVLANEDIIRQVDIT
FT                   VGQWQAEISLAMSLDPQKEGPLGEIEYWREKYSTISALYEQINSPEAKLIMKVAKEAEC
FT                   NSYHLISSTIQQFFRYYAEAKDNVKFLGTLDRHFRTLHGVTPVTGSLQPIIDTLSSMMT
FT                   GVRMVWIISRYYCTEERMVGLLEKVAKLISQKVSQHIDFHRILSLPFAEAKAVVTEGQQ
FT                   CLLKWKAAYLGTQEEINSSEREQPWNFNQKRLFETTDYMSDRCTDLLEVIETVEYYTMV
FT                   LGAQLKTVLTDTSGIERILKDVERVKRPFESLTFDPFERKATHNWQLVFSNFVNMVANL
FT                   DREVSDFINKIFDDDLRSAESAFELLLSFKCIGSRPQRVGEAFDTASLLLEKADRILAQ
FT                   FFNEVNRVRNIFVQLKDNPPLTKNQPPVAGAIHWSTSLFQRLKKPIIRFQQEGMLNTHM
FT                   GKQVRAKYAEVAQQMKDYATSRFMQWGERVRQGTTASLKMNIIVKESDNTYVTNFDIEL
FT                   FNLIREAKYLDRLGFEVPQEALNVTLQDESYHANVDALKAMLLNFNYELQNALEGPERV
FT                   ILARNIRELRQALEPGLHDINWTSLGIPDFVLNCERAITKFRNLSREVRKRADHIQTQV
FT                   VNKIGSTRLMPEYERLLQAGGELPELQVLVETIERRRADLVDGCLRAYSTAKPLLTKVE
FT                   SQLVGTHTGKCLLLESYYHHWEHRIWKAVTKMVLSSLVAFAKMLGYRVSSSSAKRPPLF
FT                   KVMIFLTTEPTYSPPQQEITSAFHKVQAGIIASTQRFRRWMRGTCIEFTQGELVPRPPE
FT                   GEHETLFTYYQDINNLSQVYRLQAIINRTIQTHLSALATNIKLLQRYRFVYLSDKKLSV
FT                   EQQAKNQFHWIDYDAKFQLYFNMIADFDAEKHIHDFGFMRCDESTFYSDLVEHVHQWIA
FT                   MEGAQLNETVRARMQKRYSSIIRVNQDLERQCEKIEDLKFVLEVMHDARAFSLDVEQDI
FT                   IDIKYIYESIMHFGVSVDPRELKQAMDLHDLWECTLARVHETEKALEPKKMQFREHTRN
FT                   EVENFLVKGKAVLKEFRKKGPGRAGIDLQEGNRLRKEWREHLVQLQARREQLTKAEKLF
FT                   DLPLTGHTHLQQLNEELTKVETVYDLYVQWVAVLKRWNRSSWKDLLLEDLQSTTEEKVK
FT                   QARVLGRTHGDVEPFADVQQVIANFYSSLPLLAKLKSPALKQRHWVELMRVTSKQFAVE
FT                   QITLDDFIAMELYRFSDEIDGIVLSAAREQAVEKDITSVKEFWFKAEFVSVPYEPRKGE
FT                   VRCHVLSDTSEIQEAVDDNILKMQSIANVKWAQPFMDEVKLWEKKLATINDVMAVWIVV
FT                   QMKWQYLESIFRGSDDIAQQLPKESAKFNELDKRFVRIMNETAAAPNVDVCCNVGGRLD
FT                   EFRYLEEKLEECQKDLSNFLETKRRMFPRFYFISDDELLSILAANRARAVQDHMLKMFD
FT                   NSARIIFKNEDDDTVCGVESQEGERLNFDRQVRTEDTPVEEWLQAVLDETHASLHDLLK
FT                   GGVYYYPRMPRLDWVKKNHGMVTLTGAKIWWTFEVEDSFNAVKKGKKNAVKDLSGKLTR
FT                   QLIDLVGEMDKDIDKQYAKKINTLIIVDVHGRDIVDRFVRDSITDVREFDWESQLRFYW
FT                   ERDGDTCAIRQCTGHFKYGYEYMGLNGRLVITPLTDRCFMTLTQALSFYLGGAPGGPAG
FT                   TGKTESVKDLAKAMSIHCVVFNCGEGLDYKAMGTIFSGLSQSGSWGCFDEFNRIELPVL
FT                   SVVSEQLRSIQSALKTREKEFLFGDTMIRLVPTVGVFITMNPGYAGRVELPDNLKALFR
FT                   PVVMVVPDMELIAENMLFSEGFATARELAKKMVTLYQLARGQLSKQHHYDWGLRALKAV
FT                   LAMAGQLKRGAPDLSEEAVLMRALRDMNTPKFVAEDEPLFKGLIGDLFPGLDPTRAPQE
FT                   NLSRAATKVFKDKGFYIDAKQVDKVVQLYETMQTRHTSMVVGPTGGGKSTVIDCLCKSQ
FT                   TQLGLPTKLFVVNPKAQPTTVLYGVMDPMTRSWADGIFSNIFRAINRPVEGGERERRYV
FT                   VFDGDVDAKWVEDMNSVMDDNKLLTLPNGERIRLLPTSSLLFEVGDLQYASPATVSRVG
FT                   MVFLDPINLGWKPFMHSWKLNRPRDELETLNELIDKYIEPLINFVLEGIDGEEISDPPK
FT                   AVIPTSDLNMVRQLTTLIDTVSSQKTSLEPKALQCVFIFCSVWSFGALITTEEDRLRFD
FT                   KFLKKITGWNMQDVGDKFLTRFVGSGSLPERKTMYDYFFDLEDNRWKPWHVLVCPFERP
FT                   PGAKFGSLLVGTPDTERNMWLLNKIVLNRTPVMLVGKSGTAKTVTIQTYLRQLKQKSLE
FT                   MDTDGDVHLEEMILEMNFSSRTTSLDAQRAMEDNIEKRTNTVLGPPAKKRLVVFIDDIN
FT                   MPKVDLYGTQQPIAFLKLLIEHQSWYDRKDLLFKNVRDTQFVSAMAPPGGGRNALDPRF
FT                   VSLFTVFNVLFPSDESINTIYGQILTDAYKSMSKEVADMSIPLTTMTLNLYQRLFVSLP
FT                   ATPAKFHYIFNLRDFSRVYEGLCRATPEKFPTRQSVVRLWRNEIYRVFVDRMSDEDDKG
FT                   FVSRAVEEEIRRHFPDVAESAIADPLMFGDFGDFVVDSEDPRKHIYEDFGAEYSKARQL
FT                   VEAMLDEVNTPTKKMDLVMFDMALDHLLRITRVISLPRGNCLLVGVGGSGKQSLTRLAA
FT                   AICQMEVFEVVLSRNYNEDCFREDLKRLYTRVGVQQKQVVFLFMDSHVKEEGFLELINN
FT                   MLASGMVPALFTEEEKEPLYNSVLRELEANKLAPSKDNKWTAFVSRCRDNLHVVLSMSP
FT                   SGEVLRTRCRSFPALINNTTIDWFQKWPPQALEAVGTRILQSEDLPEEVKASIVNHVVY
FT                   VHVTADDLSARYQMELKRYNYVTPKNFLGFLANYSKLLTTRREDIDDLVKKFAIGLERL
FT                   DHAQEDVKVLQEELAEKEVTLREKQDINERMTSEIKDQKTRNEKRKAEALVMEEELNVQ
FT                   NEEIERESAQAQEVLALAMPALEEATEAVKHINPKSITELKSFAKPPASVVAVVRMVCV
FT                   VKGVPATWESGRTMMGQNDFIRSLVDIDSLAGTLNQGKINEINRILKEFPVNSNDLKKV
FT                   SLAASGLMIWVEAMKAYWNTAKEVLPKQARVRELQDAKAKAERQLAACQDEIQDLTAGL
FT                   RMLEERLEAGMSEARRLQQEKALMERRLNAARKLLDGFGSERVRWAEQKETLGDVRNRL
FT                   VGDCLAGAAFLSYLGAFTFSYRQEALESVWLKDIRERNIPLSEGFTIQHLLTDEVSISQ
FT                   WASDGLPSDDLSVQNGILTTMSTQPPGRGKKAGRVRFPLCIDPQMQAVNWIKRQHKSNP
FT                   RFECASFSDADFLKRLEFAIQYGNPFLFEGVDEFIDPIIDSVLDPQFRHDSGQLVIRLG
FT                   DKDVVWDSNFKLYLCTKLPNPEYPAEVFGKTMVINYGVTEDGLESQLLNFVVASERSDL
FT                   QRQSEDLVQTMAESRAQLKELEDTLIRELTLATGNILDNDELIATLENTKSSATEVQQK
FT                   LEQAKETARVTELSRQEYRPAARRGAVLYFVISELSVINSMYEYSLSAFLHDVFGYSIT
FT                   KSDASFEIKDRLRNIIRALTYNLYCYVCMGIFEKDKLMLSFQMAIRLLTQENQMVHSEL
FT                   EFFLRGCVLASKDYPPHTVEWMSERQWNDLCKLAHTCEVFENVCDDVVNNSEEWRVWAT
FT                   ADRPEDPSNPLPSGYSERITEFQLLCLLRCFRHDRIYTAVSNFVSNCELLGEEYVIPPI
FT                   LSYKDVLDKSSSTSPIVCIVSPGANPTDEIIKLATKEVGIQKLRPISLGQGQGEEAMKL
FT                   VEVGVGRGHWVLLQNCHLLTTWMKELEKVIERMNQTPPQEEFRLWLTTEPSRDFPMGIL
FT                   QRSLKVVNEPPNGLKMNMKNTLSKVTEDQLEECPHSAFRPLVFALAFFHAVVQERRKYG
FT                   KIGWNVVYDFNETDFSVSMRLLDTYLAKAHQNDDPIPWDTLRYLVGEVMYGGRVTDSMD
FT                   RRIVKTYLEEYFGDFLFDTFQSFHFFKNDVVDYCLPADSNDVNKRVLLQQMMAHVEAFP
FT                   KDNTPEVFGLHPNAETGYLRNAVDGMWASLIEMMPRSVRAATGGGESREEVLLKLTEEI
FT                   LAQIPEPLDRKSIMRSEKEKAAESGHENLQPTQVVLLQEIERWNRLVVVIVLSLKELQK
FT                   ALSGIIGMSSELDELATSLHNGHLPSSWRRYAPATRKKLVRWLAHFQKRCKQYVDWATH
FT                   GEPKCMWLTGLMVPESYISALVQVTCRRYKWPLDRSSVVMSVTRYLSPNDVKERPKDGA
FT                   YVCGLFIEGARWDTERHCLAPQVKKVLTAEMPVMQIIPMEVSKIKAVSVLKTPVYVTSE
FT                   RRNAAGVGLVLEADLKTDTHASLWTLESVALILDSDE"
FT                   /protein_id="XP_844237.1"
FT   gene            complement(<252447..>254363)
FT                   /note="synonym: Tb04.5E12.700; TPR-repeat-containing
FT                   chaperone protein DNAJ, putative"
FT                   /db_xref="GeneID:3656612"
FT                   /locus_tag="Tb927.4.880"
FT   mRNA            complement(<252447..>254363)
FT                   /db_xref="GI:72387627"
FT                   /db_xref="GeneID:3656612"
FT                   /locus_tag="Tb927.4.880"
FT                   /transcript_id="XM_839145.1"
FT   CDS_pept        complement(252447..254363)
FT                   /locus_tag="Tb927.4.880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR-repeat-containing chaperone protein DNAJ,
FT                   putative"
FT                   /note="similar to Cysteine string protein.
FT                   (Swiss-Prot:Q03751) [Drosophila melanogaster]; similar to
FT                   DnaJ homolog subfamily C member 5 (Cysteine string protein)
FT                   (CSP). (Swiss-Prot:Q9H3Z4) [Homo sapiens;]; go_function:
FT                   protein binding [goid 0005515]; go_process: protein folding
FT                   [goid 0006457]"
FT                   /db_xref="GI:72387628"
FT                   /db_xref="GeneID:3656612"
FT                   /translation="MSHHIQLPCFAETITSSGTLFPNISGGKPQKKPEMNSVRHPQRPV
FT                   RTQKKRNKPMSRVAPSEYPQWEFKHRMKGNQETQKSVLSRSPGGTLKDLTAALWQTANE
FT                   EGSCRRLIVANENIQWRCILRAMGGGSAEKVLPSMELESRGMRLLASKDYAGAHVCFSR
FT                   IIRQHPNSKTAHCRRAICDWHLLLFDECIEDARRGIDTDKDMLSLLCRSLVVRERYRDA
FT                   WRWYDYGLKELAPSADDPHNVKWTAECTALPVLQKFRSCIEEKKWKEALCSSDAARPLI
FT                   DDTPLILLEARALLYVSPTAARTLLMEYVPTIPRPTSLRMDVSLEEQAVWRSVNEHYVQ
FT                   ASVVLAQANVYCGSKYLEFAAALVQTCLTLSPGFGPALVLGYYLVSLEEVLVRVADLFG
FT                   KKRYVDAIPHINEGLGLDKSNRLMCAHLYCMRAEVHSHCGRYNNAVDDCTSAIDMDPSC
FT                   AKAYACRAEAHYQLGCRAEAALDRLTAVKFDPELSHILRGDEEQSLPKMEANGSSQPRN
FT                   GQKRCIPRWYDAFLRKDDFATDPFEKTEKENSTPVVRTMNSMTLYDALELPFGATIDDV
FT                   RSQYKKLTLKYHPDRVIGESPGMQEAALEKFKRVSRAHEVLSNPEEKLLYDVSLGMTFS
FT                   AAT"
FT                   /protein_id="XP_844238.1"
FT   gene            complement(<255303..>255650)
FT                   /note="synonym: Tb04.5E12.680; small nuclear
FT                   ribonucleoprotein SmD3, putative"
FT                   /db_xref="GeneID:3656615"
FT                   /locus_tag="Tb927.4.890"
FT   mRNA            complement(<255303..>255650)
FT                   /db_xref="GI:72387629"
FT                   /db_xref="GeneID:3656615"
FT                   /locus_tag="Tb927.4.890"
FT                   /transcript_id="XM_839146.1"
FT   CDS_pept        complement(255303..255650)
FT                   /locus_tag="Tb927.4.890"
FT                   /gene_family="HOG000182712" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small nuclear ribonucleoprotein SmD3, putative"
FT                   /note="similar  to: GP:9837180: Sm-D3 {Trypanosoma cruzi}
FT                   PMID:10900267; 72.7% (but over a small region) identical
FT                   to: GP:9837180: Sm-D3 {Trypanosoma cruzi} PMID:10900267;
FT                   go_component: nucleus [goid 0005634]; go_component: small
FT                   nuclear ribonucleoprotein complex [goid 0030532];
FT                   go_function: pre-mRNA splicing factor activity [goid
FT                   0008248]; go_process: mRNA processing [goid 0006397]"
FT                   /db_xref="GI:72387630"
FT                   /db_xref="GeneID:3656615"
FT                   /translation="MNTEGLPLKVLSDAVGTTVSLELKNGELYTGTLSEVVDNMGVLLT
FT                   SARKTTMAGREVDMPKVLVCGTNIVFFQLPDALRCCPPLMKMGKLLPSDLDGRGDGKGF
FT                   GAHRSRKKPKK"
FT                   /protein_id="XP_844239.1"
FT   gene            complement(<256506..>257201)
FT                   /note="synonym: Tb04.5E12.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656617"
FT                   /locus_tag="Tb927.4.900"
FT   mRNA            complement(<256506..>257201)
FT                   /db_xref="GI:72387631"
FT                   /db_xref="GeneID:3656617"
FT                   /locus_tag="Tb927.4.900"
FT                   /transcript_id="XM_839147.1"
FT   CDS_pept        complement(256506..257201)
FT                   /locus_tag="Tb927.4.900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387632"
FT                   /db_xref="GeneID:3656617"
FT                   /translation="MRTSADIACLLAQYIKGQPEERLVTAAAYPDIFTPDVVEELNGAY
FT                   ALLLDAQRQAREACCAVDDVTREHGLPTALRITPKEQNELDVTEEMMIKRFAEEVAVYL
FT                   SEGGAPNISSDAEPTSVLNSHCVDLRWHQHSTLVLHVLSYLPLEFTLSVAENVCKGWRE
FT                   WLFIPEFSGMFWHECTMREYPECVRMLLLSGGGDARQCDWRTFAMLCCSVDEEDISGEG
FT                   TRSPDLVHS"
FT                   /protein_id="XP_844240.1"
FT   gene            complement(<257666..>258583)
FT                   /note="synonym: Tb04.5E12.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656609"
FT                   /locus_tag="Tb927.4.910"
FT   mRNA            complement(<257666..>258583)
FT                   /db_xref="GI:72387633"
FT                   /db_xref="GeneID:3656609"
FT                   /locus_tag="Tb927.4.910"
FT                   /transcript_id="XM_839148.1"
FT   CDS_pept        complement(257666..258583)
FT                   /locus_tag="Tb927.4.910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387634"
FT                   /db_xref="GeneID:3656609"
FT                   /translation="MLAPFLVSPASCLSSPFLCFLRSLLFTVAGSNLLVKWLTLSRARQ
FT                   ENMSEVDQQHGGHSALECSGHLSLTKRPPSAQVGGDPLILGVKSRVKELRRLVEEKSRL
FT                   HKTLENRLRVQTTETARMMSELQALDHKIEEAQCRKRRLLRLDVAARKRQEQLRVALKE
FT                   ADTALMQLKSRCTQPCGVGMGASPEKLSSQALPIVPPSVGPSDEAVRVATACSTCGEKE
FT                   QAGLQQKLYSVRTKYRKLCEENRKLQMALDDISAEETATSSSSTRKSSGCSNSVNKDRL
FT                   EYRVALEELIGSFMEATSVSASPH"
FT                   /protein_id="XP_844241.1"
FT   gene            complement(<259313..>260074)
FT                   /note="synonym: Tb04.5E12.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656613"
FT                   /locus_tag="Tb927.4.920"
FT   mRNA            complement(<259313..>260074)
FT                   /db_xref="GI:72387635"
FT                   /db_xref="GeneID:3656613"
FT                   /locus_tag="Tb927.4.920"
FT                   /transcript_id="XM_839149.1"
FT   CDS_pept        complement(259313..260074)
FT                   /locus_tag="Tb927.4.920"
FT                   /gene_family="HOG000260473" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387636"
FT                   /db_xref="GeneID:3656613"
FT                   /translation="MTTSDELPANGELDQPERIPDVVECERLKKAGNDLFAADRVAEAL
FT                   ELYREAIKHAPLKPVKKPTQHRQDEVPPCGSEGTAQNSIGESSVVSEKSSAPGTEKSSK
FT                   VGADDAAQDGDDDGIDYTLTSQVYCNAGLCLSKQGMPEDAITHLSEAIRHNKQYSKAYY
FT                   RRAECYYVLGKWSNAYGDYEEYEKLGGTLDAGSQDRKRQAKAKVDEEMQKMLGELKNMG
FT                   NRFLNYFGLSTDNFKFDKDPNTGGYSVRFEQ"
FT                   /protein_id="XP_844242.1"
FT   gene            complement(<260388..>260957)
FT                   /note="synonym: Tb04.5E12.640; 50S ribosomal protein L14,
FT                   putative"
FT                   /db_xref="GeneID:3656616"
FT                   /locus_tag="Tb927.4.930"
FT   mRNA            complement(<260388..>260957)
FT                   /db_xref="GI:72387637"
FT                   /db_xref="GeneID:3656616"
FT                   /locus_tag="Tb927.4.930"
FT                   /transcript_id="XM_839150.1"
FT   CDS_pept        complement(260388..260957)
FT                   /locus_tag="Tb927.4.930"
FT                   /gene_family="HOG000260472" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L14, putative"
FT                   /note="go_component: organellar large ribosomal subunit
FT                   [goid 0000315]; go_component: ribosome [goid 0005840];
FT                   go_function: structural constituent of ribosome [goid
FT                   0003735]; go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387638"
FT                   /db_xref="GeneID:3656616"
FT                   /translation="MFRFFSLRLAPAPSADAAAKLPAGKPANKSWFRHNLIIRRKASYR
FT                   SRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRLISKATAERFAHCRVFPAVAHRVSV
FT                   QRFKSGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLRTNFDRNTCILMNDQRVPLGT
FT                   RVMYCAGRHVNHKYHLKAVVLANFFV"
FT                   /protein_id="XP_844243.1"
FT   repeat_region   260989..261023
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(260989..261023)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<261222..>261815)
FT                   /note="synonym: Tb04.5E12.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656614"
FT                   /locus_tag="Tb927.4.940"
FT   mRNA            complement(<261222..>261815)
FT                   /db_xref="GI:72387639"
FT                   /db_xref="GeneID:3656614"
FT                   /locus_tag="Tb927.4.940"
FT                   /transcript_id="XM_839151.1"
FT   CDS_pept        complement(261222..261815)
FT                   /locus_tag="Tb927.4.940"
FT                   /gene_family="HOG000260471" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387640"
FT                   /db_xref="GeneID:3656614"
FT                   /translation="MSFAWTRMKMRLTTRSVDIMRAFCDGCNRAMARMSDPVRRLGRRI
FT                   GEESPWVVVLFVSSGITVFPLVFYPVLKPYLMDDPRYMKEEERVRLCLQKGIDPYPYMR
FT                   HKDYVFGNVAPATQTEEEVPLSASWEHQAVLNFQRAKEELRKEVGGDVNDSVTKLLALR
FT                   EGLHKEFKRQRHAVSEEPSNLVFHQERKIGTDMT"
FT                   /protein_id="XP_844244.1"
FT   gene            complement(<262118..>263092)
FT                   /note="synonym: Tb04.5E12.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656619"
FT                   /locus_tag="Tb927.4.950"
FT   mRNA            complement(<262118..>263092)
FT                   /db_xref="GI:72387641"
FT                   /db_xref="GeneID:3656619"
FT                   /locus_tag="Tb927.4.950"
FT                   /transcript_id="XM_839152.1"
FT   CDS_pept        complement(262118..263092)
FT                   /locus_tag="Tb927.4.950"
FT                   /gene_family="HOG000260470" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387642"
FT                   /db_xref="GeneID:3656619"
FT                   /translation="MRGQRSGKFAEYTATYAILKRIGLHQTVLIEKRDASVGYGVYVRD
FT                   ACDSGTPLLVVPSRHAFSLSTVQKLGARVRQEDLMQSPQLEILNRGVLSRLLGCTAGEW
FT                   ISLAWRLAIEHQRSLSPWWGWLNVLPRMQDFRTMEDESGRQCRLHRVQLLPYFIEVQGS
FT                   MQEEICSAYEVLSEKNLMPSPNHFRWAVDVILTRSHRLPACWTNGEGSSVELGIIPFVD
FT                   LVNGDDGGERRRNARVEVAFEVEELPRWYRDEFLQESERRHVNGEEALRRLLEEHFFAL
FT                   VALERDLTASEEVIMEYELVPWVTGALSHEDDLLLGRLLRYRF"
FT                   /protein_id="XP_844245.1"
FT   gene            complement(<263441..>266977)
FT                   /note="synonym: Tb04.5E12.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656622"
FT                   /locus_tag="Tb927.4.960"
FT   mRNA            complement(<263441..>266977)
FT                   /db_xref="GI:72387643"
FT                   /db_xref="GeneID:3656622"
FT                   /locus_tag="Tb927.4.960"
FT                   /transcript_id="XM_839153.1"
FT   CDS_pept        complement(263441..266977)
FT                   /locus_tag="Tb927.4.960"
FT                   /gene_family="HOG000260467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387644"
FT                   /db_xref="GeneID:3656622"
FT                   /translation="MSQLTAILCPRLIPGKLASGGASAALIEDIKKWPYQAAQISCHDL
FT                   LATSSYCEGSGEVIIIDINSMQLVQTLHGHASPVTSVQWNPTSPSCSHQGLLLFTGDRT
FT                   GVLKVWNVTEGTTVNSVQLPSNRPICAISLVTKKRILVVTQDSSCFVYDSHLSSNDPCD
FT                   DPQLTFALGTNEKFIPLCVRTSKLSEFWTSCVVLGDRIGMIYSQDQDRNGKSPRACVKN
FT                   LVFESTDGFETVVDAVFSESQEGLLYFATRNSVGVYDCRANLLLDENVLRYSAGDGEFR
FT                   RIFSSAPSTLTEDTQQLPLLYSYGSNQRLTAWYLLRVGKATSVSTDVRGARIASKVATN
FT                   VIQSLSAPNVFAVIFSDGSVARWRYRVDCRRWVIDSYFSAALKKPTGFCVLGDNTLCCA
FT                   LEAGYLALVDVAHSNALRRINFVNTSNTHIILLAPHSSKECVWVVTNKAEQSKQHHQVT
FT                   LFDCHSGVVLQVLREPKYSDATRMKNITQDATGTFLLLTFFGGTFEVWNITESRIIYSY
FT                   EGTGVASASWAPQIFTPVLAGLKGAPELLLIVFSDGSMSFWTVSWDQVVPNRDAVPRFP
FT                   NGSSTRVLCTPTRDASVVVDGSGAVTVVGVGTSGLHVRSLKDIPAAKTAIALAVSKGGG
FT                   GSDNKGEPSDAGNWSEEYLAVVFSDGSFGVWSISSQERMGYSKNTDINLKARGATWLGD
FT                   ALLLLTLTGNIVVVDKLLTSINSSVFSKALRRPLQNSAFFVPEHRMYIQTVLETQVACS
FT                   AVPSEVRPSSDICPSCLIRGINPERFPCRGPFGQVITAAISSLTRELDLYRKTMVPRYI
FT                   YEGIQHAFTQSRTDEIALWVARFFGQQERQRLWMQFCLRRGLNCSGAEAGGDGGQQSKS
FT                   VERWKGGPEVGPPVPYYCADRFSEVSAASEVVYNNHVYMNERRAEALEASKGKEIDVFS
FT                   QRFLTARELLKLQQPQKAIDVLMDVSHEDNRFPHLSDFAVAISASVAALSGPASELLTL
FT                   TTSRVASLLRARGDLDSAVDKYMLSGHFYEAVKALQLSGKWGEGAVLAKLSPLPVKQQR
FT                   DLICRWCSHLVRHGQVMEAAVMLASQALPFQVLVLLSESSQFEDIAGLLAMVLLEDPSF
FT                   NTRESLQEPIVLPVAEDDSSDALTLGEVLLNVLVDYANMLNTVGNVVSAKAVLEYVTSL
FT                   KGRNRGITSTST"
FT                   /protein_id="XP_844246.1"
FT   gene            complement(<267244..>267912)
FT                   /note="synonym: Tb04.5E12.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656623"
FT                   /locus_tag="Tb927.4.970"
FT   mRNA            complement(<267244..>267912)
FT                   /db_xref="GI:72387645"
FT                   /db_xref="GeneID:3656623"
FT                   /locus_tag="Tb927.4.970"
FT                   /transcript_id="XM_839154.1"
FT   CDS_pept        complement(267244..267912)
FT                   /locus_tag="Tb927.4.970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387646"
FT                   /db_xref="GeneID:3656623"
FT                   /translation="MTSRRVVNVAAGATRNRQHYLKLLRDCARELPQARMSTSEGATVT
FT                   RVEEGSKLLATPRAKFLEANLSLPEGWVESSTTSLQKSLEGVVPREKIVENDLFRCALI
FT                   HPSYVRSRSVRAAVAMPIELTLTGSSTLRLLKQVADAHNLKGYLGSEEIANVPRKLGVI
FT                   DLVLFDGTMFEGAGWKERGEPPEEVCMAAATALCGVVTLSEGAHSAAVLLDRIRGLNPL
FT                   "
FT                   /protein_id="XP_844247.1"
FT   gene            complement(<268584..>269702)
FT                   /note="synonym: Tb04.5E12.570; actin, putative"
FT                   /db_xref="GeneID:3656618"
FT                   /locus_tag="Tb927.4.980"
FT   mRNA            complement(<268584..>269702)
FT                   /db_xref="GI:72387647"
FT                   /db_xref="GeneID:3656618"
FT                   /locus_tag="Tb927.4.980"
FT                   /transcript_id="XM_839155.1"
FT   CDS_pept        complement(268584..269702)
FT                   /locus_tag="Tb927.4.980"
FT                   /gene_family="HOG000136041" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="actin, putative"
FT                   /note="similar to SP:P53467:  Actin, larval muscle-type
FT                   (A1). {Molgula oculata}; go_component: actin cytoskeleton
FT                   [goid 0015629]; go_function: structural constituent of
FT                   cytoskeleton [goid 0005200]; go_process: cytoskeleton
FT                   organization and biogenesis [goid 0007010]"
FT                   /db_xref="GI:72387648"
FT                   /db_xref="GeneID:3656618"
FT                   /translation="MAVVEIGWNVRAGYVGDTRCARQFPSLHLLEPPAETSFPSVLMAA
FT                   DGAGSESVSSMWTLQSLDAQRDSNMDYLSRIIGDELHCLKEETLTLVVPEVWHERFDVM
FT                   RALFHSVLESGVATALYCLRPSVAWALSSGKCSTVVLDVGHSHATAAAVLDGYALRGTV
FT                   ASSDVAGKVVTEVLKGMLDSEQLQALEGVARFKTPTVRALAMDDLVGDIKRLACTVRTD
FT                   ASESNKEEGSLVLRAPDGSAITVEGRARVEAYEVLFRSVGGFGSSLGDLVVGCKQRLDP
FT                   EWQLQFVSHTLCGGTAQAPGFRERLLTEVQQRDSCYFRYEKEGGFHLSRAVDGAWVGAS
FT                   LATDSSSFASLWITRADMEEEGDSVLYRKLFY"
FT                   /protein_id="XP_844248.1"
FT   repeat_region   269713..269737
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(269713..269737)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<270246..>271298)
FT                   /note="synonym: Tb04.5E12.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656627"
FT                   /locus_tag="Tb927.4.990"
FT   mRNA            complement(<270246..>271298)
FT                   /db_xref="GI:72387649"
FT                   /db_xref="GeneID:3656627"
FT                   /locus_tag="Tb927.4.990"
FT                   /transcript_id="XM_839156.1"
FT   CDS_pept        complement(270246..271298)
FT                   /locus_tag="Tb927.4.990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387650"
FT                   /db_xref="GeneID:3656627"
FT                   /translation="MDTAAEMYAMREKSQANKNDGDMAETTLGRKCPFAPSDISPFVAM
FT                   ALQDHSAVWDISDVKSPLRRAPAKRKRTESIGKDMNSSVKMEMTTNTVATMAYLLQSGS
FT                   PLYDPVEKLWRCWNGHELCIKRISDYSGAEEVTCDFCGVTHWCKNKEVRAKPHRLKKLP
FT                   PEGLLPAEAEPVDETYLYNCSECGMDLCAHCASEVYQDERYHVPCMQCVQCKLFMHDTD
FT                   GMLHRCQVKRTRVSPSVLHKSPTSTSGCVSSSIQMDSTGSCGVSVGREQSITTQLLPSD
FT                   VWEVCVAAKNAEEEVRARALATTLFVKETYVPDTVKQLTFRMPTRLAAEELARRGRDAG
FT                   LCAAVRKSFV"
FT                   /protein_id="XP_844249.1"
FT   misc_feature    271492..271599
FT                   /note="A-rich"
FT   misc_feature    complement(271492..271599)
FT                   /note="T-rich"
FT   misc_feature    271736..271806
FT                   /note="C-rich"
FT   misc_feature    complement(271736..271806)
FT                   /note="G-rich"
FT   repeat_region   271978..272001
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(271978..272001)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    272287..272378
FT                   /note="A-rich"
FT   misc_feature    complement(272287..272378)
FT                   /note="T-rich"
FT   repeat_region   complement(272351..272375)
FT                   /rpt_family="tandem"
FT   repeat_region   272546..272579
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(272546..272579)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(272546..272576)
FT                   /rpt_family="tandem"
FT   repeat_region   272846..272892
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(272846..272892)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   272954..272987
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(272954..272987)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    273266..273312
FT                   /note="A-rich"
FT   misc_feature    complement(273266..273312)
FT                   /note="T-rich"
FT   misc_feature    273357..273394
FT                   /note="AT_rich"
FT   misc_feature    complement(273357..273394)
FT                   /note="AT_rich"
FT   repeat_region   273488..273516
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(273488..273516)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    273585..273725
FT                   /note="A-rich"
FT   misc_feature    complement(273585..273725)
FT                   /note="T-rich"
FT   repeat_region   274274..274310
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(274274..274310)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tgaa"
FT                   /rpt_type="tandem"
FT   misc_feature    274342..274363
FT                   /note="AT_rich"
FT   misc_feature    complement(274342..274363)
FT                   /note="AT_rich"
FT   misc_feature    274478..274566
FT                   /note="A-rich"
FT   misc_feature    complement(274478..274566)
FT                   /note="T-rich"
FT   misc_feature    274708..274728
FT                   /note="AT_rich"
FT   misc_feature    complement(274708..274728)
FT                   /note="AT_rich"
FT   repeat_region   274827..274866
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(274827..274866)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<275000..>275665)
FT                   /note="synonym: Tb04.5E12.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656628"
FT                   /locus_tag="Tb927.4.1000"
FT   mRNA            complement(<275000..>275665)
FT                   /db_xref="GI:72387651"
FT                   /db_xref="GeneID:3656628"
FT                   /locus_tag="Tb927.4.1000"
FT                   /transcript_id="XM_839157.1"
FT   CDS_pept        complement(275000..275665)
FT                   /locus_tag="Tb927.4.1000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387652"
FT                   /db_xref="GeneID:3656628"
FT                   /translation="MMELPMEMNVDGVPMVLSKVSYSPMLDFGGTFSYRRYCFVGELQP
FT                   EGYVNWFFAPLEGYKDKRLRVHESAVKEGALNHLVFMRLGELSFRQYKLKHIPSPTEQP
FT                   HSPVTPQGDSTKQLMGHAHPHFNYIFEAMRQDQASSPSPRSSSIGSDCTYHSSKESCES
FT                   LQMSSSLVDLPGKRLSNASLRSGVRPPLEARRGAVCDDEGFLPPVRSLKKSSERSQEL"
FT                   /protein_id="XP_844250.1"
FT   gene            complement(<275955..>276230)
FT                   /note="synonym: Tb04.5E12.480; hypothetical protein"
FT                   /db_xref="GeneID:3656620"
FT                   /locus_tag="Tb927.4.1010"
FT   mRNA            complement(<275955..>276230)
FT                   /db_xref="GI:72387653"
FT                   /db_xref="GeneID:3656620"
FT                   /locus_tag="Tb927.4.1010"
FT                   /transcript_id="XM_839158.1"
FT   CDS_pept        complement(275955..276230)
FT                   /locus_tag="Tb927.4.1010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387654"
FT                   /db_xref="GeneID:3656620"
FT                   /translation="MRSSDLFYLKSFFLFHIPETVCQFPVLPPSTCEQVHMLSTPPPQL
FT                   LFIILFPPFPYCYVLLLFVSAPCLSHVVSTLNILTSLLFSFFLKTF"
FT                   /protein_id="XP_844251.1"
FT   gene            complement(<276640..>278112)
FT                   /note="synonym: Tb04.5E12.470; serine-palmitoyl-CoA
FT                   transferase, putative"
FT                   /db_xref="GeneID:3656624"
FT                   /locus_tag="Tb927.4.1020"
FT   mRNA            complement(<276640..>278112)
FT                   /db_xref="GI:72387655"
FT                   /db_xref="GeneID:3656624"
FT                   /locus_tag="Tb927.4.1020"
FT                   /transcript_id="XM_839159.1"
FT   CDS_pept        complement(276640..278112)
FT                   /locus_tag="Tb927.4.1020"
FT                   /gene_family="HOG000260463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine-palmitoyl-CoA transferase, putative"
FT                   /EC_number="2.3.1.50"
FT                   /note="similar to Serine palmitoyltransferase 1 (EC
FT                   2.3.1.50) (Long chain basebiosynthesis protein 1) (LCB 1)
FT                   (Serine-palmitoyl-CoA transferase 1)(SPT 1) (SPT1).
FT                   (Swiss-Prot:O35704) [Mus musculus;]; go_component: integral
FT                   to membrane [goid 0016021]; go_function: serine
FT                   C-palmitoyltransferase activity [goid 0004758]; go_process:
FT                   sphingolipid metabolism [goid 0006665]; go_process:
FT                   biosynthesis [goid 0009058]"
FT                   /db_xref="GI:72387656"
FT                   /db_xref="GeneID:3656624"
FT                   /translation="MVGFKTLSSTAPLAFSEFSHLLLEALLAAALAVALALHFIRRRNT
FT                   SKIVEPELPPLEEQQRRIAAFRSQMFRADAKPNANTQLPNRTGMSEVEARNSCYITLRD
FT                   ESDSSSREYLDLVTEDFHSFSTHPTVVDVAKKIVVAYGVGSCGPRGFYGTIKPHMVLEE
FT                   DIAKFLGVEDSLIFSFSFATISTLIPCHASRGDYLIVDDGVSLPVHEGCTLSRANLLKY
FT                   RHNDMAHLEEILREVQIKEMKEKKLSRRFVVTEGVFKNLGDVCKLPQVLELCEKYKFRI
FT                   ILDDSCGFGCMGPTGRGTHEHYGIPTTRIDLYVGSLSQAMGGVGGFCAGEHAIIEYQRL
FT                   TAAAYVFSASLAPYITAGVSAVLKLLDEDHSFPEKLQRNAGLFRGAIRSAGMNPEKITL
FT                   VECAGDVSPIVILRPTDAYVKCHHQKVEEELQQVVEAARRKGVLLTRHLFSKEEACSNF
FT                   SALRILVKGTATEDELLRAAKVITEAVKSVFV"
FT                   /protein_id="XP_844252.1"
FT   repeat_region   278578..278602
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cacaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(278578..278602)
FT                   /rpt_family="tandem"
FT   gene            complement(<278752..>279579)
FT                   /note="synonym: Tb04.5E12.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656621"
FT                   /locus_tag="Tb927.4.1030"
FT   mRNA            complement(<278752..>279579)
FT                   /db_xref="GI:72387657"
FT                   /db_xref="GeneID:3656621"
FT                   /locus_tag="Tb927.4.1030"
FT                   /transcript_id="XM_839160.1"
FT   CDS_pept        complement(278752..279579)
FT                   /locus_tag="Tb927.4.1030"
FT                   /gene_family="HOG000260461" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387658"
FT                   /db_xref="GeneID:3656621"
FT                   /translation="MQSPSAFVAAADQSNYRVPDAQLATCTKHGGAAVLCATAGKVGRN
FT                   GRTAAVGATLFWLTCPYLNTIVARFERHSAISALQRLLDNDRKVSEAHVASHARYEERA
FT                   KELLSSERWAFFDAHFVTGAAESAGGRKYGNAAVSHATDLKCLHALVAQSLCGASNPIG
FT                   DAVIHYILLLAEKVKTIKNASAPLSSEKGSSGDCSTAEVCGGENSFAAESLALDEVSLL
FT                   VEFVKQRLTDDIRGDRSDLRSVHDADKLCSSACEVLTFLDGRPPRSRKKHRIN"
FT                   /protein_id="XP_844253.1"
FT   gene            complement(<280221..>280721)
FT                   /note="synonym: Tb04.5E12.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656625"
FT                   /locus_tag="Tb927.4.1040"
FT   mRNA            complement(<280221..>280721)
FT                   /db_xref="GI:72387659"
FT                   /db_xref="GeneID:3656625"
FT                   /locus_tag="Tb927.4.1040"
FT                   /transcript_id="XM_839161.1"
FT   CDS_pept        complement(280221..280721)
FT                   /locus_tag="Tb927.4.1040"
FT                   /gene_family="HOG000260460" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Hypothetical 22 kDa protein in aldolase
FT                   locus (ORFI). (Swiss-Prot:P17960) [Trypanosoma brucei
FT                   brucei;]"
FT                   /db_xref="GI:72387660"
FT                   /db_xref="GeneID:3656625"
FT                   /translation="MEQDSHPRIGLMLTEGQFEALVTRLHDKSVEHKAETLRQLDARFY
FT                   PTAPPKRLPKEAIESSVVRQVDHEMNRRRAARENLEIQEERKTLSKKISSADVESSVER
FT                   LYTETLARKKANMEESRKRYLYAGPDMVKKNAKEIQEYVGRLAVPKKKEFTIEEVNKVY
FT                   DLV"
FT                   /protein_id="XP_844254.1"
FT   gene            complement(<281014..>282399)
FT                   /note="synonym: Tb04.5E12.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656626"
FT                   /locus_tag="Tb927.4.1050"
FT   mRNA            complement(<281014..>282399)
FT                   /db_xref="GI:72387661"
FT                   /db_xref="GeneID:3656626"
FT                   /locus_tag="Tb927.4.1050"
FT                   /transcript_id="XM_839162.1"
FT   CDS_pept        complement(281014..282399)
FT                   /locus_tag="Tb927.4.1050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387662"
FT                   /db_xref="GeneID:3656626"
FT                   /translation="MRFLGAGACSIVFALSEEEAREWGHLLPSHLLWQLALRLSARKLL
FT                   RCPTCCDALNDFIGFRLGIGLDDKLRERCAAAYPLFAARCQEALYAELVSNFAADPRHI
FT                   QLHGGRSTSDGVGTEAMTDSWPHYSTLAMEIKPKGVWRRPAVVGVVVDGVEYYLHPIKL
FT                   RQCRFSLMQLLKRKRHNHSTPVSMERRCTYCPNQLLLGDGSSIVDALQHLSEHPGNNLA
FT                   ILHATDAGQGLNENSIDIVSSVLRRSGILSILANLQLFGSSSSCEWPVLDIELLFRWSE
FT                   ARNMSSVRWIVCSTCEGQFAAESCACQSELPLSLCMETCSGIHLTHFIAPPMGFEECVE
FT                   RFYASVTAKDVSVLVALTISEKVELPPSLSSPPKLGMDGSAAEEKSANLCSNPRVRFIE
FT                   CGDTPNGVTINLEHPQAAICRVGVVDLDAKWHKPLSRYFELDREVLAAWEDYKVVSAPE
FT                   FHC"
FT                   /protein_id="XP_844255.1"
FT   gene            complement(<282675..>285980)
FT                   /note="synonym: Tb04.5E12.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656629"
FT                   /locus_tag="Tb927.4.1060"
FT   mRNA            complement(<282675..>285980)
FT                   /db_xref="GI:72387663"
FT                   /db_xref="GeneID:3656629"
FT                   /locus_tag="Tb927.4.1060"
FT                   /transcript_id="XM_839163.1"
FT   CDS_pept        complement(282675..285980)
FT                   /locus_tag="Tb927.4.1060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387664"
FT                   /db_xref="GeneID:3656629"
FT                   /translation="MRCSARIFCDDTLLRQWKKHLTEGQPLTKGDAFRLMRRTLNETQR
FT                   AEQQQRLSFLASKGNSTTVWKALARHNITWRNSLTLMDAQLAAFSPSRREFVCSRLGPT
FT                   SRLWMQLPHVIVGAWQTEDDMLAVFNRLLASETIVQFASIVLAAIRERPQLGGVLPVVS
FT                   CVLLHCYELGGKQPDTALSCCRLLALVGAEKLPRSEREVLAFRYAMLYATQGQWSVALS
FT                   VVNAAHEVRPSAKRLLWLHTSRMVQWIKAIECLHPVEPSFVASSIEYAPNWLCALRTYE
FT                   RWRSRDAAQALLIRKDCISAVGWEASLHFCSQNGVDSYGILRPILSMVPGDHPQRMQIL
FT                   TDATRATGESMYAGTLSRRAFKLAQRGEWAEAIGLLCGCRYYDVALPLAPYASRGAALP
FT                   HELLAYEGALCRVNLPGGLQAPVSFEEQLAVALHGDWRQLKNVHDNARLKSLMLARSEP
FT                   KLSPKSPILEESSEIQCFTFQSEELSRLVCLSASSKVQQYFVQVIPQELRKHHFGLRRR
FT                   GGLKPVSPDRYAKFLSGNEIVTDGEGCNALCAIVVEHLRLTNKLSGEAFLREVSRCLAS
FT                   GKVQLTAGLRHEFSLAVLRATPHFGRLDATLSSRIALTTPLHYLTAHAVALESCMSALA
FT                   LTGQWERAIVIMQRTKPPYPESSAALAYVAPRHLALNVVKLLWRGNPQDRWTLVLQDLL
FT                   HGDTRFATDELVISAFRTKFSNGRKDVQWRRRVLGACCALLQSSQSMHDVMQTAKLSTL
FT                   CALDVDEHGLQRLLRVLSWEQALTAIGDLSENNEVIDEHWLLIACMKPHIPFDAVSKGV
FT                   SLFPYSFLLNTVRVYYQAVEEKSLVTAVKAVYRYQMLVMKEYRADATYLRPLVTLLKGL
FT                   LLHYDGERWSDTTVWPLVRRLFNHIVEGFGMTQLGREGRRGVPVALREDKPLHALLIIG
FT                   LLYHHLSRVMQMPIPANITSHLLRSAAYGTNDYNAALYFFKSLKHPNIYERSLLVFALR
FT                   DVDDAMTLLLRAGRFVHDRPEQALLWSDSRRGSDRWLLSIELLSQSPPPRGKLLNLCRG
FT                   WTWAEALRVMELLRRIMGTSPEAKMYAELVRECHLGGAANVVISPIPTNGEGE"
FT                   /protein_id="XP_844256.1"
FT   repeat_region   286077..286112
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(286077..286112)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   gene            complement(<286380..>286988)
FT                   /note="synonym: Tb04.5E12.380; 50S ribosomal protein L13,
FT                   putative"
FT                   /db_xref="GeneID:3656630"
FT                   /locus_tag="Tb927.4.1070"
FT   mRNA            complement(<286380..>286988)
FT                   /db_xref="GI:72387665"
FT                   /db_xref="GeneID:3656630"
FT                   /locus_tag="Tb927.4.1070"
FT                   /transcript_id="XM_839164.1"
FT   CDS_pept        complement(286380..286988)
FT                   /locus_tag="Tb927.4.1070"
FT                   /gene_family="HOG000260456" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L13, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412];
FT                   go_process: ribosome assembly [goid 0042255]"
FT                   /db_xref="GI:72387666"
FT                   /db_xref="GeneID:3656630"
FT                   /translation="MQRSTRIVMAPFKSVLRRHKHHPEGLPLYNDMSKQWLCREGERWW
FT                   LLDARGEQLPRVAAVAAQYITGQHRPDFTPGMITGDHVVIVNIKDVVMVGDQWIRVPIT
FT                   WQTAYPGGKYRIRLTDMYERDPCMLMWWFLKDEVNRHFVRKLKTRIAPLEKAWLYEDSI
FT                   HPHADKNPRPLCWTDPEVKGWKYRDPQFIRRWKPNEFMH"
FT                   /protein_id="XP_844257.1"
FT   repeat_region   complement(287030..287067)
FT                   /rpt_family="tandem"
FT   repeat_region   287034..287067
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(287034..287067)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<288135..>289967)
FT                   /note="synonym: Tb04.5E12.370; V-type ATPase, A subunit,
FT                   putative"
FT                   /db_xref="GeneID:3656635"
FT                   /locus_tag="Tb927.4.1080"
FT   mRNA            complement(<288135..>289967)
FT                   /db_xref="GI:72387667"
FT                   /db_xref="GeneID:3656635"
FT                   /locus_tag="Tb927.4.1080"
FT                   /transcript_id="XM_839165.1"
FT   CDS_pept        complement(288135..289967)
FT                   /locus_tag="Tb927.4.1080"
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="V-type ATPase, A subunit, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="similar to SP:Q26975:  Vacuolar ATP synthase
FT                   catalytic subunit A (EC 3.6.3.14) (V-ATPase Asubunit)
FT                   (Vacuolar proton pump alpha subunit) (V-ATPase 69
FT                   kDasubunit). {Trypanosoma congolense}; go_component:
FT                   lysosomal hydrogen-translocating V-type ATPase complex
FT                   [goid 0046611]; go_function: hydrogen-exporting ATPase
FT                   activity, phosphorylative mechanism [goid 0008553];
FT                   go_process: ATP synthesis coupled proton transport [goid
FT                   0015986]"
FT                   /db_xref="GI:72387668"
FT                   /db_xref="GeneID:3656635"
FT                   /translation="MSSDRNPYKTEQRMGSVKAVSGPVVIAENMGGSAMYELVQVGSFR
FT                   LVGEIIRLEGDTATIQVYEETGGLTVGDPVYCTGKPLSLELGPGIMSEIFDGIQRPLDT
FT                   IYRMVENVFIPRGVQVKSLNDQKQWDFKPCLKVGDLISGGDIIGSVVENSLMYNHSIMV
FT                   PPNIRGRVTSIVASGNYTLEDDIVELEYNGKVKSLKLMHRWPVRTPRPVASKESGNHPL
FT                   LTGQRVLDALFPSVQGGTCAIPGAFGCGKTVISQALSKYSNSDAVIYVGCGERGNEMAE
FT                   VLMDFPTLTTIIDGREESIMKRTCLVANTSNMPVAAREASIYTGITLAEYYRDMGKHIA
FT                   MMADSTSRWAEALREISGRLAEMPADGGYPAYLSARLASFYERAGRVTCIGGPKREGSV
FT                   TIVGAVSPPGGDFSDPVTSATLGIVQVFWGLEKRLAQRKHFPSVNWLISYSKYLKALEP
FT                   FFNSLDPDYMRLRSVAAEILQREEELQEIVQLVGKDSLSESDKIILETAKVIREEFLQQ
FT                   NAFTPYDKYCPPYKTCWMLRNIVTFYEEGQRVVAESAGEHKITWNYIREKIPHVYTGLT
FT                   EMKFRDPQEGEEANVKYYKKQHEEIMTAFASLVQ"
FT                   /protein_id="XP_844258.1"
FT   misc_feature    290235..290303
FT                   /note="GA-rich"
FT   misc_feature    complement(290235..290303)
FT                   /note="CT-rich"
FT   gene            complement(<290687..>292591)
FT                   /note="synonym: Tb04.5E12.360; endosomal integral membrane
FT                   protein, putative"
FT                   /db_xref="GeneID:3656634"
FT                   /locus_tag="Tb927.4.1090"
FT   mRNA            complement(<290687..>292591)
FT                   /db_xref="GI:72387669"
FT                   /db_xref="GeneID:3656634"
FT                   /locus_tag="Tb927.4.1090"
FT                   /transcript_id="XM_839166.1"
FT   CDS_pept        complement(290687..292591)
FT                   /locus_tag="Tb927.4.1090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endosomal integral membrane protein, putative"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72387670"
FT                   /db_xref="GeneID:3656634"
FT                   /translation="MGYKFHFYRLVLVLFVFSVNEASSSFFKITAPIGYKEGDEVPVLV
FT                   NSLTSSKGVVPYDFYKMKACKPAAHVLKEGSGKENLGELLLGNHVLPSLYSVNVLRNVT
FT                   CQPLCIVSYTEGDKKDLDNLITQSYRGHMFLAGLPLVERIEKGTTEKLRLGYRLGVHVK
FT                   GDEKLKEEGAAGDKCLINNHIHFTITYAVLPNGEYMLTGFYAKPKTLNSPTGCPPDGAS
FT                   VDEWPDPASTGATNVAYSYSVTWEQDSSEGVFVTRWDVYWRLGGAQRKKAHLTALFNSM
FT                   LLLGFLGVLVMIVLLRIVRRDLLMQNDMLVSGDVQEESGWKLVRGDVFRAPSRPLVLTG
FT                   LVSSGCQMVAVVVLTVISSTVRKYQPWHSGNLLTNLIIFFCCSSCVSGYVAGKMLVFFQ
FT                   IRTWKNGIAAVTMVPLSLLLGYLAGNMISWSKHGSTAVSLPVLLTLFFLWVAVPVPLSL
FT                   IGLSAGFRASAFVLPTKVGSIPRAISQQSVRRRYMFILGGGIVSFTAAFMEVICVLGSF
FT                   WKGQPFLYVGYLFGVSFIISAVCAEVAVVVTYAMLSEEDYEWWWGSFCTSGSCGVYFFL
FT                   YSVVYLYGALEIRQPLSVILFLVYTFEVSVFIAVFLGTMGFVASAVFVRTIYNSIKAD"
FT                   /protein_id="XP_844259.1"
FT   misc_feature    292633..292659
FT                   /note="AT_rich"
FT   misc_feature    complement(292633..292659)
FT                   /note="AT_rich"
FT   gene            complement(<293016..>293495)
FT                   /note="synonym: Tb04.5E12.350; ribosomal protein L21E
FT                   (60S), putative"
FT                   /db_xref="GeneID:3656633"
FT                   /locus_tag="Tb927.4.1100"
FT   mRNA            complement(<293016..>293495)
FT                   /db_xref="GI:72387671"
FT                   /db_xref="GeneID:3656633"
FT                   /locus_tag="Tb927.4.1100"
FT                   /transcript_id="XM_839167.1"
FT   CDS_pept        complement(293016..293495)
FT                   /locus_tag="Tb927.4.1100"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L21E (60S), putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387672"
FT                   /db_xref="GeneID:3656633"
FT                   /translation="MVHSHGYKCGTRHLFAKKFRKHGVPSVSTILTNFKVGDYVDVVAD
FT                   AAVRAGMPHKYYHGRTGIVWNVTPRGVGVIINKPVRNRTVRKRICVRFEHVRKSRCQEA
FT                   FKQKLKDLEAFRAAKKAGTPLPPKKVSNRNGGFVCPKKVEVLARRTADYEAMIPY"
FT                   /protein_id="XP_844260.1"
FT   gene            complement(<294225..>295604)
FT                   /note="synonym: Tb04.5E12.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656632"
FT                   /locus_tag="Tb927.4.1110"
FT   mRNA            complement(<294225..>295604)
FT                   /db_xref="GI:72387673"
FT                   /db_xref="GeneID:3656632"
FT                   /locus_tag="Tb927.4.1110"
FT                   /transcript_id="XM_839168.1"
FT   CDS_pept        complement(294225..295604)
FT                   /locus_tag="Tb927.4.1110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387674"
FT                   /db_xref="GeneID:3656632"
FT                   /translation="MLDALPLLLVFAAVSLCGGSALRVGLVSDPHYDPGYGTSKAYDSC
FT                   HKPAPKYGRMGCDAPKALITSFQQDMEAQAPHVVIVNGDAQRHKFSKSGFSINDTFGFI
FT                   VRAAVKTVQSGETGEFGLGVAVSLGNNDMVPNYHFDAFKQESFTLKQEEILVENGLLAE
FT                   GQRKSFRECGYYQRVVSPRLRIIVLNTVLWCFCNKVPIPDTVVDPCHQMKFLESSLEDA
FT                   KKENAKVIIISHVPPYIDVWGVLSRGAFGSVEKDMYWKPSFQERYHALVAKHASVVVSQ
FT                   IFGHIHHFLYQVAGPDIMSFTIPSLTPLYGNVPSYFIAELDDVTMKLKSLRHHYLDKTT
FT                   WRRAPDVESTVGNLSSTEALTAFATKFRVNSFLWRRWIRLRSGGGKASGKLFPKGTCNT
FT                   WCRNLISCTMTRVKWEDIKSCTEGSRGGKADSATEKLPAVAAMPLFAYYSLFLLACSSA
FT                   S"
FT                   /protein_id="XP_844261.1"
FT   gene            complement(<296344..>297870)
FT                   /note="synonym: Tb04.5E12.320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656638"
FT                   /locus_tag="Tb927.4.1120"
FT   mRNA            complement(<296344..>297870)
FT                   /db_xref="GI:72387675"
FT                   /db_xref="GeneID:3656638"
FT                   /locus_tag="Tb927.4.1120"
FT                   /transcript_id="XM_839169.1"
FT   CDS_pept        complement(296344..297870)
FT                   /locus_tag="Tb927.4.1120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387676"
FT                   /db_xref="GeneID:3656638"
FT                   /translation="MERCCTLFVIFLSVCALTIAPDLLHQLVLRASATSVLGRDTLPKL
FT                   TVSLLGDFNYDILYGRPGGYGPCNQGQASLVTPGCESPLKLVQSVMDDVAKWEGTFTLF
FT                   SGGLMRHSMETVTPAEMEYTMKEVIGVIASASGVNGTQDAASQPTVLALGGNDLSPANS
FT                   FSPISAQPQYVQLLRLMLSEGLLTREEHSHMSYCGFYYRDVAGTKIRVIVLNTLLWSNS
FT                   LRPPLSVGDVDPCGQFPFLQASIEWAKQRDRSVIILGNEPPILNVEEAVRMKSVGDATY
FT                   YWRNDFREAYLRIIGSNRFTVAAQFFHTGTLGFVASSKLGPPMYIIPSVSPVAGSNPSY
FT                   IRATLDSNTGRVVSLQQRYLVENGSWVYGDKLEDILHVSLRGMNEYSVEDYLTIAQSEA
FT                   HWEPFSRMRAGGRYLTEKEHCGFWCRHLIICASVYYEKTDIDYCTTSVLPSRSLGVWLS
FT                   IISACSGGLALVAALTYGFGSRRIIFSPPPGAEREVTQRLFSTRAQKVYN"
FT                   /protein_id="XP_844262.1"
FT   gene            complement(<298829..>299326)
FT                   /note="synonym: Tb04.5E12.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656636"
FT                   /locus_tag="Tb927.4.1130"
FT   mRNA            complement(<298829..>299326)
FT                   /db_xref="GI:72387677"
FT                   /db_xref="GeneID:3656636"
FT                   /locus_tag="Tb927.4.1130"
FT                   /transcript_id="XM_839170.1"
FT   CDS_pept        complement(298829..299326)
FT                   /locus_tag="Tb927.4.1130"
FT                   /gene_family="HOG000260450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387678"
FT                   /db_xref="GeneID:3656636"
FT                   /translation="MYSKTPCVLGMPYEAAGAVLCNNPYRSQALSWYRKFLKAAFTVPW
FT                   ETDDDALYVMEESRRLFRQNARLTDVEMIQRKLREAEMRYELGVHYRIPYPRPVHKMQG
FT                   SLQESGVPYAADLDSMYDHPVNPRTGRISEGSANYGVMGGVDNSNELLEGEMGADAEDF
FT                   SK"
FT                   /protein_id="XP_844263.1"
FT   repeat_region   300024..300060
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(300024..300060)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(300028..300060)
FT                   /rpt_family="tandem"
FT   gene            complement(<300197..>301942)
FT                   /note="synonym: Tb04.5E12.290; phosphatidylinositol
FT                   4-kinase, putative"
FT                   /db_xref="GeneID:3656639"
FT                   /locus_tag="Tb927.4.1140"
FT   mRNA            complement(<300197..>301942)
FT                   /db_xref="GI:72387679"
FT                   /db_xref="GeneID:3656639"
FT                   /locus_tag="Tb927.4.1140"
FT                   /transcript_id="XM_839171.1"
FT   CDS_pept        complement(300197..301942)
FT                   /locus_tag="Tb927.4.1140"
FT                   /gene_family="HOG000260449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylinositol 4-kinase, putative"
FT                   /EC_number="2.7.1.67"
FT                   /note="similar to Phosphatidylinositol 4-kinase (EC
FT                   2.7.1.67) (PI4-kinase) (PtdIns-4-kinase) (PI4K-alpha)
FT                   (Swiss-Prot:P54677) [Dictyostelium discoideum];
FT                   go_function: phosphotransferase activity, alcohol group as
FT                   acceptor [goid 0016773]; go_process: cytokinesis [goid
FT                   0000910]"
FT                   /db_xref="GI:72387680"
FT                   /db_xref="GeneID:3656639"
FT                   /translation="MSNALFCLHRLLEVLLYLPRGSQDEQMALVQNLHEFPLATIERVF
FT                   LQISHACITHKGPEVSNRLRRFMHWLAGRSFTLALRLSWTVDSVRDVFSAVGLGGRVKE
FT                   VHDKIESFAINRKGVADRTNNTDGVEEEIRRKELRLKLFNDERAFLNLITNLSKHLISF
FT                   TKRDRRQHELKKELDEINKSLRSQSLICPLGCNDDPVKWIVNIVVEDSVVFFSRERAPF
FT                   LLRCEVIVDSTATVNDPTTSKLRLPNGKFKISAESDELMEEQSLDRRGEDVGGEVTAIK
FT                   SASPDMKLFRKVFGELPEERAARLREKSFFGRHPNWGTATFVVKGGDNLRQEELALQLV
FT                   DLFNNIWKNAGLTCSLVPYRALAVGVDSGIIECVEGACSIDGIKKSCQMAYLPQFFNEA
FT                   FGGKGSQRYREAQRNFVETMAGYSIFTYILQVKDRHNGNILIRADGRLVHIDFGFMLVT
FT                   SPGGVNFESAPFKLSQELLEVMGGVGSSPFNYFKLLFFLGMRAIREKADDIVALVSLMT
FT                   PYNTLPCFGASPEVAIQQLRSRFRLDLEDEGDFALYIKELIVGSVDNWRTRRYDQFQTL
FT                   QNGIL"
FT                   /protein_id="XP_844264.1"
FT   gene            complement(<302414..>304639)
FT                   /note="synonym: Tb04.5E12.280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656637"
FT                   /locus_tag="Tb927.4.1150"
FT   mRNA            complement(<302414..>304639)
FT                   /db_xref="GI:72387681"
FT                   /db_xref="GeneID:3656637"
FT                   /locus_tag="Tb927.4.1150"
FT                   /transcript_id="XM_839172.1"
FT   CDS_pept        complement(302414..304639)
FT                   /locus_tag="Tb927.4.1150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387682"
FT                   /db_xref="GeneID:3656637"
FT                   /translation="MTCRSEETNWGLLFDIALSHGESLRRQRLTYVGFMTLLRSAGVVG
FT                   PVTGIYQVLLGALWQHHGLQRSCNEGGKGGETKNALDLTMDIDGFITIMNVVCIRCYQA
FT                   QRFSEMLEDDHPISEAVTLCAEEQGKIHSSVTYTMRRFFKPFISRSIVLKRMVVSLDSR
FT                   KNSWTPYANRLITHILAASADSIVFPLFDRYAECGRIYRPSFEGMVDDIFPHFSPSQRN
FT                   AALSVFTYDGFTGIHKLMKYVHPDVDKETRAALELHSFAEALLMLAIVAFSNESQHKHH
FT                   RPFTAKVWAAFEDYYCKFLGVPMVSDPIKDNKFASITPSANLVFPAEVPLNKLSSFLIS
FT                   GWNLTVDDWPCDTPDPGKGYPPRILKFPEDGFDDIPLMDKQESAAKAPTSTTGMAAKLF
FT                   EEELIRPTPAEYSLPIYGVQRCTVYVDEQRANAFQRAPNIVEVVIPKSMWNISIDGTKV
FT                   EFVTYGDEGKLLLRPNKDVTISIRDVKGSTTFETKSVPLLESPFEQVILPPQMEVLRTA
FT                   FSHHAANDLLPVERFDDACAELCIITSGTKDHCFLFAKSKLEGSEERIPLKGAETLESA
FT                   QGISFSEFVSALATVLLRRHEARNTLPDIPYLLAVGSSRMKKSLPPLAEWKGENSGNPA
FT                   QWLPLKLTQPHNARIDVPYDNALRKKSSFLRRYSGTEGLLKSLGKDHHMLRPLPAFPVE
FT                   VKTVDVVSQYDDDEKGLFDKVAKTSSSLQESFLKEEMVVSRKGWTLE"
FT                   /protein_id="XP_844265.1"
FT   gene            complement(<306804..>309530)
FT                   /note="synonym: Tb04.5E12.260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656631"
FT                   /locus_tag="Tb927.4.1160"
FT   mRNA            complement(<306804..>309530)
FT                   /db_xref="GI:72387683"
FT                   /db_xref="GeneID:3656631"
FT                   /locus_tag="Tb927.4.1160"
FT                   /transcript_id="XM_839173.1"
FT   CDS_pept        complement(306804..309530)
FT                   /locus_tag="Tb927.4.1160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387684"
FT                   /db_xref="GeneID:3656631"
FT                   /translation="MRHLHTAKILLLTVVSCVAGWCSTCIAHANTGKVGEARTLKAVRR
FT                   SNRAPRFPVEGDGGLHRTDTQLKTGAQGRQEADENNVGRGSQVMRAKNHNEEERDAAHT
FT                   TNGSARVKPPDDKETEAQQPDDNESEPQQPDDKETEAQQPDDKETEAQQPDDNESEPQQ
FT                   PDDNETEAQQPDDKETEAQQPDDNESEPQQPDDKETEAQQPDDKETEAQQPDDNESEPQ
FT                   QPDDNETEAQQPDDKETEAQQPDDKETEAQQPDDKETEAQQPDDNETEAQQPDDNETEA
FT                   QQPDDKETEPQQPDDKETEAQQPDDKETEAQQPDDNETEAQQPDDNETEAQQPDDNETE
FT                   AQQPDDKETEPQQPDDNETEAQQPDDNETEAQQPDDKETEAQQPDDKETEAQQPDDKET
FT                   EAQQPDDKETEPQQPDDNETEAQQPDDKETEAQQPDDKETEAQQPDDKETEAQQPDDKE
FT                   TEPQQPDDKETEAQQPDDKETEAQQPDDKETEAQQPDDKETEPQQPDDNETEAQQPDDK
FT                   ETEAQQPDDNEAEPQQPDDKETEPQQPDDNETEPQQPDDNEAEPQQPDDNEAEPQQPDD
FT                   DETELQKRYERDGKVSLEETREDGTDFVVLLKQLADDASALASLIGDDVYNMRGRCVVQ
FT                   NQLVPECREGVMKLRQVVAKIVDTVGLTDEAVQGGRDKSDFSVGGCRCTASDNTTVGDS
FT                   HGNTPAPGQSQTLDANPFAGGDVGTYGGETSSINMSTLFFTVISIVAVSASGFLQQCWK
FT                   QRRHFKTERVSANEVQFQCAGRVSTNLQHHGDQAAEVHPIKGGPQSGPAELFPGAAAGV
FT                   SAPLPPVVNLAPVPTSAVKQLSMGPSKTSLAHPKPPTAASAGYPAAPLNFTQRHQAGSP
FT                   QPTRHVWGGDIPPVVEGKRDSSDDPDVLVNPFLKKWS"
FT                   /protein_id="XP_844266.1"
FT   repeat_region   complement(307791..309188)
FT                   /rpt_family="tandem"
FT   repeat_region   complement(308977..309025)
FT                   /rpt_family="tandem"
FT   gene            complement(<309801..>310820)
FT                   /note="synonym: Tb04.5E12.250; ankyrin, putative"
FT                   /db_xref="GeneID:3656640"
FT                   /locus_tag="Tb927.4.1170"
FT   mRNA            complement(<309801..>310820)
FT                   /db_xref="GI:72387685"
FT                   /db_xref="GeneID:3656640"
FT                   /locus_tag="Tb927.4.1170"
FT                   /transcript_id="XM_839174.1"
FT   CDS_pept        complement(309801..310820)
FT                   /locus_tag="Tb927.4.1170"
FT                   /gene_family="HOG000260446" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ankyrin, putative"
FT                   /db_xref="GI:72387686"
FT                   /db_xref="GeneID:3656640"
FT                   /translation="MEAAFDAIDRQDHGTLRRTLSCGNVNTTNSDGYTPLYYACMKKGV
FT                   GVSTVKEILQLGAQTDLKGSDLETPLYIACFNGKRDVAQLLLERGANPNVVNGGGGETV
FT                   LHLASRIGDAALIEIILAKGGDINARNSRKETPLFVAAKAGFHEVVYRLLRADAKTEVC
FT                   DIDGKSPLYIASERNMKHVVILLKSEAKDLNIAKAAADDILRSIPAPLKTTEEIRDEAA
FT                   LEGSGVWKIKHEVMAKEVKKEMKPLDIIEIVVPHPRGDVRDLLGGAGSRGPCLSLEEVG
FT                   YDAPPVVPPSLRNLPPVKPQRIGGTMMRIGTSIDTMGVEPVRIDTVPGDTMEFSLRRD"
FT                   /protein_id="XP_844267.1"
FT   gene            complement(<311027..>312034)
FT                   /note="synonym: Tb04.5E12.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656643"
FT                   /locus_tag="Tb927.4.1180"
FT   mRNA            complement(<311027..>312034)
FT                   /db_xref="GI:72387687"
FT                   /db_xref="GeneID:3656643"
FT                   /locus_tag="Tb927.4.1180"
FT                   /transcript_id="XM_839175.1"
FT   CDS_pept        complement(311027..312034)
FT                   /locus_tag="Tb927.4.1180"
FT                   /gene_family="HOG000260445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387688"
FT                   /db_xref="GeneID:3656643"
FT                   /translation="MAKKEVVWLGTPTEADGSELSSPFTSRIGGSAVLFREAPTYSIFN
FT                   CPKCRSSRWVSLLTQIYAPLDVYDRIVYVLICSSCSEGKGSFCFAVRSQNFNPSYVQSS
FT                   PAPVVGGGEDEGITFVEDGDWGDDDPKYVDEGPNEVCITNLTCTTMADECKVGSPTQST
FT                   DVSSVLVPHGTKVPVEGFCYPCFVLNIFEEPPKPKLCYGTVPDQLLKAQQTYGEDAVET
FT                   TVVEDEDEPLAEKLLRKYVDRIGRVPSQCVRWGPGQKPLRSSPAPIVIPRCPRCSNERR
FT                   YELQLTSPIIYFLTKGKEEKDHSLHFGSVLVYTCGGNCNVQPYSLEHCVVEDEV"
FT                   /protein_id="XP_844268.1"
FT   gene            complement(<312215..>312826)
FT                   /note="synonym: Tb04.5E12.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656642"
FT                   /locus_tag="Tb927.4.1190"
FT   mRNA            complement(<312215..>312826)
FT                   /db_xref="GI:72387689"
FT                   /db_xref="GeneID:3656642"
FT                   /locus_tag="Tb927.4.1190"
FT                   /transcript_id="XM_839176.1"
FT   CDS_pept        complement(312215..312826)
FT                   /locus_tag="Tb927.4.1190"
FT                   /gene_family="HOG000260444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387690"
FT                   /db_xref="GeneID:3656642"
FT                   /translation="MVDVHRKEGGGIGVSWVRAIVFVLLVYVISVTVDFCYNVYYDREA
FT                   AFQNVLNCSLQVFRSNSVDCWLQNGTLLGSARLGRLLLWDADLDIGFVQANHTEKLQLL
FT                   MNELDSKCFGARSDRRRGVRNPLLVFRKCTERICAEFHETSISNGIVTTGDGASPQREL
FT                   FPLRTCTIGDVVAQCPYNSSYYLREAYGSGWLTASLLEFF"
FT                   /protein_id="XP_844269.1"
FT   repeat_region   314060..314088
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(314060..314088)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(317914..317985)
FT                   /db_xref="GeneID:3656641"
FT                   /locus_tag="Tb927.4.1195"
FT   tRNA            complement(317914..317985)
FT                   /db_xref="GeneID:3656641"
FT                   /locus_tag="Tb927.4.1195"
FT                   /product="tRNA-Pro"
FT   repeat_region   318066..318273
FT                   /transposon="RIME-A"
FT   gene            <319468..>320463
FT                   /note="synonym: Tb04.5E12.120; expression site-associated
FT                   gene (ESAG) protein, putative"
FT                   /db_xref="GeneID:3656645"
FT                   /locus_tag="Tb927.4.1200"
FT   mRNA            <319468..>320463
FT                   /db_xref="GI:72387691"
FT                   /db_xref="GeneID:3656645"
FT                   /locus_tag="Tb927.4.1200"
FT                   /transcript_id="XM_839177.1"
FT   CDS_pept        319468..320463
FT                   /locus_tag="Tb927.4.1200"
FT                   /gene_family="HOG000130838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene (ESAG) protein,
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72387692"
FT                   /db_xref="GeneID:3656645"
FT                   /translation="MKVKIIEWLVFLSFVIYTEGAEDEGRCRLVDDHSFKNLHESVCYL
FT                   SCLSDALNKLYTNGERKLLVNEEVYANASRILDDMEGRAGESVKYLSVISDAMGGKHDK
FT                   LEKLISYGNTMGDLVAKVGGLFADVNESVRVVRELLPTALMEANRYYTASAEITRTVWD
FT                   DVKAVEGSDEEAAKCKGENIGVTEFPTTCGNHTCPLRDNVSDDTLQKYKDGCLEINVLK
FT                   TPGYVSECLNRPRNKLYMDGAVNNLSDTIKWRGESRDGAIFFQLTVQVQNVFGPLIGPF
FT                   SAGQPPPVLLEVMSNITSLHSHFNKVHNNFTSLLFDIDVAGNVTTANSSI"
FT                   /protein_id="XP_844270.1"
FT   repeat_region   322437..322626
FT                   /transposon="RIME-A"
FT   gene            complement(<323947..>324501)
FT                   /note="synonym: Tb04.5E12.90; hypothetical protein"
FT                   /db_xref="GeneID:3656644"
FT                   /locus_tag="Tb927.4.1210"
FT   mRNA            complement(<323947..>324501)
FT                   /db_xref="GI:72387693"
FT                   /db_xref="GeneID:3656644"
FT                   /locus_tag="Tb927.4.1210"
FT                   /transcript_id="XM_839178.1"
FT   CDS_pept        complement(323947..324501)
FT                   /locus_tag="Tb927.4.1210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387694"
FT                   /db_xref="GeneID:3656644"
FT                   /translation="MREPPYDVETTSMSWKLENAKSNCRLLFRTLHVEGVQRNRLAVRN
FT                   VIRKTKMVSPKTLRRWEKGRITLTPHGRSMGHAKNNLLCRFREGETPNKKVDFNILQHF
FT                   CHKRHQPPHRRATGATAASTDRTTSGSLLGETGPGRQWTLSKHLENVPRYRTPQFKEFH
FT                   LRCQSLHHPASLRSPLFTLTS"
FT                   /protein_id="XP_844271.1"
FT   gene            325767..325860
FT                   /db_xref="GeneID:4443144"
FT                   /locus_tag="Tb927.4.1213"
FT   snRNA           325767..325860
FT                   /db_xref="GeneID:4443144"
FT                   /locus_tag="Tb927.4.1213"
FT                   /product="snRNA U6"
FT   gene            325958..326029
FT                   /db_xref="GeneID:3656646"
FT                   /locus_tag="Tb927.4.1216"
FT   tRNA            325958..326029
FT                   /db_xref="GeneID:3656646"
FT                   /locus_tag="Tb927.4.1216"
FT                   /product="tRNA-Thr"
FT   gene            complement(326098..326181)
FT                   /db_xref="GeneID:3656647"
FT                   /locus_tag="Tb927.4.1219"
FT   tRNA            complement(326098..326181)
FT                   /db_xref="GeneID:3656647"
FT                   /locus_tag="Tb927.4.1219"
FT                   /product="tRNA-Tyr"
FT   repeat_region   328022..328052
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(328022..328052)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<328133..>328915)
FT                   /note="synonym: Tb04.5E12.40; leucine-rich repeat protein
FT                   (LRRP), putative"
FT                   /db_xref="GeneID:3656649"
FT                   /locus_tag="Tb927.4.1220"
FT   mRNA            complement(<328133..>328915)
FT                   /db_xref="GI:72387695"
FT                   /db_xref="GeneID:3656649"
FT                   /locus_tag="Tb927.4.1220"
FT                   /transcript_id="XM_839179.1"
FT   CDS_pept        complement(328133..328915)
FT                   /locus_tag="Tb927.4.1220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="leucine-rich repeat protein (LRRP), putative"
FT                   /db_xref="GI:72387696"
FT                   /db_xref="GeneID:3656649"
FT                   /translation="MVVPVMNMTREPAVDSPENSRKISLAGYPEVAGLFCVTVFKSTLD
FT                   LEVRDCCGLLTLDGVGKCVELKKFSISNCGMLTNISDLKDCVNLEMLTLSGCKTLRNLT
FT                   PLKGHRTLSCITISHCERMMELDLEGATNLMQLNISDCEELKDVHVSRCTRLEVIDIHD
FT                   CVKLEKLHGLTYLRELKTLILAGNRELSAVEGINELINRVEKLSLKNCEKLEDLKFLDF
FT                   CNFLKEVVVAGSNVTEEKKQELRGKGVRIVNEVKVADG"
FT                   /protein_id="XP_844272.1"
FT   repeat_region   329222..329251
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(329222..329251)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<329308..>330096)
FT                   /note="synonym: Tb04.5E12.30; hypothetical protein"
FT                   /db_xref="GeneID:3656652"
FT                   /locus_tag="Tb927.4.1230"
FT   mRNA            complement(<329308..>330096)
FT                   /db_xref="GI:72387697"
FT                   /db_xref="GeneID:3656652"
FT                   /locus_tag="Tb927.4.1230"
FT                   /transcript_id="XM_839180.1"
FT   CDS_pept        complement(329308..330096)
FT                   /locus_tag="Tb927.4.1230"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387698"
FT                   /db_xref="GeneID:3656652"
FT                   /translation="MEEGGRYAACKAELYKLQEKIKTQETPRDNCAEKEKMWEKQRSEL
FT                   EQEKDECLRTSDAHRTQKQDLEDRVRYMDGLTRAMISEKRFAEERRNISEKENEDLKTR
FT                   VRVLTHKLGVLTAMVQKLHISHMIKDMGIAMLQAEAKQAAEEMETNHKKDVAAAEERVL
FT                   QECKEKFCFDSSGNLNAAVFIEHNISKENRSFLLEQLNCSKENQGDTKREWRFWRKGAN
FT                   DSSRPKKSADHSESNGSSHGNNIHLVLRVCLSLLLLTALS"
FT                   /protein_id="XP_844273.1"
FT   repeat_region   330967..330990
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tcc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(330967..330990)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gga"
FT                   /rpt_type="tandem"
FT   gene            complement(<331064..>331417)
FT                   /note="synonym: Tb04.5E12.23"
FT                   /db_xref="GeneID:4443145"
FT                   /locus_tag="Tb927.4.1240c"
FT   mRNA            complement(<331064..>331417)
FT                   /db_xref="GI:72387699"
FT                   /db_xref="GeneID:4443145"
FT                   /locus_tag="Tb927.4.1240c"
FT                   /transcript_id="XM_839181.1"
FT   CDS_pept        complement(331064..331417)
FT                   /locus_tag="Tb927.4.1240c"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387700"
FT                   /db_xref="GeneID:4443145"
FT                   /translation="MSVRSDTFLGGRGSRVPSTGFNSQCAKTHAYQRGADGGFMGRKIY
FT                   CQPVPLYCCSLLFMQWYPVTLMDASFLVTAITKQKKLEKIGLHSDHHHDFSHMAHMRLI
FT                   FPRHVIFPVNELN"
FT                   /protein_id="XP_844274.1"
FT   gene            complement(<331064..>331120)
FT                   /note="synonyms: Tb04.5E12.23, Tb04.2L9.345; hypothetical
FT                   protein"
FT                   /db_xref="GeneID:3656648"
FT                   /locus_tag="Tb927.4.1240"
FT   mRNA            complement(<331064..>331120)
FT                   /db_xref="GI:71905124"
FT                   /db_xref="GeneID:3656648"
FT                   /locus_tag="Tb927.4.1240"
FT                   /transcript_id="XM_824940.1"
FT   CDS_pept        complement(331064..>331120)
FT                   /locus_tag="Tb927.4.1240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="Should be merged with annotated gene Tb04.2L9.345 on
FT                   overlapping BAC to construct the complete gene."
FT                   /db_xref="GI:71905125"
FT                   /db_xref="GeneID:3656648"
FT                   /translation="HMRLIFPRHVIFPVNELN"
FT                   /protein_id="XP_830033.1"
FT   misc_feature    331121..453009
FT                   /note="sequence corresponds to BAC RPCI93-2L9"
FT   gene            complement(<331121..>331417)
FT                   /note="synonyms: Tb04.2L9.345, Tb04.5E12.23; hypothetical
FT                   protein"
FT                   /db_xref="GeneID:3656650"
FT                   /locus_tag="Tb927.4.1240b"
FT   mRNA            complement(<331121..>331417)
FT                   /db_xref="GI:71753148"
FT                   /db_xref="GeneID:3656650"
FT                   /locus_tag="Tb927.4.1240b"
FT                   /transcript_id="XM_820929.1"
FT   CDS_pept        complement(<331121..331417)
FT                   /locus_tag="Tb927.4.1240b"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="Should be merged with annotated gene Tb04.5E12.23 on
FT                   overlapping BAC to construct the complete gene."
FT                   /db_xref="GI:71753149"
FT                   /db_xref="GeneID:3656650"
FT                   /translation="MSVRSDTFLGGRGSRVPSTGFNSQCAKTHAYQRGADGGFMGRKIY
FT                   CQPVPLYCCSLLFMQWYPVTLMDASFLVTAITKQKKLEKIGLHSDHHHDFSHMA"
FT                   /protein_id="XP_826022.1"
FT   gene            complement(<331823..>334558)
FT                   /note="synonym: Tb04.2L9.350; peroxisome biogenesis factor
FT                   1, putative"
FT                   /db_xref="GeneID:3656651"
FT                   /locus_tag="Tb927.4.1250"
FT   mRNA            complement(<331823..>334558)
FT                   /db_xref="GI:72387701"
FT                   /db_xref="GeneID:3656651"
FT                   /locus_tag="Tb927.4.1250"
FT                   /transcript_id="XM_839182.1"
FT   CDS_pept        complement(331823..334558)
FT                   /locus_tag="Tb927.4.1250"
FT                   /gene_family="HOG000260442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peroxisome biogenesis factor 1, putative"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ATP binding [goid 0005524]; go_process: peroxisome membrane
FT                   protein import [goid 0045046]"
FT                   /db_xref="GI:72387702"
FT                   /db_xref="GeneID:3656651"
FT                   /translation="MQHSSFEVSIDPSRTDSFVLVSNEFIRGNLLPYYGRNIPFVVPLR
FT                   ISDGHKNTYVGCLAHRPHNFAAFKLIISVTMATSLGVTNGAIVQCTAVFKFAKAATVLV
FT                   RPSSVDESEVVEQNALRIEAQLLRQVQVVFPAMTLDVAVFDGVNAKMVVERIEDREGHE
FT                   VTSGCAVMAEGTEFVVATRTRHVEQSGAPTWSVLRCLTWRKEKGFNNEATAGDANVEAV
FT                   SLYMNPSTAARHHWSEGLVMGFWDLAKASQLLESKEVTSSFLRSNALKAPIRLVEGMED
FT                   GVCTSPAFIQASNIVVFPTLDENIPTATDRDCPSASTSPFSNQIPYESVVEVHGTAPQE
FT                   LREHLVCWFEEIKKLGPHHSKYGSNGNVLLCGGSGTGKTAIVGAVLNELHGVHINVVQC
FT                   KAEKLLASLQRALVECVMCAPAVLVLDNFDAVAPAQKEESVLSVTGATKAILEGTLRCF
FT                   TEALSLCGAASVLVVATCANRQCVNEGLRSAYCFTKVIKVEALDRKTRVALLKQLFPKE
FT                   SAEALEEVGDLMGNYTPFDMRKVSQPIKSSLDGGRVPFREAARGAIAAFTPLSHTGITF
FT                   LKSEKASLQSVGGLAEARKVLYDTLVLPMKHPELFARLPLKTRSGVLLYGASGCGKTFV
FT                   VEAIVNSENLNCIVVNGPEVFGKYIGQSEQKIRDVFERAQAAAPCVVFFDEFDSVAPQR
FT                   GVDNSGVTDRVVNQLLCYLDGVESRKDVYVVAASSRPDLIDAALLRPGRLDKAVHCPIP
FT                   SLEDRVNILTICFEQLQAELTLPEIKEIAEQTINWTPADLNGLASSASMVVNRRIIEKL
FT                   SKRCEEREVEHNFAVLNVGKGTTREKIEDILRPSAAAAAREEALNVANRITIKDVRQAM
FT                   GMTKPSLTKEHIWEQERIHRLFSKQEKSSTREVGRKLTQR"
FT                   /protein_id="XP_844275.1"
FT   gene            complement(<335012..>336016)
FT                   /note="synonym: Tb04.2L9.370; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656654"
FT                   /locus_tag="Tb927.4.1260"
FT   mRNA            complement(<335012..>336016)
FT                   /db_xref="GI:72387703"
FT                   /db_xref="GeneID:3656654"
FT                   /locus_tag="Tb927.4.1260"
FT                   /transcript_id="XM_839183.1"
FT   CDS_pept        complement(335012..336016)
FT                   /locus_tag="Tb927.4.1260"
FT                   /gene_family="HOG000260441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387704"
FT                   /db_xref="GeneID:3656654"
FT                   /translation="MKFVWLDTKPQRYICANRSTYRDIWPRLASMRVPAAYSLTRWVAR
FT                   KGGAFHCALRLHPHRNRGCCLVAQRPIKSGAALISVPVSLSISAFTQGSDDERNIAARW
FT                   GPLEELAGTLTRELHNPSSFHRLYLEFLHDVYNSDATDQFAVNEPLQNELDAMYMGNAL
FT                   HVKGVPNAPFISKSKLVTASQRADWIRIDYLRRRMEQSLPHFASKSTSWGLSMALARAL
FT                   RDDDGGLTMYPLIDFSLHDYEPNAMIHLTHPECHSEGSIGGRWYDKTQPCAHLVARQTI
FT                   PAGSAVTIAYSTRAAASQEDAEYWKMKWGFVPDREGRARTVETDGERRVPTGI"
FT                   /protein_id="XP_844276.1"
FT   misc_feature    336454..336561
FT                   /note="CT-rich"
FT   gene            complement(<336560..>337939)
FT                   /note="synonym: Tb04.2L9.390; RuvB-like DNA helicase,
FT                   putative"
FT                   /db_xref="GeneID:3656653"
FT                   /locus_tag="Tb927.4.1270"
FT   mRNA            complement(<336560..>337939)
FT                   /db_xref="GI:72387705"
FT                   /db_xref="GeneID:3656653"
FT                   /locus_tag="Tb927.4.1270"
FT                   /transcript_id="XM_839184.1"
FT   CDS_pept        complement(336560..337939)
FT                   /locus_tag="Tb927.4.1270"
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RuvB-like DNA helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   ATPase activity [goid 0016887]; go_function: ATP-dependent
FT                   5' to 3' DNA helicase activity [goid 0043141]"
FT                   /db_xref="GI:72387706"
FT                   /db_xref="GeneID:3656653"
FT                   /translation="MSGIKIEEVISTTKKERVAAHSHVKGLGLDADGVAKPTADGFVGQ
FT                   VKAREAAGIVVELTRTKKMAGRALLFAGPPGTGKTALALGVAKELGPKVPFCPMVGSEV
FT                   YSAEVKKTEVLMENFRRAIGLRIKEQKEVYEGEVTELRAEETDNPLGGYGKSISHVIVT
FT                   LKSVKGSKQLKLDAAIYESLEKEKVAVGDVIYIESSTGAVKRVGRSDAYIGDHDLEADE
FT                   YVPLPKGDVHKKKEIIQDVTLHDLDAANAKPNQGQDALSIVNSLMKQKKTEITEKLRHE
FT                   INKVVNKYIDQGVAELVPGVLFIDEVHMLDIECFTFLNKALESTLAPVVIFATNRGSCR
FT                   IRGTDVRSPHGIPTDLLDRLLIVRTSNYSIEEVVAIVDIRARVEGVSVSDAALELLGQI
FT                   GDRTSLRYVAQLLTPALIIAETNGRSTIEVEDVTLVDGLFKDAKASAQMLHENAEDYVY
FT                   Q"
FT                   /protein_id="XP_844277.1"
FT   gene            complement(<338347..>339543)
FT                   /note="synonym: Tb04.2L9.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656655"
FT                   /locus_tag="Tb927.4.1280"
FT   mRNA            complement(<338347..>339543)
FT                   /db_xref="GI:72387707"
FT                   /db_xref="GeneID:3656655"
FT                   /locus_tag="Tb927.4.1280"
FT                   /transcript_id="XM_839185.1"
FT   CDS_pept        complement(338347..339543)
FT                   /locus_tag="Tb927.4.1280"
FT                   /gene_family="HOG000260440" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387708"
FT                   /db_xref="GeneID:3656655"
FT                   /translation="MRRFMSLGRCVTMVERVGTGDHRGAAAIRRCKIPPTHVSNGQLEE
FT                   LHKSGMEFFEKGDFRKAISAWEAVLTANDGGGGGNSTTLMNCLNNLACAYGETGDHARK
FT                   LKLLERSRDMVAHVYGDDHPQYGMVLYNMASAQEEMGQYQEMEDLLQRSLALHERKFNA
FT                   DHPKVGRVLLLLAEAHGYLGKHEAQLQVAERADKIIRRHCGANHIQTTVAMLTLARAHG
FT                   ANGNSFQRLQLAQQAYDIQETRLGGMNPQLAVTLVELASACGANGDHFRRKELLEKAID
FT                   VQKRAFGSQHTFLVKTYTALGDTYGDLGEKENQAASYCEALEIARQRYEGNHITLGTAA
FT                   AKCALGCARVGNMKKARALVKEARAIIEATASETHPAAAQLRHIQKEVEETSRAKDGW"
FT                   /protein_id="XP_844278.1"
FT   misc_feature    339860..339888
FT                   /note="AT_rich"
FT   gene            complement(<339925..>340539)
FT                   /note="synonym: Tb04.2L9.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656656"
FT                   /locus_tag="Tb927.4.1290"
FT   mRNA            complement(<339925..>340539)
FT                   /db_xref="GI:72387709"
FT                   /db_xref="GeneID:3656656"
FT                   /locus_tag="Tb927.4.1290"
FT                   /transcript_id="XM_839186.1"
FT   CDS_pept        complement(339925..340539)
FT                   /locus_tag="Tb927.4.1290"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387710"
FT                   /db_xref="GeneID:3656656"
FT                   /translation="MSTTPYDDVTEVSRRCAALREALSRADDDVITTPNKKYLYLCKVS
FT                   GERPNATFQAFTEDMTKVSLDLHKSYLSQRALLPVLLTLPLCTWLERINLREERLTTTL
FT                   IHLLCEALCRLPRIKVIDVSGNPFGSFGVDALLKLVKCNQRIVDCRMDGVQCVGSLRRR
FT                   LADACERNAKVAHTFVDREEMPSECCTTSLDTTAAESDEVK"
FT                   /protein_id="XP_844279.1"
FT   gene            complement(<341652..>342776)
FT                   /note="synonym: Tb04.2L9.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656660"
FT                   /locus_tag="Tb927.4.1300"
FT   mRNA            complement(<341652..>342776)
FT                   /db_xref="GI:72387711"
FT                   /db_xref="GeneID:3656660"
FT                   /locus_tag="Tb927.4.1300"
FT                   /transcript_id="XM_839187.1"
FT   CDS_pept        complement(341652..342776)
FT                   /locus_tag="Tb927.4.1300"
FT                   /gene_family="HOG000260438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387712"
FT                   /db_xref="GeneID:3656660"
FT                   /translation="MSTALFVQATFFNTDNKSTDNKLMTTAAVSHNQSSQDNIMVVNLQ
FT                   KELQKRLEEDAGVKTLYITMGGEPRFNRALFENKSMALFVGDSMSIHHFTDDYGRITRR
FT                   LLILYPMTFSRREEIPKQQILKKVEKAANQPEDNCGIEVVDLVELQKKHVYLEGQAAAC
FT                   YSYNGEFVYMALSGRSSEQVLSIICAPENLNIPNEKRFVFTAVLPHRSKENGRVIGEDV
FT                   IPYTSLVGWCGKGICAWGLEFLRFPSEKDQEAFYEHLENNYSKVINLDESELRAFCGNA
FT                   REVAIAHGNGERRVLCISHQALNALRPFKRQMLEDWYGLGNILPFYADVLERRAGRSVG
FT                   SLVSVPVIHGEVLPLPGELGVIEAAKVDIKDGGC"
FT                   /protein_id="XP_844280.1"
FT   repeat_region   343063..343082
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<343280..>344695)
FT                   /note="synonym: Tb04.2L9.450; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656658"
FT                   /locus_tag="Tb927.4.1310"
FT   mRNA            complement(<343280..>344695)
FT                   /db_xref="GI:72387713"
FT                   /db_xref="GeneID:3656658"
FT                   /locus_tag="Tb927.4.1310"
FT                   /transcript_id="XM_839188.1"
FT   CDS_pept        complement(343280..344695)
FT                   /locus_tag="Tb927.4.1310"
FT                   /gene_family="HOG000260437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387714"
FT                   /db_xref="GeneID:3656658"
FT                   /translation="MFGGGEEYFRDPPSIDRDTLRRFALFCARLRAVEKPGKKTVSECT
FT                   QLAREVGNNEMAFELVVGTLFRHIKSWTGSKQLTCWYVLDKLCKEDRDKYGYTASKYIL
FT                   DIGRDYIPYEDPLLGPKYESLVEHWEGVFPRHVVDAIWLAKKDRLWALAHPEEVLKQKE
FT                   EEERQWKEEELALEDEDGLNDHGQPCMDYLQGRCFWGDDCKLYHPPGEEGTLPPECRLG
FT                   DWKCSSCGAINRHFQRRCSNCVREKPQYKKGRKSTTEEDALSKPDPSALAAVQRQFGYD
FT                   PNIAAEAVAHWNTRWESTPFEVYKDERRAAYRVRILGKPPASELEERIRMQKNYPNVDI
FT                   GPPEETLDMGSMQSNLPAESLIPEHMDPVNAVAFLAQTIVERGVCDPKAPQILAELALC
FT                   VKQVATTSGTKLSGSPRETLLTACTIMFSAWEVDRVAVPFVPPFFREIRGTEASLGLSP
FT                   EQEGNLVSMTKEF"
FT                   /protein_id="XP_844281.1"
FT   gene            complement(<345185..>347911)
FT                   /note="synonym: Tb04.2L9.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656659"
FT                   /locus_tag="Tb927.4.1320"
FT   mRNA            complement(<345185..>347911)
FT                   /db_xref="GI:72387715"
FT                   /db_xref="GeneID:3656659"
FT                   /locus_tag="Tb927.4.1320"
FT                   /transcript_id="XM_839189.1"
FT   CDS_pept        complement(345185..347911)
FT                   /locus_tag="Tb927.4.1320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387716"
FT                   /db_xref="GeneID:3656659"
FT                   /translation="MRLSRYVQLNPEVIDSTLQRLSCVSQNITEVDIDMVFLSLLLKEP
FT                   LPSPVQHAITELLPQGARAAAKGCGRVGVQGAGMNAAIAVSLHTVLLSRNRITTTIGLV
FT                   QFKSVVRLSLLGNRVQRIEDCEGLSLLPLLQFLSLEFNPVTQLPHYRAHMLRICSWPES
FT                   LQPKNCRLRKLDTRPVTAVEVERAAQCLQREKVTMGELVQRMRFVAFLIEAKKRIDLHH
FT                   ELRRRGVVVQDITVNMTVENVVTRCSTQLLALVDVSAASHFVRRLMSGRCRLCDINNHD
FT                   TGVGSDSLCRSDSSLLAQSPNHSQGDINALVLHHPQHAVLTTFCKDWSKDVFRRATTSL
FT                   DHRICGLLLDIAHALGEELSVVDVDHLNKLWFMQVAKVDNWRLHKQRQHRVGCEDGMSE
FT                   ERSPALSYQSANTPSKGTKGQSSSLQEELVEIMLAPNEIFTSGGLVVGDANDEEVSLTC
FT                   ISPILRRAETVMSSCRKKELIKRGSEARDVSPRPLSEKSEGTVKTPTEAQTASQGERDV
FT                   GLSSSAMPLPQKAPSPHPSPWKEETAVDDEDAFLINRHVKKRVLRCWNSKAKHKYNNML
FT                   CSKFVRERLTNLITTTCPTPHSICTTLELLPRTERKRVLFRVWLERARSRYLPRYFQLR
FT                   SLLMRWRHRAYEMNNITYAENYYRSRTMHSVCNHWCRRLRIRENAARCRLEKSPTTIEE
FT                   PFGDPVPQQAYAGAHKNCVSEPSTREKGPQQLQPDEVMTAEADGLTSSGKQSLDCAGDG
FT                   SYTLQTDKTPNVVQRLSLPITTPSVNKFLPTQPHSVSDKTTQTTEMAPGCGTVTRDQCA
FT                   AARLDARVAVAALTEDRLRLVDRIIALEQRANEEAVTVQHRDREICDLKKRLGLMVLRE
FT                   ECLESTLNDYKKKCEHLQAVVQALRNERRELLLSASR"
FT                   /protein_id="XP_844282.1"
FT   gene            complement(<349237..>351222)
FT                   /note="synonym: Tb04.2L9.490; DNA topoisomerase IB, large
FT                   subunit"
FT                   /db_xref="GeneID:3656657"
FT                   /locus_tag="Tb927.4.1330"
FT   mRNA            complement(<349237..>351222)
FT                   /db_xref="GI:72387717"
FT                   /db_xref="GeneID:3656657"
FT                   /locus_tag="Tb927.4.1330"
FT                   /transcript_id="XM_839190.1"
FT   CDS_pept        complement(349237..351222)
FT                   /locus_tag="Tb927.4.1330"
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase IB, large subunit"
FT                   /EC_number="5.99.1.2"
FT                   /note="go_function: DNA topoisomerase type I activity [goid
FT                   0003917]; go_process: DNA replication [goid 0006260];
FT                   go_process: DNA recombination [goid 0006310]; go_process:
FT                   transcription, DNA-dependent [goid 0006351]"
FT                   /db_xref="GI:72387718"
FT                   /db_xref="GeneID:3656657"
FT                   /translation="MTEKKIKKVVIKEEENELEMVAAGMGPAKGAVKREGDENKAALLA
FT                   NEEGGGNDGETEWWTQGTLTTTKKGEKRWDTLLHNGVLFPPAYVPHGIPILYNQQKFEM
FT                   TPEEEEVATMFAVLREHDYYRNEVFRRNFFQSWREILDKRKHPIRCLELCDFSAIYEWH
FT                   QREVEKRKSRTREEKKELKRIADEEAEPYKWCIWNGKKEQVANFRVEPPGLFRGRGEHP
FT                   MRGKLKKRILPEDVVLNIGKEAPIPQAPAGHKWKGVVHDQNVTWLAMWYEPTIGQCKYV
FT                   MLAPSSTLKGQSDYAKFETARELKNHIDDIRESYTKDFSSTDEMERQRAVATYFIDKLA
FT                   LRVGHEKGEEEADTVGCCSLRKEHIELRPDNVVRFDFLGKDSIRYVNEVTVLPEVYKLL
FT                   GSFIKRTDSEIFRKVTPTTLNNYLKSFLKDLSAKVFRTYNASITLDEWFREKPVDPKAS
FT                   LSDKLVYFNKANTEVAKLCNHQRSIPKTFHVSVQSIKYKLEDIKRTIDTLRRAQSVSEN
FT                   GSVEEAATQFFKEQDEVQYQWLNTYGTPEEIQAYEEFVKKRVIPTALTGSASSTKNKSG
FT                   KKTANGKSKKSGGAKRSTKKASGTKKKKTRSKKSAAKTGKKASGKKKKQKKRGGSKRGS
FT                   RGKNGAGAASGDENDEDAPLVNIIAK"
FT                   /protein_id="XP_844283.1"
FT   repeat_region   351704..351726
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   351760..351779
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   gene            complement(<351971..>354283)
FT                   /note="synonym: Tb04.2L9.510; cleavage and polyadenylation
FT                   specificity factor subunit, putative"
FT                   /db_xref="GeneID:3656661"
FT                   /locus_tag="Tb927.4.1340"
FT   mRNA            complement(<351971..>354283)
FT                   /db_xref="GI:72387719"
FT                   /db_xref="GeneID:3656661"
FT                   /locus_tag="Tb927.4.1340"
FT                   /transcript_id="XM_839191.1"
FT   CDS_pept        complement(351971..354283)
FT                   /locus_tag="Tb927.4.1340"
FT                   /gene_family="HOG000203394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   subunit, putative"
FT                   /note="similar to Cleavage and polyadenylation specificity
FT                   factor, 73 kDa subunit (CPSF73 kDa subunit).
FT                   (Swiss-Prot:P79101) [Bos taurus] and (Swiss-Prot:Q9UKF6)
FT                   [Homo sapiens]; go_component: mRNA cleavage and
FT                   polyadenylation specificity factor complex [goid 0005847];
FT                   go_function: cleavage and polyadenylylation specificity
FT                   factor activity [goid 0030364]; go_process: mRNA
FT                   polyadenylylation [goid 0006378]"
FT                   /db_xref="GI:72387720"
FT                   /db_xref="GeneID:3656661"
FT                   /translation="MFSHAAYSAPGVHVLDSSSPRHLAAGPQPAAAPPSTDEVEILPIG
FT                   SGGEVGRSCVVVRYKGRSVMLDCGNHPAKSGLDSLPFFDSIRCDEIDLVLITHFHLDHC
FT                   GALPYFCEQTSFRGRIFMTSATKAFYKMVMNDFLRIGASAEDIVNNEWLQSTIEKIETV
FT                   EYHEEVTVNGIHFQPFNAGHVLGAALFMVDIAGMKLLYTGDFSRVPDRHLLGAEVPPYS
FT                   PDILIAESTNGIRELESREERESLFTTWVHDVVKGGGRCLVPVFALGRAQELLLILEEY
FT                   WEAHKELQHIPIYYASSLAQRCMKLYQTFVSAMNDRVKKQHENHRNPFVFKYIQSLLDT
FT                   RSFEDTGPCVVLASPGMLQSGISLELFERWCGDKRNGIIVAGYCVDGTIAKDILSKPRE
FT                   ITKPDGKVLPLRMRTIQSVSFSAHSDGRQTRDFIQALPKTKHVILVHGNVGAMGQLKNK
FT                   LQQDFADRGVQVYATKNQEAIRIPFSVQRTAKVLGTLARNPPRDGEFISGVLLMSGHHT
FT                   YSVVHPTDIPHFTDLDVAQIQQAIVLPLPRYKSPHEVLEMLKRYFAQSQMFSDVTPHEQ
FT                   QKQEGGDAANAIGGGQEQECAGNATQITVSKDVWVDVQQSTRSQTTVTVNWTSSHHNDL
FT                   LADVTCIALIKLMQQEHAASSADALPVDVCGNDRLFRLKCFHHMMSQFYPSVVTNLGTG
FT                   VCTVELEDGQHATITGCIEIDLQGNTKSSYSSTEVERLKTVLKRVYLTLFPIPVDQGWC
FT                   DCGMIHGAEPAPIDEGA"
FT                   /protein_id="XP_844284.1"
FT   gene            complement(<354577..>355971)
FT                   /note="synonym: Tb04.2L9.520; hydroxyacylglutathione
FT                   hydrolase, putative"
FT                   /db_xref="GeneID:3656663"
FT                   /locus_tag="Tb927.4.1350"
FT   mRNA            complement(<354577..>355971)
FT                   /db_xref="GI:72387721"
FT                   /db_xref="GeneID:3656663"
FT                   /locus_tag="Tb927.4.1350"
FT                   /transcript_id="XM_839192.1"
FT   CDS_pept        complement(354577..355971)
FT                   /locus_tag="Tb927.4.1350"
FT                   /gene_family="HOG000260434" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydroxyacylglutathione hydrolase, putative"
FT                   /EC_number="3.1.2.6"
FT                   /note="similar to Hydroxyacylglutathione hydrolase
FT                   cytoplasmic (EC 3.1.2.6) (GlyoxalaseII) (Glx II).
FT                   (Swiss-Prot:O24496) [Arabidopsis thaliana]; go_component:
FT                   cytoplasm [goid 0005737]; go_function:
FT                   hydroxyacylglutathione hydrolase activity [goid 0004416];
FT                   go_process: methylglyoxal catabolism [goid 0019243]"
FT                   /db_xref="GI:72387722"
FT                   /db_xref="GeneID:3656663"
FT                   /translation="MVAVTIFLYVTSIASATQLVIGTAATCLLGLIPANAYFPPVWFRL
FT                   NLFVCLYNLYCSELVGYRWLRFLIHKRYSVPHSDYRHGVRCLSGNIITRCPFPPHVLEG
FT                   SEFHTRGGGTVDLKHLGEKCREGCYDGVFVMPVPVLLDNYAYFILSCKTKRCAVVDPAD
FT                   PTLVLNMLEVVRNLTQIDFMITDILTTHKHWDHAGGNMEMRALSQCSSERCRALLSPEL
FT                   NIYGSEVDRPHACNKLIKGSDELVVAGGGAKVVVLSTPGHTGGSVMFLVGDALPKEGEP
FT                   QRLALFTGDCVFCGGCGALFEATSVDETLETVDIFNNNRTWVHPATGDIIHTDDVLIYV
FT                   GHEYTERSLDMILSVQRTANQTGEQSAIATSNYCDTVAQARNGARRLRSCVVADDVYMK
FT                   VTSMETKAPLHLRACTVPSTVTIEKKVNALLSLKRCVLEEFQGKPYASMAVQRAIYTST
FT                   KRNDTG"
FT                   /protein_id="XP_844285.1"
FT   gene            complement(<356652..>357533)
FT                   /note="synonym: Tb04.2L9.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656665"
FT                   /locus_tag="Tb927.4.1360"
FT   mRNA            complement(<356652..>357533)
FT                   /db_xref="GI:72387723"
FT                   /db_xref="GeneID:3656665"
FT                   /locus_tag="Tb927.4.1360"
FT                   /transcript_id="XM_839193.1"
FT   CDS_pept        complement(356652..357533)
FT                   /locus_tag="Tb927.4.1360"
FT                   /gene_family="HOG000283048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387724"
FT                   /db_xref="GeneID:3656665"
FT                   /translation="MAKSPIVARNDDGSSILVHLQGAHLTNWRNKEGTELLYTSSKAVY
FT                   EKGIPIRGGVPIVFPQFGNMGPLPPHGFARVRMWAVKEVTNGSASFTLNVPLRDLLGHD
FT                   SGMIAEAPIAEAPSAETETVALLYTITFSNSHLDLQMEILNQHPTSVAEFTFAFHTYFA
FT                   VGNVEKTVVEGVNMTSYVNNMAPHQGVLPPRRLWIIKKETDRTYFNQACAVLLVDAMKG
FT                   HTVHVSGENLPDVVVWNPHVEKSKKLKDLPADGYKEFVCIEHGVIAKRVKLQPQFEWKG
FT                   RQRILVLPSSKM"
FT                   /protein_id="XP_844286.1"
FT   gene            complement(<357984..>358439)
FT                   /note="synonym: Tb04.2L9.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656662"
FT                   /locus_tag="Tb927.4.1370"
FT   mRNA            complement(<357984..>358439)
FT                   /db_xref="GI:72387725"
FT                   /db_xref="GeneID:3656662"
FT                   /locus_tag="Tb927.4.1370"
FT                   /transcript_id="XM_839194.1"
FT   CDS_pept        complement(357984..358439)
FT                   /locus_tag="Tb927.4.1370"
FT                   /gene_family="HOG000260431" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387726"
FT                   /db_xref="GeneID:3656662"
FT                   /translation="MNCSSTLACHAVVSAPSTASLITSCWTPQQHCYRQLMKSLRAAYF
FT                   HDRSKLFWSRHRVLVEFYKYSEEANEEAVKQLVAIGLEVAAFIDHHMRTDVERIVKHNE
FT                   TMMALPVAQAKKFRSDYLLAEKQHDSWCKQKIKNIMKRRPPPPYPFF"
FT                   /protein_id="XP_844287.1"
FT   gene            complement(<358693..>359220)
FT                   /note="synonym: Tb04.2L9.560; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656664"
FT                   /locus_tag="Tb927.4.1380"
FT   mRNA            complement(<358693..>359220)
FT                   /db_xref="GI:72387727"
FT                   /db_xref="GeneID:3656664"
FT                   /locus_tag="Tb927.4.1380"
FT                   /transcript_id="XM_839195.1"
FT   CDS_pept        complement(358693..359220)
FT                   /locus_tag="Tb927.4.1380"
FT                   /gene_family="HOG000113983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387728"
FT                   /db_xref="GeneID:3656664"
FT                   /translation="MTVRVALQSIEKASLLLDNEQRYGSVGRGALIYIAFIGAVSEDAL
FT                   KNAVDVILTANVFHNLSSSDALPRSSDSLSSFPSADVLIVPQASLGGKLKGRNVQFHAL
FT                   VGKSEGELLYNQFCQLMRKARGVDSTTVDSNGVPLVGSAVGSSARVINGTWGNRQGLRL
FT                   ESQGPLTHVLDL"
FT                   /protein_id="XP_844288.1"
FT   gene            complement(<360414..>363218)
FT                   /note="synonym: Tb04.2L9.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656666"
FT                   /locus_tag="Tb927.4.1390"
FT   mRNA            complement(<360414..>363218)
FT                   /db_xref="GI:72387729"
FT                   /db_xref="GeneID:3656666"
FT                   /locus_tag="Tb927.4.1390"
FT                   /transcript_id="XM_839196.1"
FT   CDS_pept        complement(360414..363218)
FT                   /locus_tag="Tb927.4.1390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387730"
FT                   /db_xref="GeneID:3656666"
FT                   /translation="MMSPSLALLLLFGSVVAKAVDILHYDGFVPEVEELVESNIAPLLA
FT                   YDDGLLYTSGNSESGAAVCGTTANITPRMVFPITLKKLDSMHRRVQQGMPWSGTMLDLN
FT                   MVEGCYTKYDEDGEVCAASLQSLPKQCGMDIESSTMYWAYRVNQRSPVAESTKVFENGA
FT                   SVLVEDILYIRPQREELRRAIRLNKEFNKAGAELFEIARRGWKLNTTEEDQQAFRHAVS
FT                   ARGTQMVKEAYSAAMRKWKIVKQWLKTSIGKVDRQVPTFTAVGNGTLLSMDVCCNVAER
FT                   IDDWMPITDRNLYIPGVHGRSYSELLTFFRGTKVNESSKERYPNVSHLPCAAVSLAVAM
FT                   MLHDDFPVRLLYQNITGEANTETLWPWARFEELSTVTTMSPKYRSYTMKQFAYILNYTL
FT                   DHSAETGRFGGGLALAECVTRSILRITGRDGLPPQPSLFDCYSPAYNQSRMKSTDNEAP
FT                   PSKYKWVAGGEGMESYAGTPCPWGFTRASGNLWSTREPCVVCPPGSFSDGEGGCRCSSA
FT                   SYPTLMGCMTKRGRYPIKAKWKWLGGPMGVRVANRDNGQLVPLLVVKAPPNAEDGDQVK
FT                   VLIECTKGLTEFKAVITSTQSNSSKTELVDLPVERNTYIFTTSNTTISLDTSAAFGGDQ
FT                   CNFSTKVVNPKYSDSPVVQAGTLLVLPPVAELRNTALPVQQSSANAMAVEQLANCTSEV
FT                   RNDPGSVGIALCVTHGQDVSVRIGTHAYTPLTNAMWHILKRSVWTNGAKAKELGKLMKP
FT                   VVERMRLAVKVTFKCHGNVTTVGEAFSGNIAVGRAMHTVGVKSNNISELVVTTQIVDFC
FT                   TTEEGVHHTSCAGSRHLFIASDVSNVTFFLAPRNNTEGHRADDDDNDEGRNEGAKKPHE
FT                   GGHDEGADVTQQSRMVSGMLRLRVPLIALGAVDALLVAITAAITVLYYARYRKTALPEV
FT                   EGNP"
FT                   /protein_id="XP_844289.1"
FT   gene            complement(<363820..>365202)
FT                   /note="synonym: Tb04.2L9.600; vacuolar transport protein
FT                   4A, putative"
FT                   /db_xref="GeneID:3656668"
FT                   /locus_tag="Tb927.4.1400"
FT   mRNA            complement(<363820..>365202)
FT                   /db_xref="GI:72387731"
FT                   /db_xref="GeneID:3656668"
FT                   /locus_tag="Tb927.4.1400"
FT                   /transcript_id="XM_839197.1"
FT   CDS_pept        complement(363820..365202)
FT                   /locus_tag="Tb927.4.1400"
FT                   /gene_family="HOG000260430" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar transport protein 4A, putative"
FT                   /note="go_component: cytosol [goid 0005829]; go_function:
FT                   ATPase activity [goid 0016887]; go_process: endosome to
FT                   lysosome transport [goid 0008333]"
FT                   /db_xref="GI:72387732"
FT                   /db_xref="GeneID:3656668"
FT                   /translation="MEDSFNLKKAEEAIQLVTEARELLLQYSHFRNAGEDAIIRLQGIL
FT                   RAILQCSSLMQAYDDSPHRCAIYAHVSRTLLRVIDLPPDGTFPSSHRQHQQLQQYEMEA
FT                   KPSVSSCEQEVEELGAAILYPPGSVDGLKEHGNTNRVRWVDVSGCEDAIAALKRATVLP
FT                   LRFPHLFQGKRHPPRHILLYGPPGTGKTLLAAAAAAEYAAPLLTVSSADILSKWIGDSE
FT                   RQVRRVFEVAASFPRCVLFLDEIDAIGGVRGGAGESEASRRVKTELLLRMQKSHVDGIT
FT                   LIAATNIPWGLDSAILRRFDQLVFVGLPPSAARFRLIVEELRHVPSELGEEDIQWLVNS
FT                   TEGYSASDICRITRRAVMEPIQKISMAGYAKPIRPSTTTVSNSAPTDNELVSQKSSSGS
FT                   PQYVLCDEDEEGARPIETVPTAALHVPAVCRENFECALREFPPTTTSEELEKFLKWRTG
FT                   GK"
FT                   /protein_id="XP_844290.1"
FT   gene            complement(<365566..>367113)
FT                   /note="synonym: Tb04.2L9.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656667"
FT                   /locus_tag="Tb927.4.1410"
FT   mRNA            complement(<365566..>367113)
FT                   /db_xref="GI:72387733"
FT                   /db_xref="GeneID:3656667"
FT                   /locus_tag="Tb927.4.1410"
FT                   /transcript_id="XM_839198.1"
FT   CDS_pept        complement(365566..367113)
FT                   /locus_tag="Tb927.4.1410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387734"
FT                   /db_xref="GeneID:3656667"
FT                   /translation="MTVARRTFNFSAEPSQGISKVVWAGRTTIAVMSSVGEVVCLRSGL
FT                   CEPSNAQNDSENDDGGDGTCEGDSSVLLRIPQHAIDVCALTVNGYAVIVTTDHIRTESY
FT                   AFAISGGAAAASHQHRELSIGAFQLISGLSDCHGCPAVLLGCTLGSVVLFEWSSVKEKP
FT                   IAIRSLLMGPTTRYMAISAGVQYVSVATSGEEVERVVTFCALGNTGAEDQAERGALSLK
FT                   MADGTPLCVMETVSDSTASHYSSVLPSWNDVCRLDSGRPQSVSSLLLVTQPQLSPTAAV
FT                   PQILVVSVAQDKLHVLRNTSCTDVPAGKRKGSAEALRPETTIDAQIFLATSLECKNALS
FT                   MFRGDATMVATIRRPRNTTPGKLGGELCLFDSERAIVFGLCENCEVEPRASVGVEHESS
FT                   LLAGLVWPFDTSDALLLLSGKLLDGCHGSNDVSNDARPKGETKKVTVRTIGDLTLVSEI
FT                   PQPWRRSGAAGLDEERLTEVVRAVVRQENEKMMQRLEKRLEAIERTLSLLSSQRGRE"
FT                   /protein_id="XP_844291.1"
FT   gene            complement(<367940..>368344)
FT                   /note="synonym: Tb04.2L9.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656672"
FT                   /locus_tag="Tb927.4.1420"
FT   mRNA            complement(<367940..>368344)
FT                   /db_xref="GI:72387735"
FT                   /db_xref="GeneID:3656672"
FT                   /locus_tag="Tb927.4.1420"
FT                   /transcript_id="XM_839199.1"
FT   CDS_pept        complement(367940..368344)
FT                   /locus_tag="Tb927.4.1420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387736"
FT                   /db_xref="GeneID:3656672"
FT                   /translation="MLCRSSLWLCGPKMTHTNAQQQVLEINSAYSLLRMCYRSIDIKVK
FT                   SRHARQFLQRRLMEQWHVHCRETDPEKQRFLMDHAGAFLQALHSPRNPKPGEPIVFQLS
FT                   RRQAYEEALKEKAERATKTVHKLPVGAKLS"
FT                   /protein_id="XP_844292.1"
FT   repeat_region   368679..368722
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<368836..>370239)
FT                   /note="synonym: Tb04.2L9.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656675"
FT                   /locus_tag="Tb927.4.1430"
FT   mRNA            complement(<368836..>370239)
FT                   /db_xref="GI:72387737"
FT                   /db_xref="GeneID:3656675"
FT                   /locus_tag="Tb927.4.1430"
FT                   /transcript_id="XM_839200.1"
FT   CDS_pept        complement(368836..370239)
FT                   /locus_tag="Tb927.4.1430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387738"
FT                   /db_xref="GeneID:3656675"
FT                   /translation="MTLPELAEPCALLRVSVGKQRRRYLGKQKHAKRIVGGSERYAEEV
FT                   RIRNFIKGVEPLPPVKECEVMDYVRKLKLEDLTDDRAAHLTSPYSLHAHIMREVLEELT
FT                   ENICASVQNCEWNKPTERREWDMDFRFLHEWWLSLRTLPYREEPNGHYPPLIPWSERGK
FT                   EAENQLLADVALKIRQSKSPLYLLHLDHINLTPEQTNVLLLDGVFRNNNSGVETFSAQF
FT                   CNIGPASLLVILLILNHATQLEPQVENLHLAYNWIDASCVNMLTTLLPLTSITRLSLRG
FT                   NRFGGGDVGLFQEFLMGGCMFLEELDLGYTSLSAPEVYQLIRTIPLLGQLRVLLLDGVP
FT                   VPEGKAASLLRAIQLSQLIKVSLIAIPACSSDSYLGRVAEACRKHWTGRSGKGSGWYSR
FT                   GSGSFFEAFDNRASTFFRPRDRSALPPGYRPFTTNDPSLHPWSRRLGTPTDGTREGGWF
FT                   TSPYPASQG"
FT                   /protein_id="XP_844293.1"
FT   repeat_region   370528..370563
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<370664..>371281)
FT                   /note="synonym: Tb04.2L9.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656671"
FT                   /locus_tag="Tb927.4.1440"
FT   mRNA            complement(<370664..>371281)
FT                   /db_xref="GI:72387739"
FT                   /db_xref="GeneID:3656671"
FT                   /locus_tag="Tb927.4.1440"
FT                   /transcript_id="XM_839201.1"
FT   CDS_pept        complement(370664..371281)
FT                   /locus_tag="Tb927.4.1440"
FT                   /gene_family="HOG000260426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387740"
FT                   /db_xref="GeneID:3656671"
FT                   /translation="MPRSLFRNVRVLGATPRFAAGVQGLTEAVLLAERAPQAVELSIHF
FT                   VTPGRMHELNLEHRGVDKPTDVLTFPGSGSGTPYAKFLNETVLLARVEGDNACVADPSV
FT                   LAERRALLQELGDIYFSVEYISMRCSCRPTHCLRFHDYLQAALTHALLHALGYDHATPE
FT                   QWKRMTKRERFLRHRLSVWRRRWPGCLQELDGVEMLMSPVTR"
FT                   /protein_id="XP_844294.1"
FT   gene            complement(<371443..>372708)
FT                   /note="synonym: Tb04.2L9.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656669"
FT                   /locus_tag="Tb927.4.1450"
FT   mRNA            complement(<371443..>372708)
FT                   /db_xref="GI:72387741"
FT                   /db_xref="GeneID:3656669"
FT                   /locus_tag="Tb927.4.1450"
FT                   /transcript_id="XM_839202.1"
FT   CDS_pept        complement(371443..372708)
FT                   /locus_tag="Tb927.4.1450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387742"
FT                   /db_xref="GeneID:3656669"
FT                   /translation="MMIGVPPEASYLLQRLSRPNKFKSYASARSFEADCADLITLWTNL
FT                   PLAPGTEEGEDMQRKLVDMWSGFVKNAVSYVMSGNPLLNYRPLLEAILASSAAVESSIL
FT                   TAASCSSAVSTNSECVESLTKAVVDVVAKRTAEIAALIPPLDLLQQVLMFIDLLQEYYH
FT                   LPGDKMKTTGNCTSLNPILLHPLILNVVKAYTKLVERCATLFVEEVAFPTYWNIGGAPS
FT                   PACILVDGVHPTIYFCFTTMISLVRAYRNSGLAGDDRSCRQVIAQVWYHGSFAMIAAVE
FT                   TVENSEKRKRQLEIDTLHYVLFARMFREFVGEGYFAPVTRALVKLLVTVGGCVRGGAEK
FT                   EEASVHVHSCTKFVDDIWNVCPIKELEWLQLGAAARVARRDGSPNDGAFVPWSKAFVRA
FT                   ANVEVAREVPAGWESTCFNKLM"
FT                   /protein_id="XP_844295.1"
FT   gene            complement(<373162..>374652)
FT                   /note="synonym: Tb04.2L9.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656673"
FT                   /locus_tag="Tb927.4.1460"
FT   mRNA            complement(<373162..>374652)
FT                   /db_xref="GI:72387743"
FT                   /db_xref="GeneID:3656673"
FT                   /locus_tag="Tb927.4.1460"
FT                   /transcript_id="XM_839203.1"
FT   CDS_pept        complement(373162..374652)
FT                   /locus_tag="Tb927.4.1460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387744"
FT                   /db_xref="GeneID:3656673"
FT                   /translation="MLRCRVADVVSSDQMCEMTNFPPVQATVGYVQLLRRLSFKREFFV
FT                   PFVPTKHVIFTFQTRNPLEEGKVKDEVTDLVSHYFNWIRERGVYSFQILQLYVCILSGC
FT                   TVVVIECPDTLTTLDVHSFSQEPEAPTVGKRRVLVFPCDNDEISDSELESNYYIVPTCT
FT                   LCAERLEPTLTGYSSPTCSCVDGRECRCLLEQSSCVVCQTSITMQHESQKVQCEQCSRT
FT                   GDPWICLVCGYVGCSRYQAKHAREHYLQHKHLFSMSLLTQQIWDYDSDAFVHRVVVLLD
FT                   NATGAVNRVQYPDRDNIPSSLADEYVDAAAEKVSKKHINAKFDSKVETSNEQLALMIIS
FT                   ELNTRRVEYETEMHGGSHHLNDELMGDPSLCSVIVAERACAASRERWWQLHNANKSIQE
FT                   ELMQRRREEEAHQKTIDELQQELRSVVQHYATREYSLLTEINELRQTITDVETNLRTFA
FT                   KLSRGLGNDTLEHVRIVGGTKEPKPRRRGGNNTRDGRA"
FT                   /protein_id="XP_844296.1"
FT   misc_feature    374738..374765
FT                   /note="AT_rich"
FT   gene            complement(<375059..>375490)
FT                   /note="synonym: Tb04.2L9.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656670"
FT                   /locus_tag="Tb927.4.1470"
FT   mRNA            complement(<375059..>375490)
FT                   /db_xref="GI:72387745"
FT                   /db_xref="GeneID:3656670"
FT                   /locus_tag="Tb927.4.1470"
FT                   /transcript_id="XM_839204.1"
FT   CDS_pept        complement(375059..375490)
FT                   /locus_tag="Tb927.4.1470"
FT                   /gene_family="HOG000260422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387746"
FT                   /db_xref="GeneID:3656670"
FT                   /translation="MRHFGPSIAHFPLSANQLRFKASHIRIANRKRVEMFVAKRFHLPT
FT                   RLATAAPDIAAEWHDELNPMHMYPAIIGIGHVQPVWWKCAICSHSYQMSVEKRVVRGGG
FT                   CPQCVVNGKRAVADGALEGEMDSQLRPKRPVMFNMRTKY"
FT                   /protein_id="XP_844297.1"
FT   gene            complement(<376506..>378668)
FT                   /note="synonym: Tb04.2L9.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656674"
FT                   /locus_tag="Tb927.4.1480"
FT   mRNA            complement(<376506..>378668)
FT                   /db_xref="GI:72387747"
FT                   /db_xref="GeneID:3656674"
FT                   /locus_tag="Tb927.4.1480"
FT                   /transcript_id="XM_839205.1"
FT   CDS_pept        complement(376506..378668)
FT                   /locus_tag="Tb927.4.1480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387748"
FT                   /db_xref="GeneID:3656674"
FT                   /translation="MAGGAAGKVTRTGDDMPDTLKKYMLTREVYRNASVAILVDAFVHT
FT                   RRYLKSCRADGDGASSGLGPAGESFRGLFFLSHFHSDHYSGITEKWSHGTIYASRATGN
FT                   VLCWKLGVRRSCVECLDLAVTYIFSLRNGDLVKKEEGRAECGEGCFSVELIPANHCPGA
FT                   VMFLFRSADFGTILHTGDFRFSSPAVPALSIKHRCWEPDLRSNPVLKSMGNVDVLFLDN
FT                   TYCQPQFTFPDRAAIFQTVNKEVLDMIMGCERRLSYSQSQEHMQTKEEGQTVSVAVIVG
FT                   SYFIGKEIIALSVQENFPSKKSGDGAPAYAPIYVTPERYEAMRQLDYFPERFTPHHMKE
FT                   PQDIYLGYRMGGNGESGGECTGRFTTCEVKLPVDSEISTSKTAGEMSSDHVAPDSMTGG
FT                   VKYSLALFLVPLSLTTYSALAPAFGRPVRRRHGEGTAIDGGAADTGDETVSLWGNERVD
FT                   LKQFDGVLFVNPTGWAAKVSRQKINERVSLLNIPYSEHCCFSELIDFVEFVNPALVVPT
FT                   VSKEAFAQHESLFAEKAPRLRTRYSNMQPICRLLARASSVDSPETRTQPGDAKQEESIK
FT                   TEKQRNPFAIGRSLNAEPSKGLSSANTCESRKGPECVDVEDEESTASEDTHNRNESGSL
FT                   PNLVENARNEVVCKEMNIQPERVMSTVCRLGSVTQIRKRGRPHSRKPPSVAATTQAAIR
FT                   RWCQSGYKSSDRANAKEVIDLSSDSE"
FT                   /protein_id="XP_844298.1"
FT   gene            complement(<379060..>380871)
FT                   /note="synonym: Tb04.2L9.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656676"
FT                   /locus_tag="Tb927.4.1490"
FT   mRNA            complement(<379060..>380871)
FT                   /db_xref="GI:72387749"
FT                   /db_xref="GeneID:3656676"
FT                   /locus_tag="Tb927.4.1490"
FT                   /transcript_id="XM_839206.1"
FT   CDS_pept        complement(379060..380871)
FT                   /locus_tag="Tb927.4.1490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387750"
FT                   /db_xref="GeneID:3656676"
FT                   /translation="MSDGGISTGSHQHLGSIYRSLEYLPRYFQIFALFGAFFLASIREN
FT                   PVIAWLAVTMHSSFGTEIVWSVEYQRRLELMTLNERLSLTLYGVALSALAMFTYVKTGR
FT                   DVLYHLVQESGVDSNSRRWPVAIMCLMLACEGMVILKEEAACELSSSDSIAHFVLTGFR
FT                   GFEQTGFDPRLKYANPHFLIQVQILKAYAMSFVKRMLPAVILAFVYRSGRDARRSAHAA
FT                   LRWYIMTIMIFRSLCEAYTMMYGDGLRQYSSWSLLLTSVVWYAMVNYTFGPSKRAGWTA
FT                   STSSASSVRETTNGISKCIVLFFMVYLSVLALVVSVHVVELLLIWLMFFLLTVWIPAII
FT                   DSCAVSYIICITTAVSFVVYKMNHTTKWGSLRLIPLFSLWWLDICILYSLVANVTHSRF
FT                   GGTLAVLVALGFHCYHSLEDLEHGVRTSGSYVEKVVTMLREVVEETVTMDEEVSAGPRT
FT                   EKACYKTLVVVACAVMGFLISVAALLEYSQSSDVRVHLLNQNIILVTPRVLFRKFVRTF
FT                   ILVISLLVFVIAGLVMYRLVPQLAMFVPDFIALGVAVGVACAILGRLIDLQDPLYDALM
FT                   RLIGAMEPPALTEDSVLDEGYGRWKHA"
FT                   /protein_id="XP_844299.1"
FT   gene            complement(<381487..>387990)
FT                   /note="synonym: Tb04.2L9.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656679"
FT                   /locus_tag="Tb927.4.1500"
FT   mRNA            complement(<381487..>387990)
FT                   /db_xref="GI:72387751"
FT                   /db_xref="GeneID:3656679"
FT                   /locus_tag="Tb927.4.1500"
FT                   /transcript_id="XM_839207.1"
FT   CDS_pept        complement(381487..387990)
FT                   /locus_tag="Tb927.4.1500"
FT                   /gene_family="HOG000260419" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387752"
FT                   /db_xref="GeneID:3656679"
FT                   /translation="MRAIRLTVACRYLGPFRSVTLSPVVLPVRLFQTQEITPGEVSLVE
FT                   ATDESDRAFGETRKEDFSFDGSSEFPECFKDTKHVDTFSRARVVSFIKRFSQGAVTSSS
FT                   EVFEGREIVNDNGTPLYHSRVRLPFRSHTGELWAHGVACNSKDAELLAAMHAEHIIDEF
FT                   GYHIYTLPSMQRKHAEAARKAGRWAPLPDELERTQSPVRVPLPLRRIVDRDETEGGKWL
FT                   LIDMRPNHYISPSHTLLSPCLFDTTAVHRIKSFLDEHKLSFAQLCTSVEEPGEGGGQSW
FT                   YVATVSLPPELSTFSEIKAQGKALNREAAVTLACMHAELVLDAHSICLYPSDSTKQKQH
FT                   ALAAWSYGRPAPLPGEDQKNPSHVVCPLPLKQLAVRREDRISCISYEEDIIRRHRALTD
FT                   QTCEFIETPTLDSSAVEQLKQFLQRENVPRTDPFLVEEVNGYYKATVVLPLPDLYGIRG
FT                   GVGIAMNATDARVLAAMHAIDVLNILGFHLMDGSTARAEWIAARRARGESVPADTRDPN
FT                   VLSPSGRRRVATGNSSTQTPSSSTNARSVAAAPDVGTSDPTAPQNTKRRVAKRARVADA
FT                   QPTEEKDAANSDSDEATSYLKMRETVSKELWNLEPDSPDGYIMVSPTDPETRTQFEQAL
FT                   YSPRQVDLGSKSRIKNYLASVGRRIEEVFFVQRIEAEDNGGQAICRCAVNLPVPRRFGD
FT                   RIALGEAVDPKDAENLAAMHAELILDTLGIPIYTDSALQRLHVRLCAKCGRNAPVEYSE
FT                   SVAAATASPPPLRREVVGSIHWENKSKRRRAAISVQKGGGPANSQETTSALREDEEPLI
FT                   APKERREYTFVPEKDLDLVSRARVHYYLRRNGIAKLEPEYRMELRGLGNVLHIAELTLP
FT                   LPDVYGKRVAHGSALTKRDAEILCWMHAEQILDAVGLCLFDNLPMLQRRHVECVKRLGR
FT                   WAPLVSENATKPPHTPTPLPLTLGTTQEKPQYPTPPTNVRQDWEQYAQECQRYIEINVM
FT                   REHNIFYEMGKTPRTGDETYDAALAEVESMPIDPDAKTVLQRYCNVANVNYPTFWKSRT
FT                   VGPISCRVCLTTIEVPGHEYLRASGVAWNKEASQRQAAMHALALLRRVEPDFAEFEKQI
FT                   KAEVVDKVNLVDPAAVLDEEAPVLRRTARVSKKSLGNWDPVSKDFSHEGKVRIIELFTV
FT                   CFGLQPPLVRHLNRRSGSFVQHFTVVEVTDEDGKTWVGTGRDAGPRFNEPAAFDDLFSK
FT                   LSRGVQGFQALMDLIRAHPHLDPEHIANVSLTDSQKERILKAVDGLPMVEEEDVAHPEQ
FT                   WADADSDRGIGIMALIAMDASQRAQESQELEAKLQAKLTNEEYQTRYASQRQRLRIYEK
FT                   RDEILRAISSNQIVIICGTTGCGKTTQVPQYILDDMTEKGMGGDCSIVITQPRRLSAVS
FT                   IARRVAAERLESIGETCGYSIRLDAKPGRNINFCTSGVLLRLLHSAPLLNGINYLIIDE
FT                   IHERDINSDFLLILLRQLLHRRKDLHVILMSATLQADQFGKYFGNAPIINVEGYVHAVE
FT                   EMYLEDLVPIATERNVMTPLLKEAAAALERNGAADGFCPTVVPPTAKYGFLEATADIDY
FT                   MTIQIAIDHAVRSLDLTDSSILVFLPGWDEINRAKEILERNAKFHIICLHSSVGAEEQM
FT                   RCFLPAPEGKIKLILSTNIAESGVTIDDVAAVIDVGRGKEKSYVMRKGTTSVGRNEMGS
FT                   MSQLVTVYASRANCVQRRGRVGRTRPGMCIRLYSKKHFQSLHDFQTPEMLRTHLDSLCL
FT                   QILALDLGDPADFLQQALEPPSSDHIEAAMKRLHELGATTSTRQLTPLGLRLSRLPVAP
FT                   KVGKMVIMGAILRCLDSALTIAGVSDTDVFISTREHREAVRLHKEDLSYGTQSDVIASV
FT                   NAFNFWVTSHYAKTPAEVVYDLQERMLSVPQLLTVSKYKQQFFEIVAGSGFIHMKQNYK
FT                   DAKNKDRADIFVDQSEYSADSLNVGLVKCVVASGLFPNVVMNRGKRLMRNKLANRLDPS
FT                   SASVVHRTSQENIGQPYFVYDELVKSSESERLLVRDLTNVSLWTILLMGTSSMPVTYRD
FT                   DLNLAVVDEWIMFRATFGTLELIRKFKRALNVCLGRKFMNPNDEENNAKLEELRCIIKE
FT                   LVCTPFKPNDLAEKPWEEKGVIIEPCTEPKGGSSEAEKTHVNSSHTPTTSAEAGGDS"
FT                   /protein_id="XP_844300.1"
FT   gene            complement(<388959..>392201)
FT                   /note="synonym: Tb04.2L9.780; phospholipid-translocating
FT                   ATPase, putative"
FT                   /db_xref="GeneID:3656681"
FT                   /locus_tag="Tb927.4.1510"
FT   mRNA            complement(<388959..>392201)
FT                   /db_xref="GI:72387753"
FT                   /db_xref="GeneID:3656681"
FT                   /locus_tag="Tb927.4.1510"
FT                   /transcript_id="XM_839208.1"
FT   CDS_pept        complement(388959..392201)
FT                   /locus_tag="Tb927.4.1510"
FT                   /gene_family="HOG000201571" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phospholipid-translocating ATPase, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism [goid 0015662];
FT                   go_process: cation transport [goid 0006812]"
FT                   /db_xref="GI:72387754"
FT                   /db_xref="GeneID:3656681"
FT                   /translation="MPEVENDSCCSMSTMEEVTPCPVPPIKKRSQRMVIKRWLNMETAC
FT                   EGEPRTIPLGCAPHVWTAAGYPRNAVNNRRYSIITFLPLSLFHQFRPFFNSFYLFLTLT
FT                   QFVDALKVGFLFTYISPLALVVILSLIKDAVDDIQRYQRDKTINEEKVEKLLLNGEVSV
FT                   ITAAEIQVGDILILHHGQRIPADCVLLRTSEACGTCFIRTDQMDGETDWKLRYALKGTQ
FT                   TLNNVSLSQLRANIRCEPLHKDIYKFVGAFDIPGKESEAISLQNTLWAHCVVASGTLAV
FT                   AVLHTGVDTRSAMNRSKHSTKVGLIEHELNYLGVLCLSVLVLISFLLVVQQHFEGSWLT
FT                   MFFRFLILLSSIIPISMRVNVDVGRIWYAYVIGKDDKIPGTVARNTNIPEELGRLQYLF
FT                   ADKTGTLTKNIMNFRFIQVGSDTVLNYHEVDRFQSSIAAYFGENYVPRGTNTVDSGKIN
FT                   SHSTQRNFTRDVTSVGEAIVSLVLCHNVTPVVEDGCLQYQASSPDEVAFVNFCRSLGVT
FT                   LTHRDVTCMQFTTPGGRLVHYDIIKTFPFTSERKCMGIILREKVDSESVSCGANSDGVY
FT                   KYFMKGADFKMTSVVRSSSWLEESCQEFAQVGLRTLVFAQRQLTKEQVDTFLARYDEAN
FT                   ADLSEARDSLLDAAMALIERDMKLIGVTGVEDELQDDVTTSLETLGMGGIKVWVLTGDK
FT                   VETAITIGRATRLIPRHGKIEVMSCRTEEETQRYLDSLYLQYYNSMNDAPLDVPWTLVL
FT                   DGGRLSMCLTKATSKTFVRVARLAYSVIVSRCSPTQKAEVVRTMKKFTSRNIRTAAIGD
FT                   GGNDVGMILAADVGIGVEGVEGKQASMAADFSIAKFSHCVRLIMWHGRSSYRRTCNMSQ
FT                   FVIHRGMAYSVVQAFYSLLFAGTSMSVFNGYLLMGYSTIFTMAPVFALVLDEDVKEGDV
FT                   REFPQLYKELLKSRSMNTRSYLQWLWISVFQGGTMIYLALALFGKEMFQITTVAYTTLL
FT                   LTELVIVAGTLHLRILWTQRRKHLYYFVAAECFSIVTFLLAVLLLPDMIDQDYLFSWSC
FT                   AWQVFVISLAIVIPIYLIRLLDTYILSNARMK"
FT                   /protein_id="XP_844301.1"
FT   gene            complement(<392499..>393092)
FT                   /note="synonym: Tb04.2L9.790; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656680"
FT                   /locus_tag="Tb927.4.1520"
FT   mRNA            complement(<392499..>393092)
FT                   /db_xref="GI:72387755"
FT                   /db_xref="GeneID:3656680"
FT                   /locus_tag="Tb927.4.1520"
FT                   /transcript_id="XM_839209.1"
FT   CDS_pept        complement(392499..393092)
FT                   /locus_tag="Tb927.4.1520"
FT                   /gene_family="HOG000260534" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387756"
FT                   /db_xref="GeneID:3656680"
FT                   /translation="MNPVGVACAAAPKPSTFDYFTERYYHQYVVKNCKGVEGNNCRLLV
FT                   HSNGICVLCLDETHRVVRAAKSSAGAVETNVASVVFGSGRGNSQLSSGSIHVVGKRKKQ
FT                   AAVCQVDTKICIITMSDGTVYHIPACVDGFVLELNSALQQHPNLLLDAPTAEGYIALIS
FT                   PNYSKVKFSEFTKLSAPTGGDVVEEEEEPEGLHK"
FT                   /protein_id="XP_844302.1"
FT   gene            complement(<393395..>396307)
FT                   /note="synonym: Tb04.2L9.800; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656677"
FT                   /locus_tag="Tb927.4.1530"
FT   mRNA            complement(<393395..>396307)
FT                   /db_xref="GI:72387757"
FT                   /db_xref="GeneID:3656677"
FT                   /locus_tag="Tb927.4.1530"
FT                   /transcript_id="XM_839210.1"
FT   CDS_pept        complement(393395..396307)
FT                   /locus_tag="Tb927.4.1530"
FT                   /gene_family="HOG000260535" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387758"
FT                   /db_xref="GeneID:3656677"
FT                   /translation="MWGGVKVRAHHRDIFRAWSASQNLETLRRQLYREPRPWYMAFKLH
FT                   QHRHLLSDYHCARLLSWCTAVVQLERRPVPKRKAYMYAQHVFQFMVHSHKVGKESYQEF
FT                   FRLCALGRDVTAAFRWQQYLVEAGQSFPLSHYTWLLHIAAASPSDEITEDMTEGVWEAY
FT                   LGRYCSPVKNDVTGQTAMAHFQPTTSEEQQELEGLFAAFKALKLRIEPTAKPELLQFID
FT                   NLPNTPQVVPGATSWPTVSRHTIFPHMEAAVPWEAPTLVQPRLRDSLLHPSFVADLERT
FT                   AWTGDVKGVVALVNEYRQRITAEKEQTSATKHRSGERDIWRHYADPAAVAFRRVLVEEG
FT                   GVTAELYHYLIVALSATQPSLALRTLRRMENAKLRVLDLTRAVMIVRSEGSSEEQLNLL
FT                   KEGLKSIEERCKIDEDYDVTREVELYWKFNYAEFFHYRNALNGVELYRILMEGLGPVRV
FT                   QELLVGAKGAVSYPSEDVVVFDEVFRIAVARHYRNCTGEAEVERALDEITQHMPKLDIS
FT                   LVGSCQHFDGYALPPSDAVATDITSLARKLLGYHTIYLLDSSFVESSEAFLGLGSLNEE
FT                   ENGGHSLVLVPYFCLRQISSVLDAPDGEVVSYDEALQEVGKEDQFIASQRLRSLYALLL
FT                   NDKGNVKRRVLHFSECLLSQIVTGAVDSAGSDNDHLLLVLAMVRAIAPKETNVVLCTDD
FT                   AHLVQRLRHDEVASLFAGQVNVLSSEPPEGAVIGEGGLVDDNPNLCVGLDFEPKLNFPA
FT                   APRRVTGAGEGSVKAADSAHLHTLCGEEVREGGVSWLDMLGDDEDSGKNSEGSVSALLP
FT                   VNLTENEEKSAQDQMKLMDMYESEHSVVPIGVRMAEASTLGSLFEQFDAVNPDAALERE
FT                   AAAAAAAAASRKEPGEAHKKHRRLAPLELEQLRNRGASNKQRYRLARRLSNLAGGRVPF
FT                   NFRYKVVEVDITDERNKTYRDAYSNAVAKKREAFKRHLQR"
FT                   /protein_id="XP_844303.1"
FT   repeat_region   396772..396805
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   397694..397713
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    398651..398674
FT                   /note="AT_rich"
FT   gene            complement(<398737..>400263)
FT                   /note="synonym: Tb04.2L9.850; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656685"
FT                   /locus_tag="Tb927.4.1540"
FT   mRNA            complement(<398737..>400263)
FT                   /db_xref="GI:72387759"
FT                   /db_xref="GeneID:3656685"
FT                   /locus_tag="Tb927.4.1540"
FT                   /transcript_id="XM_839211.1"
FT   CDS_pept        complement(398737..400263)
FT                   /locus_tag="Tb927.4.1540"
FT                   /gene_family="HOG000260536" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387760"
FT                   /db_xref="GeneID:3656685"
FT                   /translation="MLRVFSGSCLSLEHMETVRDFNLVKQPHVLGPGADYFTEDGQPVR
FT                   PQPCAHTLHKVFSGSTLDLNAACGEILSDEDVALSNGTRGSPHRAGQQGQQQQPKIAPG
FT                   ATVSTILSQLSSETEKERAKSLRSKTVVLIVGGVGYVSSHVVNKALEAGYSVRITGSGA
FT                   LTPQQQAALSSVGRDHEQRLSIFEADMTNTNSLRDALRGCKYVIHCGCPVSSTDKDTVE
FT                   FHLSAVQALFNAIRQAGKSTVKRVVIHGAASSVFHVTDPEPPSGAFDESCWNSVATNDT
FT                   DPIPYARIYFEKEAWRLKQMLGVELVVILPSITIGPSRTEEVSDAMKRIQHLATASSYF
FT                   PYAPNLHWNFVDVRDVAEAHVRALECQEVKDQRVIVSGGCFSFAEIGKLIRNEYPHLTP
FT                   PTRTANTLMTLIIGATHSQVSIRFLWRTLGVRKCLDTRKATTELGMKFTPMQETLRASI
FT                   EQMISAGELPPADGSVNARSVSRAGLVVTTMVAGLIGVAAWIVVRRRGKN"
FT                   /protein_id="XP_844304.1"
FT   gene            complement(<402146..>403495)
FT                   /note="synonym: Tb04.2L9.900; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656684"
FT                   /locus_tag="Tb927.4.1550"
FT   mRNA            complement(<402146..>403495)
FT                   /db_xref="GI:72387761"
FT                   /db_xref="GeneID:3656684"
FT                   /locus_tag="Tb927.4.1550"
FT                   /transcript_id="XM_839212.1"
FT   CDS_pept        complement(402146..403495)
FT                   /locus_tag="Tb927.4.1550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387762"
FT                   /db_xref="GeneID:3656684"
FT                   /translation="MELRCFLAHISSRPNEHHVDFPFPLSAAKAPVLGRHSPELYWHLG
FT                   NNPRCSRRVMTFAVEASEKETFDSADVHHAAATPIHPQVAYCLVLTCVGENPLTVVRRE
FT                   TVGNCSSLQAVEESRTTVLCRNESTILRVGDKVGIMNRVWMQVVLARICVSETVKGPPV
FT                   VQEADEGTQCYLPPGESECIVPLPTIYTNVPWKRLRHPVRSRLIGAAARQQQRVVTVRC
FT                   SPILAALPNTQAPLALNGSLNASMDVLSIEHEGESEAAANACASGTRTSGSGGRVSPRV
FT                   HPRMECDSASTAVTNTDRKWGTCSTFLGDSLDEKSLLNSLDEVHLKRRRMSLGDGSIMD
FT                   NRSTTSVPDTNSYMDTLDERLNEELCRLEKRTADAEQLISGRSMAVLGGSPPGHANETT
FT                   ERKVGVSIATTVSRDQLQMSSRLSGRNHGLSGAIVRRPVPADSQVVYYRH"
FT                   /protein_id="XP_844305.1"
FT   gene            complement(<404419..>406026)
FT                   /note="synonym: Tb04.2L9.910; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656678"
FT                   /locus_tag="Tb927.4.1560"
FT   mRNA            complement(<404419..>406026)
FT                   /db_xref="GI:72387763"
FT                   /db_xref="GeneID:3656678"
FT                   /locus_tag="Tb927.4.1560"
FT                   /transcript_id="XM_839213.1"
FT   CDS_pept        complement(404419..406026)
FT                   /locus_tag="Tb927.4.1560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387764"
FT                   /db_xref="GeneID:3656678"
FT                   /translation="MSDLNFERPFFMEFGDFKNGYNREEAEAGINEAIRKQRKLRLQSH
FT                   VEGIMLGCGIGEAAKQSVHKGVYKPQTTINPSLLCEEDAQPSAGGDEVNSNNGGSRPCP
FT                   PLDGAALLETSPSAVMKDFATVDVQVETLQEVAEQLDQNIRVARERIGQGCAPFTFEDV
FT                   LEALTIVLTVVEKGDPTVKVLLPIQPEGSEPLEGAEEVADFAYSNIVPLTVALSSTIYA
FT                   TEWMLQYTLTFINSIGVETEEEAQLHLELRARCVRLLGEINRFTAFAIAFKMKCEMYVA
FT                   FDDLRNETEFNIGGILDSVEEDLKETMQLQFPRRRRRVLKVQRSIFKRLQRALVLLHEL
FT                   DTCWTPVMMLQKVWKDEFLAESYERIYTIIAPTFFSATLGFVDSSLYIESDSSNSVPEP
FT                   NNPSCPIQRAPSQCSISRHGRQVGSAKPRVVAERQSKKLVLGQVKTLRVEEKRSFEKIS
FT                   YLVKGTVNRTVGMQLCLGARYSLVEFGEEHDKNWDFVANEPKDPQDVNAYVMELVKKFI
FT                   RILRQRTKNTDDTDALVP"
FT                   /protein_id="XP_844306.1"
FT   gene            complement(<406346..>407293)
FT                   /note="synonym: Tb04.2L9.920; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656682"
FT                   /locus_tag="Tb927.4.1570"
FT   mRNA            complement(<406346..>407293)
FT                   /db_xref="GI:72387765"
FT                   /db_xref="GeneID:3656682"
FT                   /locus_tag="Tb927.4.1570"
FT                   /transcript_id="XM_839214.1"
FT   CDS_pept        complement(406346..407293)
FT                   /locus_tag="Tb927.4.1570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387766"
FT                   /db_xref="GeneID:3656682"
FT                   /translation="MPLDSPVGVVGRRKDVFLSGLYAVKSNSESVTPNGNGNATDPKVS
FT                   ERLRSWADTISSPLTCTACKLRMRATERTLVYHLTTTYHIEHTSEGCFSFVFPVSACDG
FT                   TLTSLSARINKKIMMWELVRVVSPPSERPLVLCPAVFDAAAGMEGKAEQEEGERGTLYA
FT                   VASRASDVLDETERGVGNEIQLEIRWTTKSVRQLTNLPAIVIAYPFACAPCLPEEIVYQ
FT                   TVFSKVVKLVSSANSRDGTQALDWRLRGKYCTVHLSPEDTKIMLKPEDEIFVLTFYFEN
FT                   PMDGEQRDTTTTVVSFVIMVAILLWFLLTKDLEL"
FT                   /protein_id="XP_844307.1"
FT   gene            complement(<407935..>408564)
FT                   /note="synonym: Tb04.2L9.940; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656683"
FT                   /locus_tag="Tb927.4.1580"
FT   mRNA            complement(<407935..>408564)
FT                   /db_xref="GI:72387767"
FT                   /db_xref="GeneID:3656683"
FT                   /locus_tag="Tb927.4.1580"
FT                   /transcript_id="XM_839215.1"
FT   CDS_pept        complement(407935..408564)
FT                   /locus_tag="Tb927.4.1580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387768"
FT                   /db_xref="GeneID:3656683"
FT                   /translation="MSRGERGVAPAKRLNRRKRGVRRRRNRAQTKASIPAVHASFACHI
FT                   CSKNHWTVSCPRLRLSPRDYPLMDREKGCWKCAQRGHSSAQCQVKKYRCSDCGGLHDTR
FT                   DCEFDHKSEEWHEFFDSTTQHVFYCNSETGEVQWTPPTHKLDVVLWFCSNCSILLPTSV
FT                   PECVKCRVPRPHSKVSDAASSSSSSVSESGSDDGSDDEGSESASDN"
FT                   /protein_id="XP_844308.1"
FT   repeat_region   408698..408725
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<408940..>409995)
FT                   /note="synonym: Tb04.2L9.950; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656691"
FT                   /locus_tag="Tb927.4.1590"
FT   mRNA            complement(<408940..>409995)
FT                   /db_xref="GI:72387769"
FT                   /db_xref="GeneID:3656691"
FT                   /locus_tag="Tb927.4.1590"
FT                   /transcript_id="XM_839216.1"
FT   CDS_pept        complement(408940..409995)
FT                   /locus_tag="Tb927.4.1590"
FT                   /gene_family="HOG000260542" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387770"
FT                   /db_xref="GeneID:3656691"
FT                   /translation="MALHAAHRRALYLHHAKHLSQYSDAHDYYRLMMWCHDQHIFIHPT
FT                   VRIHRRPSPYRDHAFVVTEDVDRLTPLFAIPEALAIGFKDTSEAENNLRDEEREKEFNK
FT                   LNTGEQSDADICQFFFDSLGMIVSDLITSIGSPLTDPRWAFAELLGRVRSMKNAPYFED
FT                   DVVLDAEATGLADVLLQMIRNYINGGPLVGKVDRAQLRWAVSTCLSHSTPLVIGATRSI
FT                   GIIPMVHLFPHGGKNTNSLVVARTSQQSSATRMAAYFARHHQYDFMCEQDGKWIYVVPA
FT                   RALRAGEEICMQTMAPVCGKDSEAEKMWRLSCGTPPEDYVPSAAVAHQQDIITNELIRK
FT                   GEQIISTEYGK"
FT                   /protein_id="XP_844309.1"
FT   gene            complement(<410608..>411312)
FT                   /note="synonym: Tb04.2L9.970; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656690"
FT                   /locus_tag="Tb927.4.1600"
FT   mRNA            complement(<410608..>411312)
FT                   /db_xref="GI:72387771"
FT                   /db_xref="GeneID:3656690"
FT                   /locus_tag="Tb927.4.1600"
FT                   /transcript_id="XM_839217.1"
FT   CDS_pept        complement(410608..411312)
FT                   /locus_tag="Tb927.4.1600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387772"
FT                   /db_xref="GeneID:3656690"
FT                   /translation="MKENGVLGGVLVPRTRRFLVGGILFSLFVILLNLLIAYAVRRYYP
FT                   RSRAKKERRSRRRSGSGSGKNSGRGKHKERKRSDPKVILLVGMPGSGKSTWLKQYKGRC
FT                   DDSCRIVDEDELRVEITGKFDDFSKEDELCAAMINAIVRHISEKHNVVVESNRYVLDEK
FT                   FRKQIISTVPSCRLLVKEFDIKAHFAQARLAKDAEEGKRHHTYTETELEDWEVRQLEAK
FT                   ELFKKEGWSQMH"
FT                   /protein_id="XP_844310.1"
FT   gene            complement(<412095..>413174)
FT                   /note="synonym: Tb04.2L9.1000; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656689"
FT                   /locus_tag="Tb927.4.1610"
FT   mRNA            complement(<412095..>413174)
FT                   /db_xref="GI:72387773"
FT                   /db_xref="GeneID:3656689"
FT                   /locus_tag="Tb927.4.1610"
FT                   /transcript_id="XM_839218.1"
FT   CDS_pept        complement(412095..413174)
FT                   /locus_tag="Tb927.4.1610"
FT                   /gene_family="HOG000260416" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387774"
FT                   /db_xref="GeneID:3656689"
FT                   /translation="MIPPAKLNDFFNIVDDFLKKTFRDESFLFAAVKSRQYSESFPGEQ
FT                   LFFTSPPSATTDQPSDESLQAGGGELRKTQNFMYFSPRLIFNRDGGYHGKVKLHSGVHV
FT                   PQVCRFEQGIAVNSEGLASGSVKVSDLLEGMEVKGRLAVNTIAPPSKDVWSVAMDYQRR
FT                   DFYSTLNYQRNGLGSSDLLVDCGTKFFNLLAGAGFERQKVSFLEQQDHTAQLDVLYAGV
FT                   GFTGVNWSVGAKLVRANDMWSAARIAFYQRVVPDTSVACAYNFDMEESRVHVSLGFSQG
FT                   FRLRVPTILQQRACEQLDVWTAILPFVGAFKAESGGLCAATIRGIFNGVVHWGLVAQKN
FT                   VLVENSPIRFGLTLSVESG"
FT                   /protein_id="XP_844311.1"
FT   repeat_region   413440..413465
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   413966..414000
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttcg"
FT                   /rpt_type="tandem"
FT   gene            complement(<414313..>415758)
FT                   /note="synonym: Tb04.2L9.1030; phosphatidylinositol
FT                   4-phosphate 5-kinase alpha, putative"
FT                   /db_xref="GeneID:3656688"
FT                   /locus_tag="Tb927.4.1620"
FT   mRNA            complement(<414313..>415758)
FT                   /db_xref="GI:72387775"
FT                   /db_xref="GeneID:3656688"
FT                   /locus_tag="Tb927.4.1620"
FT                   /transcript_id="XM_839219.1"
FT   CDS_pept        complement(414313..415758)
FT                   /locus_tag="Tb927.4.1620"
FT                   /gene_family="HOG000260415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylinositol 4-phosphate 5-kinase alpha,
FT                   putative"
FT                   /note="similar to Phosphatidylinositol-4-phosphate 5-kinase
FT                   type II alpha (EC 2.7.1.149)(PIP5KII-alpha)
FT                   (1-phosphatidylinositol-4-phosphate
FT                   5-kinase)(PtdIns(4)P-5-kinase B isoform)
FT                   (Diphosphoinositide kinase). (Swiss-Prot:O70172) [Mus
FT                   musculus]; go_function: 1-phosphatidylinositol-4-phosphate
FT                   5-kinase activity [goid 0016308]; go_process:
FT                   phosphatidylinositol metabolism [goid 0046488]"
FT                   /db_xref="GI:72387776"
FT                   /db_xref="GeneID:3656688"
FT                   /translation="MPFNREILAAISFESGPLSSAEIAARRTPTEEPPKNLEVKSCDKR
FT                   DEPRQNEATINLIRCMKWALGQSITSISHPAKQRPLNPKRDFSIKTKINLDVGVEKPKP
FT                   GFCCSTAAATGVREQRNHHAPFYDAHGDSEEASHLDESDVESHDEVPNVPLAFVDYSPM
FT                   CYRHIREFFNIDHRAYRDVLLRSRWHSTPTPGKSAAQLFFCGRDWVIKTMTHEESKFLR
FT                   RILHRYYFFVLDHPYTLLPHFVGHHRLEINGEKMYIIIMQNVFVTGNTIHEKYDLKGST
FT                   VGRFATEAEKKKQTCTQKDLDINRPLHVGATRRNLLIEQMKMDCGFLNQCNIMDYSFLV
FT                   GIHVLPMYEAHRPAPSTGSREYLGGAAALATSALEPSYLLGMGETMQPMALNGHPTAAA
FT                   DSAPTDGRCFKADQGGMMSADHPGGRREIYYIGIIDILQEYNSRKSMETLVFGMLKDRQ
FT                   KISAVPPKEYAARFVSFVSSIIV"
FT                   /protein_id="XP_844312.1"
FT   repeat_region   415832..415853
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<416437..>418647)
FT                   /note="synonym: Tb04.2L9.1050; ribosomal RNA processing
FT                   protein 6"
FT                   /db_xref="GeneID:3656687"
FT                   /locus_tag="Tb927.4.1630"
FT   mRNA            complement(<416437..>418647)
FT                   /db_xref="GI:72387777"
FT                   /db_xref="GeneID:3656687"
FT                   /locus_tag="Tb927.4.1630"
FT                   /transcript_id="XM_839220.1"
FT   CDS_pept        complement(416437..418647)
FT                   /locus_tag="Tb927.4.1630"
FT                   /gene_family="HOG000260413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal RNA processing protein 6"
FT                   /note="identical to: B:CAC39261.1: Rrp6p homologue
FT                   {Trypanosoma brucei}; 99.6% identical to: GB:CAC39261.1:
FT                   Rrp6p homologue {Trypanosoma brucei;}; go_component:
FT                   nuclear exosome (RNase complex) [goid 0000176];
FT                   go_component: cytoplasmic exosome (RNase complex) [goid
FT                   0000177]; go_function: 3'-5' exonuclease activity [goid
FT                   0008408]; go_process: rRNA processing [goid 0006364];
FT                   go_process: cell growth [goid 0016049]"
FT                   /db_xref="GI:72387778"
FT                   /db_xref="GeneID:3656687"
FT                   /translation="MLLMLVSIHLFQTRGHARAEIFLPLTLSKGVGYMSGSLPQTKDLV
FT                   NGAFTLVKEYTKLTADLAEEDYDYHMAFPAFRHQITRHSEAVVSLMDKFCQLLPAKRRV
FT                   TLSSTGGKLTDPQRAAVMEAADSLLENVDGLLDELKGRRLSAKDQLSVKFGSELQGVVP
FT                   SSSYSVFNAAGVSVLRPQLTFEHPVDNSPTPFRPVYYDEKGVRHVGEPGVHPFAERIKA
FT                   VSVPSEQLLLKTETPYLSLVTCPLTFVDTVEDLEALVAVLLNETEIAVDLEHHDFYSYQ
FT                   GFTCLMQISTRTQDFIVDCLKVRANMYLMAPVFLQPNIVKVFHGAREDVRWLQKDFGLY
FT                   IVNLFDTSIALQNLHMPHSLAFAVDHFCQVKLNKKYQTADWRVRPIPAEMVSYAQQDTH
FT                   FLLYVYDRLKQLLLNCEARASVGNMLLHVFQESRLLSLERYEKPHLDPDVTYKQALGRS
FT                   LGGLSSSQLQVAREIFNWRDMAAREADDSPSAVMHISCVLSIATKLPTSANEVLKCCSP
FT                   VSVAVRTNVMKLLQIVKDAIGSADSLKDGANGDVKPKPLPNVGVALRYMGVHRSMTGTL
FT                   PSIEQRADPAFTVEDAHVVVRTEPSAWFETMRNVAAILRRKPYYPIALPGHDVVTRMSA
FT                   VKRAREVEEMKVKGEGEEEEKRVHVDAEEPTVERENSSERGEGMAGPCLHEGLEVKDEV
FT                   EEIDVPTQKPLELKEGAISLRQQYGTGSANRKKARLGKKNKS"
FT                   /protein_id="XP_844313.1"
FT   gene            complement(<419188..>420210)
FT                   /note="synonym: Tb04.2L9.1060; lipophosphoglycan
FT                   biosynthetic protein 2, putative"
FT                   /db_xref="GeneID:3656686"
FT                   /locus_tag="Tb927.4.1640"
FT   mRNA            complement(<419188..>420210)
FT                   /db_xref="GI:72387779"
FT                   /db_xref="GeneID:3656686"
FT                   /locus_tag="Tb927.4.1640"
FT                   /transcript_id="XM_839221.1"
FT   CDS_pept        complement(419188..420210)
FT                   /locus_tag="Tb927.4.1640"
FT                   /gene_family="HOG000260418" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipophosphoglycan biosynthetic protein 2,
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: UDP-galactose transporter activity [goid
FT                   0005459]; go_process: UDP-galactose transport [goid
FT                   0015785]"
FT                   /db_xref="GI:72387780"
FT                   /db_xref="GeneID:3656686"
FT                   /translation="MTARDGAVEVMASIVVYSIFSTVMTITNKLLVANYALNYPMGIIF
FT                   VESGTALLFAVMGKMMGWVYYPNFCSRVARKWLPLTLFFVAMLWSSIKSLETMSVAMHT
FT                   IMKNIAVVLTAIGDSQLYGTRVTPVMYLAFFFMSAGSYLCAMGDQWVTTWGMIWTTLNI
FT                   MATVGYTLYMKRLLGDVSKTIGRYGPVFYNNLLSMLVAFVIALPSMGSMIHTIRSISLP
FT                   PLLALTVAGTGPLLTFATFWCMEQTTPTTFSVVGVVNKVPMSVAGMVVFNQFPTKTGYV
FT                   GITLGLVGGVIYGCASRERDSGRVGPLLHVAGFSVWGRNTPLLTSSGKYEGRSRSEETI
FT                   "
FT                   /protein_id="XP_844314.1"
FT   repeat_region   421119..421147
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   421292..421331
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   421374..421406
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   421683..421709
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<421895..>423580)
FT                   /note="synonym: Tb04.2L9.1090; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656694"
FT                   /locus_tag="Tb927.4.1650"
FT   mRNA            complement(<421895..>423580)
FT                   /db_xref="GI:72387781"
FT                   /db_xref="GeneID:3656694"
FT                   /locus_tag="Tb927.4.1650"
FT                   /transcript_id="XM_839222.1"
FT   CDS_pept        complement(421895..423580)
FT                   /locus_tag="Tb927.4.1650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387782"
FT                   /db_xref="GeneID:3656694"
FT                   /translation="MPENPQRRDGAGNEVEPVPPLEGNVETSAPDAAEECQTSSTPTEA
FT                   VIMLDEPCRNLPKLHWQDFKLIGRCISFLGESVVNDETLFLHYEGYVSMVNKNTITLLN
FT                   VNRFTSDDFLKRRERLEQEKTKRNARREVKAQEGSSKEDEKDIVTRENIWGENNGSTEE
FT                   VDESGVASGAPADENNRRSMFLSLFYVNSRRGKGDAETQSERQKLICGAGSIGPIPYVT
FT                   FARSAIHDVVVGNDQRSSFMSIFRHSSKKFFDMQCLRMYVRRFLVSASRENKEQSLTLR
FT                   SFVESKCNYKGIDDNVLVSVAKEELAALANIDKNIAKCSSRPTDARVGIQLQLFRAPPG
FT                   LFSGTGILFLTRLPMQTFWLAVVQSLMTLMLLTVAANTFIGGRNGIVNGYMFRYISPIL
FT                   IGCFHCLFASAVTAFHAIRMRMPVRFSPHAMLRAAAVGIAIGFCSLALLAVAEAISFPR
FT                   IQSYIRERAEDPIALCAYYKSNECRGYNENCDVDRDSPTCLWGVCKGEWKGAPCTRKLN
FT                   RTIVMGFVPFGVLSILLFGMFVIDGFLHYRLFRVSRLIAAITSR"
FT                   /protein_id="XP_844315.1"
FT   repeat_region   423747..423769
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   423868..423916
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   424372..424399
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttta"
FT                   /rpt_type="tandem"
FT   misc_feature    424541..424590
FT                   /note="GA-rich"
FT   repeat_region   425007..425089
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   425731..425786
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<425933..>427090)
FT                   /note="synonym: Tb04.2L9.1150; mitochondrial carrier
FT                   protein, putative"
FT                   /db_xref="GeneID:3656693"
FT                   /locus_tag="Tb927.4.1660"
FT   mRNA            complement(<425933..>427090)
FT                   /db_xref="GI:72387783"
FT                   /db_xref="GeneID:3656693"
FT                   /locus_tag="Tb927.4.1660"
FT                   /transcript_id="XM_839223.1"
FT   CDS_pept        complement(425933..427090)
FT                   /locus_tag="Tb927.4.1660"
FT                   /gene_family="HOG000260411" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /note="go_component: mitochondrial inner membrane [goid
FT                   0005743]; go_function: ATP:ADP antiporter activity [goid
FT                   0005471]; go_function: binding [goid 0005488]; go_process:
FT                   transport [goid 0006810]"
FT                   /db_xref="GI:72387784"
FT                   /db_xref="GeneID:3656693"
FT                   /translation="MGVEVADCSSGASAQNITGSEAMTVGHEKAKEQHMHVKRDSYTTA
FT                   ATFVAGGVAGACSRTLTAPLDRIKIIVQEGHLVSGTGKKSLLRPAQLIDVFHLIRNDGG
FT                   WSAFWRGNGVNCLKAGPEFALVFTLRRYFLSLYEDSLDEETARVTEWEAAMKATGSEPI
FT                   AYDLSTVSVLPAPLNRWFTLTSIPRILLNFLIGAWAGFGAQLTLYPLEVIKTRMAVSRR
FT                   SEYPGGMRQVIYDTYKNSGISGFYRGLTPNMVGIFIYRGLEVGIYSTAQQQMIMYRMNN
FT                   YGMSRHDSSLSSIETAAVSMFASMFAQTVSYPLNVVRTRLQTQGTNGRAVKYKGMTDCF
FT                   VKMVRTKGVGSLFSGISANYLKAVPASASMFVVFEKVQSILVGDD"
FT                   /protein_id="XP_844316.1"
FT   repeat_region   427258..427291
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   427490..427516
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   427516..427556
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   427998..428023
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<428389..>428850)
FT                   /note="synonym: Tb04.2L9.1160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656692"
FT                   /locus_tag="Tb927.4.1670"
FT   mRNA            complement(<428389..>428850)
FT                   /db_xref="GI:72387785"
FT                   /db_xref="GeneID:3656692"
FT                   /locus_tag="Tb927.4.1670"
FT                   /transcript_id="XM_839224.1"
FT   CDS_pept        complement(428389..428850)
FT                   /locus_tag="Tb927.4.1670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Damage response protein 1.
FT                   (Swiss-Prot:Q12091) [Saccharomyces cerevisiae;]"
FT                   /db_xref="GI:72387786"
FT                   /db_xref="GeneID:3656692"
FT                   /translation="MDKAVGKLVKVGKVLAVAAAVSVISRAIIQRLYKLHKIHCHRGQG
FT                   IRPVKPIVQRSFTADELQEYDGVRKSDVYVSVKGVVYEVAPQFYGPGQPYHIYAGREIS
FT                   RCLAKSDLTGDEINKDWRPGSTEEELQQLEGWVKKFESRYPVVGWFIWE"
FT                   /protein_id="XP_844317.1"
FT   repeat_region   429315..429365
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    429370..429434
FT                   /note="CT-rich"
FT   gene            complement(<429633..>431042)
FT                   /note="synonym: Tb04.2L9.1180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656695"
FT                   /locus_tag="Tb927.4.1680"
FT   mRNA            complement(<429633..>431042)
FT                   /db_xref="GI:72387787"
FT                   /db_xref="GeneID:3656695"
FT                   /locus_tag="Tb927.4.1680"
FT                   /transcript_id="XM_839225.1"
FT   CDS_pept        complement(429633..431042)
FT                   /locus_tag="Tb927.4.1680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387788"
FT                   /db_xref="GeneID:3656695"
FT                   /translation="MPPKRAGSRKRKEVLPDPQTLPSGTCNYYIGEWFVNKEIDSLSDI
FT                   SHSVVEAHTKSNGEVSVLPRTVVLIPPATLGDVNTHYAVEVADNLRVESIPRSAVEPKP
FT                   KAIPVEGEESFDPLSTREKKEEEGDSVVPDDTLPSAAAVQKVGSSEAAAEVVIQGTVHI
FT                   EGIVPRIVITPDLPEPPVVPKKKKSDARKNSKRKEEEQKRLAEEARIYEEKVNAAVAAA
FT                   REEEEYRMQFAHPERWPNVQFANMTFNGQVIVAHAHVKFRNCCFTSRSKDTTQLLVAQY
FT                   CKVECERCTFDQPQKGSVYGWPMSNIILTECYFKGASSSRDGCTLPVANACESRPTCVG
FT                   LHTDACKITVKDCEFSALGTGVIMRGTFPGSCAGQPAMSIKNCKFYGIYAAGIVLDSVN
FT                   GVELAGNKVDECEYYALDCVKGEGIRVYQNTFLSKIRVQKGAHARFLNNETGTIPFTVE
FT                   EVENPNWQPVY"
FT                   /protein_id="XP_844318.1"
FT   gene            complement(<431770..>432711)
FT                   /note="synonym: Tb04.2L9.1190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656696"
FT                   /locus_tag="Tb927.4.1690"
FT   mRNA            complement(<431770..>432711)
FT                   /db_xref="GI:72387789"
FT                   /db_xref="GeneID:3656696"
FT                   /locus_tag="Tb927.4.1690"
FT                   /transcript_id="XM_839226.1"
FT   CDS_pept        complement(431770..432711)
FT                   /locus_tag="Tb927.4.1690"
FT                   /gene_family="HOG000260408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387790"
FT                   /db_xref="GeneID:3656696"
FT                   /translation="MSDVDDLIEELFPKKEGGRAPPEGKGGAACEPPASQSNWDDTDEA
FT                   NSEAETTTRNRGTSVSLEAAASTTANVGDGRGEDFDDSDESVEETVMGGRHTVPFPPTP
FT                   GNMSMACNSKCFVTNVGSGELRHPSVAQLLLTGEGKYDKCSSNEQLLLRKGAFHALKAD
FT                   AGNGCTDKTADEDGRKGGCPFILCRKCNYTVIRLQDAEWDDEEGKMDLYLTVRNFYPDW
FT                   SRLASSLPVGQMRRGEQNTVLKTCPDSAAYCCQCSWLTVKCAQEVIDTRVTDHTKFVGK
FT                   ELTCCFATQLPLISGEKRRPPLWVCGGHVPKH"
FT                   /protein_id="XP_844319.1"
FT   misc_feature    433400..433463
FT                   /note="A-rich"
FT   gene            complement(<434137..>436215)
FT                   /note="synonym: Tb04.2L9.1220; protein kinase, putative"
FT                   /db_xref="GeneID:3656697"
FT                   /locus_tag="Tb927.4.1700"
FT   mRNA            complement(<434137..>436215)
FT                   /db_xref="GI:72387791"
FT                   /db_xref="GeneID:3656697"
FT                   /locus_tag="Tb927.4.1700"
FT                   /transcript_id="XM_839227.1"
FT   CDS_pept        complement(434137..436215)
FT                   /locus_tag="Tb927.4.1700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72387792"
FT                   /db_xref="GeneID:3656697"
FT                   /translation="MNRTLLGLVDNKRYVAAGLMNAQGNRSLNRLMTNSVPPSSMAGDE
FT                   RGNSARCSGKNGDDAGKDGGSNKSAKVSAHSPPRKPAPKAAKTRVTIGMRLKKWVVTGR
FT                   IGAGSFGETFTAVEVDRSSARSEDLDLAHGASSHGLTDLPTTSGEEVCIKVEQENKNVL
FT                   RVEAAALKKMQPCPYVARYLGSGNSAGMNFIVMQRLGPNLADLRRSTPQCMFSIHTTLH
FT                   LGISCLKCIQGVHELGIVHRDVKPSNFVIGLGGSSDPRQCYIVDFGLARRFRRPTGEVR
FT                   PPRANAGFRGTSRYASLASHRQQELGRVDDIWSLLFMLIEFITGTLPWRKHKEKEDIGQ
FT                   CKEQVIGPELIKNLPQEFGPFLEHLQTLKYEDEPKYDMLFSLMERAMERGGYPRNQRLD
FT                   WEPEEEDTPPDDVPLSSTGSLNSETTSCVNDVDSGCFIEKFTSKESSPKGRLLPPPPPS
FT                   RRFMPPPNAANAAVKRPTSAGRLMPPSPHIGENEDKYIPGSTRQEELRSNIRMSDIHVS
FT                   LDITRCDGGMNDATALSVSPTNPPPPPPPPLPPAPLAKNGGNNRRRKKKRRGGAANRDR
FT                   CKERHATLEVSEDLDVGSTFSPCEVESSPRNRRRGPPDQAVAHVAIGGIQNTRGHSASP
FT                   EPPPPFQREAKQGATLETKSIPSRSPTVQNDNKLVRAEGSVGKRRRKEGSTCTCHCM"
FT                   /protein_id="XP_844320.1"
FT   repeat_region   434567..434599
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gga"
FT                   /rpt_type="tandem"
FT   misc_feature    436857..436877
FT                   /note="AT_rich"
FT   gene            complement(<436987..>437730)
FT                   /note="synonym: Tb04.2L9.1230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656699"
FT                   /locus_tag="Tb927.4.1710"
FT   mRNA            complement(<436987..>437730)
FT                   /db_xref="GI:72387793"
FT                   /db_xref="GeneID:3656699"
FT                   /locus_tag="Tb927.4.1710"
FT                   /transcript_id="XM_839228.1"
FT   CDS_pept        complement(436987..437730)
FT                   /locus_tag="Tb927.4.1710"
FT                   /gene_family="HOG000260406" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387794"
FT                   /db_xref="GeneID:3656699"
FT                   /translation="MAMRDVIGDPDLLLRKTPANPKYEHVKPVVETGMTAELARFMKNT
FT                   GAALYRVSGEPFMRIRTRLIGDFVQKQQSQSGEIKDGGFAHPMDEYRAPDTQLPKEYLI
FT                   LDVRSEEEYAACHIKGALHYPKRRMVHAINPLLPEMFNFKNKENKLIVLYDLEEEMTIA
FT                   QGIGQNVFEKGIDNLAVMTGGLREFVQDYADCIVGESPVPIVPRDTRLLKRAEAVSAAR
FT                   SETQRSAFSHKPKSLSNSLAKPRPR"
FT                   /protein_id="XP_844321.1"
FT   gene            complement(<438498..>439547)
FT                   /note="synonym: Tb04.2L9.1240; nucleoside diphosphate
FT                   kinase, putative"
FT                   /db_xref="GeneID:3656700"
FT                   /locus_tag="Tb927.4.1720"
FT   mRNA            complement(<438498..>439547)
FT                   /db_xref="GI:72387795"
FT                   /db_xref="GeneID:3656700"
FT                   /locus_tag="Tb927.4.1720"
FT                   /transcript_id="XM_839229.1"
FT   CDS_pept        complement(438498..439547)
FT                   /locus_tag="Tb927.4.1720"
FT                   /gene_family="HOG000260402" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside diphosphate kinase, putative"
FT                   /EC_number="2.7.4.6"
FT                   /note="similar to Nucleoside diphosphate kinase (EC
FT                   2.7.4.6) (NDK) (NDP kinase)(Nucleoside-2-P kinase)
FT                   (Swiss-Prot:Q9QXL7) [Rattus norvegicus]; go_function:
FT                   nucleoside-diphosphate kinase activity [goid 0004550];
FT                   go_function: ATP binding [goid 0005524]; go_process: GTP
FT                   biosynthesis [goid 0006183]; go_process: UTP biosynthesis
FT                   [goid 0006228]; go_process: CTP biosynthesis [goid
FT                   0006241]"
FT                   /db_xref="GI:72387796"
FT                   /db_xref="GeneID:3656700"
FT                   /translation="MARSLQDPRLSFYCEQYDHIAHRMNHYVLQFYFEDRTVEIREVTK
FT                   NRLHLKRAHFPHLNRDDFKVGSSLSLLGGVIKLTAYADEVTRELCGERGEVTAVMFGEQ
FT                   LLPQLGRCLAVLTEECGFVALEMQMAWLPVETAAAYGVPPDLVEGRIVVVKCANTNALQ
FT                   RGIDFMARMPGARAAESVEEVGRWEQIVEKAKEQPVAILGDPNSTVVIIKPHALQKLAG
FT                   GVIVQQLIDAGLEISGISLTNMTSQQANELLKPYKGVLPDFPDTMRSLMGTVWVLQFVS
FT                   LDEGVDVVSVAREVCGPFDPVIAKELRPTSIRARFGVDRAHNAVHCCDLHEEGPLYSNF
FT                   FFRPEDVDE"
FT                   /protein_id="XP_844322.1"
FT   gene            complement(<440217..>440696)
FT                   /note="synonym: Tb04.2L9.1250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656698"
FT                   /locus_tag="Tb927.4.1730"
FT   mRNA            complement(<440217..>440696)
FT                   /db_xref="GI:72387797"
FT                   /db_xref="GeneID:3656698"
FT                   /locus_tag="Tb927.4.1730"
FT                   /transcript_id="XM_839230.1"
FT   CDS_pept        complement(440217..440696)
FT                   /locus_tag="Tb927.4.1730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387798"
FT                   /db_xref="GeneID:3656698"
FT                   /translation="MDTECLRARHSECIDLASVQLRRQLMDSGIPFTEAEIAALPARFV
FT                   ELLISRLEMFRQREVETRAAVDKCRRETEVEEMRFEQLREATERVQGEKRIISSKISAA
FT                   VSEYMREDKLEKEKQRERHNELQEVFRQVEKKEAEHRREIIEMERLRKMLKKVTK"
FT                   /protein_id="XP_844323.1"
FT   gene            complement(<441720..>442988)
FT                   /note="synonym: Tb04.2L9.1260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656703"
FT                   /locus_tag="Tb927.4.1740"
FT   mRNA            complement(<441720..>442988)
FT                   /db_xref="GI:72387799"
FT                   /db_xref="GeneID:3656703"
FT                   /locus_tag="Tb927.4.1740"
FT                   /transcript_id="XM_839231.1"
FT   CDS_pept        complement(441720..442988)
FT                   /locus_tag="Tb927.4.1740"
FT                   /gene_family="HOG000260399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72387800"
FT                   /db_xref="GeneID:3656703"
FT                   /translation="MPLLYASRAKHTRFKSIVQRTRRLLCNGASGANGIRKLSRGCGIA
FT                   VDSGGQSMEKAKFVEALEESGVSLDSEDIEAIVHVLDRSGDGVLDPTDFIAALRRNLTP
FT                   LKLTWITRVWYTFTQSKDGSVYIDEVLSSYNAAGHPDVVQNIRSEQGVRSEFEAAFSTT
FT                   TNPDGAITRQEFEQYCSGVAALCANDLEFLTLMRGVWPASVRTPLDEETMRTHREQNPC
FT                   NMTFSSYQTAAEKGAVTDVRTTVAVVDDIILSSHRPVVIQSPLAVRQLSIALRRQDVQR
FT                   NFFLSRETFLEVLRGHRLYLKDPESALTVLDTAGDGSVDYLLYMNLLLPPLPPARLMML
FT                   ERLWELFPKDTCGTADVIELHKRFSAEDGEEQDAFLTAWDVRQALYRRFTFEEIVEWHT
FT                   PLSAMFELDNDFETMLKKRWDFS"
FT                   /protein_id="XP_844324.1"
FT   gene            complement(<443538..>444347)
FT                   /note="synonym: Tb04.2L9.1280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656702"
FT                   /locus_tag="Tb927.4.1750"
FT   mRNA            complement(<443538..>444347)
FT                   /db_xref="GI:72387801"
FT                   /db_xref="GeneID:3656702"
FT                   /locus_tag="Tb927.4.1750"
FT                   /transcript_id="XM_839232.1"
FT   CDS_pept        complement(443538..444347)
FT                   /locus_tag="Tb927.4.1750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387802"
FT                   /db_xref="GeneID:3656702"
FT                   /translation="MFRGSGQASTVLGGASYTRNEVVYEPLPKNDKHRLRRREVERFRR
FT                   APLPPLRPRWNASVADEAHPFPQRPLMHTLEYYKTDEQMMCEAGFLDSIVEKPRSTVVA
FT                   KWHPETTKVASHASTAARSCTPLSNRSFLERVFQQESVEQKVPQWEWVPSTLTGTIPRH
FT                   TFRGIASKFAGTPVSFPTVHGNEYVNPPRRVQMLNELIREKKRSKRAPSKISALPHVGG
FT                   FKVPHTFKMSNIDEWWPLDPTIPLRAPKEPELNATVTSREMSASGSR"
FT                   /protein_id="XP_844325.1"
FT   gene            complement(<445153..>445626)
FT                   /note="synonym: Tb04.2L9.1300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656701"
FT                   /locus_tag="Tb927.4.1760"
FT   mRNA            complement(<445153..>445626)
FT                   /db_xref="GI:72387803"
FT                   /db_xref="GeneID:3656701"
FT                   /locus_tag="Tb927.4.1760"
FT                   /transcript_id="XM_839233.1"
FT   CDS_pept        complement(445153..445626)
FT                   /locus_tag="Tb927.4.1760"
FT                   /gene_family="HOG000260397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387804"
FT                   /db_xref="GeneID:3656701"
FT                   /translation="MLRLTRPFLFITKIAKISRPPASGYEIAELPNEKVFTDFLDHHKT
FT                   RCVVAILHTGSLHRRVGDGAETSIAEDPLTRSFISSINAVNLGNPNEVKLALVPGPRAK
FT                   KMVNEYGVLTFPTVLIFLDGKCVERVVGARVRETAIKSLFTLRNAGRNIFSRE"
FT                   /protein_id="XP_844326.1"
FT   gene            complement(<446116..>446352)
FT                   /note="synonym: Tb04.2L9.1309; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656709"
FT                   /locus_tag="Tb927.4.1770"
FT   mRNA            complement(<446116..>446352)
FT                   /db_xref="GI:72387805"
FT                   /db_xref="GeneID:3656709"
FT                   /locus_tag="Tb927.4.1770"
FT                   /transcript_id="XM_839234.1"
FT   CDS_pept        complement(446116..446352)
FT                   /locus_tag="Tb927.4.1770"
FT                   /gene_family="HOG000260396" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387806"
FT                   /db_xref="GeneID:3656709"
FT                   /translation="MFRVSRRMLTGGFEGHKPGMENKSLKDKAKGELIKMLKIQLVLVP
FT                   LVVGWVMIMYPQPSPEEEKRLRAEYEKNAGWKT"
FT                   /protein_id="XP_844327.1"
FT   gene            complement(<447058..>448200)
FT                   /note="synonym: Tb04.2L9.1320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656704"
FT                   /locus_tag="Tb927.4.1780"
FT   mRNA            complement(<447058..>448200)
FT                   /db_xref="GI:72387807"
FT                   /db_xref="GeneID:3656704"
FT                   /locus_tag="Tb927.4.1780"
FT                   /transcript_id="XM_839235.1"
FT   CDS_pept        complement(447058..448200)
FT                   /locus_tag="Tb927.4.1780"
FT                   /gene_family="HOG000260395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387808"
FT                   /db_xref="GeneID:3656704"
FT                   /translation="MHKLTQLLRYRKTEDELVESPSVDLTLSFSAGGWLQMYHFGGAQA
FT                   IVDSGLLEKLAAEGKRVRFCGCSAGSLAATMLVSKMHCFEKVRERVIMYGEHYRSSWIY
FT                   LFCMINYLKDSLDMFGKHMRDLENNPELNGKLNDGSLEIYVTKLPYIKGKVITTFKNYD
FT                   EIVESMLASCCLAPLVGMPFKLRSTGEWVCDGALTTVTPRMGEPSTITVSPFYYSSATI
FT                   HPTVFVPVWWGLCPPAEATHRDLFTLGYNDMLKGLMACGHVSKEVGEPLLKPDVSGTFK
FT                   DMKRIGIFHHWAGRPLLLFVRLVVCFFIYFELCLACMACIMRSLLRVDREPLRNMRANV
FT                   VNMLTFRTLRRLLFNQDVQGSDQHLERTSCIFRVFRPIVL"
FT                   /protein_id="XP_844328.1"
FT   misc_feature    448355..448376
FT                   /note="AT_rich"
FT   gene            complement(<448465..>449907)
FT                   /note="synonym: Tb04.2L9.1330; ribosomal protein L3,
FT                   putative"
FT                   /db_xref="GeneID:3656705"
FT                   /locus_tag="Tb927.4.1790"
FT   mRNA            complement(<448465..>449907)
FT                   /db_xref="GI:72387809"
FT                   /db_xref="GeneID:3656705"
FT                   /locus_tag="Tb927.4.1790"
FT                   /transcript_id="XM_839236.1"
FT   CDS_pept        complement(448465..449907)
FT                   /locus_tag="Tb927.4.1790"
FT                   /gene_family="HOG000107319" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L3, putative"
FT                   /note="similar to GB:AAF62506.1:  ribosomal protein L3
FT                   {Trypanoplasma borreli}; go_component: organellar large
FT                   ribosomal subunit [goid 0000315]; go_component:
FT                   intracellular [goid 0005622]; go_component: cytosolic large
FT                   ribosomal subunit (sensu Eukaryota) [goid 0005842];
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387810"
FT                   /db_xref="GeneID:3656705"
FT                   /translation="MLTLLNLFRLINRTVTFSPFLSLFSLSVIITFTLLSHIIARIALG
FT                   TSEHTNMSHCKFEHPRHGHLGFLPRKRSRQIRGRARSFPKDDPSQKPHLTSFMVYKAGM
FT                   THIVRDVDRPGSKVNKKEVVEPVTILEAPPMVVVGIVGYRQTPVGHKTIGTVWAHHTSV
FT                   EFRRRFYKNWKQSAQLAFTKRKQFARTTEGRLAEARTLKAFEKKADIIRVVAHTQLRKL
FT                   RNNRVGVKKAHVSEIQINGGTIAQKIELAKSLLEKEVRIDSVFQQSEACDVCAVTKGHG
FT                   FTGVVKRWGVACLPRKTHRGLRKVACIGAWHPSRVMYTVARAGQHGYHHRTHLNKKIYQ
FT                   LGRAVSMEPNQATTAYDLTAKTITPMGGFVGYGTVRNDYVMLKGSVAGPRRRVITLRRP
FT                   MAPQTSRKLTEKITLKFIDTSSKIGHGRFQTKKEKSQWYGPLKKDRIRREERLRKERAA
FT                   RAAERKAKGGATTTAAPRKSKK"
FT                   /protein_id="XP_844329.1"
FT   misc_feature    449995..450030
FT                   /note="AT_rich"
FT   gene            complement(<450119..>451408)
FT                   /note="synonym: Tb04.2L9.1340; ribosomal protein L3,
FT                   mitochondrial, putative"
FT                   /db_xref="GeneID:3656707"
FT                   /locus_tag="Tb927.4.1800"
FT   mRNA            complement(<450119..>451408)
FT                   /db_xref="GI:72387811"
FT                   /db_xref="GeneID:3656707"
FT                   /locus_tag="Tb927.4.1800"
FT                   /transcript_id="XM_839237.1"
FT   CDS_pept        complement(450119..451408)
FT                   /locus_tag="Tb927.4.1800"
FT                   /gene_family="HOG000107319" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L3, mitochondrial, putative"
FT                   /note="similar to GB:AAF62506.1:  ribosomal protein L3
FT                   {Trypanoplasma borreli}; go_component: organellar large
FT                   ribosomal subunit [goid 0000315]; go_component:
FT                   intracellular [goid 0005622]; go_component: cytosolic large
FT                   ribosomal subunit (sensu Eukaryota) [goid 0005842];
FT                   go_function: structural constituent of ribosome [goid
FT                   0003735]; go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387812"
FT                   /db_xref="GeneID:3656707"
FT                   /translation="MSHCKFEHPRHGHLGFLPRKRSRQIRGRARSFPKDDPSQKPHLTS
FT                   FMVYKAGMTHIVRDVDRPGSKVNKKEVVEPVTILEAPPMVVVGIVGYRQTPVGHKTIGT
FT                   VWAHHTSVEFRRRFYKNWKQSAQLAFTKRKQFARTTEGRLAEARTLKAFEKKADIIRVV
FT                   AHTQLRKLRNNRVGVKKAHVSEIQINGGTIAQKIELAKSLLEKEVRIDSVFQQSEACDV
FT                   CAVTKGHGFTGVVKRWGVACLPRKTHRGLRKVACIGAWHPSRVMYTVARAGQHGYHHRT
FT                   HLNKKIYQLGRAVSMEPNQATTAYDLTAKTITPMGGFVGYGTVRNDYVMLKGSVAGPRR
FT                   RVITLRRPMAPQTSRKLTEKITLKFIDTSSKIGHGRFQTKKEKSQWYGPLKKDRIRREE
FT                   RLRKERAARAAERKAKGGATTTAAPRKSKK"
FT                   /protein_id="XP_844330.1"
FT   gene            complement(<452480..>452824)
FT                   /note="synonym: Tb04.2L9.1360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656706"
FT                   /locus_tag="Tb927.4.1810"
FT   mRNA            complement(<452480..>452824)
FT                   /db_xref="GI:72387813"
FT                   /db_xref="GeneID:3656706"
FT                   /locus_tag="Tb927.4.1810"
FT                   /transcript_id="XM_839238.1"
FT   CDS_pept        complement(452480..452824)
FT                   /locus_tag="Tb927.4.1810"
FT                   /gene_family="HOG000260394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387814"
FT                   /db_xref="GeneID:3656706"
FT                   /translation="MLSSTALLLRGQYKTRLKKRMVGFIPKVIPRKIKNNMVALRSEAN
FT                   TGHMEGYLKTETERLDATGRKVQKVLWDPVLQRHCLFKETKIKGPFMTKSAIAKKVDFP
FT                   IGGAEKMLKK"
FT                   /protein_id="XP_844331.1"
FT   misc_feature    453010..548662
FT                   /note="sequence corresponds to BAC RPCI93-29M18"
FT   gene            complement(<453193..>455160)
FT                   /note="synonym: Tb04.29M18.70; selenocysteine-tRNA-specific
FT                   elongation factor, putative"
FT                   /db_xref="GeneID:3656708"
FT                   /locus_tag="Tb927.4.1820"
FT   mRNA            complement(<453193..>455160)
FT                   /db_xref="GI:72387815"
FT                   /db_xref="GeneID:3656708"
FT                   /locus_tag="Tb927.4.1820"
FT                   /transcript_id="XM_839239.1"
FT   CDS_pept        complement(453193..455160)
FT                   /locus_tag="Tb927.4.1820"
FT                   /gene_family="HOG000247007" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="selenocysteine-tRNA-specific elongation factor,
FT                   putative"
FT                   /note="similar to SP:Q9JHW4:  Selenocysteine-specific
FT                   elongation factor (Elongation factor sec)(mSelB). {Mus
FT                   musculus} ; similar to Selenocysteine-specific elongation
FT                   factor (Elongation factor sec). (Swiss-Prot:P57772) [Homo
FT                   sapiens;]; go_component: nucleus [goid 0005634];
FT                   go_component: cytoplasm [goid 0005737]; go_function:
FT                   translation elongation factor activity [goid 0003746];
FT                   go_function: GTPase activity [goid 0003924]; go_function:
FT                   GTP binding [goid 0005525]; go_process: protein
FT                   biosynthesis [goid 0006412]; go_process: translational
FT                   elongation [goid 0006414]"
FT                   /db_xref="GI:72387816"
FT                   /db_xref="GeneID:3656708"
FT                   /translation="MTEVNDVASVNINIGILGHVDSGKTSLARALSSTASTAAFDKSPE
FT                   SQRRGITLDLGFSATCVPTEGIAPDLFNAGIQQVQCTFVDCPGHASLIRTVLGGAQIID
FT                   MMILVIDACKGIQTQTAECIVIGEVLCKPLVLVINKVDAIQGSTSEEKRAAIDKLRKRL
FT                   QKTFERTRWPSVAMVEVAAAPRREESGGTTCEGCMMSPINVEKVLPAVLSLVDADTIKR
FT                   NKEAPLRPEDFVMMVDHCFALKGQGTVFTGTILRGQVSVGDSVVIPESHVVKKVKGLQV
FT                   FRKPVQMARRGDRVGLSVVQFDAEGMERGLLCSALQQQQRQRSRADQAVHPVPVFESAS
FT                   VMVAEVSRVRFHQLPCNVHTKFHINIGHSTVMGTMRFFSRPTVCLPSDSQAGEELAEEP
FT                   PFDLMQESQYVEELGEEAFITFECPSEDKHRWPGRPIAVKRGPLTYFAIVLLEKPILAA
FT                   IGTPLIAARLDVERENMCRIALAGRVRALLHDDKDDAVMWRSMPIVRYKSRSLVVERVV
FT                   SDRSCIASGVVTSEMHEARSGGGMSTNKKERDTKVKDALHAEVQKFIGLTVYFRPTSGD
FT                   DGCCVNENGPGGLREGIIDSAFGKTGKVKLVFKEPVFAVDDRGAEAGKGKRNEVIFLSE
FT                   GVVELTLKKYPLALHSQLQQ"
FT                   /protein_id="XP_844332.1"
FT   gene            complement(<455636..>455944)
FT                   /note="synonym: Tb04.29M18.80; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656712"
FT                   /locus_tag="Tb927.4.1830"
FT   mRNA            complement(<455636..>455944)
FT                   /db_xref="GI:72387817"
FT                   /db_xref="GeneID:3656712"
FT                   /locus_tag="Tb927.4.1830"
FT                   /transcript_id="XM_839240.1"
FT   CDS_pept        complement(455636..455944)
FT                   /locus_tag="Tb927.4.1830"
FT                   /gene_family="HOG000280990" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387818"
FT                   /db_xref="GeneID:3656712"
FT                   /translation="MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLK
FT                   TNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVVGGMDYVLNDGDTVEFISTLHGG"
FT                   /protein_id="XP_844333.1"
FT   repeat_region   456426..456448
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    456864..456888
FT                   /note="AT_rich"
FT   misc_feature    457117..457226
FT                   /note="T-rich"
FT   repeat_region   457227..457247
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    457435..457486
FT                   /note="A-rich"
FT   misc_feature    457602..457728
FT                   /note="CT-rich"
FT   repeat_region   458020..458039
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   458708..458742
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   458821..458842
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaac"
FT                   /rpt_type="tandem"
FT   repeat_region   458859..458899
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    459113..459136
FT                   /note="AT_rich"
FT   repeat_region   459379..459426
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<459437..>461758)
FT                   /note="synonym: Tb04.29M18.130; zinc carboxypeptidase,
FT                   putative"
FT                   /db_xref="GeneID:3656711"
FT                   /locus_tag="Tb927.4.1840"
FT   mRNA            complement(<459437..>461758)
FT                   /db_xref="GI:72387819"
FT                   /db_xref="GeneID:3656711"
FT                   /locus_tag="Tb927.4.1840"
FT                   /transcript_id="XM_839241.1"
FT   CDS_pept        complement(459437..461758)
FT                   /locus_tag="Tb927.4.1840"
FT                   /gene_family="HOG000260388" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc carboxypeptidase, putative"
FT                   /note="metallo-peptidase, Clan MC, Family M14: curated by
FT                   J. Mottram; go_function: carboxypeptidase A activity [goid
FT                   0004182]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:72387820"
FT                   /db_xref="GeneID:3656711"
FT                   /translation="MMVEAKVQKSLINSESLAGAARGTALGDAREEDPANWAPSPPPNN
FT                   QREFEFPEDGLSFSSKFDSGNLIQVERTGPFRYLMYTAPDCGNSPQQTNNRQWFHFAIR
FT                   GGTKGCVLAFTFVGMMHCKMFTYGWMPVVSVCPGKPQYCRLPGRAIVTPLEVMPPTPGY
FT                   PGFVLKPWAKKGGDGEPEAYGGDEDAEAKGCSEGGMPEINDLTVAGGQTGTKKKKKDQY
FT                   VAMNLTFDVRIDAETPLKSPYPLGHPQCPAIYVASNHPYSYTTLQQNIKVWKQLASGIM
FT                   DTTDVSELSGSGKATPYTTDVYFSHEILCKSLDGLNVDLLTITDYLGVSEKRVPLFSNG
FT                   EAPYSSVRGETSRPHLFSGKLAVVLTARVHPGECPSSHMMHGCIEFLLNKGDPRAEALR
FT                   SHFVFYIVPMINPDGVARGHTRVDTEGVNLNRAYRTPSKRRHPAPYHIRGLLDSLSETK
FT                   GKLALFIDMHAHSNKRGMFFYGNSMDAPELLQCLLYTKLVSLNTPYFEFQSCNFSEANM
FT                   FATGKTGEGRDNSSRVTLYQRTGMIHSYTIEASHVVGNALNGVAALMNSPVEEAEVQQN
FT                   GTCPRYTTAMFGDVGKALLVALLDLKGWNPMSRLTATAYHNPRGLLMALQRQLQIEIAE
FT                   RYFKLAFMNGGQVALARDSTGDPLVTVMDAMKAEELPEAITIKDGRVFPPLTVKGVPSF
FT                   LPYDQAVQLLSHTHPSMPPRSFVCGMVRRAMIVSGGSGSGPLRSFCNPNTGIVVAGSGT
FT                   SVATAAGRRGLLGANRTSFS"
FT                   /protein_id="XP_844334.1"
FT   gene            complement(<462615..>464351)
FT                   /note="synonym: Tb04.29M18.150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656710"
FT                   /locus_tag="Tb927.4.1850"
FT   mRNA            complement(<462615..>464351)
FT                   /db_xref="GI:72387821"
FT                   /db_xref="GeneID:3656710"
FT                   /locus_tag="Tb927.4.1850"
FT                   /transcript_id="XM_839242.1"
FT   CDS_pept        complement(462615..464351)
FT                   /locus_tag="Tb927.4.1850"
FT                   /gene_family="HOG000260387" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387822"
FT                   /db_xref="GeneID:3656710"
FT                   /translation="MDFDLLLFLKEIQLQHGLRAEDYARYRCYTTNRLSTLRSQLGMLQ
FT                   NTKKFQQKEVTPHNATKPEHLQLLILCAERCWAAAEDMQEKHRTASSAEGTEAKPPGGI
FT                   PPKCQYRKRLNKSVKWATKLQAIAQVVANERLQKEVSAYVLEVKGRAAAAHGLMAEARD
FT                   HFRDSRELYYELRKCSNPEQLSLIFSKVTELDDRVVFCMLRLGEDPSSYKPNLSLEDTP
FT                   ESIGATTIEWNNRQLNVASIKVRDALRGARAVNVEAAKAKATEASSLIPVGLQNRALDL
FT                   MDRRIGSLNDALAHARKDLRTLSDEKQKTELQLLVHYLIFQVSYETLQRTLFMVEVHAR
FT                   RFHATEKCLSGNNVDRSARTVSVISGVGTGGIAGGKSRKEIQPSQYASPMEIVRLYDAA
FT                   LETIGDMEMLPGVDGRSDVEENSALCRAGKLLYLGESWRITKESERAQNCYKAALSVLD
FT                   GIPSTPTVENLRLLVEKSALRLASSTLLSSVAGIGEENKKRQAFVPYLVDAGDEVAVAH
FT                   NVIKFPPDYQAVPCKPVFVDIASTYVDYPTSEAPAAAETKGDGAEAADEGSRWKWSWGW
FT                   RK"
FT                   /protein_id="XP_844335.1"
FT   misc_feature    464831..464874
FT                   /note="GA-rich"
FT   gene            complement(<465052..>465555)
FT                   /note="synonym: Tb04.29M18.160; ribosomal protein S19,
FT                   putative"
FT                   /db_xref="GeneID:3656713"
FT                   /locus_tag="Tb927.4.1860"
FT   mRNA            complement(<465052..>465555)
FT                   /db_xref="GI:72387823"
FT                   /db_xref="GeneID:3656713"
FT                   /locus_tag="Tb927.4.1860"
FT                   /transcript_id="XM_839243.1"
FT   CDS_pept        complement(465052..465555)
FT                   /locus_tag="Tb927.4.1860"
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S19, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387824"
FT                   /db_xref="GeneID:3656713"
FT                   /translation="MAVARTKANSKIRRIGKKKGATLRDVHPWRWVKICSQHFKQEGKM
FT                   MVPNCAEIVKTSHGRERAPQNPDWYYIRCAAVLRAVYLRPGVGYGGLSKRFSSKKNRGS
FT                   RPEITTRASKGLLHWCCKSLTKLELLEKCKGAGHRVTKLGRKVADTIAFKIALRKMGAE
FT                   TKAK"
FT                   /protein_id="XP_844336.1"
FT   repeat_region   465667..465693
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   misc_feature    465839..465874
FT                   /note="AT_rich"
FT   misc_feature    466405..466458
FT                   /note="AT_rich"
FT   repeat_region   466559..466583
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   466663..466694
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   466787..466809
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   467004..467041
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    467083..467195
FT                   /note="GA-rich"
FT   repeat_region   467305..467328
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    467446..467518
FT                   /note="A-rich"
FT   repeat_region   467641..467662
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caccc"
FT                   /rpt_type="tandem"
FT   misc_feature    467771..467796
FT                   /note="AT_rich"
FT   misc_feature    467941..467965
FT                   /note="T-rich"
FT   repeat_region   467966..467993
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    467994..468025
FT                   /note="T-rich"
FT   misc_feature    468056..468122
FT                   /note="CT-rich"
FT   gene            complement(<468188..>469468)
FT                   /note="synonym: Tb04.29M18.230; serine/threonine protein
FT                   phosphatase, putative"
FT                   /db_xref="GeneID:3656714"
FT                   /locus_tag="Tb927.4.1870"
FT   mRNA            complement(<468188..>469468)
FT                   /db_xref="GI:72387825"
FT                   /db_xref="GeneID:3656714"
FT                   /locus_tag="Tb927.4.1870"
FT                   /transcript_id="XM_839244.1"
FT   CDS_pept        complement(468188..469468)
FT                   /locus_tag="Tb927.4.1870"
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein phosphatase, putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="go_function: protein serine/threonine phosphatase
FT                   activity [goid 0004722]; go_function: hydrolase activity
FT                   [goid 0016787]; go_process: protein amino acid
FT                   dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:72387826"
FT                   /db_xref="GeneID:3656714"
FT                   /translation="MQEEEGNLEELVYFYPPSTTPPAVGKYTQLISDLLQSVSIVDALP
FT                   RGAAQAGILCQDTKEVLESENTVLEIAIPRQDNLVIVGDIHGQFADMLSNVLSIQLNLN
FT                   NTKATDGRGSPSTEIYKFLFLGDYVDRGPQSLEVITLLFALKVEYPEHIFLLRGNHEEA
FT                   QTSRLYGFFQECKSKLEGTGDRGPASVDITSSTWLQYNTVFCWLPLAAVVACPSGMFFC
FT                   THGGLSPHTLSVPLLRSLRRNEYGMVDDFEDTFYTPTSRGGDDMLEGPGAKARLVIDGL
FT                   LWSDPEDQVSGCQMNNRGCGFIFGPDVTRSFLDRNYSYGFPPSKRQLIGEMKPGMQFIL
FT                   RGHQCAREGYMWCHGGLVLTLFSAPNYCGMHGNKGAVALLRGQVQAGKDRVELEFNVYD
FT                   TVVRGGSDNLVACLSPFAFAHYFSGDS"
FT                   /protein_id="XP_844337.1"
FT   repeat_region   469544..469570
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    469683..469705
FT                   /note="AT_rich"
FT   misc_feature    469878..469944
FT                   /note="A-rich"
FT   repeat_region   470032..470065
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   repeat_region   470249..470268
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   470506..470606
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    470971..471013
FT                   /note="A-rich"
FT   misc_feature    471087..471155
FT                   /note="T-rich"
FT   repeat_region   471191..471234
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   471317..471350
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   471438..471461
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    471578..471645
FT                   /note="T-rich"
FT   repeat_region   471668..471691
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   471725..471751
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttcc"
FT                   /rpt_type="tandem"
FT   misc_feature    471752..471824
FT                   /note="CT-rich"
FT   repeat_region   471895..471924
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cactt"
FT                   /rpt_type="tandem"
FT   repeat_region   471926..471961
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   472029..472059
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   472261..472344
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   472294..472366
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   472413..472449
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    472689..472754
FT                   /note="T-rich"
FT   gene            complement(<473084..>474004)
FT                   /note="synonym: Tb04.29M18.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656715"
FT                   /locus_tag="Tb927.4.1880"
FT   mRNA            complement(<473084..>474004)
FT                   /db_xref="GI:72387827"
FT                   /db_xref="GeneID:3656715"
FT                   /locus_tag="Tb927.4.1880"
FT                   /transcript_id="XM_839245.1"
FT   CDS_pept        complement(473084..474004)
FT                   /locus_tag="Tb927.4.1880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387828"
FT                   /db_xref="GeneID:3656715"
FT                   /translation="MLRQHSPDGMAGKTRVSSITWEDELLLRGVRLDSDLVPHLQTTLS
FT                   SPHNRSEHGATTPAGSSAILAMVNAGGSCTSSPRSEVRMKNVSPLRDLSAKLRGKDSAA
FT                   STCDECGVGYSSDSGLSNTWVRYGPNAMSSPRVVVPSLLPLPQNITPPPRGGKDISHNC
FT                   ALPPLGAEGQKSSGRSTAPLSRTGHEQPGNSPAPKLSSSTIAIRDTEATLVLRTNTPLS
FT                   CGRKEKKLSLGGTGKSCSNDGRSIATPSKTTIKRAMTPLSKQTTSTSCERSSSQGNGRR
FT                   CESGRSSIQANGLQVLDPIGSRRDD"
FT                   /protein_id="XP_844338.1"
FT   repeat_region   474123..474153
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   474153..474172
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<474726..>475400)
FT                   /note="synonym: Tb04.29M18.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656717"
FT                   /locus_tag="Tb927.4.1890"
FT   mRNA            complement(<474726..>475400)
FT                   /db_xref="GI:72387829"
FT                   /db_xref="GeneID:3656717"
FT                   /locus_tag="Tb927.4.1890"
FT                   /transcript_id="XM_839246.1"
FT   CDS_pept        complement(474726..475400)
FT                   /locus_tag="Tb927.4.1890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387830"
FT                   /db_xref="GeneID:3656717"
FT                   /translation="MSDLDRDSEASSVDELTKRFVTLLSKEDFETHVVGEPEALCALVV
FT                   TTFLCPHSAKLLPLVKERFVLRDRHQTRRVRYFNVALVPEERTNIQQLIEKDPVYIATK
FT                   RPPSKVQKQELHRQAYEMLVELLLFLEVRSTPCMLFFVQGKIVKDSDDLNAPRLIAEGS
FT                   STAKWEAVLQNAVIRRNTIMKEYDEAKRMEKRRLERERRREARRRAREEEAEENEEEEE
FT                   DY"
FT                   /protein_id="XP_844339.1"
FT   misc_feature    474733..474771
FT                   /note="CT-rich"
FT   repeat_region   475490..475511
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<476192..>477331)
FT                   /note="synonym: Tb04.29M18.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656719"
FT                   /locus_tag="Tb927.4.1900"
FT   mRNA            complement(<476192..>477331)
FT                   /db_xref="GI:72387831"
FT                   /db_xref="GeneID:3656719"
FT                   /locus_tag="Tb927.4.1900"
FT                   /transcript_id="XM_839247.1"
FT   CDS_pept        complement(476192..477331)
FT                   /locus_tag="Tb927.4.1900"
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387832"
FT                   /db_xref="GeneID:3656719"
FT                   /translation="MPPTRPEFEAPPDILYNADGAQRYTRSGRVQMVQRAMTRRALELL
FT                   ALPSGCPALLLDVGCGSGLSGEVLRECGHTWIGIDISTDMLGMAKASEELMREDDEKED
FT                   EGPIEGVDLRDVRWGPIHDENENENENDDHDSTDGDGNEAEAVLPPGPSIVEVMRGDMG
FT                   EGLPFRPGAFDGAVSISAVQWLCQSDRRGQVPQRRLRALFQCLYNALRRGAKAAIQFYP
FT                   ANVEQLHMITRAAMLCGFSGGVVVDFPHSTKAKKHYLVVQAGQVAGGFMPPRPLSVCNE
FT                   GGEEVEEEEECEEEDGEEEGEEENDEGQRFGARVGGRVAHKRSRSHGGRQAGARRRKDN
FT                   RPVTGTKEWVLLKKAERRKFGLKTSEDTKYTMRRRRPRF"
FT                   /protein_id="XP_844340.1"
FT   misc_feature    476410..476491
FT                   /note="CT-rich"
FT   misc_feature    477623..477702
FT                   /note="A-rich"
FT   misc_feature    478324..478436
FT                   /note="T-rich"
FT   misc_feature    478573..478609
FT                   /note="AT_rich"
FT   repeat_region   478623..478650
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   misc_feature    478679..478720
FT                   /note="T-rich"
FT   repeat_region   478727..478785
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    478986..479086
FT                   /note="A-rich"
FT   misc_feature    479098..479171
FT                   /note="T-rich"
FT   repeat_region   479345..479369
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   misc_feature    479489..479528
FT                   /note="T-rich"
FT   repeat_region   479564..479602
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    479651..479706
FT                   /note="A-rich"
FT   repeat_region   479840..479871
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    479982..480093
FT                   /note="CT-rich"
FT   repeat_region   480231..480252
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    480253..480304
FT                   /note="AT_rich"
FT   misc_feature    480365..480434
FT                   /note="CT-rich"
FT   misc_feature    480464..480513
FT                   /note="AT_rich"
FT   misc_feature    480626..480683
FT                   /note="T-rich"
FT   repeat_region   480693..480716
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    480881..480909
FT                   /note="AT_rich"
FT   misc_feature    480922..481006
FT                   /note="A-rich"
FT   repeat_region   481007..481058
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    481059..481111
FT                   /note="A-rich"
FT   misc_feature    481172..481196
FT                   /note="AT_rich"
FT   repeat_region   481417..481445
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   481656..481698
FT                   /rpt_family="polypyrimidine"
FT   repeat_region   481721..481740
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tcca"
FT                   /rpt_type="tandem"
FT   repeat_region   481743..481782
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    481869..481931
FT                   /note="T-rich"
FT   repeat_region   482012..482073
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    482106..482204
FT                   /note="A-rich"
FT   misc_feature    482398..482436
FT                   /note="AT_rich"
FT   repeat_region   482479..482504
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   repeat_region   482550..482581
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    482657..482726
FT                   /note="AT_rich"
FT   misc_feature    482775..482810
FT                   /note="AT_rich"
FT   misc_feature    482855..482939
FT                   /note="A-rich"
FT   repeat_region   483109..483171
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   483277..483312
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   483589..483623
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    483717..483826
FT                   /note="A-rich"
FT   repeat_region   484555..484601
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   484638..484711
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatg"
FT                   /rpt_type="tandem"
FT   misc_feature    484828..484879
FT                   /note="CT-rich"
FT   repeat_region   484914..484936
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    484991..485043
FT                   /note="T-rich"
FT   misc_feature    485180..485365
FT                   /note="A-rich"
FT   repeat_region   485398..485443
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   485650..485687
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   gene            complement(<485772..>486503)
FT                   /note="synonym: Tb04.29M18.510; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656718"
FT                   /locus_tag="Tb927.4.1910"
FT   mRNA            complement(<485772..>486503)
FT                   /db_xref="GI:72387833"
FT                   /db_xref="GeneID:3656718"
FT                   /locus_tag="Tb927.4.1910"
FT                   /transcript_id="XM_839248.1"
FT   CDS_pept        complement(485772..486503)
FT                   /locus_tag="Tb927.4.1910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387834"
FT                   /db_xref="GeneID:3656718"
FT                   /translation="MSSFNMQAYPAVGSTAVASFGSPLMDCTNAISNSDNIINGAPRPA
FT                   TMKSSASNVFRGHLRPISTVVEEPVASTRHTHDPYCRTSNDGLPCVPRSPFTAEMSFIM
FT                   SHSDEGNSHFSNSANSSFSTVPQATNRPLYHQPASRGTTAAAYPTVTINNNNGASSSSS
FT                   TTTRTGVKQGGFRRAAGGNTAGFGVTPSRAAPAVVSTPVPAAPVVAAAAGGTSVMRVPC
FT                   KRVYVNGRPVIVSVNEEGQTS"
FT                   /protein_id="XP_844341.1"
FT   gene            complement(<487281..>489341)
FT                   /note="synonym: Tb04.29M18.520;
FT                   glycosylphosphatidylinositol (GPI) anchor, putative"
FT                   /db_xref="GeneID:3656716"
FT                   /locus_tag="Tb927.4.1920"
FT   mRNA            complement(<487281..>489341)
FT                   /db_xref="GI:72387835"
FT                   /db_xref="GeneID:3656716"
FT                   /locus_tag="Tb927.4.1920"
FT                   /transcript_id="XM_839249.1"
FT   CDS_pept        complement(487281..489341)
FT                   /locus_tag="Tb927.4.1920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosylphosphatidylinositol (GPI) anchor,
FT                   putative"
FT                   /note="go_component: GPI-anchor transamidase complex [goid
FT                   0042765]; go_function: GPI anchor binding [goid 0048503];
FT                   go_process: GPI anchor biosynthesis [goid 0006506]"
FT                   /db_xref="GI:72387836"
FT                   /db_xref="GeneID:3656716"
FT                   /translation="MKRVPCHRAMVVVAALLFLLCVTTRTQALKPTVPRTERRYTVHVQ
FT                   PLTTGLDDDGLESTLVSLTMTTSLWLPKGSAEDREEHLSFNEELDPFWVHVLRRRRFDL
FT                   IEWSGCGGSWRPEWTSTLHNRKHPVDKSTAELIHDLSHHSVCSQSTLSACGWVSTSSNG
FT                   NNDGNATSAGEEDLRHHHQWLAQFVSSLLSSPLTWWDDTPRFVRPIGALHSVPAGNSVF
FT                   ASSGYSGKFGDVRWCSYHHAQQDTLCTQHVTALLNGGRSGKDVEERIPRGIFRAGLVSM
FT                   EDFFSSVFHHFRFEVKQSPTTEGGEARGNHTNEEAEIKLVMRMAFVEQNKKFDALSSHW
FT                   KESFPEYAPSVDFITGSQLNAKLSSALQTLKKIQGARSGNDNQALGNVEVTPTAQHFIS
FT                   AVGYDRGTYRLVVNPTPEVPTSGNSNTKSRHEQSLMLQPGDTLEALLFFPLHLMRPSLH
FT                   EMRAGAGLESRVENAFVDESANVLVVLVHTTVTETAMRPLEAGVQSNGFVLCEFPFRFG
FT                   WSANKDMPPDANSNRILPQPVIRVGRHVCSAGGKVGEGDKASGAQNCGMSRCASISNKR
FT                   IDHQGSLESLMESMRRDNNRKGPCVCYFWLRCSNVAGSTLPVPDPAMVFNVVTLGLIFS
FT                   AIVAGGVVRSTKRLFDVEESGADDENPLIIRIILRIMKRLRKRRAAAAGTG"
FT                   /protein_id="XP_844342.1"
FT   repeat_region   489927..489953
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<490448..>491266)
FT                   /note="synonym: Tb04.29M18.550; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3656720"
FT                   /locus_tag="Tb927.4.1930"
FT   mRNA            complement(<490448..>491266)
FT                   /db_xref="GI:72387837"
FT                   /db_xref="GeneID:3656720"
FT                   /locus_tag="Tb927.4.1930"
FT                   /transcript_id="XM_839250.1"
FT   CDS_pept        complement(490448..491266)
FT                   /locus_tag="Tb927.4.1930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="similar along entire length to SP:O75821: Eukaryotic
FT                   translation initiation factor 3 subunit 4 (eIF-3
FT                   delta)(eIF3 p44) (eIF-3 RNA-binding subunit) (eIF3 p42)
FT                   (eIF3g). {Homo sapiens}; go_function: RNA binding [goid
FT                   0003723]; go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72387838"
FT                   /db_xref="GeneID:3656720"
FT                   /translation="MATWADDMEPIALGEDFGGNQLTPQEAKALADKEAAWKNAKVVTE
FT                   TITDAENKQYEIVKRVLQYRVDREATPVDVRAKWKRFGRATNPADQKDLVSRDPPIVLE
FT                   LGEVDPFERMAREEVMRLMNEVERYTVEVKDVHLARYAKVKEEQERAAKEAAAPDDQGK
FT                   ERTWAAARGDKTSVQHKEDTDRRLRITNISDDISREELYNIFNTDEYRIDKLFLPTDGK
FT                   TSNYRGFAFITFETPEQAERCLSRTKGVARFKNTVMHIVRALPEGAKQRN"
FT                   /protein_id="XP_844343.1"
FT   gene            complement(<491860..>493305)
FT                   /note="synonym: Tb04.29M18.560; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656726"
FT                   /locus_tag="Tb927.4.1940"
FT   mRNA            complement(<491860..>493305)
FT                   /db_xref="GI:72387839"
FT                   /db_xref="GeneID:3656726"
FT                   /locus_tag="Tb927.4.1940"
FT                   /transcript_id="XM_839251.1"
FT   CDS_pept        complement(491860..493305)
FT                   /locus_tag="Tb927.4.1940"
FT                   /gene_family="HOG000260377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387840"
FT                   /db_xref="GeneID:3656726"
FT                   /translation="MADNSSASSPAQVVATVRHENILLKKCLAEVRHENQLLKKQLYRL
FT                   SAILDIALSKLASKGITLETPVSIRELRAAIPSRDVIDMPAETLTSADVNYENNPVPSV
FT                   PNRRFQLRREMREHTKPVQCVAFAPGDMPLLATGGLDCRLILHDFWTGEKVHAIHGHEQ
FT                   NVADVAWFEGSGNLLSASFDSTVKVWDPRHMSGSPSPIYQLKSKGFVLSAVPLDKAYTL
FT                   VCTDSKRYTSIVDIRTKKTISWRHDVRVNTLAFNGSKTQLVTGHNNGQIAIWDLRKVGS
FT                   MLSSSMEGEGPNGGSQAVVDQTSVAHIPRLASVENEPSQSPITHISFYHNRDDSKRLVV
FT                   VSADNMVRLYYEPGINPSLPHELMLRNVVGGVPTRGYTSKAAFWKGVREEQNVPAFFDD
FT                   GEREGEAPSRRLTECDLMVTCGADNTACIYDVTERGNAVLVERLEGHRDRVVGAATHHA
FT                   DSKPIIATYSADNTVRTWVPVKT"
FT                   /protein_id="XP_844344.1"
FT   repeat_region   493634..493686
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<493754..>495586)
FT                   /note="synonym: Tb04.29M18.580; NADPH--cytochrome p450
FT                   reductase, putative"
FT                   /db_xref="GeneID:3656721"
FT                   /locus_tag="Tb927.4.1950"
FT   mRNA            complement(<493754..>495586)
FT                   /db_xref="GI:72387841"
FT                   /db_xref="GeneID:3656721"
FT                   /locus_tag="Tb927.4.1950"
FT                   /transcript_id="XM_839252.1"
FT   CDS_pept        complement(493754..495586)
FT                   /locus_tag="Tb927.4.1950"
FT                   /gene_family="HOG000173033" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADPH--cytochrome p450 reductase, putative"
FT                   /EC_number="1.6.2.4"
FT                   /note="similar to NADPH--cytochrome P450 reductase (EC
FT                   1.6.2.4) (CPR) (P450R). (Swiss-Prot:P16435) [Homo sapiens];
FT                   go_function: NADPH-hemoprotein reductase activity [goid
FT                   0003958]; go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:72387842"
FT                   /db_xref="GeneID:3656721"
FT                   /translation="MEENEGIGTITILYGTQTGSAEQLAFTFASLAIKRGFKRCVCLPA
FT                   DEFPLDKWRDATPLVIICSNANQGEAPDSIRISWAQLLHSTAPSMDGLRFAVFGTGDSI
FT                   YPKFNYMAKMLHNRLRQLGGTPLLNRGLGDESDRKGYDEVFLPWVLELWRALGLVSEDD
FT                   SHLKEENPSDAPLLCKYEVVPCNDESAPQGGVDVAVRRREPVFNCRLVQNKRLTAEDHL
FT                   QAVHHIAFSRETTPAEGSLLPYDTPLAFEVGDALGVYCTNEDAIIDRVLTQVNEDGDKV
FT                   VCIKPNNSQGIIQQQEQPFFNRPMTLRFFLKHYVDLEAVVSRSFFRMMAHYAEDAELKE
FT                   RLWELSSSDNLDDFMWYCQREKRNVAEVLDDFRAVRPPLALLLSFMPPMRARLFSISSS
FT                   PYVDCDTFHLTVALVEWQTPYKRTRRGLCSSRLTSAKPGDVFTCFLWDGTMITPSTPAP
FT                   LLCVGTGTGVAPIRSLIRECAGHSDIWGEVPILLFFGCRNETKDYLYQQEWADLKRDHL
FT                   KQLQVLPAFSRDGEKKFYVQHQIGRHARRVAKLLDAGATIYVCGNSKQMPKDVATTLED
FT                   VVTQCCCEGDEAKSQEYMKQLRKQGRYVVDTWSV"
FT                   /protein_id="XP_844345.1"
FT   repeat_region   495785..495811
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    495812..495851
FT                   /note="AT_rich"
FT   gene            complement(<495944..>497068)
FT                   /note="synonym: Tb04.29M18.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656725"
FT                   /locus_tag="Tb927.4.1960"
FT   mRNA            complement(<495944..>497068)
FT                   /db_xref="GI:72387843"
FT                   /db_xref="GeneID:3656725"
FT                   /locus_tag="Tb927.4.1960"
FT                   /transcript_id="XM_839253.1"
FT   CDS_pept        complement(495944..497068)
FT                   /locus_tag="Tb927.4.1960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387844"
FT                   /db_xref="GeneID:3656725"
FT                   /translation="MWRCCCFFHLIPLPFPLFFEGPPDTVVMDGFISLENLESYQDEWE
FT                   RNCCSATHSSPHSAGNDTGPPQLNSPRSLHACKLCNVDSSVVLAPVSLRQHFEYLQGNP
FT                   ELVSQKFAVDVPMRDALLACIEAGITGGSSLLKLQAYRRYMDHVKARKEALKMAQEARQ
FT                   RLITQETFETGRQTLREGDATLSPKIPQEQNRSNTATSTVALKNACDSMGGDSPEEEAN
FT                   NSDNNDESGEKPQQHHERARGQKVSADSPHLADNAGSSSLVKEPDNGGSSAAAMRQERR
FT                   NSSLNQSVCITGQHGGEQHDTAKGGKGDSCTPHQCGKPVISLPHVESMRNGAGSKAVGR
FT                   EVGEIRSRDPSSACEPEEVFYVYCANATASGEEA"
FT                   /protein_id="XP_844346.1"
FT   gene            complement(<497347..>499032)
FT                   /note="synonym: Tb04.29M18.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656724"
FT                   /locus_tag="Tb927.4.1970"
FT   mRNA            complement(<497347..>499032)
FT                   /db_xref="GI:72387845"
FT                   /db_xref="GeneID:3656724"
FT                   /locus_tag="Tb927.4.1970"
FT                   /transcript_id="XM_839254.1"
FT   CDS_pept        complement(497347..499032)
FT                   /locus_tag="Tb927.4.1970"
FT                   /gene_family="HOG000260375" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387846"
FT                   /db_xref="GeneID:3656724"
FT                   /translation="MGGHHGTWWTYAKLTATAVIGAVALNDSVNNHTLPSVPTPTAAAA
FT                   GVASEVEASWWFLIVADSILLCFAAIFAGLTLAIMGLDTLSLEIIADSGPEPDKGHAAK
FT                   ILPIRRLGNQLLCTLLLGNVMVNTLIAQITDSHLSGWGATVVATALTTIGGEVLPQAIM
FT                   SAHALRVGAKSVYLVKFFVLLFYPVCKPLSMVLDRFIGMDPGQIYERNELKKLMFMHAA
FT                   RGAESGLGEREADLMVGAMELHEKTVMDVLTPIWETFMLEASQPLNEETIQLICERGHS
FT                   RIPVYQGNRNNIVGALFTRDLLMVNPEEETPVLVLVKFYNRSCHIVHSETKLSSMLECF
FT                   QTGRSHIAVVQEVQQRPCGDPYYEIKGLVTLEDVIEELIHSEIFDEYDTVPKRLVGNSS
FT                   YTQRRQVGLSSRCSRRVHMGKNQLKAVALFLSRSLPEFHDCSQGECAHLLRAVEMYAAF
FT                   YKTRAPHDARGLSKDDKANIWLYRAGVPSDVFTLVLSGKVEIFAGGEEIRFEQSCWSVI
FT                   ATRALTDERFVPTFSCRVVQDSTFVQITREAYGMILSMLSNISL"
FT                   /protein_id="XP_844347.1"
FT   gene            complement(<499917..>502412)
FT                   /note="synonym: Tb04.29M18.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656722"
FT                   /locus_tag="Tb927.4.1980"
FT   mRNA            complement(<499917..>502412)
FT                   /db_xref="GI:72387847"
FT                   /db_xref="GeneID:3656722"
FT                   /locus_tag="Tb927.4.1980"
FT                   /transcript_id="XM_839255.1"
FT   CDS_pept        complement(499917..502412)
FT                   /locus_tag="Tb927.4.1980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387848"
FT                   /db_xref="GeneID:3656722"
FT                   /translation="MLSPSGASAAELDEALNQYISAIHPTVCPHLTPRHLLRVIPAQPL
FT                   PVRTVWRRAISMETVPSDMSFEAFKSALMPLVPLFLSLSSTTLGEDGDEGPLVRWQPWV
FT                   SDGWRNEQERTREQCGDGVISELSGVVPTYFVSYALLKEQTRLGQLSVATLHTLERKEL
FT                   VGGSVPPVLEWSEDHSVVRLSNEVIASSSSTRTANSFYSLQSQPEVLRRAVNILALLLP
FT                   TFKASVGEVRAVYKLNFITPGGLRHSAITHEFAIRFPDALALVDHPDVQFVIDRDSEGC
FT                   VMLHSTFLHTSRGAANVLYMCTSVGHPLSISAHGVDTNEGAGCLDRYYLRVDLPYAPRC
FT                   GDEVVLQAICSATVTGLYCVQQPDKDRFSLEIATAQGAVIVFDSTISLLCRLSTAGAPC
FT                   CGFPAEIVTLLASPNIVKLIHAAPTVCTGNQGVYGNVLDGLPLLYAHLKTDFQCVCTFH
FT                   QLALFVGIPTTETERPGQYSLLSNRLITCHGGVALPHVRPALLAAVCASRLIALHLADG
FT                   HEFDRALLQQLLRDAVEGSNALVMRNLQLRLKRYGMEPHGTCTKHSCEALLQEFLVVYG
FT                   PEVCFVDKFDDFLSRAASSTEIARTVGKNRSEEDDGEYIRELLLDQPTSTVERDEEDMD
FT                   VEHDVQGELSKCCKQNVGSGDSEVTKRSEGEQDNMEEAYNFLFDCSGAGATDKGSNIPP
FT                   SHRSSNHMNCSRGNEQSERSTVFVLPLPNLKGHHMTSRNVRWTLPPSFSRTNVRGTTTT
FT                   KAEQSVKTIHGASTRSLLPEQRDPTNWHIDKSDEHTEGIASEGALIERLTQEVLCATSS
FT                   SKTNKRRLPACSSDRLISE"
FT                   /protein_id="XP_844348.1"
FT   misc_feature    502528..502556
FT                   /note="AT_rich"
FT   gene            complement(<502727..>504607)
FT                   /note="synonym: Tb04.29M18.630; RNA helicase, putative"
FT                   /db_xref="GeneID:3656723"
FT                   /locus_tag="Tb927.4.1990"
FT   mRNA            complement(<502727..>504607)
FT                   /db_xref="GI:72387849"
FT                   /db_xref="GeneID:3656723"
FT                   /locus_tag="Tb927.4.1990"
FT                   /transcript_id="XM_839256.1"
FT   CDS_pept        complement(502727..504607)
FT                   /locus_tag="Tb927.4.1990"
FT                   /gene_family="HOG000260372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA helicase, putative"
FT                   /note="similar to ATP-dependent RNA helicase SUV3,
FT                   mitochondrial precursor. (Swiss-Prot:P32580) [Saccharomyces
FT                   cerevisiae]; go_component: mitochondrial matrix [goid
FT                   0005759]; go_function: ATP-dependent RNA helicase activity
FT                   [goid 0004004]; go_process: RNA catabolism [goid 0006401]"
FT                   /db_xref="GI:72387850"
FT                   /db_xref="GeneID:3656723"
FT                   /translation="MRRLSVTAPVLFLCFKSYCTNHGEGKLIQTVCDYIYRSSSAREQL
FT                   RQLIHDMSVENALRHLGEFSEEGCSGATPPWLGELVQAPGDLERINIVLREFGVWYIAR
FT                   KAPLRVTMGEPWDWYPKARFMRRRFIFHHGPTNSGKTHAALEELVKAKSGVYCAPIKAL
FT                   AAQVWKRINASVPCDLLIGDERQFGGGAEHVSCTVEMTPIDYQIDVGVIDEVQMIGDGD
FT                   RGWAWTRAILGLPAREIHLCGEERAIPLIRSLLYKTRELKGLRLVPHQRLAPLRTSAAL
FT                   GGDLRQVENGDCLVCFSRKMIFAMKSQLEKLPGVAAHYIYGSMPFAVREAQADAFNRGV
FT                   REAVEGKDSKKHVLVSTDAIAYGLNMSIERIIFVSMKKFDGKQMTSLPQATTVQVAGRA
FT                   GRFGVLRANTFGRCTTLHADDFPTLESAINARLSPLQRAGLLPTADILELYVTMNSDKK
FT                   RLKTSGVVPQDVFYGHVKDFSSQCKTSDLFFPCDLSRSLLQVARELDAVPGLSLTDRIL
FT                   FCYVPVNTRNKDTFDLLRCFARDHATGGPVRLRIDEEFEQLVGQCAHLKTHKDSERAHR
FT                   ILSRMEDLYRHAEMYCWLSWRFGNTFIYLEAGSALKERIVAKMDELLRRL"
FT                   /protein_id="XP_844349.1"
FT   gene            complement(<505347..>506771)
FT                   /note="synonym: Tb04.29M18.640; RuvB-like DNA helicase,
FT                   putative"
FT                   /db_xref="GeneID:3656729"
FT                   /locus_tag="Tb927.4.2000"
FT   mRNA            complement(<505347..>506771)
FT                   /db_xref="GI:72387851"
FT                   /db_xref="GeneID:3656729"
FT                   /locus_tag="Tb927.4.2000"
FT                   /transcript_id="XM_839257.1"
FT   CDS_pept        complement(505347..506771)
FT                   /locus_tag="Tb927.4.2000"
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RuvB-like DNA helicase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   ATPase activity [goid 0016887]; go_function: ATP-dependent
FT                   5' to 3' DNA helicase activity [goid 0043141]"
FT                   /db_xref="GI:72387852"
FT                   /db_xref="GeneID:3656729"
FT                   /translation="MAETNIRAEEVRDLTRVERIGAHSHIRGLGLDDALEARMSSQGMV
FT                   GQVEARRAAGVVVQMIREGKIAGRCVLLAGGPGTGKTAIAMGMAQALGAETPFTMIAGS
FT                   EIFSLEMSKTEALTQAFRRSIGVRIKEETEMIEGEVVEISIDRPSVNPAEAKGRTGQLV
FT                   LKTSDMESTFDLGLKMIESLQREKVQVGDVITIDKATGRVNKLGRSFIRSKDYDAMSAN
FT                   TRFVQTPEGELSKRKEVVHTVTLHEIDVINSRQQGFLALFAGDTGEIKHEVREQIDQRV
FT                   AEWREEGKGEIIPGVLFIDEVHMLDIECFSWLNRALESPLAPVVVMASNRGIARIRGTQ
FT                   YKAPHGIPIDLLDRMVIITTKPYSEAELSKIIHIRCEEEDVEMDDEAVALLTMLGKSTS
FT                   LRYVLQLITTASLVAQKRRSSTVSIHDIKKVYSLFIDLRRSVELLQEHEKDFLFGEADR
FT                   GAEMSYGAQCQNEEEQ"
FT                   /protein_id="XP_844350.1"
FT   gene            complement(<507511..>507792)
FT                   /note="synonym: Tb04.29M18.660; acyl-CoA binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3656730"
FT                   /locus_tag="Tb927.4.2010"
FT   mRNA            complement(<507511..>507792)
FT                   /db_xref="GI:72387853"
FT                   /db_xref="GeneID:3656730"
FT                   /locus_tag="Tb927.4.2010"
FT                   /transcript_id="XM_839258.1"
FT   CDS_pept        complement(507511..507792)
FT                   /locus_tag="Tb927.4.2010"
FT                   /gene_family="HOG000261845" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA binding protein, putative"
FT                   /note="similar to GB:AAF75257.2: acyl-CoA binding protein
FT                   {Trypanosoma brucei} (PMID:10777537); 97.8% similar to:
FT                   GB:AAF75257.2: acyl-CoA binding protein {Trypanosoma
FT                   brucei;}  PMID:10777537; go_function: acyl-CoA binding
FT                   [goid 0000062]; go_process: fatty acid metabolism [goid
FT                   0006631]"
FT                   /db_xref="GI:72387854"
FT                   /db_xref="GeneID:3656730"
FT                   /translation="MVEETLDEKFQRLSKTLGVKATRPRMSIQTKLDLYGLWHQATGGP
FT                   VKTPKPSRVNVVASTKWNARKKYEKLSKDEAKRKFVELAEKVVPPSNL"
FT                   /protein_id="XP_844351.1"
FT   gene            complement(<508176..>509456)
FT                   /note="synonym: Tb04.29M18.670; mu-adaptin 3, putative"
FT                   /db_xref="GeneID:3656734"
FT                   /locus_tag="Tb927.4.2020"
FT   mRNA            complement(<508176..>509456)
FT                   /db_xref="GI:72387855"
FT                   /db_xref="GeneID:3656734"
FT                   /locus_tag="Tb927.4.2020"
FT                   /transcript_id="XM_839259.1"
FT   CDS_pept        complement(508176..509456)
FT                   /locus_tag="Tb927.4.2020"
FT                   /gene_family="HOG000234366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mu-adaptin 3, putative"
FT                   /note="similar to Adapter-related protein complex 3 mu 1
FT                   subunit (Mu-adaptin 3A) (AP-3adapter complex mu3A subunit)
FT                   (Swiss-Prot:Q9Y2T2) [Homo sapiens]; go_component: AP-3
FT                   adaptor complex [goid 0030123]; go_component: clathrin
FT                   vesicle coat [goid 0030125]; go_function: clathrin binding
FT                   [goid 0030276]; go_process: intracellular protein transport
FT                   [goid 0006886]"
FT                   /db_xref="GI:72387856"
FT                   /db_xref="GeneID:3656734"
FT                   /translation="MITGLFFLNKHGEVIIEKEFREKVPRSSLEDFWCTYMTPLRSIEE
FT                   APAVITYSRFAFIQIHRNDVVLLAVATSECFPLFVMEVLALAAKVVQKYLKVISESTLR
FT                   ENFSLVYQLLVELIDNGYPLTTEMHVLEELVLPPSLENVFRSALEAPVAIKRRHMGSRA
FT                   VPWRDPATKHSSNEIFFDIVENLDCIVDCEGNVVQSAVRGAVEVNCRLSGLPEVIMRLT
FT                   GIDCIEDIAMHRCVRRSRYEVDRMISFIPVDGKFTLLQYRCKMANSVQVPFYVTPQITF
FT                   NASVGRFNCMVGFRGSGLAARSREYEIQKLIIHLPLPPQTEAVQVHSISHGNTNFKKAR
FT                   NMLVWNVGSLHRGTCSLSGEFTFGTEREKEGLAPCTGGSALVEFSIPNYLLSSIRVDSV
FT                   QVLNDLTKPYKGVKYVTTAGRFAVRTI"
FT                   /protein_id="XP_844352.1"
FT   gene            complement(<510453..>511106)
FT                   /note="synonym: Tb04.29M18.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656731"
FT                   /locus_tag="Tb927.4.2030"
FT   mRNA            complement(<510453..>511106)
FT                   /db_xref="GI:72387857"
FT                   /db_xref="GeneID:3656731"
FT                   /locus_tag="Tb927.4.2030"
FT                   /transcript_id="XM_839260.1"
FT   CDS_pept        complement(510453..511106)
FT                   /locus_tag="Tb927.4.2030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387858"
FT                   /db_xref="GeneID:3656731"
FT                   /translation="MPSYPSHDDRQRTKNEGAKEKGQGAENEIRVTARPGSRGYITYAL
FT                   ALLRGEEGKPKYDSVKISAMGAAIRSAVGVAEVLKRRVAGLHQTTEISSEVIHDTYEGN
FT                   DDKTEKKEVERKVSTILITLSLKPLDVNHIGYQAPLPESEVKEEEERSQISRGRGGGGG
FT                   SRAGGRGAGRGGGSRGGGRGAAGSRGRGRGRGRGGTGGGAHGSQRDGSDLGEGN"
FT                   /protein_id="XP_844353.1"
FT   repeat_region   510557..510634
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   gene            complement(<512689..>513261)
FT                   /note="synonym: Tb04.29M18.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656728"
FT                   /locus_tag="Tb927.4.2040"
FT   mRNA            complement(<512689..>513261)
FT                   /db_xref="GI:72387859"
FT                   /db_xref="GeneID:3656728"
FT                   /locus_tag="Tb927.4.2040"
FT                   /transcript_id="XM_839261.1"
FT   CDS_pept        complement(512689..513261)
FT                   /locus_tag="Tb927.4.2040"
FT                   /gene_family="HOG000260371" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387860"
FT                   /db_xref="GeneID:3656728"
FT                   /translation="MPSYPPRDEYRRVRKNEGAKEKGQGAENEIRVTARPGSRGYITYA
FT                   LALLRGEEGKPKYDSVKISAMGAAIRSAVGVAEVLKRRVAGLHQTTEISSEVIHDEYEG
FT                   IGEKKDKMEVERKVSTILITLSLKPLDVNHIGYQAPLPESEVKEEEERDPVERRRGGRG
FT                   GRGAGRGGSRGGRGRGGNDRRGGGNEE"
FT                   /protein_id="XP_844354.1"
FT   repeat_region   512723..512786
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   gene            complement(<513717..>514121)
FT                   /note="synonym: Tb04.29M18.720; hypothetical protein"
FT                   /db_xref="GeneID:3656732"
FT                   /locus_tag="Tb927.4.2050"
FT   mRNA            complement(<513717..>514121)
FT                   /db_xref="GI:72387861"
FT                   /db_xref="GeneID:3656732"
FT                   /locus_tag="Tb927.4.2050"
FT                   /transcript_id="XM_839262.1"
FT   CDS_pept        complement(513717..514121)
FT                   /locus_tag="Tb927.4.2050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387862"
FT                   /db_xref="GeneID:3656732"
FT                   /translation="MLCVDRQVPGTLRRSHYLVRLCCFPPLFPLLRLFRWLIGVVPLIF
FT                   IFLAGIHTLPSVSVFVRPQRQPTYCPCNEEEGGSEHNRAFRRCTCCLRGATARQKGIMR
FT                   REWETKVENEEKKRDTNGKEERERSIVLSR"
FT                   /protein_id="XP_844355.1"
FT   gene            complement(<514498..>516258)
FT                   /note="synonym: Tb04.29M18.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656733"
FT                   /locus_tag="Tb927.4.2060"
FT   mRNA            complement(<514498..>516258)
FT                   /db_xref="GI:72387863"
FT                   /db_xref="GeneID:3656733"
FT                   /locus_tag="Tb927.4.2060"
FT                   /transcript_id="XM_839263.1"
FT   CDS_pept        complement(514498..516258)
FT                   /locus_tag="Tb927.4.2060"
FT                   /gene_family="HOG000260370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387864"
FT                   /db_xref="GeneID:3656733"
FT                   /translation="MEASVGVEVAWSSEIVGSPQVGGYLQLVKQAQPVDVASDAVPSNT
FT                   SDLVEGMSSSTSLSSVEMITTQHTRRFDGDGWKCVLDNHMVALCDVFVKDAAAACDVPL
FT                   ENVALRELRLGSLYVTFHVTHDADIDEEEIQQRVDLYPFREVMRLYANRDAPPDGVDAL
FT                   LKRNAELEAETKAMIARLKDENDKRIEKLIRDHEKALKDLQEKVDERERELVGINNDLE
FT                   ALLQQMTEQKNSLEEERKKAIEAIKRERARNEKLAHRNSELVAAIIQENKKEMEAKERE
FT                   FEEQLLEKDVVIENLRAKLRTKNEATNGDVPHAGRSPMSNADPDRAEEFAKLMGRMEEM
FT                   AIVLEKTQESETEARSEIQKLSEALKLSEEARQSDAVIYENNTLALKQQLQSFWDTKLA
FT                   EDHQKRQEESRARRGASGVRGEKTNETIVKQYEAALENIIRTLQDRLTILREEHASFIK
FT                   VSEKETINERDILNENEAESQRVRQTFRTVSLTLQRVFWGTRDDEVPPLITELDNAAAC
FT                   SEKSRASVKMTLALLDSRLQSFVEQKEWMETHQQALEELMTSLRTLNKRAFERQLSLMN
FT                   EQSARLPSAP"
FT                   /protein_id="XP_844356.1"
FT   misc_feature    516560..516580
FT                   /note="AT_rich"
FT   gene            complement(<517255..>530622)
FT                   /note="synonym: Tb04.29M18.750; antigenic protein,
FT                   putative"
FT                   /db_xref="GeneID:3656736"
FT                   /locus_tag="Tb927.4.2070"
FT   mRNA            complement(<517255..>530622)
FT                   /db_xref="GI:72387865"
FT                   /db_xref="GeneID:3656736"
FT                   /locus_tag="Tb927.4.2070"
FT                   /transcript_id="XM_839264.1"
FT   CDS_pept        complement(517255..530622)
FT                   /locus_tag="Tb927.4.2070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="antigenic protein, putative"
FT                   /db_xref="GI:72387866"
FT                   /db_xref="GeneID:3656736"
FT                   /translation="MEILEFDESVLSQVKSDVVSVGDLVAFDTLRDDSWCYEKGYVTFL
FT                   SDYVARVSVANNSPSQDVDERATAYKEQLLALRQQLRNGRAAVEEERIASLRIQVERAN
FT                   TMVEGIEGACFRELQSYVSPPPIVRKILDDILIILGITLPTSTWAELRAQLRQPGFIAR
FT                   VLSFDPSKLPPERRNEIIKRCRSNDISDDDASVASRAAGPLHQWVKAQLNYVNHNHVAA
FT                   TTLAASSQEHLERIVLAIRDIQDRLAAVEGGNALDDLPMPEKTILRSSIIPTALIEGSI
FT                   PKIATIHRSELWRYITLQSDSLKYVNSKNKVGLSSSKPDVVGACSDASLERGQHSVDED
FT                   ERIKVVEKDAAELRTEMENIRSENRTLLQQLAICERENKVLRGQLEEAQKAEEESARRQ
FT                   GELIHSLEELQRTNDMLEGIIKKLQNAIDEGGLLVATQGEDVSTQHNQLPCSEGSFKHT
FT                   IELQRFLEERNSMEEGLDDRHGMVPDQERKSTNAAIHTGRHGPLVVTADEEKDDKGMCG
FT                   FSQSDAARSAHSRVTNTKDTHTAAANTDVDATGDHDTGKQSRLSKTSTKATAAKKKGKG
FT                   TAIISSEAQEHTDSPRSQSDTHLPKENEDKTYTNEGGEILKRLPSAANISSNSVTSDRE
FT                   EGARTTKKLTARTAVDHKKSKKEVATKISREEKDKTHKVRKTQADSKEAREHLKLTKYK
FT                   ADQTPHKRSKKQQPSPKIKKTKESNPTQCCTEFAADVESQSQQQQQRIISIESTVNKDT
FT                   AQRTNAAIEDELDSLRAVNEQYEAMQRTNAAIEDELDSLRAVNEQYETLQRTNAAMEEE
FT                   LDSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYEAMQRTNAAMEDELDSLRAVNEQY
FT                   ETLQRTNAAMEDELDSLRAVNEQYEAMQRTNAAIEDELDSLRAVNEQYEAMQRTNAAIE
FT                   DELDSLRAVNEQYEAMQRTNAAMEDELDSLRAVNEQYEAMQRTNAAMEDELDSLRAANE
FT                   QYEALQRTTADIGVGNQPLWVVQKELKAARRTNEDMGNELKLLRAFKEQCETLQHVNIS
FT                   AEKDQPTHRILKKQEKNTKEKIIDDERDIAEKRKYTEEYKILQQLNAEVEAQLEYLRAL
FT                   KKRGRSTRHFDPNMEEELDSLRAVNEQYENLRRTNEDIINELDSLRALNEQYKEDSNKD
FT                   TRVAIEQQPLQATPKQLKEDRTTNDKIQNELDSLRAANEQYETLQRTNAAMEEELDSLR
FT                   AANEQYETLQRTNAAMEEELDSLRALNEQYETLQRTNAVMEDELDSLRALNEQYETLQR
FT                   TNAAMEEELDSLRAANEQYETLQRTHAAMEDELDSLRALNEQYETLQRTNAAMEDELDS
FT                   LRAANEQYETLQRTNAAMEDELDSLRALKEQYETLQRTNAAMEDELDSLRAANEQYETL
FT                   QRTNAAMEEELDSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEEEL
FT                   DSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTHAAMEDELDSLRAVNEQYE
FT                   TLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEEELDSLRAVNEQYETLQRTNAAMEE
FT                   ELDSLRAVNEQYEALQRTNAAMEEELDSLRAVNEQYEALQRTNAAMEDELDSLRAVNEQ
FT                   YETLQRTNAAMEEELDSLRAVNEQYEALQRTNAAMEDELDSLRALNEQYETLQRTNAAM
FT                   EEELDSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEEELDSLRAVN
FT                   EQYETLQRTNAAMEEELDSLRAVNEQYEALQRTNAAMEEELDSLRAVNEQYEALQRTNA
FT                   AMEDELDSLRAVNEQYETLQRTNAAMEEELDSLRAVNEQYEALQRTNAAMEDELDSLRA
FT                   LNEQYETLQRTNAAMEEELDSLRALNEQYETLQRTNAAMEDELDSLRAANEQYETLQRA
FT                   NAAMEEELDSLRAANEQYETLQRTNAAMEEELDSLRAANEQYETLQRTNAAMEEELDSL
FT                   RAVNEQYETLQRTNAAMEEELDSLRAANEQYETLQRTNAAMEEELDSLRALNEQYETLQ
FT                   RTNAAMEDELDSLRAANEQYETLQRTNAAMEDELDSLRAANEQYETLQRTNAAMEEELD
FT                   SLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEEELDSLRDVVAEDLD
FT                   ILNVYREFKRECNESGNVISTMTGQILNLERKLKEIERLKEVAEYRCEFIKEKSREIIN
FT                   CVMEEYKKPANNSGTAGGAHETTEESTLQRHLSRLEELDEGIREQSKEEKAVNEELEEL
FT                   RHLNAAMEDELDSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEDEL
FT                   DSLRAVNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRANAAMEDELDSLRALNEQYE
FT                   TLQRTNAAMEEELDSLRALNEQYETLQRTHAAMEEELDSLRALNEQYETLQRTHAAMEE
FT                   ELDSLRALNEQYETLQRTNAAMEEELDSLRALNEQYETLQRTNAAMEEELDSLRALNEQ
FT                   YETLQRANAAMEDELDSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAM
FT                   EEELDSLRDVVAEDLDILNVYREFKRECNESGNVISTMTGQILNLERKLKEIERLKEVA
FT                   EYRCEFIKEKSREIINCVMEEYKKPANNSGTAGGAHETTEESTLQRHLSRLEELDEGIR
FT                   EQSKEEKAVNEELEELRHLNAAMEDELDSLRALNEQYETLQRTNAAMEDELDSLRAVNE
FT                   QYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRANAA
FT                   MEDELDSLRALNEQYETLQRTNAAMEEELDSLRALNEQYETLQRTHAAMEEELDSLRAL
FT                   NEQYETLQRTHAAMEEELDSLRALNEQYETLQRTNAAMEEELDSLRALNEQYETLQRTN
FT                   AAMEEELDSLRALNEQYETLQRANAAMEDELDSLRALNEQYETLQRTNAAMEDELDSLR
FT                   AVNEQYETLQRTNAAMEEELDSLRDVVAEDLDILNVYREFKRECNESGNVISTMTGQIL
FT                   NLERKLKEIERLKEVAEYRCEFIKEKSREIINCVMEEYKKPANNSGTAGGAHETTEEST
FT                   LQRHLSRLEELDEGIREQSKEEKAVNEELEELRHLNAAMEDELDSLRALNEQYETLQRT
FT                   NAAMEDELDSLRAVNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEDELDSL
FT                   RAVNEQYETLQRANAAMEDELDSLRALNEQYETLQRTHAAMEEELDSLRALNEQYETLQ
FT                   RTHAAMEEELDSLRALNEQYETLQRTNAAMEEELDSLRALNEQYETLQRANAAMEDELD
FT                   SLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEEELDSLRDVVAEDLD
FT                   ILNVYREFKRECNESGNVISTMTGQILNLERKLKEIERLKEVAEYRCEFIKEKSREIIN
FT                   CVMEEYKKPANNSGTAGGAHETTEESTLQRHLSRLEELDEGIREQSKEEKAVNEELEEL
FT                   RHLNAAMGDELDSLRALNEQYETLQRANAAMEDELDSLRAVNEQYETLQRTNAAMEDEL
FT                   DSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAMEDELDSLRAVNEQYE
FT                   TLQRTNAAMEDELDSLRAVNEQYETLQRANAAMEEELDSLRALNEQYETLQRTNAAMED
FT                   ELDSLRAVNEQYETLQRTNAAMEDELDSLRDVVAEYETLQRTNAAMEEELDSLRALNEQ
FT                   YETLQRANAAMEEELDSLRALNEQYETLQRTNAAMEDELDSLRAVNEQYETLQRTNAAM
FT                   EEELDSLRDVVAEDLDILNVYREFKRECNESGNVISTMTGQILNLERKLKEIERLKEVA
FT                   EYRCEFIKEKSREIINCVMEEYKKPANNSGTAGGAHETTEESTLQRHLSRLEELDEGIR
FT                   EQSKEEKAVNEELEELRHLNAAMEDELDSLRALNEQYETLQRTNAAMEDELDSLRALNE
FT                   QYETLQRTNAAMEDELDSLRALNEQYETLQRTNAAMEEELDSLRALNEQYETLQRTNAA
FT                   MEEELDSLRAANEQYEAVRRSNSDMEDELKSLRALNEQYETLQRSNTAMEDELKSLRSL
FT                   NEQYEAARRSNSAMEDELKSLRALNEQYEAARRSNSDMEDELKSLRALNEQYETLQRSN
FT                   TAMEDELKSLRSLNEQYEAARRSNSAMEDELKSLRALNEKYEALQCTNVCGSAVNDFAY
FT                   STVDNMNVKVSKDSAFLCEKTVGHCVADALRVMGCRVVSDDHDVVFLKSGNVGGAISSN
FT                   VLCPVDGSNSLFGGGVDLDRRGATEGAGGDAGTCVPPLKVKEEVGFPLSSALAASRCEE
FT                   DDAVVSKINDDCGSLCVSYRGGSGDAFEGSSLLSSLSDVNDCHLCSVLAKRVLKLRESI
FT                   RVQEETMKYYVESQEELRKCNDLVIKRLEDEVKALREELRGNEA"
FT                   /protein_id="XP_844357.1"
FT   gene            complement(<532617..>535337)
FT                   /note="synonym: Tb04.29M18.770; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656727"
FT                   /locus_tag="Tb927.4.2080"
FT   mRNA            complement(<532617..>535337)
FT                   /db_xref="GI:72387867"
FT                   /db_xref="GeneID:3656727"
FT                   /locus_tag="Tb927.4.2080"
FT                   /transcript_id="XM_839265.1"
FT   CDS_pept        complement(532617..535337)
FT                   /locus_tag="Tb927.4.2080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Myosin heavy chain, striated muscle.
FT                   (Swiss-Prot:P24733) {Argopecten irradians}"
FT                   /db_xref="GI:72387868"
FT                   /db_xref="GeneID:3656727"
FT                   /translation="MQQVDFGQQPIFDDRQSIDELSDLCASLKEQLAAKELNEYEQEVR
FT                   LRDLRQQLKELSDVEGKLILANRNARVLEEENNALLMKLKSGETADTSGTSFRAEAVKL
FT                   IEENSSLRSEVHELRGLLNKAQQRESHLDQRCKNINEQQEKNDLQVSLLKKRNAELEEQ
FT                   LHEVQHQWLLAKETWENERSRNLQDYEELLASVKRFDGTAQQRENWDVKTRGSNQHLQQ
FT                   ALLKEDIAELEEKLQLAEERYRAKEREWREMEAALRVEISTLQGNNIGTGGDVYRAIQH
FT                   QLDSFKHEVTVFREERKPGRMKNKLRLGDPSVDDVDDKVSEIDDSDASRESRIQSLEVL
FT                   NGNISRKNELLMRENEELHKEIEHLHLRNSRAEEEYNDLEVRVKELEIALVSTEKELSL
FT                   QKGYNINREKDSRCYDVHEMKAVLDENEQLRDSLLEYTRQISSLKAANEEQLAASESSR
FT                   SEYQAEIAKLLLQNESLQQRLLLRNSRNNSAGELAHDSNDLGNGENEQRPRTRGVSEAT
FT                   VIDKFLKDKLDSTEDFMRSLETAWSEEDEAKRKMRRMSLQDFYKETEQRQNSLQLLQSE
FT                   KNRLSNEIVDLRHANKSKENRIHELQESLSVLKRHLTNDGLGIVQGEPMRGSGIESRMR
FT                   RLEEALAQKEQSEVAEKRDKKLQELNDQLFALREANDGLWKQLVSIKDERQEGQRHQSR
FT                   RNSRSTRRSARRRSMEQLAYPPASPHLADKKKNAVAAGAHLAVTIVELRDLMKNGRPII
FT                   EPGYVVIKVKSVKEKYKTSVKELSSAIRFNETFYFYLAQPDEDVITLHVFYKSKGNSRE
FT                   HHVGDAAFTMATLHRGVPRQRVAIVAQNPGTRDARRAAEVEVTLQSDDFGMLSTPTLAQ
FT                   IEEDNIRFKELQKRVEMNSPESLHCVDVLMAMNTH"
FT                   /protein_id="XP_844358.1"
FT   gene            <540510..>541025
FT                   /note="synonym: Tb04.29M18.810; hypothetical protein"
FT                   /db_xref="GeneID:3656735"
FT                   /locus_tag="Tb927.4.2090"
FT   mRNA            <540510..>541025
FT                   /db_xref="GI:72387869"
FT                   /db_xref="GeneID:3656735"
FT                   /locus_tag="Tb927.4.2090"
FT                   /transcript_id="XM_839266.1"
FT   CDS_pept        540510..541025
FT                   /locus_tag="Tb927.4.2090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387870"
FT                   /db_xref="GeneID:3656735"
FT                   /translation="MLLPHPSFVGRFFQCRSKEMAGDRLWEDRNNRFITIFVSEWGGVT
FT                   ALSTSTAVIWCLHSIYGLRALCRCYPFRTANKTRVNTNICFILQVYKCFAISARCLYVS
FT                   PFWMCCFSAPDCQPVGPLCGVDFVVTCTAEVPRLGRRSWALIALFLGVYVLVVRGLFCS
FT                   WGGGTSSI"
FT                   /protein_id="XP_844359.1"
FT   gene            <543683..>544144
FT                   /note="synonym: Tb04.29M18.850; hypothetical protein"
FT                   /db_xref="GeneID:3656737"
FT                   /locus_tag="Tb927.4.2100"
FT   mRNA            <543683..>544144
FT                   /db_xref="GI:72387871"
FT                   /db_xref="GeneID:3656737"
FT                   /locus_tag="Tb927.4.2100"
FT                   /transcript_id="XM_839267.1"
FT   CDS_pept        543683..544144
FT                   /locus_tag="Tb927.4.2100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387872"
FT                   /db_xref="GeneID:3656737"
FT                   /translation="MTVIHLFLYVKMYFVALCFPMQLDVVITQDFCCCGITPIGAVFLV
FT                   RLDTIDFAVTLPFLSEYGAAYVDIVGRTGDCRRENGVVGASAAEYLNGAHHVDSVVYVG
FT                   NVRTLWMRYRSATQTFELSCLLSSPTKIASYLLGKAWNCTASQKEKGRY"
FT                   /protein_id="XP_844360.1"
FT   gene            <546879..>547823
FT                   /note="synonym: Tb04.29M18.870; protein phosphatase 2C,
FT                   putative"
FT                   /db_xref="GeneID:3656739"
FT                   /locus_tag="Tb927.4.2110"
FT   mRNA            <546879..>547823
FT                   /db_xref="GI:72387873"
FT                   /db_xref="GeneID:3656739"
FT                   /locus_tag="Tb927.4.2110"
FT                   /transcript_id="XM_839268.1"
FT   CDS_pept        546879..547823
FT                   /locus_tag="Tb927.4.2110"
FT                   /gene_family="HOG000260361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein phosphatase 2C, putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="similar to Ca(2+)/calmodulin-dependent protein
FT                   kinase phosphatase (EC 3.1.3.16)(CaM-kinase phosphatase)
FT                   (CaMKPase) (Partner of PIX 2) (hFEM-2)(Protein phosphatase
FT                   1F). (Swiss-Prot:P49593) [Homo sapiens;]; go_component:
FT                   protein serine/threonine phosphatase complex [goid
FT                   0008287]; go_function: phosphoric monoester hydrolase
FT                   activity [goid 0016791]; go_process: dephosphorylation
FT                   [goid 0016311]"
FT                   /db_xref="GI:72387874"
FT                   /db_xref="GeneID:3656739"
FT                   /translation="MHQHGKTSGTDGSGATVSQSSSGFMETPWRIFEYGVASEQGSRKT
FT                   MEDQHAMVAESFPFFAVYDGHGGTQCAEFLRDNLHTFIFGQPEIETDPERATRAGIAEA
FT                   ENAFLTKCADEKIESGSTCAVALVVDDTLIAGNVGDSEIVLCRAGAPIVLSTKHSIQDN
FT                   VSEGERVKACGGRIISNRVGHPKFNPQLLSLAITRAIGDAGFKLREFTDGKPSGVIADA
FT                   ETRSTRLTDDDKFLIIGCDGLWDVMSYEAAVQLCSRLASEGETPKAIAGSLCQEALRQG
FT                   STDNVTCIYINIRAKSSAPGCGQLGSGDPLHNM"
FT                   /protein_id="XP_844361.1"
FT   misc_feature    548663..718893
FT                   /note="sequence corresponds to BAC RPCI93-1H19"
FT   repeat_region   549477..549513
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   550490..550516
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <550541..>551767
FT                   /note="synonym: Tb04.1H19.40; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656738"
FT                   /locus_tag="Tb927.4.2120"
FT   mRNA            <550541..>551767
FT                   /db_xref="GI:72387875"
FT                   /db_xref="GeneID:3656738"
FT                   /locus_tag="Tb927.4.2120"
FT                   /transcript_id="XM_839269.1"
FT   CDS_pept        550541..551767
FT                   /locus_tag="Tb927.4.2120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387876"
FT                   /db_xref="GeneID:3656738"
FT                   /translation="MESPTCGDAVGSVDAGRETSCPGSSSGVPYPLFHLIAGDTVILAM
FT                   EHNNHSKLLALSTSRNEIFVTNTQSLPMEAVQMSDGEKERWDPAAATTLVDRLRHACTQ
FT                   LVWAPWQYGNRLACISRGKHIRIYRLSHNRWALDEAVPVQDCNAAAFSPYLTMACACAK
FT                   GKVLIFAQSNSDGNSAWSCCSTYSLESESSSSFNQPIGRNRTTKGCTCVSWDESGSLLA
FT                   VGDGAGSFRVMYVTGESRRVVGTAYGPRVTTDRAAVRHLSWAPGAGRSFLILAVVTLES
FT                   VTLLFFKRPSGGAVATGGAHALVPDRLQLMTETSMEKQDVVGLIWNSNGTRFVTNHTAG
FT                   TLGVWTIVVSFVRPVRRAVSDMGDRGMGLPHAGEPCEDQSPVLVAQMRQISVVHLFQNG
FT                   GYWWRGGGS"
FT                   /protein_id="XP_844362.1"
FT   gene            <552094..>553050
FT                   /note="synonym: Tb04.1H19.50; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656740"
FT                   /locus_tag="Tb927.4.2130"
FT   mRNA            <552094..>553050
FT                   /db_xref="GI:72387877"
FT                   /db_xref="GeneID:3656740"
FT                   /locus_tag="Tb927.4.2130"
FT                   /transcript_id="XM_839270.1"
FT   CDS_pept        552094..553050
FT                   /locus_tag="Tb927.4.2130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387878"
FT                   /db_xref="GeneID:3656740"
FT                   /translation="MGSDVDLRNETEAKNSNHFGKRTNLDRSSVKRQRDGKGGDSLHRA
FT                   CPNAADVQRAVACGGGEAKDAADGGKLSRTRVGRLSDPVYRIMHMLPRSDVLEVVKCRF
FT                   GPEECQRAASYFDKSFMENPLRHLRLQIGCDRATGLNLFFPKLQHHRGTLRHLDLSRNR
FT                   LDEDDVATLVQVLDIRRDETNNNSSALEVLDLSYNRHIGDRGGVMLLSALRGNDRIRAV
FT                   ILKGISLSDAGAFGIAALLPQRPKPLLCGEGGGCDYPLSSSASVSQNPTFFLNLNENII
FT                   GVKGIGALGKGIPSYVSVTASRQYPSFSSRRSARVIR"
FT                   /protein_id="XP_844363.1"
FT   gene            <553424..>556426
FT                   /note="synonym: Tb04.1H19.60; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656741"
FT                   /locus_tag="Tb927.4.2140"
FT   mRNA            <553424..>556426
FT                   /db_xref="GI:72387879"
FT                   /db_xref="GeneID:3656741"
FT                   /locus_tag="Tb927.4.2140"
FT                   /transcript_id="XM_839271.1"
FT   CDS_pept        553424..556426
FT                   /locus_tag="Tb927.4.2140"
FT                   /gene_family="HOG000260357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387880"
FT                   /db_xref="GeneID:3656741"
FT                   /translation="MADTLQLLGDVTDVSNAAAIVGLDTLVEEGRLIEERADYLKEKFK
FT                   ELHNRVLVVYKRDFFLLKRARQLRKELDAQKERMAARGKIAQDDDAEIQRLNKLLMDTE
FT                   EELSDAQERESILQVEVLELDRKKFTVALEREDAIAAEEAQLRPRMEAMRQEVSSTGKE
FT                   LEDMVEQCKTLSAKRDVLLAQEAEATEALAKFKTTMAETTRQLANIERLPEHSLRQAQV
FT                   ILKSYEAALLEAKALDEKLAAQADMIAKLELKKNNRNLDYEQAVANLQKLKSKIDSKRV
FT                   TIATLNTSLEMEQEARLGYQQRIAQIEDLINTTNATRAKQCEDVEQARRDLEQAREEYA
FT                   ELDIALCKIIKEQKDVKDNITSVMKTIERVETTRKRNAQRLDDAKRDAERRNQLFLKEQ
FT                   GYEKEFTAKVGAVSADIKVIEKEIINRTLQEETKRREIKALVVRLQELSKEKAKGKSRI
FT                   IIGKHELRMKEMYVSDARKRLSDLELRLDSIIDTFQSIKHERTHKAAQIQAITQKMTEM
FT                   TEKKAILENELVVLCRESAVKEAELVKKRRQIHKLRQSCRALRLEKNNQRKCLEKRSLE
FT                   ERNIKAQARRVASRIATMEEEMGGAKRNYQNIIENRDGAGIQLLDRNDELCVLYERFKT
FT                   QEKVIRDGITVDNAREEEIRALRIKFTDVRRQVDLVRASVPQVKELEDRLAKILNDIDD
FT                   EKWKVEVLENDLTNPKNAHRWRLLKRQNAGRSVASGVTAPQQAHSDVVATASPGEAAPS
FT                   AIVTASDSCSDDVVDLQQRYQQLEERVRNVNERIREKELILEEVTELSTRLAEQVKNGR
FT                   EFTLALTKQVNSHHHSIRAKTRQMMATVSELSVFQASAIQLQQDVQRLEGIVEEAERLM
FT                   AEGEAPFAEAEERYIREVEGKARYRNVLRRKKEELESEKSKGPKVYVEQRPNAYIPDDG
FT                   LSVPKPFGALMPFKPTPAVQTSRYYRSKSERSRDSDGPKRGPYSESYSGGGSLKGNDNG
FT                   PPKTNHFSLTQ"
FT                   /protein_id="XP_844364.1"
FT   gene            <557007..>557531
FT                   /note="synonym: Tb04.1H19.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656742"
FT                   /locus_tag="Tb927.4.2150"
FT   mRNA            <557007..>557531
FT                   /db_xref="GI:72387881"
FT                   /db_xref="GeneID:3656742"
FT                   /locus_tag="Tb927.4.2150"
FT                   /transcript_id="XM_839272.1"
FT   CDS_pept        557007..557531
FT                   /locus_tag="Tb927.4.2150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387882"
FT                   /db_xref="GeneID:3656742"
FT                   /translation="MIVGQMRRASVAGSSDSVLAIRSCFDNRDAVLFIQPGDGALLVAD
FT                   GHRYVQVILHFHGVTRFPSLIVLPWEQHRFSVRVNNVLYDDGPISLDVGDEIELMDSRS
FT                   RLTADRCVFRVELLTTGCGPYVSELLANGNRTDNAVPAHKPYKVGQGSCWAEFVNHRVG
FT                   KLDKVLSRVKR"
FT                   /protein_id="XP_844365.1"
FT   misc_feature    557832..557881
FT                   /note="C-rich"
FT   gene            <557910..>558311
FT                   /note="synonym: Tb04.1H19.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656743"
FT                   /locus_tag="Tb927.4.2160"
FT   mRNA            <557910..>558311
FT                   /db_xref="GI:72387883"
FT                   /db_xref="GeneID:3656743"
FT                   /locus_tag="Tb927.4.2160"
FT                   /transcript_id="XM_839273.1"
FT   CDS_pept        557910..558311
FT                   /locus_tag="Tb927.4.2160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387884"
FT                   /db_xref="GeneID:3656743"
FT                   /translation="MTESYRSSMYLFQHSFCSSVVLAFCLLNGTLAFLFAFMIDSGALA
FT                   AFAVPAVERGWVVSEKATACRRAGGLFMLLSVLVLVAPSLRWLRGPCRLLSSRLRYRLH
FT                   WGYRTFLSNDCQDVASSRCSDGDCEMLEV"
FT                   /protein_id="XP_844366.1"
FT   gene            <559051..>559446
FT                   /note="synonym: Tb04.1H19.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656746"
FT                   /locus_tag="Tb927.4.2170"
FT   mRNA            <559051..>559446
FT                   /db_xref="GI:72387885"
FT                   /db_xref="GeneID:3656746"
FT                   /locus_tag="Tb927.4.2170"
FT                   /transcript_id="XM_839274.1"
FT   CDS_pept        559051..559446
FT                   /locus_tag="Tb927.4.2170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387886"
FT                   /db_xref="GeneID:3656746"
FT                   /translation="MSPKLYVCIAFSFVNAVTAFVISWLMQARITTFDITAFTHGWDMP
FT                   QKTEACRSAGVLYLILGACFSAYALYLRYATRAEQLRRYEMELAGMPEGTPLLRGPVTN
FT                   GSFPQSKQNQGATGPRSKESYGADSSN"
FT                   /protein_id="XP_844367.1"
FT   gene            <560644..>561093
FT                   /note="synonym: Tb04.1H19.150; 60S ribosomal protein L35A,
FT                   putative"
FT                   /db_xref="GeneID:3656748"
FT                   /locus_tag="Tb927.4.2180"
FT   mRNA            <560644..>561093
FT                   /db_xref="GI:72387887"
FT                   /db_xref="GeneID:3656748"
FT                   /locus_tag="Tb927.4.2180"
FT                   /transcript_id="XM_839275.1"
FT   CDS_pept        560644..561093
FT                   /locus_tag="Tb927.4.2180"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L35A, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72387888"
FT                   /db_xref="GeneID:3656748"
FT                   /translation="MALVKKFSGSVAANRSKKIHQLTKKTTRVKRDRKSPRLYMKGTLA
FT                   GYTRGLHGQNKNTALVRIENVNTTEDAKWYVGKRVCYVYHGYKIKRCVRWSKAPARRSN
FT                   TRAIWGRITRPHGTSGTVRVKFNGSSVPASAIGRRIRVYLYPSRI"
FT                   /protein_id="XP_844368.1"
FT   gene            <563596..>565371
FT                   /note="synonym: Tb04.1H19.200; GTP-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3656744"
FT                   /locus_tag="Tb927.4.2190"
FT   mRNA            <563596..>565371
FT                   /db_xref="GI:72387889"
FT                   /db_xref="GeneID:3656744"
FT                   /locus_tag="Tb927.4.2190"
FT                   /transcript_id="XM_839276.1"
FT   CDS_pept        563596..565371
FT                   /locus_tag="Tb927.4.2190"
FT                   /gene_family="HOG000260353" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein, putative"
FT                   /note="go_function: GTP binding [goid 0005525]"
FT                   /db_xref="GI:72387890"
FT                   /db_xref="GeneID:3656744"
FT                   /translation="METKEKSPMLDDLRDDCPAFSRLDCLGNLTGEGEGPAVGLKEHAL
FT                   QQRAESSFDRDRRLAGIFSLDGVRGRNRLVKEDDNGNVEYKWRLTGVSAGRLEHLITQM
FT                   RFRVGEGNGQCLYELGVADDGTPRGLSAADYQESVETLLRMAKALGLDTTVLQEFAVQE
FT                   TPVPLWCGEILVTQRQAKQQDCRVAFCGTTGSGKSTLMGVLLTGLRDDGVGSARQLIFN
FT                   HKHEITTGKTSSIVTRVLPVTESRVEEMPFAYRPESSERPCRSITMIDLGGDVTKQMLF
FT                   GLMSRRPDFTGITIAVDQSVNEIARYAQVCCAMKFPFFVVVTKIDTVVEFEVDAFLLEL
FT                   AAKLSTIGCSSLVLATSSDVVAFQKTWRKNKQVPLLSLSSVSNDGIEVFQQFLSSLPHV
FT                   EIPPTPNSMFEVLLDGCFLVRGVGPVVKGHVSKGSVELGCRCNIGPDAEGKFHAVTVRG
FT                   IHVDGSHVTRAQQSDEGTFALSELPNGIDMSQKGKMLIPNSVEVCWEFEALIKVLAQSI
FT                   TPQLEPILYSGNLRQAVKIVPSGVETQQLIDEKVLVRFRFLYHPEVMREGASIILQWQP
FT                   SGIAVGEVQSVFANV"
FT                   /protein_id="XP_844369.1"
FT   gene            <566453..>571468
FT                   /note="synonym: Tb04.1H19.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656745"
FT                   /locus_tag="Tb927.4.2200"
FT   mRNA            <566453..>571468
FT                   /db_xref="GI:72387891"
FT                   /db_xref="GeneID:3656745"
FT                   /locus_tag="Tb927.4.2200"
FT                   /transcript_id="XM_839277.1"
FT   CDS_pept        566453..571468
FT                   /locus_tag="Tb927.4.2200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387892"
FT                   /db_xref="GeneID:3656745"
FT                   /translation="MIGSSATTVSCSNDVCSRANERWDEDRLAVATHVQSLLVAIRSNE
FT                   RFGAKARFLGSSDVVEHVLLRRLRALQRKIVTPCLVRPITEEAILLPFCDIWISEEMSY
FT                   TIIGTAMTSLSNLIDLRCTFITVKGIQRVLELAQRSVGGSEDDLTYEDLLLRKLKLCVS
FT                   CVKHPCARALPETFFVDVVRLAFVIAMHPDTSLLLRCIAKEAMKDTATAMYGFIIENIS
FT                   SYNLGQGSTDGVENFQAHESCVDFQLTGVPMLRYVCSLIDGTVSEIKEGRFSPGMFGSA
FT                   ADSSLVRKVQLEGLHLAQSILFVVKDHLCMPECGNLLYSVQHNLCRALLVAGVGTEDIG
FT                   LLSQIFPTVHTVVKVASFHLLPQTYSFLKVLHLDPLVRIGSDLNTNSTSSRVGSVTTSS
FT                   QRPSPAAQMSVSKMLDLCEKRELILESLVGFCTDANFAVFCYAQYDLSRRFLPLLEHMC
FT                   SLLVENCFNITNSNVPLEGGKPGHNGLTNDVEVGTPLTRMDALALEAIKGLLWQVSQVA
FT                   PPQRFHGDSNMAAMINARITEKNMLVELASLFRTNALKSGIPFLLEKAIRLPAGSLKGV
FT                   ETGSIGCDVPMLILEEPAGGREVGACLYRLSGLLDKRALGDYLGELGREPPEPDPDEGE
FT                   HYQAALAAWMEDRKDDHLKLGTVRYHQEQLKGFLQSFDFRGKSLLSSIRETAYHMCMPG
FT                   EAQKIDRVMEVFSRTWLEANRGEGKDINPFQSEQGPFILGFSLIMLNTDQHSGKMSKPM
FT                   TQEDFRRMHRDSDGGGSLPEEYLRAVFEDVKAHPIIMAEMMDVGFSNDVTWRLEMRPSE
FT                   AVESRKSDPFTRVSMQAVSPNALESCEVEALRPFILRMIWSYCLTAFGNTLVGCTKSVF
FT                   ATQKDSTQETGAEGGDVIPQLATPEYAYNCALDGLCLLAKAARDRGMASVVDRVILTIL
FT                   SQLPLDLENVGSTIPQLSTQPSALLCLEKVFRVLDECVHDVLDAWEKLGRLFSNFFLLG
FT                   MFSRDVVDSPETVTLRAELYANPCAGAEEIGDTQPDGGWLSTLWGSPNTQNRTKELRLQ
FT                   REQETMERVKALLPTLEELLNMIDGLDVDSHGRFFSVLCEEVRHKLRQKDGGRLSTHLL
FT                   VLITEIAVRRPAEQTILDRYIKLCQQTASHYFTAHEHLDDADLYRNNISEDGESSSRLY
FT                   APTTERFGVSFGAGASPASFDFFEEWLTSTTRVVKAVLRALVCFASNAESRHVFSPLLD
FT                   LLMAAPPNVFKVAVAADLSLTLLELTQEAPRLVNPPYNLSLNGVLSALSLSFTTCPSPV
FT                   VQKRVQSALSFVVREALYDSLSESDDIVNVLVTCALQSSRMQEEYPASADTTWPRTNVK
FT                   PSDVPEQGELVESFIGSLVTVCHRFAINHALRDAPADNAKGPAVWIIALKGLSNLVVMS
FT                   RHSRDRNMALLCLQRCLLDLEIGSLSADTVVLVYENVIFPLVEQTCASPSDSPATLGER
FT                   CDQNDGCQGGHATDKVLPQILPKQFSVTSILSSLAPAPPSRRAAQSAAAAAAQRSQGGR
FT                   DKHREVVDLKCRVVSLLSKVFLHYAKLMGENPVVLRDLWQRVLGTLCALYTSLSEESGT
FT                   GLPGGEAATLDVPAFNGPRRIGAMAEDNAVLREAIQEAVKNMIYVLASILVGTGSTLEA
FT                   VEAQQFWTSTKNLLRTFDFAEQLLVFIDNLEGT"
FT                   /protein_id="XP_844370.1"
FT   gene            <572177..>572656
FT                   /note="synonym: Tb04.1H19.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656747"
FT                   /locus_tag="Tb927.4.2210"
FT   mRNA            <572177..>572656
FT                   /db_xref="GI:72387893"
FT                   /db_xref="GeneID:3656747"
FT                   /locus_tag="Tb927.4.2210"
FT                   /transcript_id="XM_839278.1"
FT   CDS_pept        572177..572656
FT                   /locus_tag="Tb927.4.2210"
FT                   /gene_family="HOG000260343" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387894"
FT                   /db_xref="GeneID:3656747"
FT                   /translation="MKATIITPGETYRILAPASSLHKYLTDSYWCSAMEEVCEGKLDGV
FT                   AVRYTGQQLVLLQFRPKQLSPAGYRYPISMSIPVEYLVPISTEESTEDHNICKHDTNYG
FT                   TKESTFLGSGFAPLCVVCGRYNVPGMVLRHHGYKCPECVGHKSTRKLRMEGARRR"
FT                   /protein_id="XP_844371.1"
FT   repeat_region   573272..573304
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <574676..>576793
FT                   /note="synonym: Tb04.1H19.310; TPR-repeat-containing
FT                   chaperone protein DNAJ, putative"
FT                   /db_xref="GeneID:3656749"
FT                   /locus_tag="Tb927.4.2220"
FT   mRNA            <574676..>576793
FT                   /db_xref="GI:72387895"
FT                   /db_xref="GeneID:3656749"
FT                   /locus_tag="Tb927.4.2220"
FT                   /transcript_id="XM_839279.1"
FT   CDS_pept        574676..576793
FT                   /locus_tag="Tb927.4.2220"
FT                   /gene_family="HOG000260342" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR-repeat-containing chaperone protein DNAJ,
FT                   putative"
FT                   /note="similar to SP:Q99615:  DnaJ homolog subfamily C
FT                   member 7 (Tetratricopeptide repeat protein 2)(TPR repeat
FT                   protein 2). {Homo sapiens}; go_function: protein binding
FT                   [goid 0005515]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72387896"
FT                   /db_xref="GeneID:3656749"
FT                   /translation="METTCKEDVPQVRFPSPTSSKSMTTSPQKLSILGDITAEPLSARR
FT                   SFNDVSKVREPDGRWCRKFLSTYFRCELCQNVVTDPVQILPNVLLVCRRCALSRRVPSK
FT                   DLQELPVSLTRAFEDLYEGQREVQLPSASRMSEIGRASTTSDEAICKRRMVRVKRPDAV
FT                   QEGSDHSQTFPLAASINGTLNASGRSSVPLLLNKALCELENKEYCMRVEIESAEASGAL
FT                   ELKKSYNSDMRKITARSCGTSKTLKTDADQKYEQAEYTLALELYTKAIELQPRDRLTRL
FT                   TALYGNRSSAYFMAMRYAECIADCMKVVELDPNNVKLFARAAKAAAIMGDLTAAVSHME
FT                   SIPEERVTPNIISEREKYKNGLDTYKRAESSFGKSDSDDAWQMLVAQFSDTIFFRIRYA
FT                   ESLQNQKRFLKAVEVLDVVPQERRTPKLLYIMAACLFMCGFEHFDKARTCLEDVQQLDE
FT                   NCAQLLKVLNIVDEGKQKGNQYFQQKKFVAAMEHYTTAIGAAVNNNQILRILYCNRAAS
FT                   YKEVGKYREAIEDCTRTIQLDPAFSKAYARRARCHQALSDFASAIRDFKAAIKYDPNDQ
FT                   ELPRELRSCEQSMAKEGERERDYYYVLGVSRNATEREIKARYRELSLRWHPDKCMSLPE
FT                   EERVVAERKFKIIVEAHTTLIDAVKRRDYDLKMEKERLTRSGGFGGFNGYSSETFRGHS
FT                   NRFRQGSSGFW"
FT                   /protein_id="XP_844372.1"
FT   repeat_region   576937..576956
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   misc_feature    577841..577930
FT                   /note="T-rich"
FT   misc_feature    578099..578205
FT                   /note="CT-rich"
FT   misc_feature    578235..578332
FT                   /note="T-rich"
FT   repeat_region   578385..578427
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    578608..578628
FT                   /note="AT_rich"
FT   misc_feature    578807..578854
FT                   /note="A-rich"
FT   gene            <579354..>580883
FT                   /note="synonym: Tb04.1H19.360; glycosyltransferase ALG2,
FT                   putative"
FT                   /db_xref="GeneID:3656750"
FT                   /locus_tag="Tb927.4.2230"
FT   mRNA            <579354..>580883
FT                   /db_xref="GI:72387897"
FT                   /db_xref="GeneID:3656750"
FT                   /locus_tag="Tb927.4.2230"
FT                   /transcript_id="XM_839280.1"
FT   CDS_pept        579354..580883
FT                   /locus_tag="Tb927.4.2230"
FT                   /gene_family="HOG000177048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyltransferase ALG2, putative"
FT                   /EC_number="2.4.1.-"
FT                   /note="similar to Glycosyltransferase ALG2 (EC 2.4.1.-)
FT                   (Swiss-Prot:P43636) [Saccharomyces cerevisiae];
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_function: transferase activity, transferring glycosyl
FT                   groups [goid 0016757]; go_process: biosynthesis [goid
FT                   0009058]"
FT                   /db_xref="GI:72387898"
FT                   /db_xref="GeneID:3656750"
FT                   /translation="MIYELALLISTFLGLSIFVIPFSLLRTWTRRQASSRFDSSSARQR
FT                   HPTKLDEQVNAKRPLKVVFLHPDLGIGGAERLVVDAAIALQRYQKVTPVQVIIVTNHHD
FT                   PQRAFAETVDGTVTVQVFGSWLPASIKGRAKVFAATLRMCWAAWVTCWMHPDADCFMVD
FT                   QVAAVLPLLSFVAPQIPRLFYCHFPDQCCDGNRDENQQYKKKPSIFRLLYRKLFDEVEV
FT                   FAMNYASSIVSNSKFSRAATLKVFPKLSNRIDAEADIFYPPVSLAVREGAKPNGDTKVF
FT                   DTEELDKLRDAIQGRSVVLSINRYERKKNLVLAIEAFARLLNSGKTTCSGAPLLVLAGG
FT                   YDTRLEENVAHLNELQKVADTYKLMDSQILFLKNITELEKRYLLSQCCCLLYTPTSEHF
FT                   GIVPTEAMISAKPVVAVNRGGPCESVGEGGTLCDPTPEAFAEAILLYLNDDELRRRVGE
FT                   AGRKRASDVFTIERFGEKLATRFVKLWTETNAAMGRAAFWGKWLEGGKKAD"
FT                   /protein_id="XP_844373.1"
FT   gene            <581397..>582569
FT                   /note="synonym: Tb04.1H19.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656751"
FT                   /locus_tag="Tb927.4.2240"
FT   mRNA            <581397..>582569
FT                   /db_xref="GI:72387899"
FT                   /db_xref="GeneID:3656751"
FT                   /locus_tag="Tb927.4.2240"
FT                   /transcript_id="XM_839281.1"
FT   CDS_pept        581397..582569
FT                   /locus_tag="Tb927.4.2240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387900"
FT                   /db_xref="GeneID:3656751"
FT                   /translation="MQTGPFAAVTRVPDHVRNMILNEIASENIWLFDRGRCEAVTVGDM
FT                   RSSSFSIPMAESPPAVGCELDNNEHLLLYDLMRVRNGQVMFENDHFSRIRQNCILTAPT
FT                   ACDAANVSEDEDLGKLSTYIEGVRSTTRDFIKCNPWENGDVNLKFVTWVLPSQLSDVST
FT                   AERRSELLRTLSYAVYYVTSFFPPEDWYEEGTRYAMLYDAQRHTPNAKILQVPLRERAK
FT                   ALQQTTNAFEVLLVSDNRRHYLVPEGSRSNYLIVSGDESLLCSLEEDILVGITLRVARR
FT                   AAACARLPPLRHRKLVLGDICLAKSIAMLGTSPGVLPIKEIQVFYDEESKQNFLLAMED
FT                   YMQDKDEEIQRAVINVRGRILNDDGLLRLESPSCDTLKRLRAAYEAEALL"
FT                   /protein_id="XP_844374.1"
FT   misc_feature    583064..583084
FT                   /note="AT_rich"
FT   gene            <583450..>584451
FT                   /note="synonym: Tb04.1H19.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656752"
FT                   /locus_tag="Tb927.4.2250"
FT   mRNA            <583450..>584451
FT                   /db_xref="GI:72387901"
FT                   /db_xref="GeneID:3656752"
FT                   /locus_tag="Tb927.4.2250"
FT                   /transcript_id="XM_839282.1"
FT   CDS_pept        583450..584451
FT                   /locus_tag="Tb927.4.2250"
FT                   /gene_family="HOG000260340" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387902"
FT                   /db_xref="GeneID:3656752"
FT                   /translation="MILRHSRRLLAMEGERKFTFPSTPATLSTGGVPFYGNIYAGRVDT
FT                   QNYVPPPQEGSGLIKPNSSAWDDPQVRSKIERCPYFALCDQVVWHNMDPAYLDPGLLTM
FT                   EEHQLLLLFSRAYYEKWKLIHKRPPNALPRVRIKYGSTVLLEEMLELIDVPVPVRRALV
FT                   REFQVDDASLIAMDPDCWSAAYLDPFNRDHFSGRVLEFADMSEAHREKFYLLLRQMRRI
FT                   VVVRRDTPEEERLVLPFSSGITLYDLSKYLGIEPYGGQLKVYDYVDLQKTQQVITLKDE
FT                   DSYFDYLVTTFFKANLRNATLSDVADDMDNTARYTITVEPFTVAERRIGRWF"
FT                   /protein_id="XP_844375.1"
FT   misc_feature    584924..584951
FT                   /note="AT_rich"
FT   gene            <585251..>585799
FT                   /note="synonym: Tb04.1H19.410; centrin, putative"
FT                   /db_xref="GeneID:3656755"
FT                   /locus_tag="Tb927.4.2260"
FT   mRNA            <585251..>585799
FT                   /db_xref="GI:72387903"
FT                   /db_xref="GeneID:3656755"
FT                   /locus_tag="Tb927.4.2260"
FT                   /transcript_id="XM_839283.1"
FT   CDS_pept        585251..585799
FT                   /locus_tag="Tb927.4.2260"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centrin, putative"
FT                   /note="go_component: centrosome [goid 0005813];
FT                   go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72387904"
FT                   /db_xref="GeneID:3656755"
FT                   /translation="MSSSRPATGNRLAVPIRTNLPVPAPRKRRFELTDEQRQEIREAFE
FT                   LFDSDKNGLIDAHEMKVSMRALGFDAKKEEVLRMMQDCAARDQHNNPLMDLAGFTDLMT
FT                   ERFAQRDPRQEMIKAFQLFDENNTGKISLRSLRRVARELGENMTDEELQAMIDEFDTDQ
FT                   DGEINLDEFLAIMLEDDDY"
FT                   /protein_id="XP_844376.1"
FT   repeat_region   586003..586041
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   586626..586653
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tcc"
FT                   /rpt_type="tandem"
FT   misc_feature    587002..587045
FT                   /note="A-rich"
FT   misc_feature    587185..587274
FT                   /note="A-rich"
FT   repeat_region   587301..587350
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   587407..587449
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ataag"
FT                   /rpt_type="tandem"
FT   repeat_region   587880..587951
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   repeat_region   588280..588307
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   misc_feature    588447..588591
FT                   /note="T-rich"
FT   repeat_region   588638..588668
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    588739..588759
FT                   /note="AT_rich"
FT   misc_feature    588908..588932
FT                   /note="AT_rich"
FT   repeat_region   589029..589061
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   misc_feature    589062..589091
FT                   /note="AT_rich"
FT   misc_feature    589143..589182
FT                   /note="AT_rich"
FT   repeat_region   589562..589585
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   589643..589664
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    589821..589841
FT                   /note="AT_rich"
FT   repeat_region   589923..589984
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tactg"
FT                   /rpt_type="tandem"
FT   repeat_region   590008..590033
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    590730..590750
FT                   /note="AT_rich"
FT   misc_feature    590872..590903
FT                   /note="A-rich"
FT   misc_feature    591006..591029
FT                   /note="AT_rich"
FT   repeat_region   591076..591099
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttgtg"
FT                   /rpt_type="tandem"
FT   misc_feature    591177..591197
FT                   /note="AT_rich"
FT   repeat_region   591331..591359
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    591391..591443
FT                   /note="A-rich"
FT   gene            <591904..>592842
FT                   /note="synonym: Tb04.1H19.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656753"
FT                   /locus_tag="Tb927.4.2270"
FT   mRNA            <591904..>592842
FT                   /db_xref="GI:72387905"
FT                   /db_xref="GeneID:3656753"
FT                   /locus_tag="Tb927.4.2270"
FT                   /transcript_id="XM_839284.1"
FT   CDS_pept        591904..592842
FT                   /locus_tag="Tb927.4.2270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387906"
FT                   /db_xref="GeneID:3656753"
FT                   /translation="MDEYGDFDNRDTYDTDEAAFLTSRLAMRAEEVEANVSGSQFLNSP
FT                   RNGSTLDAEEDEEANFTPNVLGGPTNDTPLFYGEELDSLIQSQERNVAGNVTTQNIDAS
FT                   EGDALHIDEHEENDDIDNNDVDDDDEGDDDDDDNNNNNFLIDNYEPPEHTDMASGGSGC
FT                   EGGGDRTPFALSRVRELLKFHSNSTIVSKDAVTTASEAVVLILQDLTRMAAAQAERNNR
FT                   KTVRYSDVATVVQHYDRFSFLLDILPPVPEVKKHSSKPVQRQTAIVPTGSKVGQTPRSS
FT                   QKQQQLQQTGTQRGSHMRQAKLSFGNAADCI"
FT                   /protein_id="XP_844377.1"
FT   repeat_region   592236..592329
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   gene            <593290..>594438
FT                   /note="synonym: Tb04.1H19.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656754"
FT                   /locus_tag="Tb927.4.2280"
FT   mRNA            <593290..>594438
FT                   /db_xref="GI:72387907"
FT                   /db_xref="GeneID:3656754"
FT                   /locus_tag="Tb927.4.2280"
FT                   /transcript_id="XM_839285.1"
FT   CDS_pept        593290..594438
FT                   /locus_tag="Tb927.4.2280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387908"
FT                   /db_xref="GeneID:3656754"
FT                   /translation="MLPHSVPTSPHQERDRPLEQMTDEELRRELVMLIRTNAILAEESA
FT                   GLQADISALCEESVRFQQSTEIEEDKVTNQLLRRLQSEEVQKHRFHHQILCEEKARRKI
FT                   MDQITQVRQQMELEKQLEQEQEVQRMELQRKLIDVVNKKIEVERQLLEERRVQLEALTT
FT                   KLASIKEGSLAAKSKVDGAVGSRGTQGPSASSQQCQSGTANMTHESPAAAAAAAVAASS
FT                   QPPPVKTETVPSSVDLPASDVAGDDTHGTIIRLEEQLNRLLEQHAAATQASATNESLCT
FT                   ELGRNLETIQQAASVDRARTLKLKEELQETKRRVAVLEQRAAVGTAYAASDDSSDLPTP
FT                   SVSSLYDDKRRESLLNCHQRYPSSCVPPSCSASEAGEDTRSV"
FT                   /protein_id="XP_844378.1"
FT   repeat_region   593918..593941
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   gene            <595290..>596948
FT                   /note="synonym: Tb04.1H19.570; glucose transporter,
FT                   putative"
FT                   /db_xref="GeneID:3656762"
FT                   /locus_tag="Tb927.4.2290"
FT   mRNA            <595290..>596948
FT                   /db_xref="GI:72387909"
FT                   /db_xref="GeneID:3656762"
FT                   /locus_tag="Tb927.4.2290"
FT                   /transcript_id="XM_839286.1"
FT   CDS_pept        595290..596948
FT                   /locus_tag="Tb927.4.2290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose transporter, putative"
FT                   /note="similar to Probable transport protein (LTP).
FT                   (Swiss-Prot:P13865) [Leishmania enriettii] and  similar to
FT                   Glucose transporter 2A. (Swiss-Prot:Q06222) [Trypanosoma
FT                   brucei brucei]; go_component: integral to membrane [goid
FT                   0016021]; go_function: transporter activity [goid 0005215];
FT                   go_process: transport [goid 0006810]"
FT                   /db_xref="GI:72387910"
FT                   /db_xref="GeneID:3656762"
FT                   /translation="MIEGSRNSSAVKKRLVAKPLEECAPLNLLGAEDVMGALHTSSVSF
FT                   FTWGILQTVIVHCFAGALFGYGIGFVGPYYTLYKMGSDCMTVTTQSTCPMFIPEKCTWK
FT                   DNACKFVVDNCSGQLKEACGASSSSSVSQTCYWNHKTNVCQPMAGFTALQNGIFAGAFI
FT                   FGGCIGSLISAPLLSVSGHRITFLLCGFVGTVGGALTHFATYTDSYMLLVAGRFLTGVS
FT                   AGVLCVSSPAYVEETAPIQHRQLVGVFFQIACTFGILSASAMGLGLAQRSFSTQHDMQQ
FT                   RQQMFCLPGTIIALLMMFISGPMRESVVWMEQRHLSRPGEQDDLVTFAEGRVSYGTVIS
FT                   SDPKPGWGGVKGQLLTALVLCIAQQLTGMNAIMNYAPIITDRMGLEPLFGNFVVMAWNF
FT                   ITVLTSIPISSRAHADRAYVVALLLASLSCLLVAVAVLPFFGFSSNLKVKLSATGILLF
FT                   ITFFELGMGSFFWTLSQGIFPPNFRHRGSSFTVLVHFLINIVINVGFPLAVEWLSGGPS
FT                   GNQDVGMGIAFLFFGIVGLLSTAYLHRHLRLWQSS"
FT                   /protein_id="XP_844379.1"
FT   repeat_region   597625..597660
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <597749..>599869
FT                   /note="synonym: Tb04.1H19.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656756"
FT                   /locus_tag="Tb927.4.2300"
FT   mRNA            <597749..>599869
FT                   /db_xref="GI:72387911"
FT                   /db_xref="GeneID:3656756"
FT                   /locus_tag="Tb927.4.2300"
FT                   /transcript_id="XM_839287.1"
FT   CDS_pept        597749..599869
FT                   /locus_tag="Tb927.4.2300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387912"
FT                   /db_xref="GeneID:3656756"
FT                   /translation="MSAVSSPKQSQHSDVKFPEIVPRMDEAMDEVKEEAQVEREEVEEE
FT                   FHLPVCFRMHYDALPYPRTNVFRGPSTYRLHSQIVLPFIKPLSSATVGELVSRFTARAF
FT                   KCYPELSDFVVEALYPCFQGTTTSGDNVFIGHLSDRIVVKEHAASPLLSFLAPTTPGKT
FT                   AVYDLFTLWRGTKTRCGSAQMPVLAPICHNADMKNGGRQQENAMIYTWPNVSLSEIPYP
FT                   LKHRCPLTKLPPLFSSGEEGGLCDGLPAVHSRLNPEQRKLLDQLVGFESEERHARSSIL
FT                   EDEGVSWRSFREWELDARRRTVVLLRLKSRDASKVPLCGLEEFNVPEFPRTYPVDTVPL
FT                   ISPEKMVKLEKVKEYSIDTVWLSRAFARYEKRQSCDTNDTQPQPLPSKLRECNGNAVAS
FT                   SAQLGENIDNSVDKGDESDEMDELIDQFADFRRDLLMLERKEFRSLTAGFRLILERQRE
FT                   FEEEYMKEIMADELRGTDVLDAESYEAPYDSQNVNGAWTCVARMSASPQDYSANLPNGC
FT                   AASSPAPPSTCASPAKVVKEVELVGDSPKFPSYEKRECDIGVKAVTCPDFEDGIPYRKI
FT                   LTDKEARVRAALDTIERIDSQWSEPMWLKVGKRRVEHCEADVRRKLYADEVARRCDICI
FT                   CQRQDVEHMKEKKRLALVRAFEPIVEGEEEDRMAIYEEEERWRSLLLSLCLRGVVLLKT
FT                   FRPQRWGWDDDV"
FT                   /protein_id="XP_844380.1"
FT   repeat_region   600911..600945
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <601005..>603245
FT                   /note="synonym: Tb04.1H19.630; asparaginyl-tRNA synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3656757"
FT                   /locus_tag="Tb927.4.2310"
FT   mRNA            <601005..>603245
FT                   /db_xref="GI:72387913"
FT                   /db_xref="GeneID:3656757"
FT                   /locus_tag="Tb927.4.2310"
FT                   /transcript_id="XM_839288.1"
FT   CDS_pept        601005..603245
FT                   /locus_tag="Tb927.4.2310"
FT                   /gene_family="HOG000226035" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="asparaginyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.22"
FT                   /note="similar to SP:O43776:  Asparaginyl-tRNA synthetase,
FT                   cytoplasmic (EC 6.1.1.22) (Asparagine--tRNA ligase)
FT                   (AsnRS). {Homo sapiens}; go_component: cytoplasm [goid
FT                   0005737]; go_function: nucleic acid binding [goid 0003676];
FT                   go_function: asparagine-tRNA ligase activity [goid
FT                   0004816]; go_process: asparaginyl-tRNA aminoacylation [goid
FT                   0006421]"
FT                   /db_xref="GI:72387914"
FT                   /db_xref="GeneID:3656757"
FT                   /translation="MVLMRKFRCHGGVQCNCALHCFYFYRCPLLCTNIPIRTAAVLSSL
FT                   RRSSPLLSDPYESGTKKTFSPRRAFIHTTERSKLMSEEIITKLREVVGLDEKNAKDLST
FT                   KPERVTDLLEFFGVQGITAASPREQKVMMFNIWTKVKLSEHRDHIATYVKNNKLDSTQK
FT                   VDAAVRFVNALKANAAFEVAKFEEECGVGVVLSRDDTVRLVKEALEAEDPKVLKASWVK
FT                   NPNMLIGKVKRAKGLQWADISVVKSAVEEMVPPMIEGVVLEEAPSKPKQAAPSAPSGKG
FT                   AGGAQQCPRNDDWKNVVDTKKRNLIGDLPKCKEGEIVHVIGWAHRVRHQSRISFVVLRD
FT                   GSGYIQVVFGGETEPFHRETSLAIRGRLKHEPKAKAELQPPYELHVEEYAIIGNSDGSI
FT                   ENVITAESSPDKLLDDRHLVIRGTYGSTTLKVRHELIRAFREYFWSKGMYEVTPPTLVG
FT                   TQCEGGSTLFDVMYYGKKAYLTQSSQLYLEACTASLGDVYCLLSSYRAEKSKTKRHLSE
FT                   YTHLEVEYAVCNFEEMLTYIEDLIVSVFNMVIERVGDLIAFMNPKQLVDPNGNPRDPKN
FT                   WKLAPKKPFRRLKYADAIKFCNEHNILNPETNEPFKFGEDITDQPERAMVGMIGEIVLM
FT                   THFPAEMKSFYMARDDHDNRLTESVDVLAPGIGEVVGGSMRMWDYDELMEAYKREGLDP
FT                   EVYYWYTEQRKYGSTPHGGFGLGLERLLVWLLDLDSVRDACLFPRYMGRCQP"
FT                   /protein_id="XP_844381.1"
FT   misc_feature    604075..604104
FT                   /note="AT_rich"
FT   gene            <604609..>605043
FT                   /note="synonym: Tb04.1H19.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656761"
FT                   /locus_tag="Tb927.4.2320"
FT   mRNA            <604609..>605043
FT                   /db_xref="GI:72387915"
FT                   /db_xref="GeneID:3656761"
FT                   /locus_tag="Tb927.4.2320"
FT                   /transcript_id="XM_839289.1"
FT   CDS_pept        604609..605043
FT                   /locus_tag="Tb927.4.2320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387916"
FT                   /db_xref="GeneID:3656761"
FT                   /translation="MVVFHQLILPLGVLLLLHSIYLALSAREQLQEQHHGTGESLNRGD
FT                   YFPMTSLRTGAVTGSSGATLYIFAELLVGVAVSIIGYVKRSTFKPARLIDKNCFDRYDS
FT                   IAYTGVGFMHFNHRGAGTARRSAKTPNGESIRASTGKKHA"
FT                   /protein_id="XP_844382.1"
FT   gene            <606108..>606350
FT                   /note="synonym: Tb04.1H19.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656760"
FT                   /locus_tag="Tb927.4.2330"
FT   mRNA            <606108..>606350
FT                   /db_xref="GI:72387917"
FT                   /db_xref="GeneID:3656760"
FT                   /locus_tag="Tb927.4.2330"
FT                   /transcript_id="XM_839290.1"
FT   CDS_pept        606108..606350
FT                   /locus_tag="Tb927.4.2330"
FT                   /gene_family="HOG000260348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387918"
FT                   /db_xref="GeneID:3656760"
FT                   /translation="MFRRTFFTPMIAQPTLLMLGNKGGTPKRKKNPMQLRRKVYGLHFK
FT                   EKYLKMEEWYYCPLCAEPKKPGEWCRREDCRQIKP"
FT                   /protein_id="XP_844383.1"
FT   gene            <606820..>608397
FT                   /note="synonym: Tb04.1H19.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656763"
FT                   /locus_tag="Tb927.4.2340"
FT   mRNA            <606820..>608397
FT                   /db_xref="GI:72387919"
FT                   /db_xref="GeneID:3656763"
FT                   /locus_tag="Tb927.4.2340"
FT                   /transcript_id="XM_839291.1"
FT   CDS_pept        606820..608397
FT                   /locus_tag="Tb927.4.2340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387920"
FT                   /db_xref="GeneID:3656763"
FT                   /translation="MIHICNPTEERCRMDLIFPEEAHTVTVRHFSVPEPPGAPELRQQS
FT                   NFPITSNPQISPAPDPVVVAAIQRRIECGSGLSSCGESGDSMDNASDPARRLAHLQSAL
FT                   SILCHTAAMDKSQFFLYRKQVSKKSTNDNAECASTTDYSITDIYTTVRALKLEYDEAVK
FT                   HSRDEKGTQTANAEVLELARRRTECRVDDCLRLLEPTITELILDFTHVKKVPVAYTEEM
FT                   LQGLPQVFAMERWPCTILRKETDDFVGQKRPRVSSRPLAGESGRGESFFEHNDVAHAAT
FT                   AVVFKALRDLRKNDYMCLLGDKTLTSAPKAADVSRSHLTYGELVERTLSGVYRERGLLA
FT                   ALYDVKRLLYGAYDAAPAEHAPTIKSLHAQFEQDLRRHYSAFLSKTGLRCRANDFVLQV
FT                   KTMFDINPLPASREVKDGEGGVPLYSETQKKCLKLLGHLRAVDSKGWFEYPAFDLANIE
FT                   LSSIERWICGPPFSTKTDREAFVALRDVLEQMVDNCVLSYGPTSQYSRVITMVRQRLVE
FT                   ASQEVGLL"
FT                   /protein_id="XP_844384.1"
FT   gene            <608837..>609799
FT                   /note="synonym: Tb04.1H19.700; G-actin binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3656759"
FT                   /locus_tag="Tb927.4.2350"
FT   mRNA            <608837..>609799
FT                   /db_xref="GI:72387921"
FT                   /db_xref="GeneID:3656759"
FT                   /locus_tag="Tb927.4.2350"
FT                   /transcript_id="XM_839292.1"
FT   CDS_pept        608837..609799
FT                   /locus_tag="Tb927.4.2350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="G-actin binding protein, putative"
FT                   /db_xref="GI:72387922"
FT                   /db_xref="GeneID:3656759"
FT                   /translation="MAKALSVSFKIDSVLQEAFGKIAAEDSRLRALVITVEDETMRLRG
FT                   APLEATGNQSDDLVKLRDAITEDGLSAAFLIVKLAKGEFAQISFCSEDVKPKVRMMHSS
FT                   GAMHLAEVSGLQKPPFKLTKRNVERMDDICESLFKKESESSRAELMTEEEKLHAAVAKL
FT                   EVAPPVAVMPGVTVPISEEGVLLLKRMANSEVNAVTFAIDKEKFVVEKSLEAAAAVSAL
FT                   TAASLADDVVALLPEGQPRVVVMRCPTAEAGVIIVNVCPPTCKPRERMTYSSCRASFVQ
FT                   QAQQHNVKCVRRMEVGEMDEFREAVVEAFAEQTSGDGKP"
FT                   /protein_id="XP_844385.1"
FT   gene            <610194..>611156
FT                   /note="synonym: Tb04.1H19.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656764"
FT                   /locus_tag="Tb927.4.2360"
FT   mRNA            <610194..>611156
FT                   /db_xref="GI:72387923"
FT                   /db_xref="GeneID:3656764"
FT                   /locus_tag="Tb927.4.2360"
FT                   /transcript_id="XM_839293.1"
FT   CDS_pept        610194..611156
FT                   /locus_tag="Tb927.4.2360"
FT                   /gene_family="HOG000257196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387924"
FT                   /db_xref="GeneID:3656764"
FT                   /translation="MFLRRLIVSQRRHVFCAGVVLSASRFCSGCGTTSSRADSPPTSAV
FT                   NVESFTLNEEVVKRDMEALAKWNDLSSRMDAYREEKQYGKILSAVDEGIAMLEEMGALS
FT                   APIQCETLLLLEASQAHYNLQQYDLALERAKKAKQTLMAAPEGMRDAAKLGETNQLIGY
FT                   IHLKSGKLEEANSVFTDILRWIDVDARTATPMQAVAAVNMRRFIVTGIALCWHKVAERE
FT                   CATGGDGREMYGKALDLLLEALNTHIDENDHEMVKMSLLSILQCFDGVGDGSQAVITAE
FT                   KLVRWCSRHKDEQGIAEGNEWLTKMQEKYPQKKEEGDKV"
FT                   /protein_id="XP_844386.1"
FT   gene            <611657..>613375
FT                   /note="synonym: Tb04.1H19.720; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656765"
FT                   /locus_tag="Tb927.4.2370"
FT   mRNA            <611657..>613375
FT                   /db_xref="GI:72387925"
FT                   /db_xref="GeneID:3656765"
FT                   /locus_tag="Tb927.4.2370"
FT                   /transcript_id="XM_839294.1"
FT   CDS_pept        611657..613375
FT                   /locus_tag="Tb927.4.2370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387926"
FT                   /db_xref="GeneID:3656765"
FT                   /translation="MAKGNEECVDLRQSWRHFMVTPVEQTHAPVGVEQAQIKRGEFTLL
FT                   QRYHLVGTNADEQSLFFLSLISPNAELLRATCHLFIQLNFQYRQLLLDNEEKLTLLRFH
FT                   HEEQLTSLLEASNAETRDMVVGSDVTEHFVLKHQRELEEHQEENRFSENTLLLELRQNF
FT                   FTFLKASAQGTMDSLEGEPGWLKLRQNDEQHKRGMNIGYFCDGRVPVRVVELPNLLGRN
FT                   LTGFRPKDPLLRPIVVDISPLTSLRECLHCLYSEERDSVLAVEEHLLRLSRQVHAVLLF
FT                   IGLEDEAMRILSSNYAELFLDQESISPSRPAPCFVPLRHHRCLRVMLSTQLWGANIILL
FT                   WTPQAANGRHNCEPLIVEDALNLALSWNADMFTVAVLGSAARSHATSSLHTEDPTREIP
FT                   MEVLRQLQCGVGRLVFEAATMKASAVWGGSEETEQRQQKNNWDAGQTVPQLVSAREPQL
FT                   EFNLPMSIRVFLPTTMASLDESGDRSESLELSLQGGGGAAGRVERHGFRQDEDVGDVSV
FT                   IDSSSLTDVHSIRHTTNSSFSSNIGSRRETDRRGRRQMTFGRLLAYNFGESAVLR"
FT                   /protein_id="XP_844387.1"
FT   gene            <613831..>615705
FT                   /note="synonym: Tb04.1H19.730; sarcoplasmic reticulum
FT                   glycoprotein, putative"
FT                   /db_xref="GeneID:3656768"
FT                   /locus_tag="Tb927.4.2380"
FT   mRNA            <613831..>615705
FT                   /db_xref="GI:72387927"
FT                   /db_xref="GeneID:3656768"
FT                   /locus_tag="Tb927.4.2380"
FT                   /transcript_id="XM_839295.1"
FT   CDS_pept        613831..615705
FT                   /locus_tag="Tb927.4.2380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sarcoplasmic reticulum glycoprotein, putative"
FT                   /note="similar to Sarcalumenin precursor
FT                   (Swiss-Prot:P13666) [Oryctolagus cuniculus]; go_component:
FT                   sarcoplasmic reticulum [goid 0016529]; go_function: calcium
FT                   ion binding [goid 0005509]; go_process: endosome transport
FT                   [goid 0016197]"
FT                   /db_xref="GI:72387928"
FT                   /db_xref="GeneID:3656768"
FT                   /translation="MSSHGKLVRKAEDLQEDLSWDSHIKHVLIELEKIYFQRIRPIEVK
FT                   FDYDMCCPSWFGESMVQKKPFITFLGPFSAGKSTFINYLLQGNLLSTGPQPVTDRFTVI
FT                   SHAKDVQKIPGRVLMADSKQPFRGLNQFGGVFGEVLEGITHPHPILQSVTLIDTPGVLE
FT                   TAGNAHSRRYDYVNACRWFVEKSDLVFVMFDPTKLDSGEELRAVFQQALRGHESKIRII
FT                   LNKADTVEPQELMRVYGALFWNLSALVATTEPPRVFISSFWEQPYRMGTDHELFTEEKA
FT                   DLIYHITTVVPMQALDRRVASVLQRATRVIAFAILCATYKTKMPSLFGKAKARKQFIED
FT                   LPQICEDLANKYRCSVADFPKKEVLENFFSRAKTSDFFDMNQLLKRKWIELMRITVDRD
FT                   LPMLLKPLEESAVVDPNDRKHALLLQREYFKRMSMEAHGQLFVEDVCQNLGTVPMIQSQ
FT                   FTDRPAICDVPANNTSMQLQSTAPPNGAGGNVNQEQLAVMMQMMQTMMAAQQGQKPSPQ
FT                   QQGVPLISQQAYAPQQVQPEQGGPLFPPSQQISTTTQQMNPYQQMQTMDTLQQGVPQFP
FT                   PSQVCIEMPQSNPYQQGQPTFMPYGGFPSDPQGQGLPQNPQQQGQLFP"
FT                   /protein_id="XP_844388.1"
FT   misc_feature    616340..616370
FT                   /note="AT_rich"
FT   gene            <616735..>618795
FT                   /note="synonym: Tb04.1H19.740; ATP-dependent RNA helicase,
FT                   putative"
FT                   /db_xref="GeneID:3656758"
FT                   /locus_tag="Tb927.4.2390"
FT   mRNA            <616735..>618795
FT                   /db_xref="GI:72387929"
FT                   /db_xref="GeneID:3656758"
FT                   /locus_tag="Tb927.4.2390"
FT                   /transcript_id="XM_839296.1"
FT   CDS_pept        616735..618795
FT                   /locus_tag="Tb927.4.2390"
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /note="similar to ATP-dependent helicase DHX8 (RNA helicase
FT                   HRH1) (DEAH-box protein 8). (Swiss-Prot:Q14562) [Homo
FT                   sapiens] and  similar to Pre-mRNA splicing factor RNA
FT                   helicase PRP22. (Swiss-Prot:P24384) [Saccharomyces
FT                   cerevisiae]; go_component: nucleus [goid 0005634];
FT                   go_component: spliceosome complex [goid 0005681];
FT                   go_function: ATP-dependent RNA helicase activity [goid
FT                   0004004]; go_function: pre-mRNA splicing factor activity
FT                   [goid 0008248]; go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72387930"
FT                   /db_xref="GeneID:3656758"
FT                   /translation="MLPKLNPFTKKPYTPQYYKILAQRTTLPVYQRAKELTQNVRDHQV
FT                   VLFVGETGSGKTTQVPQFISEMELPGVVVCTQPRRIAAMSIAVRVAAEMDVQLGEEVGY
FT                   RVRFKSMVSDKTKLLYMTDGMLLREAFSDRDLSRISVVVVDEAHERTVETDVLLGVLRL
FT                   LMQRRQDFRLVVMSATLDMERFQAYFPKAPLIQVEGRMYDVQVLYSTVPVKDYVEACVE
FT                   RVCDIHLNEPPGDILCFLTGEAEIERAVSRTKLKLEHLLADDGNTVSSNGAQLLARVLP
FT                   LYGSLGVDDQGRVFSNAGKNTRKIIFATNIAETSLTIDGIVYVVDCGYHKQSLYNAEAR
FT                   VDYLLPAVISKASAEQRKGRAGRTRPGKCFRLFQQSDFSSFPNQTHPEVLRSNMINTVL
FT                   LLLKLDVANPYQFAFIDPPSQQSVMDAYCQLSLFGAVDDDLQLTDFGRLMADFPVDACL
FT                   ARVLMRSAQYGCAADAAVIVAMLETRNVLVRPASRGIEAEQKHVMFRHPDGDHLTLFKV
FT                   FHAFWRSGQSSQYCFDNFLAYQALQQAVNVYTQLTKLMKKKNICFVSTYDDRSGKLDSV
FT                   AIRKAVLEGFFTQVAYKPPGGELYKTVRDSQMVALHRHSFPSMSGSPSWIVYDRLEVQG
FT                   QGGTFIRVASAIEPEWLLEVSDFFNDTSEFGDGEICRILQDLKAGGTTQKG"
FT                   /protein_id="XP_844389.1"
FT   gene            <619197..>623600
FT                   /note="synonym: Tb04.1H19.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656766"
FT                   /locus_tag="Tb927.4.2400"
FT   mRNA            <619197..>623600
FT                   /db_xref="GI:72387931"
FT                   /db_xref="GeneID:3656766"
FT                   /locus_tag="Tb927.4.2400"
FT                   /transcript_id="XM_839297.1"
FT   CDS_pept        619197..623600
FT                   /locus_tag="Tb927.4.2400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387932"
FT                   /db_xref="GeneID:3656766"
FT                   /translation="MEGERGRNSQNQKLGLELVHDDGRPIASCPIDMNELLKKMGKTVE
FT                   VKEGVRVRLEEYNEDEGLYYSEDSWSEESEEESQSEENDSAEDIAETPPPGCRRVEDWN
FT                   SAVRATQRGEKPPMVQASGILSRSPKHVKEKGTADIKAGQIPRRELWVSRAPPADTERT
FT                   YKRLQTVRLMPCPTSRRFCLPPLTFHAAASYTGNAARGPRMLVYGGTTNLGKTTENELY
FT                   EFSLLSGDWRRVEGKQSHSPGVYGHTAVVLKKHRRVVLTGGVGYGGVPPEPLESLTDDY
FT                   RRARFHLLFPHKEPIQSNAQAIPETVANTELPTLWTLAHAAESVPTFGFLPVIFDVDLR
FT                   TRRWRTIETSPKLPVVFHSAVAIGTRLYIFGGMNTHLQVSSQLILVDGETYKISLIPPS
FT                   TDPPKARFLHSAVVYAHWMIIYGGFDAHNQPLDDAWAFDTVNERWEQLHCHGSHARGAH
FT                   AACVVGSRLIVVGGFDSSFDGDEAPASTCLELNLIPNHEDKHLWRPLPLHPTVPPVAFA
FT                   AVCPCGDDASFLLYGGCIAAKKGDDSKKAQGGGGKSPGRGRHTNSGHTGYSDCIGDDGD
FT                   NLTIWKRLVPSNEGFLLTFPVKRPEKNNEGDAEPRYNALGVEIDPDEVPAEFLAFVKRQ
FT                   HDFLLKKTGNVEQTMKKIFLEERESMEPHLYLTPDEVERLIEESEELCTRFSEYKMEEL
FT                   PPHVPERQLRLHLNEECVSLSRQVRDVIKSMKGNPAAAAAVKSKTHRFKVGQKFESHSA
FT                   PKPFRRVVIMSLMKEIKRNIKRVLLSNKALKTVEWPNKAEYLEAIRRMQETADTFLLSV
FT                   KEILDVYIEKRVDSLVSAIDTRKNKLKRLTEAVERSRQSFPVHPLDIVARVGGRGGRSS
FT                   PSPQSISSRARSRSPSARHFKGGEEATHTLNKGEVGVLLNKASAVRTNASLFGESCQSM
FT                   IPPAPKQVATALLVPGMTPPPEGEDAAASRETVWHTACGQVQQIVKCVDRFIEGIRASQ
FT                   LEQKPLNEAGDGTEEGSYRVNLALATVWPLETCKDKLDELKKGMPEVRNPSPAAGGDEA
FT                   AKLKKTQQHYTRLSKSLTALVQSVKMSILSRAGAKPPPAVHITSRDVVAASPSSKGRAW
FT                   RPPQSRRQRSTIEVLDLHADDATEPEGYSPTAEEEQRHCHAVLSPLSPKLVPIEDLFAS
FT                   PRTAPAVEAPNRIPITSREAAALVSAPQAAVAATGECVIVPSKKDVRVVKNSSSASLLF
FT                   HEGDDTSAAMHSRLFPPQAYHDYYAAAATPQQPTCIAVSNGPKMVAAGENRSSDAVISL
FT                   IDVFDGVHPVTVTDEGKQDLKAMVSVTPGFFHAHPSAVDTGTSETSDHVKYCDSPMLED
FT                   DYFFFGRRLESSCLPTGPVQPLSTPSAKGTTRKKTQKREPSVKLAAKSRTRDTKSSPHC
FT                   LSFSATPLRDSKRRSVSRGERAVRQLMEPDSFARGGGGGPLRGKLTPGEARIAEARKRG
FT                   SLMSGS"
FT                   /protein_id="XP_844390.1"
FT   misc_feature    624205..624272
FT                   /note="A-rich"
FT   repeat_region   624430..624461
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <624605..>628051
FT                   /note="synonym: Tb04.1H19.760; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656767"
FT                   /locus_tag="Tb927.4.2410"
FT   mRNA            <624605..>628051
FT                   /db_xref="GI:72387933"
FT                   /db_xref="GeneID:3656767"
FT                   /locus_tag="Tb927.4.2410"
FT                   /transcript_id="XM_839298.1"
FT   CDS_pept        624605..628051
FT                   /locus_tag="Tb927.4.2410"
FT                   /gene_family="HOG000260339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: hydrolase activity [goid 0016787];
FT                   go_process: O-glycoside metabolism [goid 0016140]"
FT                   /db_xref="GI:72387934"
FT                   /db_xref="GeneID:3656767"
FT                   /translation="MGFWPRSLLARDYEVPKRPIFHLEGWDVVQGTDAATYVSGVVPDG
FT                   VMYGTNGCLGVRHHCESETVGYRTSLYMNGVYHSAPLNAYVDSEALPEEIQVGATVCEV
FT                   TLDCFIDGESGTLGEAPSQRLNLRDATYSSTSVDVVSGDGGLTFDSTYRQVVSLNELDL
FT                   WCAETVCTNFSIDALSSGTDFASQNNSESSAKHIEEDMYSTESSTYSVVFIVSVTVSLD
FT                   DWYLVGGDSTEKLLIESTTSGILVGTETEASCTVECGDRTYKIVPEQQVRNVPEDFYTP
FT                   HRDCGFSHAAYVSESESEHPHSSRAAWRGTSGSRGRVCFQKQFPYTITPDNVPQKVTLS
FT                   FHARHHNGGLPLSRPFPSFADVVAEQRLVLDNFWSTFWIDIQRQDELPPNRMKLGLIFN
FT                   SFRLFCVSRNLQNGLPQAGCSTTKSNLLYDLQQYVYHGIYYILTSPSSALALLRSLYCM
FT                   LSQARMNALRLSLEHGAVYPRRTITGTECWHCSTLNNARFHVNAEVGYIINMYFSAVES
FT                   IATSDRLWLLELMLETARVWSQVGEWVENEGVFRLDNIAGPDEYNGNAAGNFYVHLSAK
FT                   LHLRNAYNLYEEQQKIVGDEAIFCLLQGINMDISELENFRTISNEIVVRRDNHLDVFLV
FT                   HDHFDTLKEWKGERPKHPLSMNYHPLAIYRHKVVNIPEVLLGMLLYPAEFERKDLLQNL
FT                   SYYAPLCTHDSAESLAIVACVEFRANGRFTHGMPLLCSLASLDLDNIIYAADEGLDFGA
FT                   MSATWIAVVMGIGGVKITSRSLHLDPSFPAGLSVLSFTLHWRGATLRTRVEKDCITYDL
FT                   MAGDSIRFIHASRHRIHLHSGCRQSVARKQVAIPQPMSSMHGEFAGAIFLCETLFDSVM
FT                   EMNFIAWGKTLESLYENYRALHLRHIPPLTAEEFVDKVIYQAEHREIAFSGIHNVLLDR
FT                   GIDLPLGSPDDAEIVETRYGLANAKVAELEEMWSREAPCVNPAMRALLRDLEDNGIPLA
FT                   LVSYSRTLKTLMQYHPEEALRFLTAIDGDEAHERHIKSRPHLDIFVRAAEKIHVEPSRC
FT                   LIFSSHIDSNFKVSELSYFRMVFDVEDPFAARVRGSKTCEYPSMLRPAAADGDVRPLVI
FT                   NLKRDKFPTTVDGLESILCGPVASGSDLAAAGDAPPSDPCS"
FT                   /protein_id="XP_844391.1"
FT   misc_feature    630038..630070
FT                   /note="T-rich"
FT   repeat_region   630594..630626
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttcc"
FT                   /rpt_type="tandem"
FT   gene            <630695..>631117
FT                   /note="synonym: Tb04.1H19.810; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656769"
FT                   /locus_tag="Tb927.4.2420"
FT   mRNA            <630695..>631117
FT                   /db_xref="GI:72387935"
FT                   /db_xref="GeneID:3656769"
FT                   /locus_tag="Tb927.4.2420"
FT                   /transcript_id="XM_839299.1"
FT   CDS_pept        630695..631117
FT                   /locus_tag="Tb927.4.2420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387936"
FT                   /db_xref="GeneID:3656769"
FT                   /translation="MTLADTLHPVFVFILIVNAVSCAFPLLSHRLVFYPIVFVALGLLY
FT                   VTLLVLLMGATVMMRNQSFSDHRVKENTLIIIKRDVNMTTWMVISTVVMVAWMYCWARR
FT                   VWLVYILPMVEEYNAFKSRRWADALDLRGRMKPTVS"
FT                   /protein_id="XP_844392.1"
FT   repeat_region   631623..631658
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <631854..>633818
FT                   /note="synonym: Tb04.1H19.840; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656772"
FT                   /locus_tag="Tb927.4.2430"
FT   mRNA            <631854..>633818
FT                   /db_xref="GI:72387937"
FT                   /db_xref="GeneID:3656772"
FT                   /locus_tag="Tb927.4.2430"
FT                   /transcript_id="XM_839300.1"
FT   CDS_pept        631854..633818
FT                   /locus_tag="Tb927.4.2430"
FT                   /gene_family="HOG000260337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387938"
FT                   /db_xref="GeneID:3656772"
FT                   /translation="MARHPNTAIVLQPTNSAIITLDLCLQLGGPSAPLWRKSVARDENE
FT                   AADRAIERLRILIAQSAGDKKSKKTSREEILKNCQPIEVLGVSSEGEQILNEENGLTKL
FT                   DTSVSNKEFWRNVRQMLIGSTVVPVKYNVPTITAVVPPSALYVGAPAVCAGITALFTTE
FT                   VDVQYEWCARAAPKSPAGTGASSDATVRVISTKPVFTPTTRELGESLFLRVLPEPGSDL
FT                   CTQVELPQVRAEVPPMDRWTQTKQSVEAPSFRMVTYNVLHEEFCSTSSAKKTIYPFATD
FT                   DILSLEYRQSRIVQELLAYNGDIICLQECGKKVYQQFFSRVMTQYGYEGCYTNKNGGVR
FT                   EGCACFWRRSRFFLQEKDEFPLNWSTMEKEHPALAAEVTRHPELKEALENVTSIGALVL
FT                   LKDNATNEELVVGNTHLFYHANACHIRLLQVYMLLHKLKSRSDSRRGVVLCGDFNFTHT
FT                   TGGYKLVTTGRTEASHHSWAKGEVFHWGCDRMLGINAAEGAGGSAEVETGLDVRRGKGE
FT                   SATCASKNNKNDTNNNNESNGNSVDASTSCAATSADTGVASSVKADYRPPFDVFRADME
FT                   APMQFTDAYGVTDPEMPWTNYTMTFREVIDYVFFNPDRLLVVQTIPIPPESELSENVAL
FT                   PNRKYPSDHVALIADLSYK"
FT                   /protein_id="XP_844393.1"
FT   gene            <634811..>635965
FT                   /note="synonym: Tb04.1H19.850; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656770"
FT                   /locus_tag="Tb927.4.2440"
FT   mRNA            <634811..>635965
FT                   /db_xref="GI:72387939"
FT                   /db_xref="GeneID:3656770"
FT                   /locus_tag="Tb927.4.2440"
FT                   /transcript_id="XM_839301.1"
FT   CDS_pept        634811..635965
FT                   /locus_tag="Tb927.4.2440"
FT                   /gene_family="HOG000256360" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387940"
FT                   /db_xref="GeneID:3656770"
FT                   /translation="MFSQTRCSACIGKELYSRASTLPRDFYEACAKHFGIKMHQETFIG
FT                   VRSSQIRGLFLSPSINKPLEANKPIATIPLSSLYTVTNIHTKPDTLHHVTLSNVRDAIR
FT                   DVEFKAMTSQFYLGLQMSAIISSLPDITRAQNAEEMERITQILRGGAMPWVRLIDDEDF
FT                   NEQFVFGMYGMALDSWQRQSYEEMTKVFHRNITSIHEKTNPPFSVDTFRRITRLILARA
FT                   EHFPPLEYYNGSVLWRRVLRFVRRWSKIPEPSELCLVPLLDLVNHSNRPNCAIRIGPSA
FT                   AMDGRPAITIYSIARINPGQEICRHYNFAINRPNALFRYGFLPFDLISIVEHDAIDEYL
FT                   VKNQHMLREETEEAQIKRAKERAELQRLEQIFQKARSGSVPADS"
FT                   /protein_id="XP_844394.1"
FT   gene            <636846..>638081
FT                   /note="synonym: Tb04.1H19.870; thioredoxin, putative"
FT                   /db_xref="GeneID:3656771"
FT                   /locus_tag="Tb927.4.2450"
FT   mRNA            <636846..>638081
FT                   /db_xref="GI:72387941"
FT                   /db_xref="GeneID:3656771"
FT                   /locus_tag="Tb927.4.2450"
FT                   /transcript_id="XM_839302.1"
FT   CDS_pept        636846..638081
FT                   /locus_tag="Tb927.4.2450"
FT                   /gene_family="HOG000260335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin, putative"
FT                   /note="similar to GB:AAF45013.1:  symbol {Drosophila
FT                   melanogaster}; go_component: integral to membrane [goid
FT                   0016021]; go_function: protein disulfide isomerase activity
FT                   [goid 0003756]; go_function: electron transporter activity
FT                   [goid 0005489]; go_process: electron transport [goid
FT                   0006118]"
FT                   /db_xref="GI:72387942"
FT                   /db_xref="GeneID:3656771"
FT                   /translation="MKRPSFLLVSLLFLAIGSTVIEAFPFTASSGVVELTPATFNSFLG
FT                   SHKPVFILFYAPWCGHCKRLHPEWEKFAKSVEGIVRVGAVNADEHQQLGQQFNLRGFPT
FT                   VKFWGLGEKRANAAMDYAGERSAGAIQSQAISLINAPGIKTVKKAEELREAAQAAPEKK
FT                   AVVLFSAKSRVPPIYAVLSLSPRLKSMPFYFAGEQEKSGFASEFGVSKLPAIVVLNTTA
FT                   GEVKPVIYPGKKVAYEPIAKFLLACANDAYDEANFSLEGGESEQATKKGAAKLALPVRP
FT                   LPASAHGLENFCSPDARKKAERTPLCVISLTSEFSLNDVHKTFSNEPLVFFEAGDARDI
FT                   LLGALRGKLGLEKIADKLKDDKEHNALLLRASKQGTVHYRLVGGVNTAETLSSVLQMVV
FT                   SGEISLTKEQPK"
FT                   /protein_id="XP_844395.1"
FT   repeat_region   638680..638729
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <639439..>643299
FT                   /note="synonym: Tb04.1H19.900; dual specificity protein
FT                   phosphatase, putative"
FT                   /db_xref="GeneID:3656773"
FT                   /locus_tag="Tb927.4.2460"
FT   mRNA            <639439..>643299
FT                   /db_xref="GI:72387943"
FT                   /db_xref="GeneID:3656773"
FT                   /locus_tag="Tb927.4.2460"
FT                   /transcript_id="XM_839303.1"
FT   CDS_pept        639439..643299
FT                   /locus_tag="Tb927.4.2460"
FT                   /gene_family="HOG000260333" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dual specificity protein phosphatase, putative"
FT                   /EC_number="3.1.3.48"
FT                   /note="similar to GB:CAA77232.1:  DsPTP1 protein
FT                   {Arabidopsis thaliana}; similar to Dual specificity protein
FT                   phosphatase (EC 3.1.3.48) (EC 3.1.3.16).
FT                   (Swiss-Prot:Q39491) [Chlamydomonas eugametos]; go_function:
FT                   protein-tyrosine kinase activity [goid 0004713];
FT                   go_function: ATP binding [goid 0005524]; go_function:
FT                   protein tyrosine/serine/threonine phosphatase activity
FT                   [goid 0008138]; go_process: protein amino acid
FT                   phosphorylation [goid 0006468]; go_process: protein amino
FT                   acid dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:72387944"
FT                   /db_xref="GeneID:3656773"
FT                   /translation="MGACIAALRGKVAGKTNDSHGISDQSLPTAESTDDSVNNRNGKFN
FT                   KCIRGEESISSGDMHGKEGSDLSKSLTSLWGVLSKTEFADFFRAHPELLKSNSAAVMCT
FT                   GAFRPGELVGAYCVVKELPGGTVGRSFLVKAVDDSGPPTPTVTTPEVEDSGKREFVFKV
FT                   MTFINRKNLVEPVLDDKRALMNLTGDGLLRPVHLLLDEGNETVISVTPFLKEGSCARLA
FT                   GKLEEDRLLSILRDVASALRLLHSHNIYHCNLKLENVLLREDGKACLADAALWRIFSTQ
FT                   SRDCLLFNGELACMPPEMFMIDEADNQSKDASKVDIWGFGLFMYRLAYGREPFDIEGKA
FT                   LEQVCELVSVDRLQFPQRNWSIASSLEDAIRVCLDDDPERRPTVPGLFSFSLFRNHNFN
FT                   SVVAGGSVGLPGFRASHNDTGPSGGRSGSDNYIRWAYPRYHWRKNVSLDEMLGSGGICE
FT                   TYRVHLRRHPSKQFVMKVLKRSVLKAASQYRISTDDLRHALAVSRLINHPNVLNLLEIV
FT                   DSRDGCFASQQLAKSRFLYAEFPPLLNHKNPLFTLKQMLADVLQGLFVLHLNGVPHLRL
FT                   TPSNIFYELGVGFRVSDFGPLFLAREEIVESMETDQPLYSVPQWVVDDLKVPIHMSRFS
FT                   LDVFCVGLLAASALPSVLHEDWYRFSNSEGCILDVKGVCEKVKNASLYLKPMLVDFILQ
FT                   ALTNPATTVRDLMNHSYLSDAIDVSRLDEMKPLNISPADMEMAVSERFTTTDESGLWNV
FT                   LGHDPAAGNGHLWCSMFRNEALPDGCIRSGIQSVNEVAAARRVPFVKKLVCGLCRCELP
FT                   IVLFLCDKCDDYIRCAKCSLVDTHADDHKLSPHLVHTVGQDGVDGNFFALLVPTCNICV
FT                   AQSLEALEMQANLPHGTLTKDITTQSVTAERALRRLTLAKLNPGPKVLPKVSDTEGETW
FT                   EEEVASCRETRNTELLLHQFELNTVPKELFDPPLLHVASIDLSYNKLTSLPDDLALLCN
FT                   LRSVSVAHNALTVLPDSMGELRQLDRLDASHNKLKDLPLTFVKLRKLSTVTLDFNEFSG
FT                   LPRVLDDLIVATASTPQLSTIYLAENTNITRFPDYTNLAILPTLKLALDNEPSVYQTYL
FT                   NENLAEKLPNIGMLWNKIYPDRIVDNVFCGSLRTTQSQVVYDKLGIKNLLTVGRDLVPV
FT                   PPVGGKHLVISLDDIEEADIRCTFDEAVNFIDMSVEKGEGCLVHCFAGLSRSATTVIAY
FT                   FMMKRGMRLGDAYQLTKRGRPSIYPNEGFFRQMIELDGELFPDDPPLQLEDIGRESPNV
FT                   RV"
FT                   /protein_id="XP_844396.1"
FT   repeat_region   643357..643386
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    643774..643796
FT                   /note="AT_rich"
FT   repeat_region   643948..643986
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   643989..644020
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    645274..645294
FT                   /note="AT_rich"
FT   repeat_region   645706..645781
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <646319..>650353
FT                   /note="synonym: Tb04.1H19.920; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656774"
FT                   /locus_tag="Tb927.4.2470"
FT   mRNA            <646319..>650353
FT                   /db_xref="GI:72387945"
FT                   /db_xref="GeneID:3656774"
FT                   /locus_tag="Tb927.4.2470"
FT                   /transcript_id="XM_839304.1"
FT   CDS_pept        646319..650353
FT                   /locus_tag="Tb927.4.2470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387946"
FT                   /db_xref="GeneID:3656774"
FT                   /translation="MELLNVLPHEAALHRLMRAGVCNDDQMHDYFISQAFRGIAYAVNR
FT                   ATLPAPVFVQQPFLSGSSNTTGSSGGTNDSPTLNPCAAGSTTATTTGAVCVLCRMCVQA
FT                   VTSHMSHRTAAYLATRLLADEATAFGEGNERPCCTVAWVEALCSVGKASFLQKQLGVNR
FT                   RMALGYLYILAETVRATARGRVIGKRLSSHFVEFAHRILDDVIPYLAIMADAREVFAVT
FT                   RHVPVAGNPSEGNIPTETTSTAAVVPRPAWHPPSRLTVEANNTIIHLFHDIAHDIIDVH
FT                   HRSGKNPGERCLVLDRDMPSRMWPAVSILQSALHRALDWILQEGLACVRTMALATEHRE
FT                   EKAAIEAVQTVKKALDDTFAQMFERQETLECSRQAVERQYGKGAKDYHGITDTLWANTL
FT                   RLCLLCRNVTGAWIEVYGGAGYTETRSTDKNVLSFIASFVSSVPLMDGDETESSVFLAT
FT                   IALLSAALAAVVAAPVPFMQVSLWVSDTALTGQVHNVVIQRGLRYKDELVQRLSALISQ
FT                   LILSGSSLSGASRAIVESSDQLLELISNGRDAASHCVIRMLSRAILERPHSMLPALFRL
FT                   LQHGDVKTRRNVLDVLSALPQMDDEAGLGEKLVAEQMRPMLRQLSEELLLRIQDEELLV
FT                   RLQGSKLFAKVWPEDVIRPLLNLATQKDKSHKKQSAAQQALRSVVAAHTGDSRVVLLLL
FT                   DESLKLVGETTPTAPTAPNTPAGMLAFAQLHSCVGEREGEGDGAGGQPGCAAATGGLTT
FT                   ISAAGGFCQRLMGIALSLVKRWAEEVPSWSEPVLQPIVDRVVSARSPKEQEFAVRFIAQ
FT                   VSSLCGITVEGAAALTSCVLRVVQGGKTGSLPSERWLTGLCGSRQSNNSNEKRDEIALV
FT                   EECCPVDSEYRMIAPLLCLRGCPRRPFLSCRVDSMPPSMLNLWEFIWFVLFSSDYCEQL
FT                   TPDTQRLLLELVCKYRTSMVLERFAHFERMHLEKNGDKERKSCEGNSAYLICADKQACF
FT                   LFRAGFFCTGTLVAQSSLAFTKPATKDGESQLGVETATTSSPEGSCEEAMELLDLVHAA
FT                   ELVSRWTESVVFPWLLGDNDDETTCSRNPPSDLQRLSRSAIDCIALLTVVALNRAEFDA
FT                   HVSRLVRNPLSELALLYREEVKQSKKDVGAERKEAFALEKCGDLLGRFEFAVQVHSRVL
FT                   NILRASQMGRGNVCTWFIAFMPHLIELANAACGVAARLGRNDVGQVAVECCNVLFLAAM
FT                   SSSGGPPAVEGERRATSGESDTKPLLMDLCTSDRSALLAFAVGSSRYSSLPAVQSEGVK
FT                   LLSALLGAAPDIFVDTAAGKGTALDEAFSALSSVALLHEDCKTRSLAEAVISTIQKTEQ
FT                   I"
FT                   /protein_id="XP_844397.1"
FT   gene            <650671..>652173
FT                   /note="synonym: Tb04.1H19.930; 8-oxoguanine DNA
FT                   glycosylase, putative"
FT                   /db_xref="GeneID:3656775"
FT                   /locus_tag="Tb927.4.2480"
FT   mRNA            <650671..>652173
FT                   /db_xref="GI:72387947"
FT                   /db_xref="GeneID:3656775"
FT                   /locus_tag="Tb927.4.2480"
FT                   /transcript_id="XM_839305.1"
FT   CDS_pept        650671..652173
FT                   /locus_tag="Tb927.4.2480"
FT                   /gene_family="HOG000260331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="8-oxoguanine DNA glycosylase, putative"
FT                   /note="identical to GP:27764447: putative 8-oxoguanine DNA
FT                   glycosylase {Trypanosoma brucei} (PMID:14706348); 100%
FT                   identical to GP:27764447: putative 8-oxoguanine DNA
FT                   glycosylase {Trypanosoma brucei} (PMID:14706348);
FT                   go_component: nucleus [goid 0005634]; go_function: DNA
FT                   binding [goid 0003677]; go_function: DNA N-glycosylase
FT                   activity [goid 0019104]; go_process: base-excision repair
FT                   [goid 0006284]"
FT                   /db_xref="GI:72387948"
FT                   /db_xref="GeneID:3656775"
FT                   /translation="MQRVLPFALHCYFNLGSAMRDWHALAPSAAIHLPMTLCGGQCFRW
FT                   RRTPRGTWVGVVRHTAYELCDPLKMSIAKPEQKKARKTASFLSPLSLAATAAPPFISSA
FT                   DVSATGQPSADLLWFRCLNCDLRSESDAREQTLFLRHYLALDVDLQKMWLRWTADNPMK
FT                   SHPLVKCLTPCGSTDLPVSIRHLRQDLHETLLGFLCSQNNNVPRITSLMERLSISYGDY
FT                   LCDYNVVTGDVRHAAHCGNVKGNPSEQNDGGGWIALHALPSMDQLAAATEESLRALGFG
FT                   YRSRYLTECAAIISKSGATRVQKEVKDKKMKKKEVGKPAGPLAAVQPYKWYEELASNRL
FT                   TLQERREKLLALPGVGRKVADCILLFALGHHELVPVDTHMAQVAAEYLACPPAVVVAAK
FT                   KQRESEASERLKRRRGSNHEELANAVDSGDSVLSSLSWENTLVEWYRNGRGKKAKFPAL
FT                   LLKHHDAIQYGFKLLFGDYCGWAHSILFYARMRSSGNKEATA"
FT                   /protein_id="XP_844398.1"
FT   gene            <652953..>654305
FT                   /note="synonym: Tb04.1H19.950; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656776"
FT                   /locus_tag="Tb927.4.2490"
FT   mRNA            <652953..>654305
FT                   /db_xref="GI:72387949"
FT                   /db_xref="GeneID:3656776"
FT                   /locus_tag="Tb927.4.2490"
FT                   /transcript_id="XM_839306.1"
FT   CDS_pept        652953..654305
FT                   /locus_tag="Tb927.4.2490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387950"
FT                   /db_xref="GeneID:3656776"
FT                   /translation="MSNNVELLRFVALSAAVHADAVQCLADDTRRVLSQMAVDSDQLEA
FT                   LEAQLTDLLQKQRRLHTLRDAVTKARQERSEESGSGCKSSGSRAPKSTAPVIPPTSAGN
FT                   VDRNIKCILQFASRAVEKDEIQPIGTRRSKRVTVTPTSFLPKIPHEERTETTCDSTDGG
FT                   REEKEDTECTIDEEVERLKMEIRHAEAMSVGKKLRDLEALKQQVKEVDANSLVQRYVGS
FT                   FSFPMEVEELWRGNNVLNCTNIDTFVSGACKRFAGRYDDALRAISDFPLSEASDAARVY
FT                   GSTLYAEELTSSSNYDAVGVQVLERSGESTLPQFYRRKRRLARVSAPFRRRAVGTVLGP
FT                   EEFTFLPTDWPATQLILPPAEGHLPPAKHIMTPRFSFASTDELKALQSLRVDIQRSAVA
FT                   AFMDASKALDELMNPTTLQRDGIDYKATLIRLLEAERKGSSRVWTTLAREG"
FT                   /protein_id="XP_844399.1"
FT   repeat_region   655039..655062
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <655877..>658903
FT                   /note="synonym: Tb04.1H19.980; protein kinase, putative"
FT                   /db_xref="GeneID:3656778"
FT                   /locus_tag="Tb927.4.2500"
FT   mRNA            <655877..>658903
FT                   /db_xref="GI:72387951"
FT                   /db_xref="GeneID:3656778"
FT                   /locus_tag="Tb927.4.2500"
FT                   /transcript_id="XM_839307.1"
FT   CDS_pept        655877..658903
FT                   /locus_tag="Tb927.4.2500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="similar to Eukaryotic translation initiation factor
FT                   2-alpha kinase precursor(EC 2.7.1.-) (PRKR-like endoplasmic
FT                   reticulum kinase) (PERK) (PEK)(DmPEK). (Swiss-Prot:Q9NIV1)
FT                   [Drosophila melanogaster;]; 53% similar to Eukaryotic
FT                   translation initiation factor 2-alpha kinase precursor(EC
FT                   2.7.1.-) (PRKR-like endoplasmic reticulum kinase) (PERK)
FT                   (PEK)(DmPEK). (Swiss-Prot:Q9NIV1) [Drosophila
FT                   melanogaster;]; go_component: integral to membrane [goid
FT                   0016021]; go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: eukaryotic elongation
FT                   factor-2 kinase activity [goid 0004686]; go_function: ATP
FT                   binding [goid 0005524]; go_process: protein amino acid
FT                   phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72387952"
FT                   /db_xref="GeneID:3656778"
FT                   /translation="MPDAYVFAASLLCCLWALTGSGVRGGDTEATIRSQPSGAENNILP
FT                   LAVTPPSGLLLLLQMDGNITARWLDSGSHMWTVNTGGNIISVDVLRHATREVIRRDPFA
FT                   LPFIIEGGMLFTRRRYPASDAGKQLTTRYTKDGTFDDGDDYEDDYIDDAPLTPSHPQFF
FT                   MNLSTLIRRRHVNVENTEIYVTTSVQLMDYDSHTGIPIMRPTPLTSFLHVVLCNVTIHV
FT                   VRRGMYKWKMSIAQYKLSESFPPQGPESDEGGEKDQNFIANVVEEQSQNSVRQAILAMQ
FT                   ARLRDAAMPFDFKRKTFNVDDLVMREVGNQRYTLWNTLTNVAEWPAAVGTTSSIVNAFF
FT                   WHPGRGGVYPIPLYRFHRPPTADAFTHAGRLQRNGFPLLSDRPWTHRTVRLKPYVATWE
FT                   DDIDADERETEELQRSFQQCSWLQECSANSRQMVAYSFREGMVGNESIPILSLSYILLN
FT                   TMTRRTMFFAFQTVCILVSATLVGFGMLLRPRLRNAWAQYDSLMDNMRQTSKTTPTGFA
FT                   AADRSGRFDTPAGGSPAAVFVESSPFSLTMTAAPLDDGVEQIVRMGKPQVTDSVNETSA
FT                   GLGDTWWKNPNDYDDDDEYVAGESSLSVRGSVSATQPVTTPMPQLFQQHFDVLKKIGRG
FT                   GEGNVFCVKHQVTGAMYAIKAVRIREEDKQRCVREAILHSSLDNPNVVRYFYSWIENIA
FT                   RSIAEAHGIVNNDNVEGSVSFCGDESYGTINDTVSSATGAPLNVLFIQMEYFKSGTLAD
FT                   HFRNRNAFSRLENVEHLLQIVRGLRYIHQQDVIHRDLKPTNIFVSDAGIMKIGDFGLAK
FT                   RWQTPLGWKRASVEEFGSATALFDDERSFAGGTPLYWSPEQQCGGSATAASDVFSLGLI
FT                   AVEFYCEFTTQHERLRTLGDARHGELPSALEDDFPEEAEVFRQMLGEQPDGRPSVDEVV
FT                   QKLKHIVVEIRSGGNGSAKLGDNGATDDVGDVELAMPTSSSADMLSVNKTPADSMNIVP
FT                   LGNVSSVESSTAGRLPSAN"
FT                   /protein_id="XP_844400.1"
FT   repeat_region   658959..658993
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   659240..659310
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   659346..659367
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   660006..660033
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   660437..660496
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   660574..660636
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   660699..660746
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    661160..661228
FT                   /note="GA-rich"
FT   gene            <661909..>666420
FT                   /note="synonym: Tb04.1H19.1030; multidrug
FT                   resistance-associated protein, putative"
FT                   /db_xref="GeneID:3656783"
FT                   /locus_tag="Tb927.4.2510"
FT   mRNA            <661909..>666420
FT                   /db_xref="GI:72387953"
FT                   /db_xref="GeneID:3656783"
FT                   /locus_tag="Tb927.4.2510"
FT                   /transcript_id="XM_839308.1"
FT   CDS_pept        661909..666420
FT                   /locus_tag="Tb927.4.2510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multidrug resistance-associated protein,
FT                   putative"
FT                   /note="similar to GP:20271162: multidrug
FT                   resistance-associated protein 7B {Mus musculus};
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_component: ATP-binding cassette (ABC) transporter
FT                   complex (sensu Eukaryota) [goid 0043191]; go_function: ATP
FT                   binding [goid 0005524]; go_function: ATPase activity,
FT                   coupled to transmembrane movement of substances [goid
FT                   0042626]; go_process: transport [goid 0006810]; go_process:
FT                   cadmium ion transport [goid 0015691]"
FT                   /db_xref="GI:72387954"
FT                   /db_xref="GeneID:3656783"
FT                   /translation="MTTKNRPIEEAAAVYILRIIHTILLWLGVTLGSVLVVCSQPRFVP
FT                   IRTAISSFVYLLASLCVIFVSILELKGHISTISGVTHWMDRVGCSYWFLLLFIRCIKPS
FT                   HAVEWVASALLPLLVLTEWAVVTTYILISSTYHPVITVDLFLTVLHTVVFTAFVGLDRL
FT                   MISDITVIFSAARAAQDADAVEACGGNMGMSRSGPGSFRSDDMLELSHELQSSASSYSS
FT                   ALCRGNSRCYILRVVARRWGGTYAVLVFVRLLYEFGGLLPAHLLRILVDNLSVVENKHG
FT                   KKHGSDGLCMASVMIVVIIAYNLICTFLRAHYRVALQKIVLYTRGLLTSELFRCTLCRR
FT                   KHLFDGRTQGDIMNHLSLDVARVADAASSFNDLWALPLQLSLALYLLYIQISFAFVAGV
FT                   VVSVALIPINMWLTKRIQGVMSELMRENDERVLRITEIVRNIIYVKMCGWSQLVQQWVK
FT                   ESRDRYLVHLRWLKYLDAFCVFFWATTPTLVSLVTFITFILMGGELTPGKAVTALALFN
FT                   SLTMPLNAYPCVINGLVESYVSWCRLSPFLVMRPDACHGDLYGFASGESDSGTKMFTEI
FT                   TEEYQDMVVSSEEMPCASSLNEIQPLLQAKGCVGEMRRQRLAGIHGLPHPFRRNHDLLI
FT                   DIRSGVIRLNTQGGAGLPRPSFMLHIPTFQATSGQLIAVVGVSGSGKSTFLDGLAGEHL
FT                   IDPNDATGHAAVSRFSTAYVEQQPFLMSGTLRENILMGLMYDSVRYEAVINAVALTQDL
FT                   QTCFYPDGDTFLVGDRGIRLSGGQRARVALARALYAGKELYLIDDILGCLDPTVARHIV
FT                   TNALVGSAKSGSCVIVATHNQELVERADVVYRCVEGQLLFSQRLVKTAATTVAEPSSPA
FT                   AKPHATQQHVALANNEKGHGKVGNVLGDVPWPSSDSSPARAPVATPESGSIEAAEVLET
FT                   SKHGTLAWETLACYIGRVGWKLSAFIIISAALMQISRNAGDQYVVTWAKSGDGNTTRFI
FT                   WSLAILAGVNSVLALARGFSFAFGGLRAAKRLHNELLGHVMSATFTFFSDTPPGRIINR
FT                   LCGDTYTIDDSLPFIMNILLAQTFLLCGAVVVILLNSSSLLIVTLIPVSVLYHRIQCPY
FT                   RASSRELRRLEEAANAPLLDTMRDALDGGVVIRSLGGRVVMSHLRRASRNTDLLLRVKF
FT                   NSMLLGAWFTIRLELVGLLPLIFVGGTAIYYHGSASAPFIGLALAYVQPLTSYVGGLLG
FT                   AFASTETELISVERVRQYFSLASEEPRTLGMFFSPPLSNWPSGGQVVLSNVSMRYDPSG
FT                   PEVLRSLSFHVNAGEKVAIVGRTGAGKSSIFSALLRLVEIESGSIHIDGYDTRRLPLEV
FT                   LRTRLSVLPQQPFIFSGSLRQNIDPFGLHSEDAVRDVATSVKLDGVALDYNVTDSSRVS
FT                   GGQRHLIALARVILQRSPLLLLDEPTAQSSAEAEAALWSSLAEHLRSTTVLCITHKLSH
FT                   IDFFDRVIVIENGHVASDGTVAQLRAASVWPFSSPNADASLT"
FT                   /protein_id="XP_844401.1"
FT   gene            <666641..>667375
FT                   /note="synonym: Tb04.1H19.1040; NAD dependent deacetylase,
FT                   putative"
FT                   /db_xref="GeneID:3656777"
FT                   /locus_tag="Tb927.4.2520"
FT   mRNA            <666641..>667375
FT                   /db_xref="GI:72387955"
FT                   /db_xref="GeneID:3656777"
FT                   /locus_tag="Tb927.4.2520"
FT                   /transcript_id="XM_839309.1"
FT   CDS_pept        666641..667375
FT                   /locus_tag="Tb927.4.2520"
FT                   /gene_family="HOG000085950" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD dependent deacetylase, putative"
FT                   /EC_number="3.5.1.-"
FT                   /note="similar to SP:P97013:  NAD-dependent deacetylase (EC
FT                   3.5.1.-) (Regulatory protein SIR2homolog). {Salmonella
FT                   typhi;Salmonella typhimurium}; go_component: chromatin
FT                   silencing complex [goid 0005677]; go_function: DNA binding
FT                   [goid 0003677]; go_process: regulation of transcription,
FT                   DNA-dependent [goid 0006355]"
FT                   /db_xref="GI:72387956"
FT                   /db_xref="GeneID:3656777"
FT                   /translation="MRRPNGMIAILTGAGISAESGISTFRDQNGLWENHRVEDVCTPAA
FT                   FLKQPTVVQRFYNERRRALLSPEVKPNASHQALARLQREYKDGQVVIITQNIDDLHERA
FT                   GSRQVLHMHGELLKVRCTATGRVFESREDVIHGESKCECCGVVETLRPHIVWFNEMPLY
FT                   MDVIDEVVQNAGLFVAVGTSGNVYPAAGLVMIAKAHGAETLELNLEPSGNCRDFDRSVY
FT                   GPASVIVPAWADEVLHGKGPAA"
FT                   /protein_id="XP_844402.1"
FT   gene            <667858..>668334
FT                   /note="synonym: Tb04.1H19.1060; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656779"
FT                   /locus_tag="Tb927.4.2530"
FT   mRNA            <667858..>668334
FT                   /db_xref="GI:72387957"
FT                   /db_xref="GeneID:3656779"
FT                   /locus_tag="Tb927.4.2530"
FT                   /transcript_id="XM_839310.1"
FT   CDS_pept        667858..668334
FT                   /locus_tag="Tb927.4.2530"
FT                   /gene_family="HOG000260532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387958"
FT                   /db_xref="GeneID:3656779"
FT                   /translation="MGFGAVVSYFGLIFLLTVFIASGVQIMMYPTSGAMMLAKSNFPKL
FT                   LEMAGIQYRLSVAEYTMVVQGIGASCIGFSLLMLLGVGRSFFAFLLAVLVSLLTLAFHI
FT                   DLRAPTKMSETNAFQVLKNAAIFGGLMFVAGSSGRSRAAPRAATNATGKEKKKN"
FT                   /protein_id="XP_844403.1"
FT   repeat_region   668511..668561
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   668936..668965
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    669046..669078
FT                   /note="A-rich"
FT   repeat_region   669800..669832
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    670159..670187
FT                   /note="AT_rich"
FT   gene            <670241..>670477
FT                   /note="synonym: Tb04.1H19.1090; ubiquitin, putative"
FT                   /db_xref="GeneID:3656780"
FT                   /locus_tag="Tb927.4.2540"
FT   mRNA            <670241..>670477
FT                   /db_xref="GI:72387959"
FT                   /db_xref="GeneID:3656780"
FT                   /locus_tag="Tb927.4.2540"
FT                   /transcript_id="XM_839311.1"
FT   CDS_pept        670241..670477
FT                   /locus_tag="Tb927.4.2540"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   ubiquitin [goid 0005551]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]"
FT                   /db_xref="GI:72387960"
FT                   /db_xref="GeneID:3656780"
FT                   /translation="MLLKVKTVSNKVIQITSLTDDNTIAELKGKLEESEGIPGNMIRLV
FT                   YQGKQLEDEKRLKDYQMSAGATFHMVVALRAGC"
FT                   /protein_id="XP_844404.1"
FT   gene            <671279..>672187
FT                   /note="synonym: Tb04.1H19.1120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656782"
FT                   /locus_tag="Tb927.4.2550"
FT   mRNA            <671279..>672187
FT                   /db_xref="GI:72387961"
FT                   /db_xref="GeneID:3656782"
FT                   /locus_tag="Tb927.4.2550"
FT                   /transcript_id="XM_839312.1"
FT   CDS_pept        671279..672187
FT                   /locus_tag="Tb927.4.2550"
FT                   /gene_family="HOG000260531" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387962"
FT                   /db_xref="GeneID:3656782"
FT                   /translation="MSLWPFRTGNDERFQVTSTEETIYDAIKNEMPAYPYGTEVDRYLE
FT                   WRWRRGLVQSIFPATCYGAFVGFAVGYRQARVEGRYIGRYKVVWRYSSTFAAVGLLTTA
FT                   FHHVLVVRNNYHDRFYYPMMAGASGAVVLTVASQMGTLGQGMLAGSLVGVLYTLSCYGM
FT                   TYYHRRRLKMFLRQQQTQQVPVHKVSPELQRMYRAYLYDNRPLEEKDVMVRRAVVLSMS
FT                   EDDTCLDAKRVLQNMTPEIYDWVNFPDWWPLKFPQQTEEERMIYERQRDEEVERRKRAF
FT                   LETDDGALIKRVNRAKKYRDL"
FT                   /protein_id="XP_844405.1"
FT   gene            <672653..>674572
FT                   /note="synonym: Tb04.1H19.1130; cardiolipin synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3656785"
FT                   /locus_tag="Tb927.4.2560"
FT   mRNA            <672653..>674572
FT                   /db_xref="GI:72387963"
FT                   /db_xref="GeneID:3656785"
FT                   /locus_tag="Tb927.4.2560"
FT                   /transcript_id="XM_839313.1"
FT   CDS_pept        672653..674572
FT                   /locus_tag="Tb927.4.2560"
FT                   /gene_family="HOG000260533" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cardiolipin synthetase, putative"
FT                   /EC_number="2.7.8.-"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   catalytic activity [goid 0003824]; go_process: metabolism
FT                   [goid 0008152]"
FT                   /db_xref="GI:72387964"
FT                   /db_xref="GeneID:3656785"
FT                   /translation="MTFNGRFRATLRGINIRNASMTSLSLTGSHAQKQTVLGSTPGALG
FT                   TIPTVALNGVNPLPRYRHNLLFGTLSFGDRWDRIQRRLAVLGRASTGNVVVPFSDSADA
FT                   FRRMWESVDSASDSVLWQTYICKDDFVGQKTVKKLEEAHRRGCKTELLYDCGGNITGRR
FT                   RLVGDLKKSGANVIEHRPMWEHFFPYFLRGMKWELSPGIRNHRKILIVDNKLGFCGGLN
FT                   IGDEYCGTSEGGNGRFRDTHCVVMGPAVMHMREVYEDTKAPKPWKWSLARWRQIASATM
FT                   NLRYLEGMNVKHDYLEPTTTFVRQGGGVYLRRQMERAERSTVRMMERMRWKRQRERLNR
FT                   CLLTLAKNLREGQGLVFKAATGKGDDVATTDAGSKRNNEVSHGQWKLMKRRIDEYRQRA
FT                   IKNAEESFFRRLRVVNPSMRLLEDTSPVAEAEAYGQAHAAVTQVLSCNPHSRDWSIPYA
FT                   FWQVSKFVHQRLWVTTPYYMPHRKLMRALQLAARRGVDVRILAGSNRTTDPWFMWYASN
FT                   YITGMLMASGVRVYEYKGGQVMHAKTVVADSIWTSIGSYNWDMMSNKNMEICVCHLDHN
FT                   LALTMEKQFLDDMNVSEEVNYEEYQRRSLWLRFSSWFFYTALRIAEKFTFRTFWDPDLS
FT                   SEID"
FT                   /protein_id="XP_844406.1"
FT   misc_feature    675168..675195
FT                   /note="AT_rich"
FT   gene            <675687..>677027
FT                   /note="synonym: Tb04.1H19.1150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656784"
FT                   /locus_tag="Tb927.4.2570"
FT   mRNA            <675687..>677027
FT                   /db_xref="GI:72387965"
FT                   /db_xref="GeneID:3656784"
FT                   /locus_tag="Tb927.4.2570"
FT                   /transcript_id="XM_839314.1"
FT   CDS_pept        675687..677027
FT                   /locus_tag="Tb927.4.2570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387966"
FT                   /db_xref="GeneID:3656784"
FT                   /translation="MTNNHVENNCIAHFLRQSGSGEVTGRVHMLLLAATKRLTSDIREL
FT                   NKEVRPPPEKLGALERTTRKIKEIVAAAFSTRPLDVVDSTEKHSRGVVDVLCHGSHVYS
FT                   TALADSALDITVITNDNPRARYYWRSLRDNVESMETVESLLLLPVKGTEAAALQPYPAS
FT                   LPVTLPLLERTDMLQYLSTVISKSSLSRVSINRHSHNTFERICLGGAADEIGMNLTVNQ
FT                   RDSVEACGVLRQFLRSNEPVRHVIILMKVILKQLHIHSSQLTPYVLTLMVVAFSRHCAN
FT                   EYPLCGSFHYPHRRNMVESGYLLLSFLSFFSPPPRGLFTPTDMLIVPMHPDGIIKRSTC
FT                   VPAPSPGECVNSWKVMDPICHNQNVAASCSAIDQCPLFFERILNRLLCGYLDASVLPLQ
FT                   HVDVELADGSNKWEANHCHWMNAFTGCGRPLFALLKAWRAHKKTDLS"
FT                   /protein_id="XP_844407.1"
FT   gene            <677663..>680683
FT                   /note="synonym: Tb04.1H19.1160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656786"
FT                   /locus_tag="Tb927.4.2580"
FT   mRNA            <677663..>680683
FT                   /db_xref="GI:72387967"
FT                   /db_xref="GeneID:3656786"
FT                   /locus_tag="Tb927.4.2580"
FT                   /transcript_id="XM_839315.1"
FT   CDS_pept        677663..680683
FT                   /locus_tag="Tb927.4.2580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: mitochondrion [goid 0005739]"
FT                   /db_xref="GI:72387968"
FT                   /db_xref="GeneID:3656786"
FT                   /translation="MLRRRPQGIIGSCRFGLSYRNVWHITSRLCNAGNTGSPQTATGAS
FT                   AETAIGGRMDDTRAHQWNDTTLLNDIARILCQLLSQRGTAKQDKSEGSQETKSLHVHEL
FT                   FRELGVELRYQLQNSSFGLLDRALQSKPEWFVLSANGSAVSCTEAMRLHLEGIGREGFT
FT                   DTIPGAANVPNLECKARSVRCSKPAGHLISCKTNVLVHGPLATTPVDVSKPPITPEEIE
FT                   QLKLRRLICPLNLYFLLDGPPVTLFPSGDKPRRLSDQFQELDALYVAKGFFSPSEVAAA
FT                   FIHITPTFFVETRHVLNAMSPDVAHSFERHMSRDHIVDAFFKKYPMIFKLKTGKFQKAS
FT                   VKLNLDFPFVRDYPGCGRADRPLRRYNQEYRATVGGLSARPLPSAEPAANARRGEPHID
FT                   VKIFEVLVRNLPRVPTDPTIPKQQLEEQRCQSFPLVEWINKFSQDDIETLNSVPQARVL
FT                   TLMTRYVRIFQLMCHGEDGNVFTESKCLDQLRNGRRSLPEERSNASRAASDSTKLDEDL
FT                   QGEVVDFGVDDIEDEDGKTPDTALIASKEEVKRREANLSAALRDDLIGLDEILLEGKCP
FT                   SVEPVEKDGVTSGQDNGDSASLKNPEDGDDEVDGFEGGSNCAEGDDVFLPCGEGNEETE
FT                   FRRSRNVDSSFPNEEEGQSGFYIPSRYDIIYVRRLPKHIAPRSLSDYNVATTPEPELLQ
FT                   YLVAFLNPPPSLHGNLMMKKVPPPLKFAEGKPPMPWRWVPVQRIYASLSKEQKRLLRPY
FT                   KGLVHFMRLHGEVFELSDDLLHVIAHDPQGKIPPFVPTQTVFNSEDRVLLPPTLDDDEN
FT                   SKASLIGDTERNKFRSILGASQIPTDRRQLLLLDPQNPLLDHEVLCEEVSFFMPDHPVS
FT                   LHQLVARLPPILKAALSHRHRNNFKSSKHLTVWSDGTRMMLQKSKLGVPEAALQAEEGL
FT                   SVEDAVECIREVVPDEGIMVGHLQRMLPSAAKRTLKEQFGGLHTALLGYPQYFYIEKNG
FT                   EDRNSSMLFLVERLQHE"
FT                   /protein_id="XP_844408.1"
FT   gene            <681468..>683264
FT                   /note="synonym: Tb04.1H19.1170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656781"
FT                   /locus_tag="Tb927.4.2590"
FT   mRNA            <681468..>683264
FT                   /db_xref="GI:72387969"
FT                   /db_xref="GeneID:3656781"
FT                   /locus_tag="Tb927.4.2590"
FT                   /transcript_id="XM_839316.1"
FT   CDS_pept        681468..683264
FT                   /locus_tag="Tb927.4.2590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387970"
FT                   /db_xref="GeneID:3656781"
FT                   /translation="MRAEPNPSVGEHDPRESVSLSDRSGNIMTDCCASLLDTEWPNILG
FT                   ERCFTPSDEEVLSSATREQRIERGIEAPSFESLLQEIMKCYRAFCNCSGTVHFKHLEFE
FT                   RFLRRCLFAAHETNGLSVSSPLEGTTCKPFWLHYPPSYFLMAHDVVQSVECGTPHSSND
FT                   DSKTSSATTATLHRTPSEDLSFTGDSENEAKRREHLRQLYILSVQPVVPRTIRKKLAQC
FT                   AKRESAASPGALAEAVRYMLDVYFFFIRMQFLPPFNRPTGSMYSTCVQFMTRVRGRLLT
FT                   PEVAVRFTEVALVLILLSVKHQSATRCALDETTDSAVSSRLELQFLFSTYFPALVVAFL
FT                   SASPLQSMEELRHSLTRTDLAECLPTLQTCRKGAELVRELFDFSQGAAPLWSVTLSEVV
FT                   AFATQHLQQKDKGNEDGNSHACITSVLGVPSSVDDCLFVCDDTTLDCLLRSAPKSVQKT
FT                   EEAGHERLRKEINQTFHRNQTGMSPESDEFHRKAMRVTSSSPSGPYNTLYFSLHTLANM
FT                   ESLSPTALSLLLTAIEKCLGPKGDLQPLCTFASSEVCTSLPVIAAELLRVVVSVLEAER
FT                   SMKFMEVINEVRDLVYRGRESL"
FT                   /protein_id="XP_844409.1"
FT   repeat_region   684304..684357
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    684652..684705
FT                   /note="T-rich"
FT   repeat_region   684763..684791
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   684982..685030
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    685812..685841
FT                   /note="AT_rich"
FT   misc_feature    686544..686564
FT                   /note="AT_rich"
FT   repeat_region   686867..686889
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   gene            <687074..>691960
FT                   /note="synonym: Tb04.1H19.1210; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656787"
FT                   /locus_tag="Tb927.4.2600"
FT   mRNA            <687074..>691960
FT                   /db_xref="GI:72387971"
FT                   /db_xref="GeneID:3656787"
FT                   /locus_tag="Tb927.4.2600"
FT                   /transcript_id="XM_839317.1"
FT   CDS_pept        687074..691960
FT                   /locus_tag="Tb927.4.2600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387972"
FT                   /db_xref="GeneID:3656787"
FT                   /translation="MHSVNPYLSAMSFKSTDSRFEVTLPPSHCEALQGINRQEKPKTTT
FT                   VPQTNHPLPLSDYAQPIVRKAGLVKASTSSVVSQFRAEGSVMEPVHALHTCIRHFLSHP
FT                   EVYGSDVRAMLDRELMYVMRVKASESALLTSTTVPVSSVSLPSIANTVPENNKVGTSFL
FT                   GKCSNWVVTPRSVDAAVNLDAAFGPNGMFGLGSAKLVDGSTGLFSLLERNRNLLTIQER
FT                   QLPMEDGEEKGSPSTMSPLNDWEEKSVKTDGGRYREKSRVHFSVNTQSGPDVSSEYGAK
FT                   LLIDGAGYEISFLRSQLHQVEAAYNAKCIRLHELQQESNRFATELESLEERNRQQNAKI
FT                   NELSQQVDGLTREAERWKRRANEININEKAHGGRGPTDQTRRMQASQYVELKREYTHMS
FT                   QLWRETEKSLQETRRSLESAEKENRVSHRYLTDAFSFIERLERRIKRRDDFIEKLKLRQ
FT                   DSMEERYEKILWCLNELQTLRGQHSYVDYLLSENNVWSMFLFSRLQCRLASVGHVDEVA
FT                   YDTSIPLYFRRTAAGGKLADAYSPQLVYRLITEHVQGKRRGLPVANDTFPFAVPCWRGM
FT                   HSISYFSATGGNRTPNTSIMLSGELTHDRPRRSLPLLTLATVLLPPQNGAAPGEVIVDE
FT                   DIPNSGQYDQLTLRYLIYCFWGERLTQYKRETERRREEYIAAREKAAALDISVDVDIES
FT                   GANDMDESIKFPTFLAALVEYVRRLCPYKAPKGEEESAPKLVGPVFVRGVVLNLEGAPA
FT                   NPRMCLPFIFQKEENGSETPVPLSPQARELLFALYYYAEEYKDVDSDFRLFHLVAHQQL
FT                   PELVAINFYASMEAMRTECDNVICESLRGTRNAPEDKTCDGAEQQCPDEATTELLFTDS
FT                   PAETLRKVAVMVDEAPLAEEDTCMEADSDGEGYGVILPGAVGENEGNKEKQEAGQEPTP
FT                   CYLTKLKHDILACLNRNTEKPEASATNTSVRSPKADDTTETSDALSVPKQWKRIDEKLQ
FT                   HMLAPFSSLLHAFKKYKERRSLGGRRCDRHKARCRLDMLPGSRSLIAIETFIAILHKHC
FT                   FATYALSCSGSVRSSLLDAAMKGGHGGNDANDVGPFTRVGQLPPMNKHIRRLRFAIAMD
FT                   QPSSLLRYTDLFTVDSRFGTPSHFHNEYLRLTIDTYLEQQEAYMNIILGSCVVRDGRTI
FT                   PTPVVDSDGILPFPALRAGFEAVLRKLSFAPKESNIVAKHFLNYCDLLRHEDDIRQEQY
FT                   VDAPLVICAEVVSKKDFARESALLREHSWSVEDEAASCSLLHLSFAARMMYIVWGLNSS
FT                   SKGRLAISMLPGAARSFVNAGCTIGGQLVPSESSDSAEGLCPLREDLEPLFRFEVEEEC
FT                   RDALNRAKVGYGRRNELRQLLMETEDVPTTKATESSAAITDVREVEGMDPWELLVDIGC
FT                   FCPLFGARLRPGTHSLHGEATSVCSRKTRTSKRVSPRPSSCDTDAPAGAIHLSGGASLL
FT                   RFFGARRAAKTKGDKRKSKNRRNSQELPGAVFAQVLRSEVAPVHYQSILENLAAVSSEA
FT                   NASVKCVVDLANATSLLRNPHVSSPHSASLQQQTEVSNSTIPESPASRRSRAAKGRDGH
FT                   ASFLDGSEQRAYSPLAMSSSDKSELEGGDLAPSSLARQLHVASAVLSLL"
FT                   /protein_id="XP_844410.1"
FT   gene            <692201..>692665
FT                   /note="synonym: Tb04.1H19.1220; hypothetical protein"
FT                   /db_xref="GeneID:3656789"
FT                   /locus_tag="Tb927.4.2610"
FT   mRNA            <692201..>692665
FT                   /db_xref="GI:72387973"
FT                   /db_xref="GeneID:3656789"
FT                   /locus_tag="Tb927.4.2610"
FT                   /transcript_id="XM_839318.1"
FT   CDS_pept        692201..692665
FT                   /locus_tag="Tb927.4.2610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387974"
FT                   /db_xref="GeneID:3656789"
FT                   /translation="MCFTHVSLVCFCDSFELYDVIPRSETRHLRPLTHTRAHVLLFLNV
FT                   FYRHLMRRMASEGVFFFFPNSSQSLDVNLYTLHLWYYGHLQLFAVGYTPRQVGRFPPFP
FT                   DLRLYSLIILNIYCVWQYCGLQGHIGPRGCQVPHVSTPDQSDMASNFQPY"
FT                   /protein_id="XP_844411.1"
FT   gene            <693278..>694009
FT                   /note="synonym: Tb04.1H19.1230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656788"
FT                   /locus_tag="Tb927.4.2620"
FT   mRNA            <693278..>694009
FT                   /db_xref="GI:72387975"
FT                   /db_xref="GeneID:3656788"
FT                   /locus_tag="Tb927.4.2620"
FT                   /transcript_id="XM_839319.1"
FT   CDS_pept        693278..694009
FT                   /locus_tag="Tb927.4.2620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387976"
FT                   /db_xref="GeneID:3656788"
FT                   /translation="MRGVVYYGEQFVEVPDATVTLRDICTSFGLTGEFVGFSLKNRASG
FT                   LVVATLPFEVLPEVSSASGDVDEMTYDLITPADGDAATEERDPTTDDMTDILKQLVQLG
FT                   ATPLLSAETDALIDPYEPRAAPGLLLRTIYPPSAYCPYRYRGDPVKAVGRFGATSSAAT
FT                   HSASPPYMSAVEVYTVEKATGAALRGRPDLTPKTEEEANDIMRGLLTAATQAKAMIALT
FT                   SAEERRHAEVDVKPNIYPTAT"
FT                   /protein_id="XP_844412.1"
FT   gene            <694735..>697266
FT                   /note="synonym: Tb04.1H19.1240; ATP-dependent DEAD/H RNA
FT                   helicase, putative"
FT                   /db_xref="GeneID:3656790"
FT                   /locus_tag="Tb927.4.2630"
FT   mRNA            <694735..>697266
FT                   /db_xref="GI:72387977"
FT                   /db_xref="GeneID:3656790"
FT                   /locus_tag="Tb927.4.2630"
FT                   /transcript_id="XM_839320.1"
FT   CDS_pept        694735..697266
FT                   /locus_tag="Tb927.4.2630"
FT                   /gene_family="HOG000246455" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAD/H RNA helicase, putative"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_process: nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism [goid 0006139]"
FT                   /db_xref="GI:72387978"
FT                   /db_xref="GeneID:3656790"
FT                   /translation="MKGVGTWESAMEVAEEQQQQQKKRGGGFQSFGLEKPLLDGILRLG
FT                   YNVPTPIQRRAIPPMMQGNDIVAMARTGSGKTAAFLIPMLHLLKAHSKIVGVRGLILSP
FT                   TRELSMQILRFGIQISKFLDLRFVALVGGNSLEQQFEMLASNPDIVVATPGRILHIMEE
FT                   ASLQLSMVKSIVLDEADRLFELGLQPQIVAIMQKIPESCQRSLFSATMPSVLAEFTNAG
FT                   LHNPVVLRLDAEMKLSDKLKQSAFFVRNDEKIAALIVLLKKVIGIEASDKKSESAEKQA
FT                   LVFVESKFHVDYLEAIMEAYHISCSAVHGQMDQEGRRNAVRAFAKRETSVMIVTDVAAR
FT                   GLDLPLLDNVVNFSFAPTPKLFVHRVGRVARAGRSGAAYSILTFEDFPHYVDLMAFLNR
FT                   PLQCRKEPGDLLFTADDGCYGRMPEDALQLELDFIRRLVQNDVELKGMTKVVENAHKKF
FT                   ARTKKKATHDGIQTARQSEYQFDSTPLHPIFVERLEKKEIAADEARVGLKRFKAKESLL
FT                   EIVHGEKMMEIKKPVTVQSLWREQRQRGEDKEGSEKVDTGSDKKQGKHESENCVSMVAR
FT                   KNGAVKGSSTMGRKLSLAESLLLKAQERKKREREAVNGEENDDVDGITVFPARAAYHSN
FT                   SSAGAIGGMECNSDKYRDREFFMEDVKRNTIEDVHYSVKDATFDIGADTAQEAQQRRQV
FT                   YAWSKKKNRYVRMNVNDAKALLRGVKNEAGKAVNFKTKLKTYSKWTKKSNLRIQDAGEE
FT                   EDLGPLRQARDAQRQNERGVGDEDDGFDETEEVDISNPNQGKKLRIGRKLRRLPKDGHV
FT                   RTFEEMALMKRKAAKEKARLERKKQKGKRKR"
FT                   /protein_id="XP_844413.1"
FT   gene            <697918..>701742
FT                   /note="synonym: Tb04.1H19.1260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656795"
FT                   /locus_tag="Tb927.4.2640"
FT   mRNA            <697918..>701742
FT                   /db_xref="GI:72387979"
FT                   /db_xref="GeneID:3656795"
FT                   /locus_tag="Tb927.4.2640"
FT                   /transcript_id="XM_839321.1"
FT   CDS_pept        697918..701742
FT                   /locus_tag="Tb927.4.2640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387980"
FT                   /db_xref="GeneID:3656795"
FT                   /translation="MYGVTHPRQGNGGQKRKQKRPMDQAAATGPPVLLPSIKTDARSVV
FT                   EARNFDVMCGAEITTATEQKYRNTGSMSGGVLGLDSSPETILNMNKEAMSLLNKGKMGA
FT                   CEDVLQTALQLAESGVQNCRHAIMMSADPTKQEELEAWQLVFATTLSNMGSVQRRVDQP
FT                   QDALRYLQDACGVEEEVFGQPTCSTLLNLSTVMLNLGLFDDALNMARNCASTAEGGDPL
FT                   LHIIALHNYGIALRSHPSSEMKQSAAPVLMKALREAESNLGKDHPTTLIIRQRCGMAAA
FT                   TPARTSTPGRSVRTPLQQRRSGSSGAKSSVSSGYSVKQRRKQGSGSRTSRGNSTSGKRK
FT                   SATGQKGSTLPPVGQAPVDRLRVKQAIQRLDYGEIKKVVTTKMEECESTPSAVSSETDE
FT                   EPVTPRPSAPPSHLPPPLPPIAVQEMSVSTHNSQKCSDASPFTPIFAVLNDNVMSLGSA
FT                   SGDKSAFSNEMVWRWQPPVEVVEAAVPSLRETQEEAPTSKVEATATPPAVPAANEEEKV
FT                   VPTIKNEERKEEMIQKQSRASSIRHLNKRGSMRRGKERRNEERDSDVRNRSTGSKKSSK
FT                   LGCCGGYINLCESFSEGRPSFLHFGDQEAAPHAAVSATEPMQHQFPGSVGPTNDPVSRR
FT                   EQRRRERLLLGFDDFDDIDIDEEEEEEEEEEEEEEEEKKEREKQRDAKERGEGTPGRFA
FT                   VGDAEQKGEKKRMGISKIIGTSPAVRRLQRIEKEKQEEEALRARWEREAAERAKKEIFE
FT                   RSLEKIVHRTRVRAATTIQLVWIEWWENIGKRRRELLNKRAADRERRERLRLALLDYES
FT                   RLAQQQSKKAAPAVVEVGIPSVIKCVKRWMEKTACIIYAVQKGLRREERDNNFFRSMIV
FT                   KIQSAWRRIQAKRRSREIAITRDQRRAETLEREPQEYAALVIQKFVRCAFARQKRKQLR
FT                   TERYRPAVIKVQRWFRQTYARARMRGTDVVSCWRRKYSARLIQRAWRGYLGRLNDAMNN
FT                   LRFKLNETRRREREAATTIQRVGRGHLLRCQVAKRAKDIDRIYSTMRFLELKATDGVEE
FT                   QQPLSTHATLPAYLPSDAEEVARVAELEREKYHIGMFVEEVAKREREAWSDALRFRPFE
FT                   VQRRRAGEDLLCQLEFNVYRRERAATKIQREFRAWRRVRHDVLRDKTLLMKGRGDYMQN
FT                   FFDNKVQKMLHRRRYEGGKELYGDHARPMREMKEEAQSELQELCPLVRTHAHPTELRTR
FT                   EERCKAEEELLHDEELVASEQVSDWLNFRRETLMNRFREEVSSARGSCF"
FT                   /protein_id="XP_844414.1"
FT   repeat_region   699886..699942
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaa"
FT                   /rpt_type="tandem"
FT   gene            <702634..>704262
FT                   /note="synonym: Tb04.1H19.1300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656792"
FT                   /locus_tag="Tb927.4.2650"
FT   mRNA            <702634..>704262
FT                   /db_xref="GI:72387981"
FT                   /db_xref="GeneID:3656792"
FT                   /locus_tag="Tb927.4.2650"
FT                   /transcript_id="XM_839322.1"
FT   CDS_pept        702634..704262
FT                   /locus_tag="Tb927.4.2650"
FT                   /gene_family="HOG000260320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to HECT domain and RCC1-like domain protein
FT                   3. (Swiss-Prot:Q15034) {Homo sapiens}"
FT                   /db_xref="GI:72387982"
FT                   /db_xref="GeneID:3656792"
FT                   /translation="MIRDAEFWIEARRLSNRGNSIFTTLLPLLHSRQLALDSGVQVNEI
FT                   NPACKEVPLTENLQRKEPYEENKTLQLPSATAPRGSVSESTLRVLQQAMMFAVPMYALR
FT                   YQVTGMSMSSKTSAVVDRETKQVATFGAGDGVHIPNNIRCRGCAAGDNFFAVLTDQEEV
FT                   WASGGLHVLTCDEGTLTASPLGKSNEMKKVASKALMVVGNGQRLSCLTESLSVQPLSVV
FT                   LNPVTSIFPFRRIRFMDMGYGDDCYMVGMDSVLYKTVVSSRTLGTPRRIMTLSRTTVSR
FT                   VASGSGFYVFIDENGQLYTIGCNNKGQLGNGQKQHARRRPFLHQSLRHHYFVMAAAGSG
FT                   HSLALTSSGMVYGAGNNESGQLGLGEHVTEVLTFTPIPLPAKCTGIAAGPKGSMFACAN
FT                   GCVYTCGANDLRQLGLDVDDPVVYRPMPMPAVTSGVEAYYMDFGAYRSPPVAVLRSFCS
FT                   SIPSLDVSDLDKPEVLPKPVSSTVSVVSEEVPDTPQLPSPLLPEDGVENLPEPSVNHHP
FT                   SKRRERKEIKEEREKQSCGKCCVVL"
FT                   /protein_id="XP_844415.1"
FT   repeat_region   704423..704476
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   704740..704759
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    704934..704973
FT                   /note="AT_rich"
FT   repeat_region   705440..705544
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   705591..705635
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   misc_feature    705941..706005
FT                   /note="A-rich"
FT   repeat_region   706295..706326
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    706383..706488
FT                   /note="T-rich"
FT   gene            <706635..>706904
FT                   /note="synonym: Tb04.1H19.1340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656793"
FT                   /locus_tag="Tb927.4.2660"
FT   mRNA            <706635..>706904
FT                   /db_xref="GI:72387983"
FT                   /db_xref="GeneID:3656793"
FT                   /locus_tag="Tb927.4.2660"
FT                   /transcript_id="XM_839323.1"
FT   CDS_pept        706635..706904
FT                   /locus_tag="Tb927.4.2660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387984"
FT                   /db_xref="GeneID:3656793"
FT                   /translation="MPRQRSFLSSVLKGRRNTPTYYSGRGDMAGNPDILAEAACCGRPD
FT                   AEWAWLRLLCFVCVSSTVGVWLWQVYFYKQAMFFKDEPWSPFKN"
FT                   /protein_id="XP_844416.1"
FT   repeat_region   707153..707180
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <707466..>708134
FT                   /note="synonym: Tb04.1H19.1350; pyroglutamyl-peptidase I
FT                   (PGP), putative"
FT                   /db_xref="GeneID:3656794"
FT                   /locus_tag="Tb927.4.2670"
FT   mRNA            <707466..>708134
FT                   /db_xref="GI:72387985"
FT                   /db_xref="GeneID:3656794"
FT                   /locus_tag="Tb927.4.2670"
FT                   /transcript_id="XM_839324.1"
FT   CDS_pept        707466..708134
FT                   /locus_tag="Tb927.4.2670"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyroglutamyl-peptidase I (PGP), putative"
FT                   /note="go_function: pyroglutamyl-peptidase I activity [goid
FT                   0004219]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:72387986"
FT                   /db_xref="GeneID:3656794"
FT                   /translation="MKPTKPLLYITGYGPFLEVTENPSATIAQSVAEQVRQSGEADVHH
FT                   ETLDVNLEAVSKYFNRLNESVTAHLEATHPENRVLLVNVGLHSREKEKVLRLEVRAFNE
FT                   LEGNPIDDELPLSTCKDSAFVKGCKLETTTALIEELNAIERNGSDHHEKPRWIISYDAG
FT                   RYYCNYALYRGVKMQEALNSRVFAVFLHIVASTVVCMEEQVAQVRMLVSHLLKHMEAVE
FT                   "
FT                   /protein_id="XP_844417.1"
FT   gene            <708788..>710923
FT                   /note="synonym: Tb04.1H19.1380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656791"
FT                   /locus_tag="Tb927.4.2680"
FT   mRNA            <708788..>710923
FT                   /db_xref="GI:72387987"
FT                   /db_xref="GeneID:3656791"
FT                   /locus_tag="Tb927.4.2680"
FT                   /transcript_id="XM_839325.1"
FT   CDS_pept        708788..710923
FT                   /locus_tag="Tb927.4.2680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72387988"
FT                   /db_xref="GeneID:3656791"
FT                   /translation="MQPPSPTVSFIEYVLLALELPPNMFVSKLAACCTMLFLTRSDPKL
FT                   LRELCRKWVIRFKKDRHLIISRIRESTRSANCSDMYSRASMDSVVENLPGSDECDPQNC
FT                   MEHFLHLINTFVPEYFSWNWHHTELMIQTNRKSEDFVRERLLPLCRNSSEDADGLDDED
FT                   KDKDEALASFFLSKRPADTRGFNKCEEAWTNGLENPERPPLERYASRIRFATFSNLRNC
FT                   FRQSPHGVVLIFHANYSSKSCETLRTFEEILMKQMLNPQPQVCVVHIVAEPELARLYQI
FT                   NWFPTIIYVPPLSQPKSGPLLEVVESNTNGNGCSFNQVRTSNGTPTIRGTGGEADDVSC
FT                   DALPPVRLVSSDAEESSDDSPCAASPLQEEEISPSVKHKKHRVYPPEGDLSAPSLAKWI
FT                   NSRGSVAQLMPADNRAVSRINQLPERKGFPNGLKHSSSRDSLQTLSSSAEAADSHETSA
FT                   KAPVFIFLGGGVAAGKSTVVSVLSGSLWWEEHKANSVIISADNYKSQSYLVSNDMEKQH
FT                   EYSTRLAEELMVRAVNGRRSIVFDSTMMWKPFVQQVIDMVRNSHRVLYEQGPGYRDGGK
FT                   VEEYFRTVGPRSESHLPPYVIRLLAITVEPEVAVRRGILRNFSTGRSVPIKTQLRSFRL
FT                   FAENFVEYVSLVDEATLYNNNVIVDLEKGELPPVVAEKREGKLVVVDHDAYALFLGQRG
FT                   LNENAGNALELYNPKQS"
FT                   /protein_id="XP_844418.1"
FT   repeat_region   711010..711045
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   711187..711233
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    711704..711802
FT                   /note="T-rich"
FT   gene            <711916..>712728
FT                   /note="synonym: Tb04.1H19.1410; hypothetical protein"
FT                   /db_xref="GeneID:3656796"
FT                   /locus_tag="Tb927.4.2690"
FT   mRNA            <711916..>712728
FT                   /db_xref="GI:72387989"
FT                   /db_xref="GeneID:3656796"
FT                   /locus_tag="Tb927.4.2690"
FT                   /transcript_id="XM_839326.1"
FT   CDS_pept        711916..712728
FT                   /locus_tag="Tb927.4.2690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72387990"
FT                   /db_xref="GeneID:3656796"
FT                   /translation="MHAQAWSFWRRFLLFLFFLCLCVVGVVVVVVVFYNYSCKVLPLIS
FT                   GLYVIPFFFLFLPSPHLPLLSSLPRLFFHTHMHSFVFPLFFFILFKERNKKNLFQTRLN
FT                   HFSFGVGLKSRPAERISLLGELLCCISTTLFPSLNSTFPTIILIYIYLYLHINKSVVVA
FT                   ICGGVFFPPPPSPPSFLLKLLYTFIFSFSFLCVGNKILTNKLAHTLTLPPQTHTHTLTS
FT                   NTAAVCCCSWTVEPIERQTKRVTKKGIRTCQKKNSGGKIKSKVDKAGD"
FT                   /protein_id="XP_844419.1"
FT   repeat_region   711981..712010
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    712351..712390
FT                   /note="AT_rich"
FT   gene            <712839..>714134
FT                   /note="synonym: Tb04.1H19.1420; hydroxymethylglutaryl-CoA
FT                   lyase, putative"
FT                   /db_xref="GeneID:3656799"
FT                   /locus_tag="Tb927.4.2700"
FT   mRNA            <712839..>714134
FT                   /db_xref="GI:72387991"
FT                   /db_xref="GeneID:3656799"
FT                   /locus_tag="Tb927.4.2700"
FT                   /transcript_id="XM_839327.1"
FT   CDS_pept        712839..714134
FT                   /locus_tag="Tb927.4.2700"
FT                   /gene_family="HOG000219757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydroxymethylglutaryl-CoA lyase, putative"
FT                   /EC_number="4.1.3.4"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72387992"
FT                   /db_xref="GeneID:3656799"
FT                   /translation="MFRTLPLRSSIRMVECPRDAMQGLPHFIPTEQKIRYLKALLKCGF
FT                   YALDCGSFVSPRAVPQMRDSTEVIANCWKTMQEEKAAPKLSVVVASLAGFKQALETPGV
FT                   SVIGYPIGCCERFQQRNAKKSIAMSLDEIRNIKEATDAFNAQRSSNPVAPNEDVNGREL
FT                   LIYISMAFGNPYGESHSIDLVEKLVGELVASGARDISLADTTGVAQPPLIFDTFTQLRK
FT                   KFPDVTFAGHFHSNAVEARGKIVAALDAGCTMIDSALCGMGGCPFAKDDGLVGNVATEV
FT                   VVKALEERGVLPAALNKEQLKKCVLIKQEIFGVSVRDMLISQTLHDEKRFATLCQEHFK
FT                   LYDVNDDGTLDYEGFRDSMIHVFAELGAPQPSEEKIRSSFAKVDIQNLGFITIDAYTMG
FT                   ARRLLVKRLASNTNTTTKNEERGEGVVEASSC"
FT                   /protein_id="XP_844420.1"
FT   repeat_region   715090..715110
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   715117..715141
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <715158..>715634
FT                   /note="synonym: Tb04.1H19.1460; ubiquitin-conjugating
FT                   enzyme E2, putative"
FT                   /db_xref="GeneID:3656800"
FT                   /locus_tag="Tb927.4.2710"
FT   mRNA            <715158..>715634
FT                   /db_xref="GI:72387993"
FT                   /db_xref="GeneID:3656800"
FT                   /locus_tag="Tb927.4.2710"
FT                   /transcript_id="XM_839328.1"
FT   CDS_pept        715158..715634
FT                   /locus_tag="Tb927.4.2710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ubiquitin conjugating enzyme activity [goid 0004840];
FT                   go_process: protein modification [goid 0006464];
FT                   go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72387994"
FT                   /db_xref="GeneID:3656800"
FT                   /translation="MKRIAKDLNVLKTDISRSAPVVSLIAAVESENVYQWHIVARAPAD
FT                   SIYSSNSDEAQHKKKNAYRLSVIFTDDYPDKPPKVSFITNIYSPLVGEKGDVCERLTEK
FT                   DWTPDQRATNVIMRVLNEVFSGYKNNDDYDLNHDARRCLKEEPEVFEKRAQCPF"
FT                   /protein_id="XP_844421.1"
FT   misc_feature    716278..716304
FT                   /note="AT_rich"
FT   gene            <716542..>718761
FT                   /note="synonym: Tb04.1H19.1490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656802"
FT                   /locus_tag="Tb927.4.2720"
FT   mRNA            <716542..>718761
FT                   /db_xref="GI:72387995"
FT                   /db_xref="GeneID:3656802"
FT                   /locus_tag="Tb927.4.2720"
FT                   /transcript_id="XM_839329.1"
FT   CDS_pept        716542..718761
FT                   /locus_tag="Tb927.4.2720"
FT                   /gene_family="HOG000136046" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to ATP-dependent RNA helicase srmB.
FT                   (Swiss-Prot:P21507) {Escherichia coli}"
FT                   /db_xref="GI:72387996"
FT                   /db_xref="GeneID:3656802"
FT                   /translation="MQRNVIQSNSGRGLRSILDQYEDFKLIMQLRKNGRGNYYRYQQKL
FT                   WPSAEALERDMTERLYSSTERTPLALLPQPKRAPSPRTCVLEGCGAAALLEGAENAVQI
FT                   SEDLNDNQKEVNEPLDLTDSTETMFAELYGTDQSINNKIITDNDLQGTVLEAAQQRART
FT                   LIFNDLRVNELATSPAVASTNSRRTTTILSAKDKGSMAWEALGLCPTLSKQVIAKYSAA
FT                   PTRLQCRLLPALLHEDHNDVLFNGVTGSGKTSALLLALLQAVRNESAGLNVFVASNAIT
FT                   AMRARDQLQALCGELGGAMVDRPRDDFTWLFMGIFSGEYEAYYRTLRRSLNSDHGPVRI
FT                   FITTADTFCQLLFEKKMEFEAFGYLRRVYVDDVGVQLPMVPPHAPVHEMRERLRNPLPC
FT                   ELLLGTLHQLPGPHIRSILQLGLVSADMETALKDHLKSLCVKLERHTIVLSAVRIPSTI
FT                   HCLFSFHLAHEDVYEYVVQLIWNARATIPGRAVIYVRYEDNILQVRTKLRQLGMDVKLF
FT                   SEVYHDGVFRDSWKFLLLHESEAFGVDLPLVSHVFITFCPHSTCSFQHMCGRTGRLGNV
FT                   GWVYTITDKREAKAVREVVTQLEVDFCSHVVDSNLAQVPPSDMDRLTKEFELYGLDPQY
FT                   AVRQHYVVQSENPDMAYRSREFFSKPAEKQFQMEDYTPTPVLHRRFVNAKKLAKDVERD
FT                   PSVALTLQKEGLLNSKLAPTKKMRNLLNNKSRSFNAALYGMKSNK"
FT                   /protein_id="XP_844422.1"
FT   misc_feature    718894..879985
FT                   /note="sequence corresponds to BAC RPCI93-2H8"
FT   gene            <719312..>721723
FT                   /note="synonym: Tb04.2H8.1400; kinesin, putative"
FT                   /db_xref="GeneID:3656801"
FT                   /locus_tag="Tb927.4.2730"
FT   mRNA            <719312..>721723
FT                   /db_xref="GI:72387997"
FT                   /db_xref="GeneID:3656801"
FT                   /locus_tag="Tb927.4.2730"
FT                   /transcript_id="XM_839330.1"
FT   CDS_pept        719312..721723
FT                   /locus_tag="Tb927.4.2730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin, putative"
FT                   /note="go_component: microtubule associated complex [goid
FT                   0005875]; go_function: motor activity [goid 0003774];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   microtubule-based process [goid 0007017]"
FT                   /db_xref="GI:72387998"
FT                   /db_xref="GeneID:3656801"
FT                   /translation="MTTLSLDSTAVRVVARCRPLLPSERNHTTSRIQINAEAGTITLAE
FT                   KGLGVGRCFTFDRVFLPNAQQHDVAEEVSPLISHVLEGFCATIFAYGQTGSGKTHTVEG
FT                   FEYIRNGRGGPKVNIDTDPEKHGIIPRVIQLIFDRVREKQFADANTSYHLKCSYYQIYN
FT                   ERVTDLLNPSSEASKGTGLKVRWCRDDTFTVENLYICECDQPGEMRRMFLSGAKAKEMG
FT                   SHMMNQQSSRSHCVFTIHVERSDSDIPGNSVKSQLTIVDLAGSEKLTALDANPSSKLTK
FT                   ESIDINTSLFALGKVITSLAQRSKHNQKNGAGANQLHIPYRDSKLTKLLKHALGGNSLT
FT                   TMLACISPSDNYAEETMSTLMFATTARTIKNVPYVAEDPVTQVVNQLRSELGNVKEELN
FT                   YYQNLVGSNLINSGPTRPQPMYHVQASNDEAVNAQVNELSDKLLQACDALQKIMSINTQ
FT                   LRSAFDVVKEAKAELERREMELNAENLALRERIEMLESVVLKEDLTECFGNGAKSQEGY
FT                   LKNNGYYYSSARASLLTNASDPKSCHAPTRPHSASVHESPAPTTAGQTNPRAYAADGAW
FT                   AAERPPIAEDNPRPMTGPSVRPSAEGFVPSAQLAEERLRGEQSINKRREKLTKGLAEYA
FT                   NRYCQPDRFVNYAEYYGKARRLVTTNRSVSSTVDDMSKTLRQIPESIASTVPNSLKTTS
FT                   QFGMLHFGGSREELGELEERRRQREEKRQALIAQQDALRGDVARAFVGITEKKEPIRAG
FT                   KEPYEQGSLASTDTTGKQMPKLPSAQPAPADSVSRLKAYLEQEIGMRGEL"
FT                   /protein_id="XP_844423.1"
FT   repeat_region   722301..722320
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(722301..722320)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   722678..722702
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(722678..722702)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <723054..>723506
FT                   /note="synonym: Tb04.2H8.1370; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656798"
FT                   /locus_tag="Tb927.4.2740"
FT   mRNA            <723054..>723506
FT                   /db_xref="GI:72387999"
FT                   /db_xref="GeneID:3656798"
FT                   /locus_tag="Tb927.4.2740"
FT                   /transcript_id="XM_839331.1"
FT   CDS_pept        723054..723506
FT                   /locus_tag="Tb927.4.2740"
FT                   /gene_family="HOG000260314" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388000"
FT                   /db_xref="GeneID:3656798"
FT                   /translation="MEAVFYAFASFGTAPTKEMDNAHFSKMLKEAKIIGKTFTSTDADL
FT                   LFNKIKAKGARKITFTEFNTRALPDIATKLKMTPEQVAEILTKASPASNSTKAEAVKFH
FT                   DDKNLYTGVYKAGGPTNVDRNAGSLSGVVDRRVDQVDVRGTTSSQK"
FT                   /protein_id="XP_844424.1"
FT   repeat_region   723541..723568
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(723541..723568)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    723588..723786
FT                   /note="GA-rich"
FT   misc_feature    complement(723588..723786)
FT                   /note="CT-rich"
FT   repeat_region   724042..724078
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(724042..724078)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   misc_feature    724291..724408
FT                   /note="GA-rich"
FT   misc_feature    complement(724291..724408)
FT                   /note="CT-rich"
FT   misc_feature    724757..724816
FT                   /note="CT-rich"
FT   misc_feature    complement(724757..724816)
FT                   /note="GA-rich"
FT   repeat_region   724818..724952
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(724818..724952)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   725043..725090
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(725043..725090)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    725151..725183
FT                   /note="AT_rich"
FT   misc_feature    complement(725151..725183)
FT                   /note="AT_rich"
FT   misc_feature    725325..725358
FT                   /note="AT_rich"
FT   misc_feature    complement(725325..725358)
FT                   /note="AT_rich"
FT   repeat_region   725373..725409
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(725373..725409)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   725437..725467
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(725437..725467)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    725891..725919
FT                   /note="AT_rich"
FT   misc_feature    complement(725891..725919)
FT                   /note="AT_rich"
FT   misc_feature    726035..726063
FT                   /note="AT_rich"
FT   misc_feature    complement(726035..726063)
FT                   /note="AT_rich"
FT   misc_feature    726176..726296
FT                   /note="A-rich"
FT   misc_feature    complement(726176..726296)
FT                   /note="T-rich"
FT   repeat_region   726314..726346
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(726314..726346)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <726421..>727320
FT                   /note="synonym: Tb04.2H8.1330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656804"
FT                   /locus_tag="Tb927.4.2750"
FT   mRNA            <726421..>727320
FT                   /db_xref="GI:72388001"
FT                   /db_xref="GeneID:3656804"
FT                   /locus_tag="Tb927.4.2750"
FT                   /transcript_id="XM_839332.1"
FT   CDS_pept        726421..727320
FT                   /locus_tag="Tb927.4.2750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388002"
FT                   /db_xref="GeneID:3656804"
FT                   /translation="MSTTSSRTADDGLTELDGHVPGHFRLPTRGSQQPLDEDEDRALVS
FT                   NGTGGDDGSCFSGDPHEVPHPEEPTQLNTRTLRRMQRAVAGGNIPLRADLLGGTNLRAQ
FT                   RTASAITAMSCTSGGMDAQSSGCDTSRAESKQKSNDVPLGRAHDSVANLSMASVESMCG
FT                   STVMPNILNRKNLDFFSAQLLSGGARLRQEFLSGEDVKPRGGEPSEMATADLPMSLWTE
FT                   GGGSEHLSRFISQSDIGLNTEETRQGNAADSLSEATNPRTPANEEGMQSVMAEMGTFGS
FT                   SSRIADPTTASEGSAQKK"
FT                   /protein_id="XP_844425.1"
FT   misc_feature    727386..727434
FT                   /note="GA-rich"
FT   misc_feature    complement(727386..727434)
FT                   /note="CT-rich"
FT   repeat_region   727487..727520
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(727487..727520)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   727865..727912
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttgg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(727865..727912)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ccaa"
FT                   /rpt_type="tandem"
FT   misc_feature    728063..728202
FT                   /note="T-rich"
FT   misc_feature    complement(728063..728169)
FT                   /note="A-rich"
FT   misc_feature    complement(728097..728202)
FT                   /note="GA-rich"
FT   repeat_region   728300..728320
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(728300..728320)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   728327..728360
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(728327..728360)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    728550..728636
FT                   /note="A-rich"
FT   misc_feature    complement(728550..728636)
FT                   /note="T-rich"
FT   repeat_region   728856..728892
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(728856..728892)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   misc_feature    729045..729067
FT                   /note="AT_rich"
FT   misc_feature    complement(729045..729067)
FT                   /note="AT_rich"
FT   misc_feature    729169..729237
FT                   /note="T-rich"
FT   misc_feature    complement(729169..729237)
FT                   /note="A-rich"
FT   misc_feature    729417..729440
FT                   /note="AT_rich"
FT   misc_feature    complement(729417..729440)
FT                   /note="AT_rich"
FT   repeat_region   729560..729609
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(729560..729609)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   730266..730301
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(730266..730301)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   730483..730521
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(730483..730521)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    730560..730626
FT                   /note="T-rich"
FT   misc_feature    complement(730560..730626)
FT                   /note="A-rich"
FT   misc_feature    730663..730704
FT                   /note="A-rich"
FT   misc_feature    complement(730663..730704)
FT                   /note="T-rich"
FT   repeat_region   730894..730950
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(730894..730950)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            <731459..>733477
FT                   /note="synonym: Tb04.2H8.1280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656805"
FT                   /locus_tag="Tb927.4.2760"
FT   mRNA            <731459..>733477
FT                   /db_xref="GI:72388003"
FT                   /db_xref="GeneID:3656805"
FT                   /locus_tag="Tb927.4.2760"
FT                   /transcript_id="XM_839333.1"
FT   CDS_pept        731459..733477
FT                   /locus_tag="Tb927.4.2760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388004"
FT                   /db_xref="GeneID:3656805"
FT                   /translation="MEEGDHMEFSAREIEELENDTINPTNCNHKLDKEHVEKLRQATLQ
FT                   EIEEKDKLVEKGMRLFFMNKVKDAEDIMNNNAPLDPLHALGACCLAALKSLLSMGVNDT
FT                   KYALQKADFSIAFSTEVATIPKGFFGSVTNLFWGEAGREFQPGMFRAKTIRAQSFAVRG
FT                   ILLISQQGDMMALLRGGMALKNSYKLLQSLKRELEDLKKKKDANSYEGLGADRNSVYGL
FT                   LLMVGVTHVVISLLPSRVLSILGFLGLKYDRKHGMKFISMTWESRTLFAPFAALFLMVI
FT                   TSFVPGFCPLHVPRWLPAAKAIAEHTVDQPPMGESLLHLWILGRIKRLEQDVEGSMSAL
FT                   SKCLKAAEEGQVAKWMPQLRDFAIYDQGWNFVITMQWREAIELYKRLEDHSAWSKLFYG
FT                   YAQACCFDMLALEAEQAGNKEGVAKYQQEASEALWRTAHYRINIMGGRAVSVEEFVSVR
FT                   LGETFKHCGIEHPNKGNKRIVEPTPFPLEGLKLRNPVRVGVIELLALFDITHQMPQSNT
FT                   EKFLDIIDRVSKKCSDSPQIGSTDDGNGACGNEAPAEKGDEKNIETYTTIVCAAVKANL
FT                   LCRIESRREEASACLEGAVAISSKYKREKCSVSWVRPQMIYEQAVLASVEGDEGRMNKL
FT                   LDKVKESNHKRLFQNVMDVKLHLTEYGKEAPVVSHII"
FT                   /protein_id="XP_844426.1"
FT   misc_feature    733720..733747
FT                   /note="AT_rich"
FT   misc_feature    complement(733720..733747)
FT                   /note="AT_rich"
FT   repeat_region   734241..734272
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(734241..734272)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <734314..>735339
FT                   /note="synonym: Tb04.2H8.1270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656803"
FT                   /locus_tag="Tb927.4.2770"
FT   mRNA            <734314..>735339
FT                   /db_xref="GI:72388005"
FT                   /db_xref="GeneID:3656803"
FT                   /locus_tag="Tb927.4.2770"
FT                   /transcript_id="XM_839334.1"
FT   CDS_pept        734314..735339
FT                   /locus_tag="Tb927.4.2770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388006"
FT                   /db_xref="GeneID:3656803"
FT                   /translation="MAVTPIEKREGGMELENQEVVVQSESPREAARNGGSSLNSELKKV
FT                   LNRRARYRTPLIFISLTSVVLMLTTLATSTIPVPQFKNNTKKRVVMIVAPSLRPDVLKL
FT                   SIESNKAPFMNLVTAAGGNYLYTNWGAKKNWSVTSAPDTSRGSGWSEANGRSNSLKLLQ
FT                   ELAKEGKRSIVLASSSDDRQSNKEEKSSNGGRRGVEILPVTTSSSELLEEDVLHAFERL
FT                   TKNDGDLLYIHTGVGGGSKAAEGEGNAAAFDDINILDSMLKKLTIAVAGHSQKTAEKWL
FT                   VAVVAGGGRGGNVAHEVSMLTSTYDRGNLLNSDSLTKDISSDCVQSTLLRWFGVREATA
FT                   S"
FT                   /protein_id="XP_844427.1"
FT   repeat_region   735943..735971
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(735943..735971)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <735980..>738352
FT                   /note="synonym: Tb04.2H8.1260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656797"
FT                   /locus_tag="Tb927.4.2780"
FT   mRNA            <735980..>738352
FT                   /db_xref="GI:72388007"
FT                   /db_xref="GeneID:3656797"
FT                   /locus_tag="Tb927.4.2780"
FT                   /transcript_id="XM_839335.1"
FT   CDS_pept        735980..738352
FT                   /locus_tag="Tb927.4.2780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388008"
FT                   /db_xref="GeneID:3656797"
FT                   /translation="MTHCDPSNLTGDSILSLGDCTSTVASETANSPAPHTDMKAMPWPS
FT                   PIQKQQQEGPYIQSLVHLHADRQCDEGGLGLNTNNGEDKTNISALQDSIVMSDLSDQVK
FT                   KTQARLATLREEEKVLQLRRRALLGSEEHCIAGDGSAAVGYIHLASLTSPKAVDDTCVG
FT                   CAVGEKREGENHSHLCDSPSVGTDGTPCSTPAAVRESRGVQVSCVAAKSNNTSKHSRAT
FT                   SPHLVGDRGFTTGTTGSRLQSCGLVFSLVTYLEPLWAVDVEVSRGVFKRLEVFAGENVN
FT                   EVARRFVEKNGLEEVRALQPLQRYLAALAAQKMNQGEGMEPSGSTPNVHTGVNRMDEKL
FT                   VGPLQTDCDRVGTPLRFEVGQRNRGCSKKVQGSDAANIAQGGTVQGSDTSDITHPDVKM
FT                   CGRDGKLMLKRPGGSRKIDAGRNIEEEQEEKWKRRGTPASPRRPERDRFGARRTNSSCA
FT                   AVPRGIEDTNRQLVRKMEAVPPRDPSTTRGQAARTAMSERGRRAATPTAPYTDRASSGC
FT                   TGTHRNGMGATSTILCSSTQHGERPIITEPGCAREDEVERLLIRRQQRSEQVKNTESHR
FT                   CTPQLSKARAVKGSGAQPQVLNCGAKKVSYSTQRGKIEERVAGPPLHPADEQSTSDMES
FT                   LQVSPSAAQPRGEAERQALHGEERSYERLNTSKSHGSPSPASQKRSVHVKSTEELELEA
FT                   CTFSPAINPRSVHIFNTIINGRAASERKPPLTKREGVRFVSPQSRSTSTTRGGSPAGNR
FT                   LPNQEIIQRKLSEEMKCHRTSENFGTGKRASNPFHGR"
FT                   /protein_id="XP_844428.1"
FT   gene            <738781..>740490
FT                   /note="synonym: Tb04.2H8.1250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656810"
FT                   /locus_tag="Tb927.4.2790"
FT   mRNA            <738781..>740490
FT                   /db_xref="GI:72388009"
FT                   /db_xref="GeneID:3656810"
FT                   /locus_tag="Tb927.4.2790"
FT                   /transcript_id="XM_839336.1"
FT   CDS_pept        738781..740490
FT                   /locus_tag="Tb927.4.2790"
FT                   /gene_family="HOG000260307" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388010"
FT                   /db_xref="GeneID:3656810"
FT                   /translation="MIHRSLRSSYFSIHVTKPQRVLLMGYRQCASSAAAPLINAKGAGV
FT                   SPQKDEVRSTCQELRRVMASLLEDRQCLYRDAVLSAALDPYRSKLQSLLEGNDSFGGST
FT                   ETPKSLTLGKLLECRDGWAAQVGGDAISLVDFYNAFLLSALVNSHADVQLVLDCMQQHD
FT                   HMDPTAETYVTIMHSFTAQRKGPNPVAGDTAFHYFGHALKTRGEGFITPELWSAVFVVC
FT                   AVTGAAGKLLDQWWELLLKTCKEGSSPLPYGAVHAALTWCSSKGDVERVMRYFNTANSN
FT                   SMVAFDQNDVPHVIGSGSLTTRSSDQVVQQCQLRLLVKLMVTAKAIELDGGLRALVVKD
FT                   VRRLIDPEVLRAAPWGIINDLLSGLSLQSAMQLLKFRSAAALEKDGAVPFTLWASLLRR
FT                   CARDHHIDQAESLFLFIRKRFELSGEQKAELVEIMIRMFATLPQGDFASATSLFIEHVI
FT                   RHPPGEPRVEPNATFYNLLIRAADTRNAAMMTFLEACAAGIDMNIETFEALCRSNRFGT
FT                   ISSLSKKLPHGYQASKLDQQIRIPADADAHLRREEAMRLRGKPLVDSTGEVD"
FT                   /protein_id="XP_844429.1"
FT   gene            <741017..>742477
FT                   /note="synonym: Tb04.2H8.1240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656809"
FT                   /locus_tag="Tb927.4.2800"
FT   mRNA            <741017..>742477
FT                   /db_xref="GI:72388011"
FT                   /db_xref="GeneID:3656809"
FT                   /locus_tag="Tb927.4.2800"
FT                   /transcript_id="XM_839337.1"
FT   CDS_pept        741017..742477
FT                   /locus_tag="Tb927.4.2800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388012"
FT                   /db_xref="GeneID:3656809"
FT                   /translation="MTVSANDDPVNESFCTAYNSSKKEGDETTSAQVSDSTAPRVTPVP
FT                   LTTPRHAKKQRLNRRIEVTDTSADRITVTDALQQHTREVLTVHNGPVVYEEQMIFHPYE
FT                   LYKHGKNKIHTGSVGYSSGADLVMLRDAVSEPSDADLAYVRRSAEIGSVICLDPKAQRP
FT                   LTETEEEEQKKNKKRLAGAGYRKYPGIRAPKNRKVRNRLLNTYLATELGREILDNYREM
FT                   QENGETDADQTPPLRPIFSDLPQVFYDILDLDEDAQTAALERYGVKIHAPAGNAQPKDP
FT                   DSGEVRFQNLNSRLRGELVHAINSEFLSKQIEDLEQNFTAFIKSGDPSKSLTYRFRDGY
FT                   GRLVCHGVAAYYKLVSQSHQQADGSKTTVVSWPKRKRKNTSSLTLPKITLKSLLRKKRN
FT                   EMPHTPLQSSTLDTPLFDFNDGPTDMEPLDLGAAASNDANPDDWLQPLEPDGIMPVYQP
FT                   FSLAYSIGNENSGTKQKGKKSKGTKTSN"
FT                   /protein_id="XP_844430.1"
FT   misc_feature    742670..742690
FT                   /note="AT_rich"
FT   misc_feature    complement(742670..742690)
FT                   /note="AT_rich"
FT   gene            <742780..>743577
FT                   /note="synonym: Tb04.2H8.1230; hypothetical protein"
FT                   /db_xref="GeneID:3656807"
FT                   /locus_tag="Tb927.4.2810"
FT   mRNA            <742780..>743577
FT                   /db_xref="GI:72388013"
FT                   /db_xref="GeneID:3656807"
FT                   /locus_tag="Tb927.4.2810"
FT                   /transcript_id="XM_839338.1"
FT   CDS_pept        742780..743577
FT                   /locus_tag="Tb927.4.2810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72388014"
FT                   /db_xref="GeneID:3656807"
FT                   /translation="MHRVITILSGYTRFFFLEKDVKIPSCIHPFRVRLEVFLHVPVFPS
FT                   SLFIRFFLPFILRLALLSSVRRGLASKTSMGSHESTTLFFFSSCRLSFPPLLNSLSFSY
FT                   LTFYFSFYGVAACSFICFVLGKRRVEGRISHENFFEYLLLTFFFKSFPHLVDPLVVNNY
FT                   QPAFVCVWRCCDELESRTRERWKVGQLQLHPSAASFSCCLFVAVVVLVVVVVLCFPVPF
FT                   PTCFPFAVFVVSHHRNYRRCFYLLYTSIGRGPMHPLEFWLMSE"
FT                   /protein_id="XP_844431.1"
FT   repeat_region   743379..743424
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(743379..743424)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   743962..744007
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(743962..744007)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   744460..744488
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(744460..744488)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   745296..745323
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(745296..745323)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <745474..>748479
FT                   /note="synonym: Tb04.2H8.1210; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656806"
FT                   /locus_tag="Tb927.4.2820"
FT   mRNA            <745474..>748479
FT                   /db_xref="GI:72388015"
FT                   /db_xref="GeneID:3656806"
FT                   /locus_tag="Tb927.4.2820"
FT                   /transcript_id="XM_839339.1"
FT   CDS_pept        745474..748479
FT                   /locus_tag="Tb927.4.2820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388016"
FT                   /db_xref="GeneID:3656806"
FT                   /translation="MNLVYGSHLPPGTEGPTCGELRIRVEKMILREDIVNSAVRSECAS
FT                   ANARPISVSVDHCAVAPLFRGEARPSAQCTPTTPGKVRGVLSLVYPIKTHEAQFVEYLT
FT                   NMSKSFNGGVHVLVFVPTSYSGRRKPTHIGKTIVALDRLKPSSPVGGWFHIMRDMSSTD
FT                   GKTAEKGTSPVTLVDVGKVKLSFTVTYFSQATPTRQRSTSTTASHALQQGGAETSDQSR
FT                   IEKKNPPPGAARVSSPTLVGVNILPPQAIKDEQSGEQRPRGERSLGRDDRTTPNSTPGP
FT                   QLMPASQVPLCGSFPRASEVPMGFSTNQKDTISQLLQRGHTLRARMERALDRSALMEGA
FT                   LGATTYTPMLPYANSIERAMALPGVTPGSNLMLGLFPVSAEADTSASSRTSLSDGSVKG
FT                   TPENSVASGVVEPNETPKESRLHTGVTSGQRSFQRTGALPTEGGYVEVDLSRISFSSGP
FT                   ATLGMEEMRIDIRLSKDVKTDEPVESYSSYVHRVPLAKGPEHHIVIGFQVRSFSEDKSR
FT                   MVIGFYRVFSAPVSNPPSETLLPAPASAKRVLVNETLLGICIVGLHAQSRDIVAHDPFS
FT                   GEDPTQAHLCVRVRDSAPAVVDNGPKRKEASRVKRVTVVRSDQRSNGSHSNEKLVETRR
FT                   EGHRVHLKEGADEPVQWKRECSEDRESCSSSSTSTPSSTGRSKRRHRVGDSSNRVEQTE
FT                   VYPVQICPTTPVKPTVQNAGEPEKKNFRSILASPQVTGGLHRGKTSTDGPSDRFRMHVA
FT                   IRSCKDLPLVALRRDGLPMVSTVVPTDQMANGVRSALASDGSLVLIDSEYRVFTPPSTF
FT                   FTVEDIYNATSSSALSRGVVPDWYVEAAVRGEYDRTLVVPKSQSPQYDYECILSLPHEA
FT                   VFLRQASAENQRTAIEAAAVREGAAPGFPPSLLPADKTWAAQGAGKETVPCLSEMRLTL
FT                   WHHAPEVDGVETRAQRSEEEKLWVNAAPLGECRIDLRSLRFLRVIDGWYRINEIDRLDN
FT                   VVGYVRVSVRML"
FT                   /protein_id="XP_844432.1"
FT   misc_feature    748521..748588
FT                   /note="GA-rich"
FT   misc_feature    complement(748521..748588)
FT                   /note="CT-rich"
FT   repeat_region   749165..749190
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(749165..749190)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <749453..>750148
FT                   /note="synonym: Tb04.2H8.1180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656808"
FT                   /locus_tag="Tb927.4.2830"
FT   mRNA            <749453..>750148
FT                   /db_xref="GI:72388017"
FT                   /db_xref="GeneID:3656808"
FT                   /locus_tag="Tb927.4.2830"
FT                   /transcript_id="XM_839340.1"
FT   CDS_pept        749453..750148
FT                   /locus_tag="Tb927.4.2830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388018"
FT                   /db_xref="GeneID:3656808"
FT                   /translation="MRPGSQFTPKAIQVFKSFATAAPAVMEVGTQSGIPKDLIGGAIGQ
FT                   LCNEEGDATSNGGVPFKAAEIRLYSPPPLKNSKAQVMLLFRGTKFVTVEESIGAGPEGT
FT                   ILFFSSSLLVALPYGVLQEGESNAFRITLCRVERRPDSAILDKSHLPDKELAILEKHAN
FT                   DVEKLKASVSQWPHEGSDNTVYDGTMEYGDYGMVYCFNTNYVGVSTLLSADVQWGETVL
FT                   THSSEGKRV"
FT                   /protein_id="XP_844433.1"
FT   gene            <750490..>751239
FT                   /note="synonym: Tb04.2H8.1170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656811"
FT                   /locus_tag="Tb927.4.2840"
FT   mRNA            <750490..>751239
FT                   /db_xref="GI:72388019"
FT                   /db_xref="GeneID:3656811"
FT                   /locus_tag="Tb927.4.2840"
FT                   /transcript_id="XM_839341.1"
FT   CDS_pept        750490..751239
FT                   /locus_tag="Tb927.4.2840"
FT                   /gene_family="HOG000260303" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388020"
FT                   /db_xref="GeneID:3656811"
FT                   /translation="MRCHVMGPSGHKSEYHCATLLGNWQEERRSFGFVDPAREPLSYMT
FT                   VYKDSFRGTKTDEELANAKPPSCFHENALPELLFYHNEITNPPKNLLTVNELSYTNAKG
FT                   GEEVNTLHDILHKEGVSKKRDKTIAIRRELGFIGYGAPHEGSLLASKGATATPLDYTMR
FT                   CGTTTDQNFLESTRGGCYKPPVIPAIGRMQEKQRLLTTKNVTVDATGEYLKDNIDEYPA
FT                   TSSECWGMFMKFTDNMKGKKLRECYED"
FT                   /protein_id="XP_844434.1"
FT   gene            <752534..>754579
FT                   /note="synonym: Tb04.2H8.1150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656812"
FT                   /locus_tag="Tb927.4.2850"
FT   mRNA            <752534..>754579
FT                   /db_xref="GI:72388021"
FT                   /db_xref="GeneID:3656812"
FT                   /locus_tag="Tb927.4.2850"
FT                   /transcript_id="XM_839342.1"
FT   CDS_pept        752534..754579
FT                   /locus_tag="Tb927.4.2850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388022"
FT                   /db_xref="GeneID:3656812"
FT                   /translation="MQSTKGTTLPKQRPASTAPLEATKTLMPLHELPSFRRDLLSRSVF
FT                   VLGLRTTAEMRELLSLMKRHCGIITGAFRVADFASGGMSTGGSMAVQGTAVDSRSALSN
FT                   AGGCVVVCLTFRTEEGAHLAQRMDNTALVYGSRFVVLPATRFHQNISQVSSKKQRNMPQ
FT                   HERLWQLLFSPTVGGSNIDWAAAAGAVNRGELLMLHPSDLPVDVTSDGTSSGGGASGAA
FT                   YMKRQVDGGTHSTGDDDKFRLSHYPAAAAPADDLNGARNFSTTPATTTAVTAPVPLYTP
FT                   RAAVDTENLGRSNTLQQQYYNDVYESSRTPFLSTVSDIASSILTSTGSGNTEYIPRVGR
FT                   AAQQTDLYGSPPLRQRVEPSRGQPLAERVTAHSQRLTVEGNETESRTNNVTTNSVYIPR
FT                   VHSLGSLVMDALPFASSLISTLLRAVSSPSQQHLTADATAGYERINEGEAEESRIREML
FT                   GMGDWRDARGRKRMRHGEDARGTPVRYISSRGNEVAGTTEEKFYNFEGGFTTLSPDVLN
FT                   TRFSPSGMAAVPMTVAGGEAGGGVTGPMGSFYAAGRRHGGGQDLRRSLLHAMMSAASLR
FT                   AQGNGSGVGNDNSDLTASAARSDLPLPPVPDNASNEEVREYIMRNVRLLPAEGQRQQQM
FT                   RYVRGTDVAAAAAAATTTPAGGGSSFIPFVSAVSSLFRRVNSVWRG"
FT                   /protein_id="XP_844435.1"
FT   gene            <755227..>756270
FT                   /note="synonym: Tb04.2H8.1130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656813"
FT                   /locus_tag="Tb927.4.2860"
FT   mRNA            <755227..>756270
FT                   /db_xref="GI:72388023"
FT                   /db_xref="GeneID:3656813"
FT                   /locus_tag="Tb927.4.2860"
FT                   /transcript_id="XM_839343.1"
FT   CDS_pept        755227..756270
FT                   /locus_tag="Tb927.4.2860"
FT                   /gene_family="HOG000260308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388024"
FT                   /db_xref="GeneID:3656813"
FT                   /translation="MRRGVGVAHVQKSRETKRQMTDLGAQLTAERAGQIADQLESLEEQ
FT                   LRVLARKHKDEIKRDPVVRARFKQVSDSLGVDLISSKKNVFAGLLGLGDFYYGLAGKVV
FT                   EACMKEQKFFGSYVPLARVVHVMNKQYEMSAQGGKRCVISEGDVRMALSKLHVLGDGYN
FT                   IVKLGSVNYIQTTPDGSRGVDHVPILEYVLAKQEKLVANYRAAHRKSNSRDAVKPLGGP
FT                   LRHVGVSCFPLKGGKELVCSDAVGKSSTAAKENNSSSESNEDVPFEVVCVSVTHDELEK
FT                   HLMWQSHRVEAALQCLVRSGSVWIESVKTSTEEVPPTTWISWPTAKGKVASGTETIYWF
FT                   VGVASGN"
FT                   /protein_id="XP_844436.1"
FT   gene            <756688..>757539
FT                   /note="synonym: Tb04.2H8.1120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656814"
FT                   /locus_tag="Tb927.4.2870"
FT   mRNA            <756688..>757539
FT                   /db_xref="GI:72388025"
FT                   /db_xref="GeneID:3656814"
FT                   /locus_tag="Tb927.4.2870"
FT                   /transcript_id="XM_839344.1"
FT   CDS_pept        756688..757539
FT                   /locus_tag="Tb927.4.2870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388026"
FT                   /db_xref="GeneID:3656814"
FT                   /translation="MNRQQRQPQGGLTSRSVNLPPRSANLANKTSTVTKPSASPPASAT
FT                   SRSNRKSDPASNEKVSDSKLEYENALAQLQLIQQKLRQQALTACHLEREALEFYYSHVI
FT                   CFEGYSGEPMPQQQSSSHHYYFNSTIARARQTDRERRATEEQQLQRERCRVEQLEEELR
FT                   SSVVMKRLEEERCAVRSAEAEKEALERQLAQKHAERNSREEELQKQREKLQQMRREFLE
FT                   REAGIRQLEIGKRKQMEDMETIRLQLKTQRGELDSAQTELQRREKVVEDLQQTIERLSR
FT                   KK"
FT                   /protein_id="XP_844437.1"
FT   gene            <758292..>764504
FT                   /note="synonym: Tb04.2H8.1110; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656817"
FT                   /locus_tag="Tb927.4.2880"
FT   mRNA            <758292..>764504
FT                   /db_xref="GI:72388027"
FT                   /db_xref="GeneID:3656817"
FT                   /locus_tag="Tb927.4.2880"
FT                   /transcript_id="XM_839345.1"
FT   CDS_pept        758292..764504
FT                   /locus_tag="Tb927.4.2880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388028"
FT                   /db_xref="GeneID:3656817"
FT                   /translation="MMNPEDVLQSIANVCRTGHLGDAAAAGIKAYIAAPFKHSNTSHSS
FT                   TTVTNSSTMANIPPANVTAAPPTGLGGVGGGFTTSIQQQPFALLNTVKDTQASHVTATD
FT                   ELDEQVSKIKSLMNLLLLCGDPERFGSVTCVIASIAPTVSSNVVNFIKTEISPTSLSLI
FT                   DHGPVASSLASNGKSNPVLLAAQCLFLLTRHFQMNPDVVRGICELLEILLQEMSCHTNS
FT                   STTSAASFRQHPSTRGLCALTWFVTMSLVNTLAVWQKLRGATGVAQENALLGSNIVADI
FT                   EKWATNLHARLERTQDTGFLSSSLQMRRGISQQYQHDEAAWRGGNGKRPRWLVIVDGYM
FT                   SIVLLALGMFLCGKGDERGLDKAVEAFVGDCAHSTGAGRRGKVMKYIVDLAPLQAMLAI
FT                   PLECIYIIPYEMAAYMFDEMLVAVKHVADIDVSSCVRYLEALQSKSDASYAIKGDVAAA
FT                   DGGLQRPEANKAQAGEEPFISETAHILRALTICLENLPSTVLNPDIDVDCAVTFFIFKN
FT                   CVTHMRAIFETQRSSGAWEAYTLKVVTRFLDVLAMIGRNPQYTQRVVALFSEMQVNCAE
FT                   LQWSSLIAKAQACAGASGDAVPLTLCDNGGSMAALRKPSVSGAAAPGRHRQFTPEYLQE
FT                   KQQEFASSVFVLLRQMATHPLLSEQVRQHTTLNVVLGFLHATKLSQLVLGRVLSLIGSL
FT                   ITNHEEAACVWTYLEESHLICSTENAAAQTKGGQGSSTVMGNKQRQGDNVAVTVEARSL
FT                   LGHCQYECHHATYSITIGFLDLMLAMFKYHRPDVTCLPTYATIIRFISEEIFRGVSRRS
FT                   FSCEKERYIVTALAAVVLNRALSLHLPLHGKNNVPSFQLVMACSKAPADVLGELLHIIG
FT                   EAAGALHEMDNYQRAAVRQCLALLRTAITVKEEQRLDNIFTFDARTHSSKEFAAQLLPL
FT                   CVSFDSLLANKALQVLLLLPHSTLSEAARYWDGRPDALETVITPYVSTLREEAVSNPVI
FT                   HAPPALAVLDSDEVQLLMPYVETETKSLMLDLLIQHAAAPQPSITSWLCGYQMYGSTEE
FT                   LLPGYCLEPIIDGARSRVLEEKSPHIAVKYVKLLYQLRANPSLCTPSLKRLMRERGTDE
FT                   MFHVLKTLRPDQCPPLVMSKYAFVMKLLGLELFSVGTEFLEELNALSPLTPHASVVELL
FT                   FQLLQAAPPHELYRQTSESGAQLVLEDHNNGVALDFAQWPSSCLMSLPPFPANCVAPGG
FT                   AESYVFRASDDVPQYSIPRLYEALRRENIANKGEAPSGAELREQLGVFARANECLLAYA
FT                   SAVQFLDGWCTLTNITVVVLDRISHERVVYLARSMLGSVQLISNLTVAAQEQIVHRVSR
FT                   TMSTLAAQLRRKLGRNTNGEGLSGATATCAGDEGPVEADVSVPQTAQQDVTSFLQVTGT
FT                   KISAFGTNASLTRGRLTGGSKRDPRGAVVSRMDATGVISTLVEAPSRAAIHSENLQLLR
FT                   TLLIVTVQWGSRVPQARQHLYDAISAFLSISGTNVDDITLQQYHNALFDILVQDTSATA
FT                   TNGNKFAALPLLSQLMYISPQLCELLCVSLTNDGVSPRLMSCVAQCFQAIDESICAFFS
FT                   HGGASVSSILWFVRVVFDMLMVISQRHSLQLFHANALTHCMGMKLWSTCARIMLGHVKY
FT                   AAGTSLSNTENIEVFKEVIHNVLLSTIRWFNAVLSALDNSESALGAVADFVFSQQLLFQ
FT                   SVLVSPTTSEHRRFIDTPTLEMYGEIGGLLLRLASSPLVDECRPFVQLFALTELLDVLT
FT                   RSEFINTPIFLEDRMPNSVAAVPLSSSQSGSLPSIYQRQLIAVATQNIVLFIFFVERLV
FT                   QHFNGYEGNVPSAQQQPELQKKSYLRDDPRSRFLITTITENVVAIMEKFCDGQVLHVAT
FT                   VVPYFVATHSLVLLLHAFLLVDRAFSLNNVNSNNQWGGIVHALEEARRVVGLWRALHSD
FT                   YHKGVKVSRTGGRWSVAAPSLSNQTLHHAAVMPVPPAEVESPSAAGSRAAAGEMIHADN
FT                   AAPAPAENGTNMASITSGTVCDRTTIGALVELSRIGCMDTVSDEPPVYKAVDQVVLMES
FT                   FLRRVKVAISNALREASRM"
FT                   /protein_id="XP_844438.1"
FT   misc_feature    765267..765295
FT                   /note="AT_rich"
FT   misc_feature    complement(765267..765295)
FT                   /note="AT_rich"
FT   gene            <765317..>767212
FT                   /note="synonym: Tb04.2H8.1090; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656816"
FT                   /locus_tag="Tb927.4.2890"
FT   mRNA            <765317..>767212
FT                   /db_xref="GI:72388029"
FT                   /db_xref="GeneID:3656816"
FT                   /locus_tag="Tb927.4.2890"
FT                   /transcript_id="XM_839346.1"
FT   CDS_pept        765317..767212
FT                   /locus_tag="Tb927.4.2890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388030"
FT                   /db_xref="GeneID:3656816"
FT                   /translation="MNSASQDIADTVRQLQKLSRELQPVKAALAAIAKRERATPNAATA
FT                   AGSLDKVASRVQEVSRKYSSFFSRVNFLLDAEFPRLQAITPLLEVCRDGEDTSGEGNSG
FT                   QDPFRLVCSPIVPHILNRTSYHVVCGVIRLHMEMVDYLIATERYQLACHVADAYGLPLY
FT                   LFPRLAALVLPPLPPIQNNSAGSEERGGGRDSTSLPASALVSPYLGPVSAKATLGSNET
FT                   GPPHDSVPPEHIAVKCIEAKHSVMEAIAYCEGKLLPALESIEPERRPKEMEVLYDLLLD
FT                   LHVTRILQLFQGGTTGQEAIHVYLANNILRWATRRPYFVQTVINALTLRSEAGATAVPP
FT                   QKSAVQNGRERTPNGRSACRTSQKDEEAIRLVACMMSVEGYRKLAVLFHRGAILAGSQI
FT                   LSLAETLERRRASAASQSQAVGSDACASTMEGCKCELPDLVVRAVAASILLKDEYFDRM
FT                   VISRRSAADAENGGGETRAIQIPPTHLNTQSGSAAFDGAVMAIVEEMLRSFFCNKQNSE
FT                   AQQSGRGKSLDGVNSCVPLNASDLLQVEERWSNDVIFIRRPTRFYCYITKECFDGGRGG
FT                   NYPLALPNGTVVSKLAIMQYHSKNVSQSDHAQPVVVCPRTGEEFPISAIKRIFVT"
FT                   /protein_id="XP_844439.1"
FT   gene            <768136..>770892
FT                   /note="synonym: Tb04.2H8.1060; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656815"
FT                   /locus_tag="Tb927.4.2900"
FT   mRNA            <768136..>770892
FT                   /db_xref="GI:72388031"
FT                   /db_xref="GeneID:3656815"
FT                   /locus_tag="Tb927.4.2900"
FT                   /transcript_id="XM_839347.1"
FT   CDS_pept        768136..770892
FT                   /locus_tag="Tb927.4.2900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388032"
FT                   /db_xref="GeneID:3656815"
FT                   /translation="MTESDMYRGSCSVLLQAVLTQACRIILALCATAKGKGTVSERITA
FT                   TVAAYISTVEASSVVEGASKYAMLTAVHMIHCEHHPYRACQHQHGELGAAVGVVLKEAG
FT                   LRLHILTALTQLIMKRCGSSEGSVGVLLSRAASLESVRHEAASTMPNAEENVSTELLLQ
FT                   VFPELGVAPSKAESGAVVIIHAVHCGCPHQWFSLMLPTFLLAATMEEHVRVWRRTTLLL
FT                   KAFRRLQQRRGMRLLRAIVEEVNAPSSVAPPMERLQALPDTITCGAGQEGYIETSIVGV
FT                   STVMLEDEEVGKKDESRDGIHTGENRSDPPESAVTNSSIVGTCIIRGDSDKPTVSGGVP
FT                   DPVRHLSSSTREPDSVSSAGHIRDKLVNDFVKKRNTLAAEHLKRFCLSHWRYARMHERC
FT                   AIKQQLRKLAERTTQECWTHWKSRWQCHREMRRKQDMEKQCDSFVTEKLLKLQKHVFSF
FT                   WRALFLLRQFQICRLGRRCFVRWRCAYTFIIHSRGDKLPLMLRQDMGSRCFLQWRDAYR
FT                   QRVADRMCARRYFSLMRERLERWSIWREQEQVAVMRERTAVQRRCLSNWYRAWRVQSLC
FT                   TRFISSACKRLKCRVMTVWRVRWLRREDTAERLRTLYAWWNRRIAAHSFHWWCKRVRLQ
FT                   RSGRRLSDVRERRFYRFAWARWSSRVLSHQRLTQKHELNASRRRQWGLLRATWCTWHRR
FT                   YAKRVQQRHARNQEETLKYAAAMREQSLVASAYFTWKRKAHMIRRRLPGKPPAAVGAGG
FT                   GTSIPLGLNRSFTNRDVSLLTNDESCDGEKTGEDCSYANIHRVPTYKTSHTGVFNVSKR
FT                   CLDHREPPEALRAERLLIRSLDSPRWQAIAHSRLFNIGGNITRSNTKVDKSTVCTQADY
FT                   RQFQHQKRYYEQARWNRNDELLDVTPTMPSDIENDACPSVEDSQLPD"
FT                   /protein_id="XP_844440.1"
FT   gene            <771652..>773406
FT                   /note="synonym: Tb04.2H8.1040; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656820"
FT                   /locus_tag="Tb927.4.2910"
FT   mRNA            <771652..>773406
FT                   /db_xref="GI:72388033"
FT                   /db_xref="GeneID:3656820"
FT                   /locus_tag="Tb927.4.2910"
FT                   /transcript_id="XM_839348.1"
FT   CDS_pept        771652..773406
FT                   /locus_tag="Tb927.4.2910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388034"
FT                   /db_xref="GeneID:3656820"
FT                   /translation="MRRCVRAATTPPAAPWRAGSSFIPIWRFSAFYSSSKFIGRRSSGS
FT                   KKLGAFPRMPHAVKKSSTDVPRAAESPVDTTAVQTSVIEEDKEEEQPHMCNNKRTKSKR
FT                   SSQPCTEAKQCSNSREGKQAVAVTGTKSCNPSEGSTAQCLPCVTDDKNTQKKEREGENV
FT                   CLVDRAVVLKLFVVSDALAFMFATSPKDQRCVNWHLKKVDQSVIMQPPTQAPRSQHKGQ
FT                   EGITDNDSNSKDKKDARRESRSRRREQRNAVTREYNIALRVLSEESADNVHYIHVREME
FT                   RLVPPADVLPRNAMSTVLASKKGNENSKRRQSSEKRNSKVQKGRGTSPAEPSAAALEAL
FT                   GRVMALRQWQTAALRKAQESQRLHALPPACHAITHVYMNDPSLPDTTVVQGCNIKKSVT
FT                   DILDLMKQSTVSGNLLGFVNLHKGRKSSSSGNKGTTPSATLSMPFELKPLLSVVASCIP
FT                   RSDAALGVRFDEDGFLRSVLQRHSRKSGSNEPTTAVAQVVSEEERQTATDRELSARRVP
FT                   PVPRYTTRVVLLIDYDSSESWDLHSDGVSSETKAKSAKGDSGEEVVNRRRRRKEPHIYC
FT                   LIADGGEV"
FT                   /protein_id="XP_844441.1"
FT   repeat_region   774391..774423
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(774391..774423)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   gene            <774789..>777689
FT                   /note="synonym: Tb04.2H8.1000; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656818"
FT                   /locus_tag="Tb927.4.2920"
FT   mRNA            <774789..>777689
FT                   /db_xref="GI:72388035"
FT                   /db_xref="GeneID:3656818"
FT                   /locus_tag="Tb927.4.2920"
FT                   /transcript_id="XM_839349.1"
FT   CDS_pept        774789..777689
FT                   /locus_tag="Tb927.4.2920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388036"
FT                   /db_xref="GeneID:3656818"
FT                   /translation="MTCTPPAQDVNDGKLFAHSPSFPTVSFAAEDASEDLSASLHRRQP
FT                   RVSIFPAERSGSITSDSEQGGTGVPLPTDGRSPLSSVRRRHDTAGSPQNFQGNEAQQPG
FT                   RNPGQQLASRHREGSGGSHKGQQSAANSSPSRRQHSSPTNRDDSTAHRKQSMGQGGGSP
FT                   SAAKKGGAERRRSTELQPRGANSALSPTRRSSASKGGSQSKGSAKQDAAHGKQTKPKTK
FT                   SSSRDSSRSKQRQSLAIKAASAKDLSRTDSEAQPASGRRLSTVSLASRGSPRGKRGKKA
FT                   AAVLVKNEETARKEIEVAQEEAFDEIMMSIFIHSFQPQRNLIKKLEYEMQKQKQELTGK
FT                   LAQAKNSAMQMLEQVALLVDTVQKNGVEAMKESQILEAEVPFIHQELAPKGRRLSCVNA
FT                   VPTAENEDERRIRRKDQEEGSESERIKAFFSADLYSSCSIGTFKDMRTDDIVSSVDKMC
FT                   GEAASLSNVFSDLLNRTQRMINQSRQIIKAQQAALDECVTHVELADETLRDATEREKEN
FT                   IDYAFQIGRQFSMELRHRIDRIEYEMFEGLDEVIRRSTEVCCDAIASTDQMQRQVDKDI
FT                   VAEQFMTRMELAAAEKAKLLRDVRSKLAYLWRRRLNVGSEERATLTYTGLPQEYQKSLE
FT                   LCDYDMLCRLIHFVSLNNDEARELFMGALDEHESFLKGNSVEAEIASQRVTLETAVRSL
FT                   LRKLEDEGNIKVNPTRVPQTYEEKVKDLVDHYNIYMSKVEKQRRRILRRMAAEDALSCL
FT                   PYFDRRRPVPEEYAADLDSRPGFVKPPAICNSLSIPKEEEAAQKVNVSEISRPPSFRIK
FT                   RTDVGSFRGPTGPPLCARPPHDVEVAEIKEYLRRSHPSADKLPGPATVVGYGRWGGQVA
FT                   QRPQSGLPRNSVTFSDATETRGPIGPLKDVQQPHRKPPPPMVPPRRALLTHVLEHHTHN
FT                   PKAPLRAPNEYCTGVWGEDKPFVAKQVELLQKDIRL"
FT                   /protein_id="XP_844442.1"
FT   gene            <778623..>779438
FT                   /note="synonym: Tb04.2H8.970; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656819"
FT                   /locus_tag="Tb927.4.2930"
FT   mRNA            <778623..>779438
FT                   /db_xref="GI:72388037"
FT                   /db_xref="GeneID:3656819"
FT                   /locus_tag="Tb927.4.2930"
FT                   /transcript_id="XM_839350.1"
FT   CDS_pept        778623..779438
FT                   /locus_tag="Tb927.4.2930"
FT                   /gene_family="HOG000260292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388038"
FT                   /db_xref="GeneID:3656819"
FT                   /translation="MRRSSMKFGLRQILSEELGKAAIFLRFKANEYIASTARACQTLTG
FT                   AETNPEQANKRRKHRQVYEEILRQRQQVAQEAARRAMEGKSLRERLMASASAALKGLKE
FT                   ATSTNAGALALLQHCTAAHAAEVAVEQGIDVKSVTMQVEERKTGSQVGSETVVVGYIDA
FT                   PNTSEEEMMAFAEQLSKKCPMANAMRGKIEWRRANGEVQHNDEQTTGNDNSVGSTSDKA
FT                   GDAGSIPHGMPGTRYYSHESMRRGAGGVGDGDELHLPGVTKGSGKGPDK"
FT                   /protein_id="XP_844443.1"
FT   repeat_region   780076..780104
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(780076..780104)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   gene            <781173..>782159
FT                   /note="synonym: Tb04.2H8.950; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656822"
FT                   /locus_tag="Tb927.4.2940"
FT   mRNA            <781173..>782159
FT                   /db_xref="GI:72388039"
FT                   /db_xref="GeneID:3656822"
FT                   /locus_tag="Tb927.4.2940"
FT                   /transcript_id="XM_839351.1"
FT   CDS_pept        781173..782159
FT                   /locus_tag="Tb927.4.2940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388040"
FT                   /db_xref="GeneID:3656822"
FT                   /translation="MKKCWVFDCAAPGLYCEPRRLLKPFSTDSILDAAGRAFETVEDGL
FT                   KATTWRTHHAFSARCGLTSVTRSDSTTCGKGVEESSVSRSPEDYREWHADFHLRSPSAE
FT                   PHVLLSVAPHYLPSRGSGNADDGRKMEVVGSRGRWLKPWRPQTAEEQAAYDAAVLGTPL
FT                   IWEEPLVLSLDCTADGVFLWSEDHGIYGEKVANRCFERHSSDAGDDSAEFKQEAFLRFR
FT                   WSEQPPAQTSSVGSGRHEMKEEHVESPNVSKCGELRVFRGQRTKVEAEEPHVERISYEE
FT                   ADVDAGSGGFLWQSVLHRIISCGPVPKEVYFAPYVTLMESGDEVSLL"
FT                   /protein_id="XP_844444.1"
FT   gene            <782476..>785352
FT                   /note="synonym: Tb04.2H8.940; mitochondrial DNA polymerase
FT                   I protein A, putative"
FT                   /db_xref="GeneID:3656821"
FT                   /locus_tag="Tb927.4.2950"
FT   mRNA            <782476..>785352
FT                   /db_xref="GI:72388041"
FT                   /db_xref="GeneID:3656821"
FT                   /locus_tag="Tb927.4.2950"
FT                   /transcript_id="XM_839352.1"
FT   CDS_pept        782476..785352
FT                   /locus_tag="Tb927.4.2950"
FT                   /gene_family="HOG000260288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial DNA polymerase I protein A,
FT                   putative"
FT                   /EC_number="2.7.7.7"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: DNA-directed DNA polymerase activity [goid
FT                   0003887]; go_process: DNA replication [goid 0006260]"
FT                   /db_xref="GI:72388042"
FT                   /db_xref="GeneID:3656821"
FT                   /translation="MSLHGHPYQRYVSVKLTHFQQGDENDGPTKSGGVESGSNREKWRA
FT                   FGVDIGVNLASATSQSSCTSSSTQSQMVNDASITKTASVQESLRQQLAVLTSRVGQTRE
FT                   QIFNAVRLKEKTSSKSTSNTCTPSSVTTDTEIIGGGSAPPSQKRVPGKDGLSRDSAKNK
FT                   RSTTSDNNIVLNKGAGSTATHQQQEAGQQISEKKTKTRARKSSTLSNAEATVTSRHSSK
FT                   CATQRTLFKLPVDPATSPQRGLQVAFKEELDGSALFNDARDTLNDPNRFQVPTIFVGFA
FT                   TREGQTNFTISSSSRGKVHFMRGVNPELSHLEVSFLVVRWKDDVIVYSAAVGLELLVRV
FT                   AEELPGVEIVTFNAPCLLLPLLSYKQGKFFTSCVSDVRLMTWMLEPSADTAEFADYDKL
FT                   LQSYQQQIGLPAGLNAAECKGSKEAVSHRVFYMEPLYRMLYGRLGSHGLLPAFLKQEKR
FT                   ISIMCAAMKLNGFYVNLVEVDGFKARCAEKMEKLRSEARSMIPSMTNFNIQSADDCRVA
FT                   LYEVLKLGPNLVSKGTEGSTENNSLILTRGGKLSTSEETLRILARHHEFPRILIAYRKL
FT                   AKLLQTYVVGFMEMAIPIEEGDGEFTDFSISEQGKEAIPNASDRHKAKWAKLHPNLVQE
FT                   GTETGRLTSVEPNMQALPRSTQLVATHEKNNTNDADSENGNNENINGDVNAADAGGNES
FT                   DGPVQEKEVSFIRRCLGAPDGYSLVSLDYEQVELRVLAHLSGDSALINVLTKSGDIHRS
FT                   IAEIIFRKTSVTGEERSLAKKVVFGILYGAGPRGLAQQMGVSVEQALRVSSLFKSCFPT
FT                   VDAYQRRIIDQCRSDGSVRTLSGRVRSIPDINDRVLTKRSHAERQAFNTVVQGSAADVM
FT                   KLGMIAVEREVLQPHAPDVRLLLQVHDEIILSVPNHMLHSIVPAAMHAFAHPISLLVPL
FT                   LVTTKVGRLLGDLEEWTVDHALGLRVPS"
FT                   /protein_id="XP_844445.1"
FT   misc_feature    786699..786721
FT                   /note="AT_rich"
FT   misc_feature    complement(786699..786721)
FT                   /note="AT_rich"
FT   gene            <786736..>787101
FT                   /note="synonym: Tb04.2H8.930; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656825"
FT                   /locus_tag="Tb927.4.2960"
FT   mRNA            <786736..>787101
FT                   /db_xref="GI:72388043"
FT                   /db_xref="GeneID:3656825"
FT                   /locus_tag="Tb927.4.2960"
FT                   /transcript_id="XM_839353.1"
FT   CDS_pept        786736..787101
FT                   /locus_tag="Tb927.4.2960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388044"
FT                   /db_xref="GeneID:3656825"
FT                   /translation="MNARDELVEQLSIALSDIEQLQPCTDTALDAELLGAVADYIESGV
FT                   NAEATLKRLRGTLAQVAKKGSVPQAPVQVKKESEGEEKEMNGNGAVSAPVLTAEELGRQ
FT                   RAQLILRDILKERYARH"
FT                   /protein_id="XP_844446.1"
FT   repeat_region   787184..787228
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(787184..787228)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   787943..787962
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(787943..787962)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <788021..>789028
FT                   /note="synonym: Tb04.2H8.910; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3656823"
FT                   /locus_tag="Tb927.4.2970"
FT   mRNA            <788021..>789028
FT                   /db_xref="GI:72388045"
FT                   /db_xref="GeneID:3656823"
FT                   /locus_tag="Tb927.4.2970"
FT                   /transcript_id="XM_839354.1"
FT   CDS_pept        788021..789028
FT                   /locus_tag="Tb927.4.2970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_function: protein binding [goid 0005515];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72388046"
FT                   /db_xref="GeneID:3656823"
FT                   /translation="MTTYGHRPEHMLHAWRTLGLRANPTYEEIRAAYRRLAFATHPDRS
FT                   NEPGTKERFQKLQAAYEAAVENCRRMAALGGYRLSGDAANFDWRAEVARVREAWARKHG
FT                   LGSDAAEEEEEETTARKKRQQTKTAAKGTKTAKPASASASAAPDFSGTNSPTPARGRKK
FT                   ASPRNSRRQQKRGSATTSRWSKPVANKKGKPKPPFTLFSSPRSPPPPASRGADGVAGEN
FT                   KSLNTSRAGSPGATTSHTSERRAQVVRRRRRCFLSNEDKMICRLMAVEAARRLALYVFE
FT                   GATRRIISQMLAEVRIRCAIKQFEDLAWKKLVKYVQLGPSDALVRHKGKRRIVA"
FT                   /protein_id="XP_844447.1"
FT   repeat_region   789806..789826
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(789806..789826)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <790014..>790838
FT                   /note="synonym: Tb04.2H8.890; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656826"
FT                   /locus_tag="Tb927.4.2980"
FT   mRNA            <790014..>790838
FT                   /db_xref="GI:72388047"
FT                   /db_xref="GeneID:3656826"
FT                   /locus_tag="Tb927.4.2980"
FT                   /transcript_id="XM_839355.1"
FT   CDS_pept        790014..790838
FT                   /locus_tag="Tb927.4.2980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388048"
FT                   /db_xref="GeneID:3656826"
FT                   /translation="MFLLTFIVRVLAETAAYMYKHEIPSYLPSLHLYHLKDTIAVSAVF
FT                   IRWCVSVAAEMGLVHSDSQPSAWSSHINWFKSFGFGASQDDDILGSPVSRGELQAAEQI
FT                   QTEFTSLDHEAEYVNERLRRCEEALVAVLEKEKILSQGVEAIMMEMHDYTAAGGSEWSE
FT                   SDLERFRENQQSVDSVLKILEEIREKREHLQQRIFKTEVYSRLLEAERKEAEKTLDAVR
FT                   RSVGDRTGYIAVEGGNESTLVIPPAPLVVSIVEEFRNEVVNEEPSSTLASLI"
FT                   /protein_id="XP_844448.1"
FT   repeat_region   791039..791075
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(791039..791075)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <791219..>795088
FT                   /note="synonym: Tb04.2H8.880; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656827"
FT                   /locus_tag="Tb927.4.2990"
FT   mRNA            <791219..>795088
FT                   /db_xref="GI:72388049"
FT                   /db_xref="GeneID:3656827"
FT                   /locus_tag="Tb927.4.2990"
FT                   /transcript_id="XM_839356.1"
FT   CDS_pept        791219..795088
FT                   /locus_tag="Tb927.4.2990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388050"
FT                   /db_xref="GeneID:3656827"
FT                   /translation="MSLSLGCRDDSLTPVPRSSGETASNVYTVEQYTKLLSKYEAARRH
FT                   IAQLEGKVALLRQQSNSGGDKQPLSPRSQGYGCGTEYTPSREEFQQVIDWNKELVSTVE
FT                   TQRCELVRMDTENKLQVVMLNDELKRLQETCARLQQENDRLKSSVVDDILQRRRKARAE
FT                   LATERSRRICVVRAAGRGRLEQLEGVLMASHDDMYFQPRFDSLRLPLHDATFVVHTVAS
FT                   VTYPLRGTEGFTMGVYHELLKDLAVKHNGHHVCFEGHLQVFVFYCATHALRFAGECHSA
FT                   LLKVDWPARTIKIPHFAPVTDFGELIYSGPRIHTCLYTCSPGVEVDPITGSWLYYGKEV
FT                   RDALVTTLEEAPVGEIVANKKWCSMFSREHDITNETTTTDHLTIQSVRAKLGAQWSIVP
FT                   VNDSPNELFCSILPAFLERRRGIPPYMVDPVPRFARKIIDVKEVVPDVIGVMKGVGPVS
FT                   LAGATQQGQQPAPANGWVDHLNTLSPSEEGVGDKVLSLLIMKNEKDRAQHEWLKLQEVS
FT                   AYHERVAMEGEDRYIHRFRPIMPGQPCFVCTVDIGENEAWQQVIGGKLSVNEKLDLHDR
FT                   LHCEVVACGDRNDGLYVNGNSRDVVTFAFHQACQALRFAAQAYASVSKSCELKKTTTCI
FT                   VRAGIAVGEIHTIGHGSSRALKGRTSDDGEAGNTGSGGRMGSMRLCAGVAVTLSAKLCD
FT                   IARGGEIIASAGVVDSFYTKKSNVISDEYNILRYGVRFLGEGSTLTDIYSILPKEYAYR
FT                   RQQQMGDKRTVQGAGEEKMWRSQRSVKEELVFKSPHIRRVDVQHMLVEKQGFLERNEAA
FT                   MMALHDAAWHVSVRQAIRVPWLFTQTSRDATKKRKLGFLFCAAAGLSALSRLVTNELYK
FT                   ELCGQYNSTVQEVALANDGYVVNTDSISSYIIAFNDAFRALEAALQIDSKLLALQWPEE
FT                   ILTLAPTLRVKSARTGVLLFSGIRATTVVHASDGYEWNRVQSSTGEDSGIEISGPAIST
FT                   LMDVSYRAIGGEAALTQAAHESVESSTRGRLLLKQLAMEVAEDNNSKTEVLYAPRHLRE
FT                   RLKLFSSERATSPAPAGTDRRSKTPKSVWTNNPLRGDLVWWMRRNGFASQLPTVHAAQW
FT                   AAPQKQQCRSTDAIMSEYTERVVDHFKQELATNLYITSCGECFFNVVIGVLVALSGSFG
FT                   NLSPSRRTSLPSRASSSGACASSPSTWGVLDPALTMSMGSEGLSRSSGRRDNRQSSQQS
FT                   AADECDDPYKYTLTVLNETLKHLLQQSHRVLGINVSFSFSPIKPNSQTFSPLRGRRNKL
FT                   PLLKR"
FT                   /protein_id="XP_844449.1"
FT   gene            <795639..>796943
FT                   /note="synonym: Tb04.2H8.870; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656833"
FT                   /locus_tag="Tb927.4.3000"
FT   mRNA            <795639..>796943
FT                   /db_xref="GI:72388051"
FT                   /db_xref="GeneID:3656833"
FT                   /locus_tag="Tb927.4.3000"
FT                   /transcript_id="XM_839357.1"
FT   CDS_pept        795639..796943
FT                   /locus_tag="Tb927.4.3000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388052"
FT                   /db_xref="GeneID:3656833"
FT                   /translation="MDSQARAGKSILHKGIPRYRQAAHVRRGDEEALGHVAGSGAKVPL
FT                   RTHTITSGRLRIKTYQDTQSMREAFERLKQICGAFSLDEDEEISCMIPRVCDSGNPAPA
FT                   QLNRMPGHLIVHCFSFCDLSSLGQLSRVSRRLAAFANAHHIWVEHAKRLNKPVRGPETA
FT                   RADLRFEVCGRWDAEIQEHEQAYEDLQRRLQERAAAERAAVLDVEGVLNENRRNVRGGD
FT                   ILRSRGSNNSNIYSVADVQALQAKVEQLEAVKLELLRSVRDLGDILAQQQAQIQDMQNR
FT                   LAVRVTAEGDVVTTTSSCNTVDGTATHVSPPELTLHELTNFERRMCRLVLGTIPDLSVV
FT                   LRRGVDDFGTMEMLVQHSGGELESGIRKRWQAFKSFFPPLSNDYSKARFYLLSGESAQS
FT                   ERRNESITRCSAIVRRLMKMSDSEITDIVMQSGSS"
FT                   /protein_id="XP_844450.1"
FT   gene            <797540..>798154
FT                   /note="synonym: Tb04.2H8.850; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656832"
FT                   /locus_tag="Tb927.4.3010"
FT   mRNA            <797540..>798154
FT                   /db_xref="GI:72388053"
FT                   /db_xref="GeneID:3656832"
FT                   /locus_tag="Tb927.4.3010"
FT                   /transcript_id="XM_839358.1"
FT   CDS_pept        797540..798154
FT                   /locus_tag="Tb927.4.3010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388054"
FT                   /db_xref="GeneID:3656832"
FT                   /translation="MLRRWSECGRFSTTLSWCAANPVGRQQTRRVSGETTAKDASVDST
FT                   GDEDKDKEAQYRERLIQEILSRDKEIFELKRQHELSMLRVEQNQKRVLKDQEDRGMYYE
FT                   QNCNVHTFDTVSVGLYTQRNTLYHTMSIERLRNVKLFTTLLVTVLTCFYLYYRYMINND
FT                   WVYVEKPMKLLGSRACALSEIREKMGEQQEEKEHRERRFAA"
FT                   /protein_id="XP_844451.1"
FT   gene            <798557..>802879
FT                   /note="synonym: Tb04.2H8.840; ATP-dependent DEAH-box RNA
FT                   helicase, putative"
FT                   /db_xref="GeneID:3656824"
FT                   /locus_tag="Tb927.4.3020"
FT   mRNA            <798557..>802879
FT                   /db_xref="GI:72388055"
FT                   /db_xref="GeneID:3656824"
FT                   /locus_tag="Tb927.4.3020"
FT                   /transcript_id="XM_839359.1"
FT   CDS_pept        798557..802879
FT                   /locus_tag="Tb927.4.3020"
FT                   /gene_family="HOG000260280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAH-box RNA helicase, putative"
FT                   /note="similar to Dosage compensation regulator (Male-less
FT                   protein) (No action potential protein). (Swiss-Prot:P24785)
FT                   [Drosophila melanogaster]; go_component: chromatin [goid
FT                   0000785]; go_function: chromatin binding [goid 0003682];
FT                   go_function: double-stranded RNA binding [goid 0003725];
FT                   go_function: helicase activity [goid 0004386]; go_function:
FT                   ATP binding [goid 0005524]; go_process: nucleobase,
FT                   nucleoside, nucleotide and nucleic acid metabolism [goid
FT                   0006139]"
FT                   /db_xref="GI:72388056"
FT                   /db_xref="GeneID:3656824"
FT                   /translation="MFTRALSNAARVVAVAARQGFSHSLTVSSASLQFQLRARADIRRR
FT                   YRSREGNPQLGNSGGADVGSMPLNFAVIPVSRINMRMESQLESFLKKQEKETLELGTSA
FT                   ESPKIRLLNVPRTTLKRAVLDFNVRGQQVRAVGQSRRGKVAKALCCMHAAMLIDHFSID
FT                   GVGCHDMPLPLEEEGVSSVPSNAAQTPHHKHAQGSPLSTTLKLPPPWAPGMQWERYVSD
FT                   CENYIRRREQQERTDAYVQLRVPRSGNPLVDRAADMTKGEKNINHLALQRLNNEIRNAT
FT                   KDIHITRVSRRIFVATLLLDDTSQLSATGVATSLKEAKQRCAMHALNILKLVKDQRLAS
FT                   SPLASVCREGSSTSAISSSLSPRYSKMLDFFTLLCGVKPKPSFTRDGRGYKCELLLDDV
FT                   TSTGRGVNRFEAERDAIEHALSEMELYDERLQAINSIISRYPKIQPQCVPSAKLPESLR
FT                   NAIHALVQRVHKELHLADDGTTLTGSKASSSKDENKSDDTDDVVDAETRATINALQEIS
FT                   RDEAYANRLRDRLCTLRADPKYLERYHARRSSLSINAVSQSILNELQQNRVVVVCGTTG
FT                   CGKTTQVPQYILDAEIMAGRGDQCCIVVTQPRRLSAFSVAERIASERLSAVGGDVGYAV
FT                   RLDARPGRHVTLCTTGVLLQMLVGMPSLDAVSHLVIDEVHERDINCDVLLALVKDLMES
FT                   GGNPRLKVVLMSATMQSDMFASYFGRAPVISVEGATYPVEVRYLDDVAALLQKQTNPRN
FT                   AYYSTMFDSLTAARGAGEVGRRGKGAANRGRSGFGAKKQLLSSPLKTDYSLIAQLVRRS
FT                   VEVDLNNDVFGKSVLVFLPGWKELVAAKQAIEGLGDGQRYHIILLHSCVDAAKQRECFA
FT                   PAPVGKVKVVLATNIAESGITIDDAAVVIDTGLIKQTTWVSRVSGLQQQGRELGILAAP
FT                   MSTTYATQLSLRYASQANCTQRKGRAGRTQGGVCYRLFVRDVWDVLPAFQEAEIHRVPL
FT                   TQVLLKLLALGHDRPKEKLRTFIEPPSEKNVEDSMRQLQSLGAVSADERLTPLGLYLSR
FT                   LPCEPTVAKMIMMGAVLRCLDSALTMAATGDVNPFLSSRDMSFEVRVRRRVFAMGSQSD
FT                   HISVLNAYNAYSARRADAGFAKENFLSANNMRLISRYKQQYRDILQRSGFIRDTELNSP
FT                   QFTSECGSFGGDGSHVLYFDDGPLSADATDVSLVKACLCAALFPNVAVLDPTPLLQQQG
FT                   KKAKTLVMRTSTRSAISPSKDSACRRTGSPQAHTCSTPQDLFSPHNDEHMDLPSMLYIY
FT                   QGIFSLKESREEFLTQVSSVSLWALLLFGVGEADMHYDNQVQLCVVGNWIGIHMDSESY
FT                   KALVAIRTILHACVWRKYKHPEDPGNNRALEELHRICKGILKSPPNDKEQYLNNLVDTG
FT                   RIFSPMEVQQLTDDVKMERLNGEQDDDGNRDVWELHEV"
FT                   /protein_id="XP_844452.1"
FT   gene            <803315..>804730
FT                   /note="synonym: Tb04.2H8.820; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656836"
FT                   /locus_tag="Tb927.4.3030"
FT   mRNA            <803315..>804730
FT                   /db_xref="GI:72388057"
FT                   /db_xref="GeneID:3656836"
FT                   /locus_tag="Tb927.4.3030"
FT                   /transcript_id="XM_839360.1"
FT   CDS_pept        803315..804730
FT                   /locus_tag="Tb927.4.3030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388058"
FT                   /db_xref="GeneID:3656836"
FT                   /translation="MTDGNPGEDAIRKVIVSASPHCDLLHFVGHVPHPYGVITPQTMME
FT                   KNAECVKFSLTPLEREPSVTVSGNHPLFAPVVIPRVKATSSAPAAASEAGMSPYFPHSG
FT                   VGLAQSAFRSNFETFSWGVVSSDEQRQQNYQSQRHKVTERGDHQVQQQPAHNEAETPNP
FT                   DAVGEQAFIPTVTDSSSRLVNTSRIGGEIRYEVNFLAVRRSLLQVFLILHMPERSPAVA
FT                   FRFCSHDPLPGGTTCLSVLPRCAERLPTLAHPAEVTFTDVQATAHWKYSLRCDCRIIQE
FT                   GEEASVAEGKSQRFISMRWTTGGTPERTLELSALLTEVMTPMLFAVPAKLLKSTEERGK
FT                   TTPQITGFFQRRSFHLMALIAHGVWCEKVARYIINESNRSGLVALCAETCSAKLKLRDD
FT                   VSLDANEKWETELTFHRTESCDCTTTERSVQKPKPSKCLHVLVRGCEDVMGWGWGTAST
FT                   RSGLQDLAEAVTR"
FT                   /protein_id="XP_844453.1"
FT   repeat_region   804921..804947
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(804921..804947)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <805021..>805638
FT                   /note="synonym: Tb04.2H8.810; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656831"
FT                   /locus_tag="Tb927.4.3040"
FT   mRNA            <805021..>805638
FT                   /db_xref="GI:72388059"
FT                   /db_xref="GeneID:3656831"
FT                   /locus_tag="Tb927.4.3040"
FT                   /transcript_id="XM_839361.1"
FT   CDS_pept        805021..805638
FT                   /locus_tag="Tb927.4.3040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388060"
FT                   /db_xref="GeneID:3656831"
FT                   /translation="MRRSVCLLLLSLVMHANGNFFGISLENRCQPLSSLKGVNRAILNK
FT                   SGEEYKESDELFCERGAPEQFKCNCGVATTCLSKKDPWGNNIGVCGCCPPWLFLFYTFF
FT                   TIIVGFAIASAFYICCCRGKWWFDGYPKAIIPAFSRRGPGTVVPAAVPLPPTLFRGYRT
FT                   TDFVNDTAATRPVVDGESAGTRTQREGASSLWNNDQIVDDEP"
FT                   /protein_id="XP_844454.1"
FT   misc_feature    805663..805697
FT                   /note="GA-rich"
FT   misc_feature    complement(805663..805697)
FT                   /note="CT-rich"
FT   misc_feature    805748..805814
FT                   /note="A-rich"
FT   misc_feature    complement(805748..805814)
FT                   /note="T-rich"
FT   repeat_region   806040..806073
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(806040..806073)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   806266..806301
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(806266..806301)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   806421..806499
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(806421..806499)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   806512..806538
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gggaga"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(806512..806538)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tctccc"
FT                   /rpt_type="tandem"
FT   repeat_region   806612..806634
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tccc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(806612..806634)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ggga"
FT                   /rpt_type="tandem"
FT   misc_feature    807084..807124
FT                   /note="T-rich"
FT   misc_feature    complement(807084..807124)
FT                   /note="A-rich"
FT   repeat_region   808187..808221
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(808187..808221)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <809336..>809800
FT                   /note="synonym: Tb04.2H8.740; hypothetical protein"
FT                   /db_xref="GeneID:3656834"
FT                   /locus_tag="Tb927.4.3050"
FT   mRNA            <809336..>809800
FT                   /db_xref="GI:72388061"
FT                   /db_xref="GeneID:3656834"
FT                   /locus_tag="Tb927.4.3050"
FT                   /transcript_id="XM_839362.1"
FT   CDS_pept        809336..809800
FT                   /locus_tag="Tb927.4.3050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72388062"
FT                   /db_xref="GeneID:3656834"
FT                   /translation="MTTQTGGKNHPPVFFFRLPVRLRLLPWSNDDMNHSHWVTTGRNLH
FT                   LHTQRCLLTAVMHENYNTNQKKMTGIARTCSSACRHGSNNEKKKHVHPLTFFLFTTNSS
FT                   PCFRHLRTARRHACSPERTIYWLEYERISDLPIEEQEKRGATTFVAYTLF"
FT                   /protein_id="XP_844455.1"
FT   gene            <810076..>810522
FT                   /note="synonym: Tb04.2H8.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656835"
FT                   /locus_tag="Tb927.4.3060"
FT   mRNA            <810076..>810522
FT                   /db_xref="GI:72388063"
FT                   /db_xref="GeneID:3656835"
FT                   /locus_tag="Tb927.4.3060"
FT                   /transcript_id="XM_839363.1"
FT   CDS_pept        810076..810522
FT                   /locus_tag="Tb927.4.3060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388064"
FT                   /db_xref="GeneID:3656835"
FT                   /translation="MEIIDRPLSEIIKEQNIAQSLRRNRRGGKGNQQRRPRGGARGAVT
FT                   GGNRGVSRPRRGLGRDRFREVDRRRLLSRRPDGPFRRFRPSYGRVLERRRNAVDYGDVR
FT                   SRRSVKSTDYLRERRLSGSERNERLRYQRRREELSRVRSRFSRD"
FT                   /protein_id="XP_844456.1"
FT   gene            <812413..>813759
FT                   /note="synonym: Tb04.2H8.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656828"
FT                   /locus_tag="Tb927.4.3070"
FT   mRNA            <812413..>813759
FT                   /db_xref="GI:72388065"
FT                   /db_xref="GeneID:3656828"
FT                   /locus_tag="Tb927.4.3070"
FT                   /transcript_id="XM_839364.1"
FT   CDS_pept        812413..813759
FT                   /locus_tag="Tb927.4.3070"
FT                   /gene_family="HOG000260275" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388066"
FT                   /db_xref="GeneID:3656828"
FT                   /translation="MLRHTCRRLLLNVSGESPSFRAKPIRNLQMDVQMSPYKEQFKDYW
FT                   STPVPWADREYGEKPKLGAPVPTRRAATAVVIGMNRHADMAKVERGEDNDYKVLMMYRE
FT                   GKSRFVRDQFILPSMPVSLEDSSEDWEKILRRRGVKTQWTDLHHRLCAMRALFAQMNIL
FT                   LIPKEGGGLAEVEGPPGPKKWHLLVHSNPKAMKNLVDVLELPMETCLSQLLPFRSITTP
FT                   TTETFRFCNLNYLVPFEKVPDVRFTISTLGEKLVWVSPMEAMARFNAGIMNMPTPSLIL
FT                   LSELNNECPTFADVMKRKPHDSYRDVLPELFRHNQTKVATILLPGDLQHTSTTEEDKAQ
FT                   QYVRRFVYEKDYPFGVRAVFEERPATVEESAGPLEQEMPKLLEEANEMDMVYAEVPYPK
FT                   REKRPEEIGRTAFAVPNYTFQEGVENADGVIPVKKRNIGSVGDLYSHTK"
FT                   /protein_id="XP_844457.1"
FT   gene            <814322..>814819
FT                   /note="synonym: Tb04.2H8.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656830"
FT                   /locus_tag="Tb927.4.3080"
FT   mRNA            <814322..>814819
FT                   /db_xref="GI:72388067"
FT                   /db_xref="GeneID:3656830"
FT                   /locus_tag="Tb927.4.3080"
FT                   /transcript_id="XM_839365.1"
FT   CDS_pept        814322..814819
FT                   /locus_tag="Tb927.4.3080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388068"
FT                   /db_xref="GeneID:3656830"
FT                   /translation="MKVSSFIVQLRPGFFRLMIHAKPGARSTALAAQPQALDEALEVRL
FT                   AAPPVDGKANTELVEFMQTLLEQQLATLRITQKQHLRKSGCEDGEDEVYTYEHYAKKKK
FT                   SKNNKRMNEDSKSGEAKVEYPDDKVRVSLVSGLTSRNKVLEVTFPGTEEDLLAVLKSAD
FT                   FS"
FT                   /protein_id="XP_844458.1"
FT   repeat_region   814882..814918
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(814882..814918)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <815515..>816213
FT                   /note="synonym: Tb04.2H8.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656829"
FT                   /locus_tag="Tb927.4.3090"
FT   mRNA            <815515..>816213
FT                   /db_xref="GI:72388069"
FT                   /db_xref="GeneID:3656829"
FT                   /locus_tag="Tb927.4.3090"
FT                   /transcript_id="XM_839366.1"
FT   CDS_pept        815515..816213
FT                   /locus_tag="Tb927.4.3090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388070"
FT                   /db_xref="GeneID:3656829"
FT                   /translation="MHPFYTIRYPPSKGSNESQPILVTDTAIEPLFFCIVYSIEFQCPV
FT                   QTTESRTANSRSSSFPFGGRASGSGGKREANELHVCPVENTSKLLGNVTYVSCLDHNPT
FT                   LLASLQTAVDAARAIPIPEDEQKVPLQLCVRLLHKQTRWLWEESRPLVEWTFKIVKTRG
FT                   LSYAAVPEASSGASARNTNVEFVHASGPAQIREVLQFILKHSYEAIDLNTFSDFKSGEL
FT                   VFEVFVDQAR"
FT                   /protein_id="XP_844459.1"
FT   gene            <817233..>818327
FT                   /note="synonym: Tb04.2H8.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656839"
FT                   /locus_tag="Tb927.4.3100"
FT   mRNA            <817233..>818327
FT                   /db_xref="GI:72388071"
FT                   /db_xref="GeneID:3656839"
FT                   /locus_tag="Tb927.4.3100"
FT                   /transcript_id="XM_839367.1"
FT   CDS_pept        817233..818327
FT                   /locus_tag="Tb927.4.3100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388072"
FT                   /db_xref="GeneID:3656839"
FT                   /translation="MPLCVPLLQNVLAWYGDELSISLALLSTSPSVRFFCERHAEPPLR
FT                   ILAGTWTVQCRTDGPRFITHNVGIKVADALGADVFSSMAWWCNRIVTSSSGRGREPVQL
FT                   HLNLNGARCSVEQVLQGALAFRTLVELSLRRVSIKDVNVLGKMPSLQKLDLVEASVADS
FT                   GIVGLGDSNSLVSINLWGCEDIADVSVLGKIPTLRELVVAETKVTDCGTAGLVDCVNLR
FT                   ELNMEACPSITCVGAVSELPVLQRLLLVTTAVTSAGIASLGNSRSLVEIDLWGCRGVDS
FT                   VNTLGKIPTLRRLDLFGTSVTNEGIIELGCSQSLEEVDLTFCEAISDVGTLVAVPTLQR
FT                   LILLHTSVEEGACRQFSKRVSIAI"
FT                   /protein_id="XP_844460.1"
FT   gene            <818647..>819906
FT                   /note="synonym: Tb04.2H8.610; tRNA-dihydrouridine synthase
FT                   4, putative"
FT                   /db_xref="GeneID:3656840"
FT                   /locus_tag="Tb927.4.3110"
FT   mRNA            <818647..>819906
FT                   /db_xref="GI:72388073"
FT                   /db_xref="GeneID:3656840"
FT                   /locus_tag="Tb927.4.3110"
FT                   /transcript_id="XM_839368.1"
FT   CDS_pept        818647..819906
FT                   /locus_tag="Tb927.4.3110"
FT                   /gene_family="HOG000260272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA-dihydrouridine synthase 4, putative"
FT                   /note="similar to tRNA-dihydrouridine synthase 4 (DUS4) (EC
FT                   1.-.-.-) (Swiss-Prot:Q06063) [Saccharomyces cerevisiae];
FT                   go_function: tRNA dihydrouridine synthase activity [goid
FT                   0017150]; go_function: FAD binding [goid 0050660];
FT                   go_process: tRNA modification [goid 0006400]"
FT                   /db_xref="GI:72388074"
FT                   /db_xref="GeneID:3656840"
FT                   /translation="MSGVEPEPRARTDLASMLKEAQSAILRLVKEAPELRDATIEPSQY
FT                   EWACQRMEKAYGSILKIQAPMVRCSRPAFRKLCRLWGTDISYTHMIMADSFACSEAARQ
FT                   AEFSIYSGETRLITQLASSSGPTAATAAAIVAPWCDAIDLNCGCPQRRVMADGLGAALL
FT                   RNPEVVADTVRCVRNALEGGVELPCVVKMRVKDDVRLSVDFARQCEAAGAAWITVHGRT
FT                   PNCSAHAPVRFDAINTIREALGVPVVANGGVRDPSTALQAALTAGVGGVMSGMGLLANP
FT                   ACFYVPGADEKFHFEPQHIAYGTGSCPWESGSEVREEHIDARKRCLSTGHSGGERDAKT
FT                   VWPKGFSHCPLEVLSDFIRLSCVTDLGSKATSMHLLKMGGNYLSPVERTFIAEMHSSFS
FT                   VIAAFQQLGLYVREGRFQVE"
FT                   /protein_id="XP_844461.1"
FT   gene            <820474..>823275
FT                   /note="synonym: Tb04.2H8.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656841"
FT                   /locus_tag="Tb927.4.3120"
FT   mRNA            <820474..>823275
FT                   /db_xref="GI:72388075"
FT                   /db_xref="GeneID:3656841"
FT                   /locus_tag="Tb927.4.3120"
FT                   /transcript_id="XM_839369.1"
FT   CDS_pept        820474..823275
FT                   /locus_tag="Tb927.4.3120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388076"
FT                   /db_xref="GeneID:3656841"
FT                   /translation="MEIEGHETEAMPTATKYDPTECGRTEGSHITQINVTVQGRGRPPT
FT                   VPEGASVEKPKSILKNTTGTSTTSAEASRKRTVRFGGSDTFEAAPYFSTPESNSEEGSV
FT                   DSRGGGDNIGAAAAPRAGKERHDDDDDQLETGSNTSEPTSPRLGAIGWVPLAVQRPPAG
FT                   EHRKGKQGNKPTEGKRNEMASWEMPSTHQGGKGKGEGSLLDVSVSESTLSPGSEKSLIA
FT                   AADDENNIEKHRKDVKAVDLVAKSRTSGKPPRGEVLTVTGLSLDKIPIQESRGTDYKEN
FT                   STDDLPRLFYPTPRPQKDFNNAEEEKPPLRHRDSHTDGDDGDKPGTVSAELLDHLQRKS
FT                   GVGDLLNPEGGVDPQHLMFDDNLAPPARRKGSVASHTNHDDYDRLIHPSIRLFPDLPPP
FT                   IAASDSEPSVIVEVMAIEQANADNAEVGISRSGNHQQAGWMSSSVKATFEGPNTISPIG
FT                   TGYVFNSSGAGVDTCVSNTENGWSAVLNATPLKIGGGSKNVVHRKNSNTGFDLKSDFLM
FT                   SSVQTESETIRGEHRPNVAKPVDVQTVSCATEMWREVLNNDEEYTMQSSKAGRYLPGDF
FT                   FEGVQASMGNDATNKGIRKGSASKSASLLPIRGMEIVRPTKPQGESTRKTSVYRKSRSV
FT                   ERRKTEKEQPKVLAVEVVAGAESRSALDESTNPREPQAAARATTSSKERSLCVVQPCGG
FT                   KVSASELSALASTQLMSKDTSLSEDCASRLRKKWGVTPKKAEKEDDEEERIRRAERFER
FT                   INLALLKLEVCRKNNHSSHDTRGWASPTSDLDSRYETKPWTQAYSPSGATTDTLDNGYT
FT                   SSIDPPRSKYWDREMAGGTSKRHNSRPRSLFPPPHSPVKTSADPPVDGLIYTPAKTASA
FT                   RSASWMFERSPDEDRYNSYFMDANSRLQELRVCDSMAAKNFARDLSSLASAVRGSELFS
FT                   MIS"
FT                   /protein_id="XP_844462.1"
FT   repeat_region   824030..824059
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(824030..824059)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <824258..>825085
FT                   /note="synonym: Tb04.2H8.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656837"
FT                   /locus_tag="Tb927.4.3130"
FT   mRNA            <824258..>825085
FT                   /db_xref="GI:72388077"
FT                   /db_xref="GeneID:3656837"
FT                   /locus_tag="Tb927.4.3130"
FT                   /transcript_id="XM_839370.1"
FT   CDS_pept        824258..825085
FT                   /locus_tag="Tb927.4.3130"
FT                   /gene_family="HOG000231709" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388078"
FT                   /db_xref="GeneID:3656837"
FT                   /translation="MSVPLTEEDLHDLYVWVDEIPISRPKRNITRDFSDGCCVAEVMKF
FT                   FFPKLVELHNYVPAMSQSKKIENWNTLNNRVFRKLHFEVARDEISDITAGVPGAIERFL
FT                   RALRTKISEIKARREELAAAEALTGVPGTGLSPSRFRYGARHADRAGTAGSTLSAHDRN
FT                   VENEAERGQRGGSKVGVTSGYANTQGRSNAAPNVKSGFDQRNGSARTSGSVDDGIDSRT
FT                   AASLRQLFDEKDRTIAELRETVGLLSEKVMKLEELVRLKDNKLHDYRSTFGHM"
FT                   /protein_id="XP_844463.1"
FT   gene            <825953..>827359
FT                   /note="synonym: Tb04.2H8.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656843"
FT                   /locus_tag="Tb927.4.3140"
FT   mRNA            <825953..>827359
FT                   /db_xref="GI:72388079"
FT                   /db_xref="GeneID:3656843"
FT                   /locus_tag="Tb927.4.3140"
FT                   /transcript_id="XM_839371.1"
FT   CDS_pept        825953..827359
FT                   /locus_tag="Tb927.4.3140"
FT                   /gene_family="HOG000260271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388080"
FT                   /db_xref="GeneID:3656843"
FT                   /translation="MSARMQVPLSQRRHTNVAAVRYTKNGHKLEIACYKNKVISYRNGV
FT                   ETRLDEVLQIDRVFTNISRGLFASEKDIQAVFGKGTTEEDALKYILVHGELQVAQHERE
FT                   VEVNQMFTDIALIISQKCVNEVTQRPFPAQVIEQALRSIGAAVRLDQPAKKQALALIHR
FT                   LMDAQIIPIARAPMKLRCTTVDEQSLKKVTEWCESNRATILEEPGETCQDETVHGAGKY
FT                   SLLILLQPHLFRDLEIFVKDELPHGATVHMIDSVAMDVGEVDVMDADLIARANAHTNAA
FT                   DKSVGGGGGSHQTGSSSNPTQCLNNNNKGGKKGGKSGRKQKNAKYSLQKNDDTPQEEQG
FT                   TPLTADLSSTGPGVVDDKEISDVKTALSKLGLDNPCALDDHDDDDKNKRGKKKAKRRQG
FT                   AQQQSQQPASSKKEVEVEAQEDSDEEVLVNRKQRKMAAVKAKDISNNHDCDFDDEYNYE
FT                   YDMEEGVGEE"
FT                   /protein_id="XP_844464.1"
FT   repeat_region   827781..827805
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(827781..827805)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <827846..>828877
FT                   /note="synonym: Tb04.2H8.560; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656838"
FT                   /locus_tag="Tb927.4.3150"
FT   mRNA            <827846..>828877
FT                   /db_xref="GI:72388081"
FT                   /db_xref="GeneID:3656838"
FT                   /locus_tag="Tb927.4.3150"
FT                   /transcript_id="XM_839372.1"
FT   CDS_pept        827846..828877
FT                   /locus_tag="Tb927.4.3150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388082"
FT                   /db_xref="GeneID:3656838"
FT                   /translation="MWNAFSGFQPPKLRDGNGGWGSGRPYRPMRVGGQPYHKERFGAPS
FT                   YPQTQGGYQHHGNLDPMNRSYSRHTPQAAHRIRQPNIDEPFAWKAFMRRSTEGAIYRGT
FT                   TQLEGSQRTKESGETTSPNGLARHIDGEAWNAYWGEYSDHFASRIDDVQEHLSKGERYN
FT                   GKRCVRVATPIPKDSLMESFKSRMIDYARHFGAIECVTRDGGVVGVQFTTHRSAELFAV
FT                   WAASMTFVEILGDTVKPDEVNGPVEMVVRLAPHDPNRLTTTLRLGDNIVLSTAFVEGLF
FT                   KGIFDAEDIKFHAGAFQITFGSVQAAKVALHSVQRHLFDGFGLLLTFSEVPLGAGPLMP
FT                   HAK"
FT                   /protein_id="XP_844465.1"
FT   gene            <829752..>833480
FT                   /note="synonym: Tb04.2H8.550; dihydroxyacetone phosphate
FT                   acyltransferase, putative"
FT                   /db_xref="GeneID:3656842"
FT                   /locus_tag="Tb927.4.3160"
FT   mRNA            <829752..>833480
FT                   /db_xref="GI:72388083"
FT                   /db_xref="GeneID:3656842"
FT                   /locus_tag="Tb927.4.3160"
FT                   /transcript_id="XM_839373.1"
FT   CDS_pept        829752..833480
FT                   /locus_tag="Tb927.4.3160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroxyacetone phosphate acyltransferase,
FT                   putative"
FT                   /EC_number="2.3.1.42"
FT                   /note="similar to Dihydroxyacetone phosphate
FT                   acyltransferase (EC 2.3.1.42) (DHAP-AT)(DAP-AT)
FT                   (Glycerone-phosphate O-acyltransferase)
FT                   (Acyl-CoA:dihydroxyacetonephosphateacyltransferase).
FT                   (Swiss-Prot:O15228) [Homo sapiens]; go_component:
FT                   mitochondrion [goid 0005739]; go_function: acyltransferase
FT                   activity [goid 0008415]; go_process: fatty acid metabolism
FT                   [goid 0006631]"
FT                   /db_xref="GI:72388084"
FT                   /db_xref="GeneID:3656842"
FT                   /translation="MKQGNGATHSIPHNVPFRRIVILSDYGSPWLNAVTAVTCATLPCL
FT                   SALSNGWCEKRGNVVVASKLDSPRVLIPAEAGVAPDGTSCSSLSSLSAVCRDLADGRNI
FT                   ASRIFFTADAASNPRAQTFAPSVEDDLFVYVSAWSGEKDAAHLALRSLSNMFGATSFGI
FT                   GASGVLTGPCGVPRLIILADESTRNSVCETARHLSNWCVLSCIVPSFAPPAFNHQLAAS
FT                   VVRECDVVCGVLECVALGVALGTVKRLPFGFMDPVCVMPLDAAISTALIAFLQRLKGGP
FT                   AAVCGGTSATIIIGSPSDSAFVWGMFAQYLMDYYGRVGLLALKESQLRWLFDTSPALQL
FT                   NADFMNWVNYGTSTMMPFRCYYDNAAARRRKQLMEHYPHSNVARKVCGTLTNIDTRIHN
FT                   MVKLTQHSEPTGQHDGERVNKQGKPNTAGFYSDLLRAVEQDAALRPLYPYISLSCIRWD
FT                   VFVKVIAQSVLEHAARQIAGHPTVVPPPLPLYHNDIIFYGPQRAPRNCLLTRFFPESVR
FT                   WAQRSGLRPNGVLVAAEPGLTEESLACILQRPSIIQVVKKTAKAEGVTEEDVLRRATAI
FT                   LRGMGDNLNQLNVRVFGLMVRKALFRLFDRVSLNASAFERLHAATTQPRTHVMLLPAHR
FT                   SYIDFIIMTYLLLVMGLTLPHVCAGDDFLRMGQITKLMRGSGAFFIRRTFRDDPLYTAL
FT                   FKEYIHNLVLRKQMIEFFIEGTRSRTGKTQRPMLGVLKFIADTLVNAQEAIDDVCILPV
FT                   SLSYDELLETKLYAAEQLGLSKPRESVGNLVRASSVLSRRHGKIHVHVAEPLSLRSFCH
FT                   NPSQCPEGFEPVTGGVTAAAPNKSSDGEGARSPSHIPKQVLTNIAWHVTHTLQDNTIIT
FT                   PTALLAAVLGTLSPPAGCMSLREAQAKMLWLRDHIIRRRAHVSEDCVNNNGEELSRMAL
FT                   FHLAEFVETRVEAGETWVAMRQDSRAPLGVAICSNQLIHVFVDEGVVALVARASGELSD
FT                   NKKTARVSTDLLKRECELLRTLLAGEFQDYLPWCPYTYASWFKYAVTRLLAHDDIHNDG
FT                   TVTLEGGGSAESTNKVKKGGTYAVASEPRLHDSEDIVIHFTRRFRFITGILYPFVESLY
FT                   VVSVAVAAVAETHVEHLLRRRPLLLACQKWALELCNEKRLVVHIQSCGSVALKSAFTSI
FT                   MEFIGLKSRTEEKDLVYILPIPPNGLETQLQPVTEQLKKLLRPLIEVKEEEEREARNHM
FT                   VNVYKKIQMSSKRASRM"
FT                   /protein_id="XP_844466.1"
FT   misc_feature    833494..833515
FT                   /note="AT_rich"
FT   misc_feature    complement(833494..833515)
FT                   /note="AT_rich"
FT   repeat_region   833551..833586
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tgaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(833551..833586)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttca"
FT                   /rpt_type="tandem"
FT   misc_feature    833699..833803
FT                   /note="T-rich"
FT   misc_feature    complement(833699..833803)
FT                   /note="A-rich"
FT   repeat_region   833894..833955
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(833894..833955)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   834140..834186
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(834140..834186)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    834699..834738
FT                   /note="GA-rich"
FT   misc_feature    complement(834699..834738)
FT                   /note="CT-rich"
FT   repeat_region   834964..834990
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(834964..834990)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaa"
FT                   /rpt_type="tandem"
FT   gene            <835158..>837848
FT                   /note="synonym: Tb04.2H8.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656844"
FT                   /locus_tag="Tb927.4.3170"
FT   mRNA            <835158..>837848
FT                   /db_xref="GI:72388085"
FT                   /db_xref="GeneID:3656844"
FT                   /locus_tag="Tb927.4.3170"
FT                   /transcript_id="XM_839374.1"
FT   CDS_pept        835158..837848
FT                   /locus_tag="Tb927.4.3170"
FT                   /gene_family="HOG000260260" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388086"
FT                   /db_xref="GeneID:3656844"
FT                   /translation="MQGDTKTMGKKKTVSSLNETRERRRLDIGKVRDVWNTFQTAMWHV
FT                   CLPNELVMCFDPLLRCIFALYYLPPVALVVAITHSALARIVWVLVTPVAQEMEKQPYDA
FT                   SRIVTLALGLYQIIICMLPFTTLSIAVATLGHKALNCFMESMVDSWCTYEQRDYPLLAA
FT                   RLRFMMEDRWRCCTFLVVLFLLGTLVLSGFHTDLLVAWPDREGNVALNVWLIIFIDLTF
FT                   VVVSAFTCSPPGLRLLNSKKDTADGKDGSFLEYFFDTWWRKRVFYIRYATGYMVIALGV
FT                   FTTYHDGPLRALSMLLETLMYLLIPHVMVHAVLSISIVAVNFHRSVRWLSHHRAAVPHT
FT                   IAFILPYEGVLLYSMYYFRHHWMTVCLLVGVSVLLIYRSIDIAREFEVTEAGSVLWKRE
FT                   DDGTVAPPDLAKVLEEAHENKSRHLNTVSLGVSGDMERMRLISDGKEIPLQRVVIERIG
FT                   ESRSLSKKAVFLAYAFPRVLHAQKPNYLGGKHFRTGRLLLRTITSILLTFFALLVAGVI
FT                   LQAAFPELRKWPVRLRISEGGEILTIDHIVVRMHLLSRNASANPLSPPVTSAMTPAHAA
FT                   FQWGNTTAFNTDWYASLCAREFHGASVWEVSLLALATYLSTEEEVRQMLHFMNTHMETD
FT                   WIMRERHGMDCVAVDSSTKPTEWNGYFDFYSAKHDLSVVAIRGTDMTSAIDFLIDFNMF
FT                   FEVVLYHLLSNFVPGAGILPSHLIADLIGLASLRSDGNFQYGTWESLIAESKADDKNNK
FT                   LQCVSNNYRRDFFADVYNHIRYIGSRSKRPKHVILTGHSLGGAVASIVGAKMGIQAVGF
FT                   GAPGITLARKKFNVDLRSINKHVGNIISSHDIFPMIGGNVGEQHRIECLATTRELCHAM
FT                   EFLVGALWRSCGSIRSRFPSMGSVL"
FT                   /protein_id="XP_844467.1"
FT   repeat_region   837911..837946
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(837911..837946)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   838532..838569
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(838532..838569)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   838771..838811
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(838771..838811)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   838970..838994
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(838970..838994)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   gene            <839374..>840021
FT                   /note="synonym: Tb04.2H8.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656847"
FT                   /locus_tag="Tb927.4.3180"
FT   mRNA            <839374..>840021
FT                   /db_xref="GI:72388087"
FT                   /db_xref="GeneID:3656847"
FT                   /locus_tag="Tb927.4.3180"
FT                   /transcript_id="XM_839375.1"
FT   CDS_pept        839374..840021
FT                   /locus_tag="Tb927.4.3180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388088"
FT                   /db_xref="GeneID:3656847"
FT                   /translation="MSTTGSWTIERSDGVIVKIDKPNVSFRFGRGKELPPGQQLNDKYI
FT                   SRNHISFECKSSSLFAKQSGRNPTFYSAAFRQVPRAGLEFRPADANKTSAAQPDGSGNK
FT                   NEENIVFVPCGNEKTNQVVISSSGNEIELCTLHFPEELRLPKLTVRYTPPRIEKVDHMP
FT                   RGVPAVPLVFPKDDDDDDDDDNNNNNNSHGSTPPAWRGILDAVLQSNKGSDS"
FT                   /protein_id="XP_844468.1"
FT   repeat_region   839899..839924
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(839899..839924)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   repeat_region   840514..840551
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(840514..840551)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   gene            <840584..>841246
FT                   /note="synonym: Tb04.2H8.480; ubiquitin-conjugating enzyme
FT                   E2, putative"
FT                   /db_xref="GeneID:3656845"
FT                   /locus_tag="Tb927.4.3190"
FT   mRNA            <840584..>841246
FT                   /db_xref="GI:72388089"
FT                   /db_xref="GeneID:3656845"
FT                   /locus_tag="Tb927.4.3190"
FT                   /transcript_id="XM_839376.1"
FT   CDS_pept        840584..841246
FT                   /locus_tag="Tb927.4.3190"
FT                   /gene_family="HOG000170329" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="go_component: endoplasmic reticulum membrane [goid
FT                   0005789]; go_component: integral to membrane [goid
FT                   0016021]; go_function: ubiquitin conjugating enzyme
FT                   activity [goid 0004840]; go_process: protein modification
FT                   [goid 0006464]; go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72388090"
FT                   /db_xref="GeneID:3656845"
FT                   /translation="MPAPPAASGVRRLQKELRDITLDPPPYCNAAPSSESIFTWYFTLD
FT                   GLPQTPYEGGRYVGELRFPPEYPMKAPKIIMLTPSGRFVINSPICLTITDFHPEEWSPM
FT                   WGVRTIITGLLSFMVSEESGLGGMTATAESRRALAAESHRYNVERVPVYKELFNSEYQK
FT                   DLKKLNEEAEALRKNCGDVSEHLGNKTTNAGRAQLRGIVASIVVLVALAVGLLVLRN"
FT                   /protein_id="XP_844469.1"
FT   gene            complement(842652..842725)
FT                   /db_xref="GeneID:3656846"
FT                   /locus_tag="Tb927.4.3193"
FT   tRNA            complement(842652..842725)
FT                   /db_xref="GeneID:3656846"
FT                   /locus_tag="Tb927.4.3193"
FT                   /product="tRNA-Val"
FT   gene            complement(842789..842868)
FT                   /db_xref="GeneID:3656850"
FT                   /locus_tag="Tb927.4.3196"
FT   tRNA            complement(842789..842868)
FT                   /db_xref="GeneID:3656850"
FT                   /locus_tag="Tb927.4.3196"
FT                   /product="tRNA-Leu"
FT   gene            complement(842927..842999)
FT                   /db_xref="GeneID:3656849"
FT                   /locus_tag="Tb927.4.3199"
FT   tRNA            complement(842927..842999)
FT                   /db_xref="GeneID:3656849"
FT                   /locus_tag="Tb927.4.3199"
FT                   /product="tRNA-Met"
FT   misc_feature    845616..845637
FT                   /note="AT_rich"
FT   misc_feature    complement(845616..845637)
FT                   /note="AT_rich"
FT   gene            complement(<847180..>848109)
FT                   /note="synonym: Tb04.2H8.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656852"
FT                   /locus_tag="Tb927.4.3200"
FT   mRNA            complement(<847180..>848109)
FT                   /db_xref="GI:72388091"
FT                   /db_xref="GeneID:3656852"
FT                   /locus_tag="Tb927.4.3200"
FT                   /transcript_id="XM_839377.1"
FT   CDS_pept        complement(847180..848109)
FT                   /locus_tag="Tb927.4.3200"
FT                   /gene_family="HOG000137476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388092"
FT                   /db_xref="GeneID:3656852"
FT                   /translation="MVRIVPVVFAAISVVLVDSRMQETDKEALSTLKQIDCVVKKLNWM
FT                   INVTEDLLLRTRVHAEEVYEKRYSAEEQNAAWRELFLRGKPFMKKEKGDKMKEILNEME
FT                   SVFEGESYLRKKFDLSVSYMEEKAMDVVRTGTRYAATMEEMYRVGSEAVRMLNNSHGFC
FT                   RNNGIQVTCDGTLTGRDVSDIITEFDSSRDEHVDLRFHNGTAYSTGGRKLADRVDSVST
FT                   SHGHIFKHRGIRGNLGRDKVLANRYGLVEDVNVTRVFKSFLPHLKEINDVSSEIEVMLS
FT                   KLSERASRIDTLSDKLHSLFSSLMASSV"
FT                   /protein_id="XP_844470.1"
FT   gene            complement(<848255..>849439)
FT                   /note="synonym: Tb04.2H8.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656848"
FT                   /locus_tag="Tb927.4.3210"
FT   mRNA            complement(<848255..>849439)
FT                   /db_xref="GI:72388093"
FT                   /db_xref="GeneID:3656848"
FT                   /locus_tag="Tb927.4.3210"
FT                   /transcript_id="XM_839378.1"
FT   CDS_pept        complement(848255..849439)
FT                   /locus_tag="Tb927.4.3210"
FT                   /gene_family="HOG000137477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388094"
FT                   /db_xref="GeneID:3656848"
FT                   /translation="MGNKKHMLSKLLFACFVYEGDNMISVGGVVIMFSFLVVACANSGP
FT                   EGDEKGKGKALTQSDANAICSIVRKLRELRNNVTHNMKFGEKIVEDCEKIVAHYSARVR
FT                   TKTILVDVLKEVIPDGGKRVNEVAKLLIETEESLLELKKSIKNMNTSLRAMRLPSWNLL
FT                   NMSDSYAYWIKDMVEVFHHAALGYGNCCLVVDGGATGDCIRGGKRGSVPRDCTVEPPQH
FT                   SEGGLAEYENPLNTELSLTMGNAGDQGADAVYGCYITTTYQPYTKGKKPFINELSGGLF
FT                   YTQNDRLMANFSSIGEEFQELIDLLSASVIKISAGNTSITAQRAVLDRLLLELEEKVRS
FT                   IVKMKERTNELTETLGNAKDSPWNDNYSEDNNGVVKFQQTLPWVALLLCVLVPF"
FT                   /protein_id="XP_844471.1"
FT   gene            complement(<849729..>850658)
FT                   /note="synonym: Tb04.2H8.370; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656853"
FT                   /locus_tag="Tb927.4.3220"
FT   mRNA            complement(<849729..>850658)
FT                   /db_xref="GI:72388095"
FT                   /db_xref="GeneID:3656853"
FT                   /locus_tag="Tb927.4.3220"
FT                   /transcript_id="XM_839379.1"
FT   CDS_pept        complement(849729..850658)
FT                   /locus_tag="Tb927.4.3220"
FT                   /gene_family="HOG000137476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388096"
FT                   /db_xref="GeneID:3656853"
FT                   /translation="MIRILLVMLFVVWVVLAENMSPEADNDESLTTLNQIDCVVKKLNW
FT                   MINVTEDLLLRTRVHAEEVYEKRYSAEERYAAWERLFVYVKPFMKKQKGDKMKEILNEM
FT                   ESVFEGESYLRKKFNLNVSYLEEKVMDVVRTGTRYAATMVEMYRVGLEAVCIVNKSHGY
FT                   CGDNGAYVKCGTTFVGKDISGIVGDFDSDADYMDLSFTGGGFQSHGGNKLADKVNTAST
FT                   SLGLVLKHRGIRNNLGKDNVQTNKLRSVEKVNASELLKLFVTPLREINDIISEIEATPS
FT                   KLLEQTSRIDALEKELQSIFSSITISTA"
FT                   /protein_id="XP_844472.1"
FT   misc_feature    850746..850770
FT                   /note="AT_rich"
FT   misc_feature    complement(850746..850770)
FT                   /note="AT_rich"
FT   gene            complement(<850780..>851970)
FT                   /note="synonym: Tb04.2H8.360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656851"
FT                   /locus_tag="Tb927.4.3230"
FT   mRNA            complement(<850780..>851970)
FT                   /db_xref="GI:72388097"
FT                   /db_xref="GeneID:3656851"
FT                   /locus_tag="Tb927.4.3230"
FT                   /transcript_id="XM_839380.1"
FT   CDS_pept        complement(850780..851970)
FT                   /locus_tag="Tb927.4.3230"
FT                   /gene_family="HOG000137477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to GB:CAB43348.1:  ESAG11 protein
FT                   {Trypanosoma brucei}"
FT                   /db_xref="GI:72388098"
FT                   /db_xref="GeneID:3656851"
FT                   /translation="MGNKKHMLSKLLFACFVYEGDNMISVGGVVIMFSFLVVACANSGP
FT                   EGDEKGKGKALTQSDANAICSIVRKLRELRNNVTHNMKFGEKIVEDCEKIVAHYSARVQ
FT                   TKTILVDVLKEVIPEEDEILTEIIKLLSDMKVLKDELRNLVAQMHSSLGYMRLPSWNLL
FT                   NMSDSYAYWIKDTVESFAHAALSTLSCCLVVDGGATGDCMKNGKRGSVPRDCIVEPLQR
FT                   SEGSLAEYKNPLDEGLTLTMGNAGNYRNYSEYGCYITTTHQSYTSGRKSLIYELSGGLF
FT                   YTQNNNVVANFSSIGEEFQELIDLLSASVIKISAGNTSITAQRAVLDRLLLELEERVRY
FT                   ILEKKETTNELTETLGIVKHIHWNDKESNESDSVARVQQTLLGVALLLLPFVFGNS"
FT                   /protein_id="XP_844473.1"
FT   gene            complement(<852260..>853204)
FT                   /note="synonym: Tb04.2H8.350; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656854"
FT                   /locus_tag="Tb927.4.3240"
FT   mRNA            complement(<852260..>853204)
FT                   /db_xref="GI:72388099"
FT                   /db_xref="GeneID:3656854"
FT                   /locus_tag="Tb927.4.3240"
FT                   /transcript_id="XM_839381.1"
FT   CDS_pept        complement(852260..853204)
FT                   /locus_tag="Tb927.4.3240"
FT                   /gene_family="HOG000137476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388100"
FT                   /db_xref="GeneID:3656854"
FT                   /translation="MIKISQVTVTVVFFVLPYAGRTQVSYREPCFTLKRIDCVVKKLNW
FT                   MINVTEDLLLRTRVHAEEVYGKKYSLEERFTTWKELYVYVKNFVRKEKGDKMKEILNEM
FT                   ESVFEGESYLRKKFNLNVSYLEEKVMDVVRTGTRYAATMVEMYRVGLEAVCIVNKSHGY
FT                   CGDNGAYVKCGTTFVGKDISDVVRVLENSSEHIDLSFQNRKTQKVAQSGHGGSKLADKV
FT                   NAASTSYGHIIKHRGIRSNLGKSKVITNGNGLVEFVHSPRIFKSFITPLREINDIISEI
FT                   EATPSKLLEQTSRIDALEKELQSIFSSITISTA"
FT                   /protein_id="XP_844474.1"
FT   gene            complement(<853338..>854525)
FT                   /note="synonym: Tb04.2H8.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656859"
FT                   /locus_tag="Tb927.4.3250"
FT   mRNA            complement(<853338..>854525)
FT                   /db_xref="GI:72388101"
FT                   /db_xref="GeneID:3656859"
FT                   /locus_tag="Tb927.4.3250"
FT                   /transcript_id="XM_839382.1"
FT   CDS_pept        complement(853338..854525)
FT                   /locus_tag="Tb927.4.3250"
FT                   /gene_family="HOG000137477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388102"
FT                   /db_xref="GeneID:3656859"
FT                   /translation="MGNKKHMLSKLLFACFVYEGDNMISVGGVVIMFSFLVVACANSGP
FT                   EGDEKGKGKALTQSDANAICSIVRKLRELRNNVTHNMKFGEKIVDEAEDVKSYYGAKVM
FT                   SKKMLVSVLEKVMAEEKSSFSGMERILEKMGELRDGLGKTITSMNASLRAMRLPSWNLV
FT                   NISDSYAYWIKDMVDFFHYAAFSPGSCCLVVDGGSMEDCPFDRKRGIVPRDCIVEPPQH
FT                   SEGSLAEYENPLNTELSLTMGNSGNYGKTPNSYGCYITSTAGGFNTKKSFINELSGGLF
FT                   YTQNNNVVANFSSVGKEFQELIDQLNTSISDIFTWNTSITGQRTILHSLLLRFEEEVGD
FT                   ILKRKKRVMDVTKRLGSIEDVSWYDNESYESDGMSKKPNLSEVALLLFVFSVFWK"
FT                   /protein_id="XP_844475.1"
FT   gene            complement(<854814..>855740)
FT                   /note="synonym: Tb04.2H8.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656855"
FT                   /locus_tag="Tb927.4.3260"
FT   mRNA            complement(<854814..>855740)
FT                   /db_xref="GI:72388103"
FT                   /db_xref="GeneID:3656855"
FT                   /locus_tag="Tb927.4.3260"
FT                   /transcript_id="XM_839383.1"
FT   CDS_pept        complement(854814..855740)
FT                   /locus_tag="Tb927.4.3260"
FT                   /gene_family="HOG000137476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388104"
FT                   /db_xref="GeneID:3656855"
FT                   /translation="MMRMIQVVFAVTLVVLVVFWGVIAETTHGDESLSTLKQIDCVVKK
FT                   LNWMINVTEDLLLRARVHAEKVYKKKYLLEERYAAWERLFVYVKPFMKKQKGDKMKEIL
FT                   NEMERIVETESYLQKNFNLNVSYFEKKMMTIVRVGIRYSATMEEMYRVGLEAVRSGKEV
FT                   PKSCEIYEANVTCERAFSGGNLSIIVAEFGSGTEENIDLRFENGGHWSKGGNKLADRVH
FT                   NVSTTFGRVIKHRGIGNSLGKARVLMDERDLVEHVSAAKLLKLFVTHLREVGNLTSEVE
FT                   ATPSKLSERVHKFSILEKKLESLFNSL"
FT                   /protein_id="XP_844476.1"
FT   gene            complement(<855871..>856980)
FT                   /note="synonym: Tb04.2H8.320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656860"
FT                   /locus_tag="Tb927.4.3270"
FT   mRNA            complement(<855871..>856980)
FT                   /db_xref="GI:72388105"
FT                   /db_xref="GeneID:3656860"
FT                   /locus_tag="Tb927.4.3270"
FT                   /transcript_id="XM_839384.1"
FT   CDS_pept        complement(855871..856980)
FT                   /locus_tag="Tb927.4.3270"
FT                   /gene_family="HOG000137477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388106"
FT                   /db_xref="GeneID:3656860"
FT                   /translation="MMPLKRGMVVACLVVVCAYGQAEGDIEGKGKALTQSDADAICNVV
FT                   KQLRELANNVTRNMKLGEKIVDNGENVATYYSTRVEAKKMLVKVLGKLIPEEGEKLSVM
FT                   GKLLSDMEEPIQVLKRSITNVNASLGCMSVQMWNLTNMSDSYAYWVKDMVELFAQTAFG
FT                   SGNCCLVVDGGATGDCIRGGKRGSVPTDCTIYPPQRSEGGLAEYKNPLDEGLTLTMGNA
FT                   GDEGEYPLCGCFITTTNDTYSRGKKSLIYELSGGLFYTQNNRLMANFTFVGKEFQELID
FT                   PLRRVTNNFSAWNTSITRQRAVLDGLLLKLKKEIRHVLEKEKNKAITEALGSTKNIPWF
FT                   GNESGNSDGMGTQPTLRGVSLFLFFLVFF"
FT                   /protein_id="XP_844477.1"
FT   gene            complement(<857093..>858325)
FT                   /note="synonym: Tb04.2H8.310; expression site-associated
FT                   gene (ESAG) protein, putative"
FT                   /db_xref="GeneID:3656862"
FT                   /locus_tag="Tb927.4.3280"
FT   mRNA            complement(<857093..>858325)
FT                   /db_xref="GI:72388107"
FT                   /db_xref="GeneID:3656862"
FT                   /locus_tag="Tb927.4.3280"
FT                   /transcript_id="XM_839385.1"
FT   CDS_pept        complement(857093..858325)
FT                   /locus_tag="Tb927.4.3280"
FT                   /gene_family="HOG000130846" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene (ESAG) protein,
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72388108"
FT                   /db_xref="GeneID:3656862"
FT                   /translation="MKRRGCAGVLLLVALLWGSIRGSQGQQKGVFNITDYQHNTGEFEI
FT                   LCKIYRITQAKVPRPEFRNREKEDEIMKRFEVMVSEARANGKETSVSQKAREGIEKLYK
FT                   RAKAVKGEIDRNRKRAMRESSKAEESMMKAVYGDLVDEAHKTNRPIDDIMETNKSLLFN
FT                   SNESALESCGSNGNETGKTLVNDFFCVCVGEAKDEANSSSYYYNGHSSPCRTYLRRPEK
FT                   NKWTGMSNECALAEEKCEVNSSMTLKDAWQVVKRGCVYRHIASNSKLLKAALEEFDKSV
FT                   NMRQDKFQVEGVFGHVNDTSNETFLCDGHRPGTTCVNYKHTLSHGGIPWHNRLTNATKN
FT                   MEDMEKYESEANSHIYELEDLQHDAEEMFLEYKLGGNIDIWGKAENLDVDTEGDAHFDL
FT                   MVSIFVLLVFS"
FT                   /protein_id="XP_844478.1"
FT   gene            complement(<858436..>859716)
FT                   /note="synonym: Tb04.2H8.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656858"
FT                   /locus_tag="Tb927.4.3290"
FT   mRNA            complement(<858436..>859716)
FT                   /db_xref="GI:72388109"
FT                   /db_xref="GeneID:3656858"
FT                   /locus_tag="Tb927.4.3290"
FT                   /transcript_id="XM_839386.1"
FT   CDS_pept        complement(858436..859716)
FT                   /locus_tag="Tb927.4.3290"
FT                   /gene_family="HOG000130847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to PIR:S48172:  variable surface
FT                   glycoprotein (clone BENat 1){Trypanosoma congolense}"
FT                   /db_xref="GI:72388110"
FT                   /db_xref="GeneID:3656858"
FT                   /translation="MKEIIVTFLLTAFGAFHLVCGEDSKLVNEKEFNQMCEILRLAEGE
FT                   PEKIMEEPANLTSIIDRLQMFVKATYVKDSLYKEAMERRKGTVNNSGAAKMSMHRANDI
FT                   IRWRVTHEKLIKLAEKATILVSGIREERRLANVSRKFALERMAQVVYGANAGRLMEKEE
FT                   FEKFAVHTGDTLIGNSAEETCGAGYHPSTEDAMAGRSLVGDFFCLCVGEENNETVCHKS
FT                   IKGPGRKKLWKNVSYDGSDVAFGPGWFKIKDEACPKNENLKLITPEKIQDAVREFNKLL
FT                   GRQRENIIMNMKESEGFRTYVFGRAKKIHTGVFDRSENICTGKNDQMCVNYAYRLLTQK
FT                   GIEWQLRLLDAEKYLVEMERHNKEAKVLLGRLWKLAENMKSAAAKINLNLEHLMMESEV
FT                   NEVEEDGAGFSISLTVLAMMALTAFVA"
FT                   /protein_id="XP_844479.1"
FT   gene            complement(860615..860686)
FT                   /db_xref="GeneID:3656861"
FT                   /locus_tag="Tb927.4.3292"
FT   tRNA            complement(860615..860686)
FT                   /db_xref="GeneID:3656861"
FT                   /locus_tag="Tb927.4.3292"
FT                   /product="tRNA-Glu"
FT   gene            860774..860846
FT                   /db_xref="GeneID:3656856"
FT                   /locus_tag="Tb927.4.3294"
FT   tRNA            860774..860846
FT                   /db_xref="GeneID:3656856"
FT                   /locus_tag="Tb927.4.3294"
FT                   /product="tRNA-Met"
FT   gene            complement(860890..860970)
FT                   /db_xref="GeneID:3656857"
FT                   /locus_tag="Tb927.4.3296"
FT   tRNA            complement(860890..860970)
FT                   /db_xref="GeneID:3656857"
FT                   /locus_tag="Tb927.4.3296"
FT                   /product="tRNA-Ser"
FT   gene            861087..861160
FT                   /db_xref="GeneID:3656865"
FT                   /locus_tag="Tb927.4.3298"
FT   tRNA            861087..861160
FT                   /db_xref="GeneID:3656865"
FT                   /locus_tag="Tb927.4.3298"
FT                   /product="tRNA-Val"
FT   misc_feature    862375..862408
FT                   /note="AT_rich"
FT   misc_feature    complement(862375..862408)
FT                   /note="AT_rich"
FT   gene            complement(<862494..>864653)
FT                   /note="synonym: Tb04.2H8.240; mitochondrial ATP-dependent
FT                   zinc metallopeptidase, putative"
FT                   /db_xref="GeneID:3656863"
FT                   /locus_tag="Tb927.4.3300"
FT   mRNA            complement(<862494..>864653)
FT                   /db_xref="GI:72388111"
FT                   /db_xref="GeneID:3656863"
FT                   /locus_tag="Tb927.4.3300"
FT                   /transcript_id="XM_839387.1"
FT   CDS_pept        complement(862494..864653)
FT                   /locus_tag="Tb927.4.3300"
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial ATP-dependent zinc
FT                   metallopeptidase, putative"
FT                   /EC_number="3.4.24.-"
FT                   /note="similar to SP:Q9Y4W6: AFG3-like protein 2 (EC
FT                   3.4.24.-) (Paraplegin-like protein). [Human] {Homo
FT                   sapiens}(PMID:11549317); 65% similar to SP:Q9Y4W6:
FT                   AFG3-like protein 2 (EC 3.4.24.-) (Paraplegin-like
FT                   protein). [Human] {Homo sapiens}(PMID:11549317);
FT                   go_component: mitochondrion [goid 0005739]; go_component:
FT                   integral to membrane [goid 0016021]; go_function:
FT                   metalloendopeptidase activity [goid 0004222]; go_function:
FT                   ATPase activity [goid 0016887]; go_function: unfolded
FT                   protein binding [goid 0051082]; go_process: protein folding
FT                   [goid 0006457]; go_process: cell cycle [goid 0007049]"
FT                   /db_xref="GI:72388112"
FT                   /db_xref="GeneID:3656863"
FT                   /translation="MFRIPRSAHLSFAAAALQTSKCFCATGSNSDGKADAPKEGEKATV
FT                   AGGVSSKSRSNNNTSNTNTSDSNAAVGRAPGLSSEKRYPKGFEAFYSVSLLRRLPFSRP
FT                   SSESVNRAYAMSSDERMLIAIISAKARKARRVRMLVIFSCLFGVTMAVRFYFLHSRAEG
FT                   DISGYTTVEVDLAGHRAVFRGQKGEALGVRNFVDYRAFEASCDSNKDILVGIQTYYPWV
FT                   PMLLLCLLPLLALTHSLFNTSARLASLTAEKSSYSFKRELSVATRLSDVAGLTEAKHEV
FT                   VEVIDFLKNPSRYQALGAKLPKGVLLDGPPGVGKTLLAKAIAGEAMVPFLSCSGSEFEE
FT                   VYVGVGAQRARELFKQAHECKPCVVFVDEIDAFGRKRKSDSGGSLRGTLNAFLSEMDGF
FT                   KDSTGIMVLAATNRADILDNALTRSGRFDRKITLEKPSHKDRVAIAEVHLAPLKLEPSG
FT                   TIRGFAETVAALTPGCSGADIFNICNEAAIQAAREGKEYVSTRHFHQAVDRVLVGLEKS
FT                   AVKLSDAERERISFHEAGKVVLHWFQEKTDPVIKTTILPRGQHRSGVTQKLPQTAFIST
FT                   QEQLMQGMVAQLGGYVAEEYFFKDVSTSAADDVQHATNRARQVVCTYGMDPENIGHFGY
FT                   NLDQEDSIQKPFGPLKEDIVDEAVHKLITEALNRARSILKQYLREVRALAGLLARQETL
FT                   TAHELWLLLGDRPVMTKEFRTYLES"
FT                   /protein_id="XP_844480.1"
FT   gene            complement(<865213..>867234)
FT                   /note="synonym: Tb04.2H8.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656864"
FT                   /locus_tag="Tb927.4.3310"
FT   mRNA            complement(<865213..>867234)
FT                   /db_xref="GI:72388113"
FT                   /db_xref="GeneID:3656864"
FT                   /locus_tag="Tb927.4.3310"
FT                   /transcript_id="XM_839388.1"
FT   CDS_pept        complement(865213..867234)
FT                   /locus_tag="Tb927.4.3310"
FT                   /gene_family="HOG000260261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388114"
FT                   /db_xref="GeneID:3656864"
FT                   /translation="MSGGVSPEVAAQAAARREAAAQLGSWRDMLLTLSKEFPPGSGLKP
FT                   VEETLKYLREAEDKAGVVNALKSLEAGVSHACNVNDTDALEWKSRGNDAYSCKKLEECI
FT                   LMYTRGMMSASEDDTLAALINNRSAAFMAQGRITEALADAHAAFTLTPSYWKALQRRGS
FT                   CLQRLGFIEEGTKDMEAASREEASGANGEEVVKKILHAGRSDGCCDGSSGNVVCGNATV
FT                   VSGSANISYGTGVSGVVAKGPLDPGDIIREVPVAYALYDDHWGVRCCFCLKATRLLYSG
FT                   AAYRSRGKSARGLFCSEVCAATSWERDGQYETTNAFFHLCPVDALVACRMLRSEQVLRG
FT                   EELPLRSNFTGELYPAAVIGGYETAVSLLALVLGAADADGADRLRLAQRQVTLSAFELK
FT                   FHTGTQININTETREALIDESRTIPVGKAVYVTAARFRHSCQPNCFASFVGNPLGCSLQ
FT                   LCIRAIRSVQAGEELTIAYHNMTKYKAVSAHTRRRSLVERCGFLCECSACRDDKDESVT
FT                   SEKKAYYIQASDLYQKGCRLIREGQFETAVNVLSQSYALTMEHLCPPPRPPQTMVPKVH
FT                   MALAKAFNRLRDDGKCVEHLVKKVELDNTLYGTDHVEMADDFIRLAFFEATEEKRRKSA
FT                   ERAVELLRRFYAQSRELDEQTRRIESFVTRSSPCQRAL"
FT                   /protein_id="XP_844481.1"
FT   repeat_region   867278..867306
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(867278..867306)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   867307..867359
FT                   /rpt_family="polypurine"
FT   repeat_region   complement(867307..867359)
FT                   /rpt_family="polypyrimidine"
FT   repeat_region   867485..867542
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(867485..867542)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    867715..867765
FT                   /note="A-rich"
FT   misc_feature    complement(867715..867765)
FT                   /note="T-rich"
FT   misc_feature    867835..867870
FT                   /note="AT_rich"
FT   misc_feature    complement(867835..867870)
FT                   /note="AT_rich"
FT   misc_feature    868010..868057
FT                   /note="A-rich"
FT   misc_feature    complement(868010..868057)
FT                   /note="T-rich"
FT   repeat_region   868163..868198
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(868163..868198)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    868376..868398
FT                   /note="AT_rich"
FT   misc_feature    complement(868376..868398)
FT                   /note="AT_rich"
FT   misc_feature    868492..868548
FT                   /note="A-rich"
FT   misc_feature    complement(868492..868548)
FT                   /note="T-rich"
FT   misc_feature    868572..868592
FT                   /note="AT_rich"
FT   misc_feature    complement(868572..868592)
FT                   /note="AT_rich"
FT   repeat_region   868823..868872
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(868823..868872)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    868945..869017
FT                   /note="T-rich"
FT   misc_feature    complement(868945..869017)
FT                   /note="A-rich"
FT   repeat_region   869018..869045
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="acttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(869018..869045)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caagt"
FT                   /rpt_type="tandem"
FT   misc_feature    869046..869164
FT                   /note="T-rich"
FT   misc_feature    complement(869046..869164)
FT                   /note="A-rich"
FT   repeat_region   869238..869285
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(869238..869285)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<869336..>870058)
FT                   /note="synonym: Tb04.2H8.180; uracil
FT                   phosphoribosyltransferase, putative"
FT                   /db_xref="GeneID:3656871"
FT                   /locus_tag="Tb927.4.3320"
FT   mRNA            complement(<869336..>870058)
FT                   /db_xref="GI:72388115"
FT                   /db_xref="GeneID:3656871"
FT                   /locus_tag="Tb927.4.3320"
FT                   /transcript_id="XM_839389.1"
FT   CDS_pept        complement(869336..870058)
FT                   /locus_tag="Tb927.4.3320"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uracil phosphoribosyltransferase, putative"
FT                   /EC_number="2.4.2.9"
FT                   /note="go_function: uracil phosphoribosyltransferase
FT                   activity [goid 0004845]; go_process: pyrimidine salvage
FT                   [goid 0008655]"
FT                   /db_xref="GI:72388116"
FT                   /db_xref="GeneID:3656871"
FT                   /translation="MALHDNAGRNYNEQEEALLKEFPTFHLLPQTNQLHYLFTIIRQRE
FT                   TGRTDFVFYSERIIRLIVEAALNLIPTIPYDVITPTGSKYQGCMTDGQGIIGISILRAG
FT                   EAMERVLRETCRGVRIGKILVQRDEKSLEKAPDERFNYSKIPSDVSGRHVLLLDPMIAT
FT                   GGSVIKATEILINEYNVPEENIIFLNLISCPEGLRRYLTAFPHVNVVSAALDPGLDSRK
FT                   YIVPGLGDFGDRYFGTCE"
FT                   /protein_id="XP_844482.1"
FT   misc_feature    870090..870131
FT                   /note="CT-rich"
FT   misc_feature    complement(870090..870131)
FT                   /note="GA-rich"
FT   repeat_region   870468..870508
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(870468..870508)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    870711..870805
FT                   /note="CT-rich"
FT   misc_feature    complement(870711..870805)
FT                   /note="GA-rich"
FT   repeat_region   870879..870898
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(870879..870898)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   gene            complement(<870948..>871499)
FT                   /note="synonym: Tb04.2H8.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656868"
FT                   /locus_tag="Tb927.4.3330"
FT   mRNA            complement(<870948..>871499)
FT                   /db_xref="GI:72388117"
FT                   /db_xref="GeneID:3656868"
FT                   /locus_tag="Tb927.4.3330"
FT                   /transcript_id="XM_839390.1"
FT   CDS_pept        complement(870948..871499)
FT                   /locus_tag="Tb927.4.3330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72388118"
FT                   /db_xref="GeneID:3656868"
FT                   /translation="MPASASTRTVGDSSKNASTSSVTNAVKDPNVTLSRADVEAAFAFF
FT                   DLHNHKCLKPATLKERLSAFYPNMTSSEYKFLLDEASGAPFTVDTLWNIIDNFNTTRTA
FT                   MPPAVAGSLRFDPIREAFRIYDPQGSGSVDVVVLADIMKTIGFGDLSPNELTLLIRPAD
FT                   FDNDGKISLEDFMNFLSNHR"
FT                   /protein_id="XP_844483.1"
FT   misc_feature    871790..871917
FT                   /note="A-rich"
FT   misc_feature    complement(871790..871917)
FT                   /note="T-rich"
FT   gene            complement(<872259..>873569)
FT                   /note="synonym: Tb04.2H8.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656866"
FT                   /locus_tag="Tb927.4.3340"
FT   mRNA            complement(<872259..>873569)
FT                   /db_xref="GI:72388119"
FT                   /db_xref="GeneID:3656866"
FT                   /locus_tag="Tb927.4.3340"
FT                   /transcript_id="XM_839391.1"
FT   CDS_pept        complement(872259..873569)
FT                   /locus_tag="Tb927.4.3340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388120"
FT                   /db_xref="GeneID:3656866"
FT                   /translation="MNLPFPTHNKEALPFNEDAGPESRSHPSSDSVRIYFSLGEMAAAV
FT                   SPLHRCFSFPVTRPFVSPCIRCPNCKGCQLHMQFCSGAYGLRHTLAWIVRRHPPAAEER
FT                   RTIKLRSQPPSAGGGAACRMVRRVCRFEVAPVVITQHVTHVDYNQTIDTARHGGSRGPF
FT                   AGMVCPRPQEIRSVYSRIFHEHIRTGGSRLPFRHFQRTAMRSLAGEAQALWEKLTFAPE
FT                   GSRLDEPPMRTERGDKVPRRVPIGWKCPMFFVSLLPRAAAGNNGITFKLWLPEALVHDF
FT                   LTAHIVEVERVRELPHTCRFRCLSTDTMLEVEDAIASVNALLPRWEGELKCPRCYGRRN
FT                   HWGFICNRHRRQLDPIITLLRVRQSSVRRRVQRRAELSGHVVDGAMKNEVVWMNKRKTR
FT                   AQVMALMLANRMPTTVCGPFRQRHLPAPPSFKEGCAR"
FT                   /protein_id="XP_844484.1"
FT   gene            complement(<874914..>876167)
FT                   /note="synonym: Tb04.2H8.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656870"
FT                   /locus_tag="Tb927.4.3350"
FT   mRNA            complement(<874914..>876167)
FT                   /db_xref="GI:72388121"
FT                   /db_xref="GeneID:3656870"
FT                   /locus_tag="Tb927.4.3350"
FT                   /transcript_id="XM_839392.1"
FT   CDS_pept        complement(874914..876167)
FT                   /locus_tag="Tb927.4.3350"
FT                   /gene_family="HOG000204444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388122"
FT                   /db_xref="GeneID:3656870"
FT                   /translation="MLGDDRYPGPPPPYPHDPGLDFCYDSACPPHGQLPWSDQSPSGDR
FT                   EMRDDHISFMRTVKAFREYIKYAMSSREARLASFNKFNNEYREVLCIDLEATFGKYAKC
FT                   IEANSEFFECICDASKGLFDAYWPNGTTVTPEEVPPPTPLDIDKVFSTLRQFVRDWSAE
FT                   GAAERDAVYKPMLQTLEEHFPDVSRRSGVQILVPGAGLCRLVVELALRGFSAQGNEFSY
FT                   HMLIAAHYIQNHVVAPGQHTIFPYVDNTCNLVERDHQFVELNIPDLCASEEVGRRSQQP
FT                   YSFGELSMVAGDFTEVYAKGSQLKKWNAVVTCFFIDTAHNIVEYIKILYNLLVPGGIWV
FT                   NCGPLLYHFAGNAEGDSIELSLSEVLTVAMRFGFVVRRDPILIDTTYTNNYRSMKQLLY
FT                   RCAFFVLQRPPVDTREAA"
FT                   /protein_id="XP_844485.1"
FT   repeat_region   876270..876299
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(876270..876299)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<876620..>877954)
FT                   /note="synonym: Tb04.2H8.50; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656869"
FT                   /locus_tag="Tb927.4.3360"
FT   mRNA            complement(<876620..>877954)
FT                   /db_xref="GI:72388123"
FT                   /db_xref="GeneID:3656869"
FT                   /locus_tag="Tb927.4.3360"
FT                   /transcript_id="XM_839393.1"
FT   CDS_pept        complement(876620..877954)
FT                   /locus_tag="Tb927.4.3360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388124"
FT                   /db_xref="GeneID:3656869"
FT                   /translation="MKVAAVGTLPEDLIDAIRGGAVELHWEGDSVVVFHDDINCCSWRC
FT                   ELDAKPDGKELQPVSFRHQRTGEGGSACVPRIGRITRSEVHRVKDLADTTVEENAPAPV
FT                   QSDGSLNPPIMNVTEVLTKYRPLVVRIVHYLAPLPRESGELMRFFSSEDGKVLKAVLNA
FT                   FTTMNGRGQYELTAAGYELVDVESYDSKAVKQQVADRALQKIAHNKVLVDRFSLYADRD
FT                   VLLAACSKGIMAGLGSSRSKRGRDDVDDNSGSDDDEDKGNGAEPSASGFKSSAQNAVSI
FT                   AAKGDVVMFTSMSQSYIRWNDADLTKEPWEMPSAAAEALKQLQDAAKNARASAGKSLPP
FT                   MSIMSPEQLSTAQERYGILRSEYTKIHDRLKRLEEVSEEVRGWSQTQGDRFTRELNEEL
FT                   RNWFERQEAPRLKLVTAMDAVHEALYRLKRDIEDYVNLRQWGVMM"
FT                   /protein_id="XP_844486.1"
FT   repeat_region   878284..878335
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(878284..878335)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<878428..>879345)
FT                   /note="synonym: Tb04.2H8.30; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656867"
FT                   /locus_tag="Tb927.4.3370"
FT   mRNA            complement(<878428..>879345)
FT                   /db_xref="GI:72388125"
FT                   /db_xref="GeneID:3656867"
FT                   /locus_tag="Tb927.4.3370"
FT                   /transcript_id="XM_839394.1"
FT   CDS_pept        complement(878428..879345)
FT                   /locus_tag="Tb927.4.3370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388126"
FT                   /db_xref="GeneID:3656867"
FT                   /translation="MSSNTCINTALLDFCTRLDNGPKASSGESNLPKRSPEEMQWLREA
FT                   LASVEQPERKIRRILDAVAGEGLSEDVCLEHLEELSDMVEDTNWAVEFVLGGGHRIILD
FT                   FMHKRKLAAGSAEIRQAAAMVVAHAAQLNERAQKCFEEIQWQSVLVPMLMKEEDPAVIA
FT                   ALLHACSCLCRDYAPNAQLFARADGVDIIKGFLDVDSIGSRSNDKIVKRVLFFLSYLAE
FT                   VVTVDVPDLTQRIAAVIDSDDDEVQVVVARALLSLAAKNLSAVRAVLQEEKPGCLSQWQ
FT                   SQLLEDDDCRRQLMRVLSGDELKG"
FT                   /protein_id="XP_844487.1"
FT   repeat_region   879883..879908
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(879883..879908)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    879986..952733
FT                   /note="sequence corresponds to BAC RPCI93-26G5"
FT   gene            complement(<880014..>883517)
FT                   /note="synonym: Tb04.26G5.60; myosin IB heavy chain,
FT                   putative"
FT                   /db_xref="GeneID:3656874"
FT                   /locus_tag="Tb927.4.3380"
FT   mRNA            complement(<880014..>883517)
FT                   /db_xref="GI:72388127"
FT                   /db_xref="GeneID:3656874"
FT                   /locus_tag="Tb927.4.3380"
FT                   /transcript_id="XM_839395.1"
FT   CDS_pept        complement(880014..883517)
FT                   /locus_tag="Tb927.4.3380"
FT                   /gene_family="HOG000260265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="myosin IB heavy chain, putative"
FT                   /note="go_component: myosin [goid 0016459]; go_function:
FT                   motor activity [goid 0003774]; go_function: actin binding
FT                   [goid 0003779]; go_function: ATP binding [goid 0005524];
FT                   go_process: cell motility [goid 0006928]"
FT                   /db_xref="GI:72388128"
FT                   /db_xref="GeneID:3656874"
FT                   /translation="MAHLDLNKQPMVGVEDLVLLPQLSDKAIMENLKLRHSKDLIYTSI
FT                   GSVLLSVNPFKNIPNLYSDECVAYFRNGGKGEGSGSYGGPHIFGLAEETYRTMVSDGEN
FT                   QCVIISGESGAGKTEASKHIMRYISAVSGDTEEMQRVKHIILASNPVLEAFGNAKTVRN
FT                   DNSSRFGKFFEIFFDQMGGPIGGRLSNFLLEKSRVVSQQKGERNFHVFYQMCCGAKPEL
FT                   REKLRLRDPGNFAYLNQGGVHDRSGIDDVRGWEEMLTSMETLMLTPEKQQAIFETLSLI
FT                   LHLGELQFGPPSSASAAGGDSNTLVVSNRDELEFCAGLLGADAAAMEKAFTKRRLAMGA
FT                   NEVVDVPLDAQQCRNTRDAMAKTLYHYLFDFVVDSVNTALGKKQYDLMLGVLDIYGFEV
FT                   FNKNGFEQFCINYVNEKLQQIFIELTLKVEQEEYVREKIPWEEIKYFNNKVVCDLIEGM
FT                   QPPGLFPIFDDVCATMAKEKESVADIKMLDKLDAVHAGNRHFNRTERGFFVKHYAGDVH
FT                   YDADGFTNRNKDTLSPDLIGLLRSVTNRFILDILAETLNEAAEAESAAVSGAGGRKKRS
FT                   TTAGSKIRQQAGHLVKTLMACNPHYLRTIKSNDEKRADFIDEARVQHQVKYLGLLENLR
FT                   VRRAGYSYRKHFDKFIKRFKYLSSATFPRPFKGSDRDACAAILKQVGGRLPDGSWQLGQ
FT                   QKLFIRQPQHLSILEELRDAALSDIVYKIQRAWRRYLQNKHGILLKAGMGRMYTKASKV
FT                   RRADSVFRPYLGEYLDYRTQLAPMHPIVDYDPVGGAWKEYWSDGGKKYYYNYILEQSQW
FT                   ECPREMQQRRILFTATVERVYDHQQALIETDILIVTDMALYLFTERIKSLPPPAEKGPK
FT                   KKVTGSAPIPASSTVQFVLQKRIDLRLLSGLSVTKHADTVLVIHTYQPSVPYRTVICTP
FT                   IKSTRSCECCGCKLTPATKKQNCPGCGRLCCLKNCLPFSRPLPMLLAGGKDVRVCPNCV
FT                   SGEPYEPVEDIVLLSPMKTEMVAVLRKAYHQLMGNKLHMNINDSLGYNLFGEEQQRQLT
FT                   AIPYSSSSDTTITPGGPNTLVVSAPAGITKETIDAIEAAREQRRQAVAEQRRKEEEEER
FT                   AREAEREREREEEHKRIVEERRRARAAAAEAAEAERLHQENAARERREAEARVVEQRSK
FT                   R"
FT                   /protein_id="XP_844488.1"
FT   gene            complement(<884011..>886038)
FT                   /note="synonym: Tb04.26G5.90; tuzin"
FT                   /db_xref="GeneID:3656873"
FT                   /locus_tag="Tb927.4.3390"
FT   mRNA            complement(<884011..>886038)
FT                   /db_xref="GI:72388129"
FT                   /db_xref="GeneID:3656873"
FT                   /locus_tag="Tb927.4.3390"
FT                   /transcript_id="XM_839396.1"
FT   CDS_pept        complement(884011..886038)
FT                   /locus_tag="Tb927.4.3390"
FT                   /gene_family="HOG000255500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tuzin"
FT                   /note="go_component: membrane [goid 0016020]"
FT                   /db_xref="GI:72388130"
FT                   /db_xref="GeneID:3656873"
FT                   /translation="MWRRTWRVMRIASASASRTPPTASKPSSSDVGISTSTADCSRDAA
FT                   TQMSLQGLGVAAYFRNSETASTDEPIAIGHITAQISESVYAVFFKEIALSPVIEVGSRV
FT                   YVSCRKEAPTPKDSTAPDVLNHSNTSNTSGNEITAPVNLSSPKGEGVEQQPVGGAEGSA
FT                   GAAVGGGGGGGGGGGTTAPVTAGPFCPYSNGGGTIIGGLVAKVNGNGTFGVLLDDDRFD
FT                   LAVPREVIMLSEGRSKFISNEKFQEVLEWVKSAGVDRRSDQESTSCILYHRGWRADKLY
FT                   LLESADVHCLSHLNKSVRMSVLEKSEWERDQHRHRREEIKERMKEKELRYVLTKYSGVF
FT                   SACVAVLGVMSVFGWNFKNYTKQQRSYQLAIAANTLSQRTVRHPIKGTVPREAEEQRVR
FT                   QILRQQDVTHPRIIVFSGFHGCGKSSLVRSAIRKEKMAAVLVDIRANEDPVRSIVKSLG
FT                   VQNIEACGDLLDFIVDASERAKKAMNGVSPLFVVKLCEGSSLMRVYNELVALACDRRLC
FT                   HVVIEVPIESLTLAMTALPRLDFHLIPNFSVGEAFRYTNHMIDPLEFLNFVEVAGTNSN
FT                   DIDELFATVQHGRMSASAYTNQKLVKAMRQLEAAWSKDPSLREAVINLAKFPFEAGQRE
FT                   GYDYSSLRSEALRDIVMYNPVSDVWMFHQKVFHTAARCWQ"
FT                   /protein_id="XP_844489.1"
FT   repeat_region   885512..885538
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tcc"
FT                   /rpt_type="tandem"
FT   gene            complement(<886658..>888475)
FT                   /note="synonym: Tb04.26G5.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656872"
FT                   /locus_tag="Tb927.4.3400"
FT   mRNA            complement(<886658..>888475)
FT                   /db_xref="GI:72388131"
FT                   /db_xref="GeneID:3656872"
FT                   /locus_tag="Tb927.4.3400"
FT                   /transcript_id="XM_839397.1"
FT   CDS_pept        complement(886658..888475)
FT                   /locus_tag="Tb927.4.3400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388132"
FT                   /db_xref="GeneID:3656872"
FT                   /translation="MDIREIIDLVNGYQSTGETSADESLLQAVQRLKSALVDIPQLGSN
FT                   TQEALKALVRAAVVWPSEWNDILQLLHDALADAALSCAHRTLLLELLPGLLEGDSDVKA
FT                   HGESVCDVLLQWLLATVRKQGESAGDSKHQEDWRAALKALLVLPKECYSKIVQFCASQL
FT                   PQSLPLCKAILTNSSASDLLKRAFEEWLVLSGNASQHADCARDIERLLRENFSGFGSLL
FT                   CEKACSTLLSSGSLSSMSSLRTLQGALQVVHAFSMLHREIVRTHVPNSFVVSTTVGLLD
FT                   IVGAENKDDKQQDAKGPWPCIKMTQEESTLVVSILRSLVKLSGIVTAVPGCVSISEVRK
FT                   LCAPLLAIRNEAAALDCHLPLVECVFNLTLRILSCVCAGADEMRELLQELVDVSNVMLP
FT                   VLSDSHNQIESFGPFCEKKSRRDNHSGPGGKEKDYDFWNMSDEQQQTMLSALRVLRAVS
FT                   AMCRVCRAQNRSKPEDKSDEEHWKAVASDIASAARTLAPSWKIEVVEQPRPTVTSNPRL
FT                   TEGTTVGRSAPTSRHESRNPYSQSHSSPSNHQYYSSNHSSYSPTPRHHSPSHHPHHHPP
FT                   SHTHHGVPRSSRYSDYEGAPHRLSKRPRR"
FT                   /protein_id="XP_844490.1"
FT   repeat_region   888504..888526
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<889458..>891788)
FT                   /note="synonym: Tb04.26G5.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656875"
FT                   /locus_tag="Tb927.4.3410"
FT   mRNA            complement(<889458..>891788)
FT                   /db_xref="GI:72388133"
FT                   /db_xref="GeneID:3656875"
FT                   /locus_tag="Tb927.4.3410"
FT                   /transcript_id="XM_839398.1"
FT   CDS_pept        complement(889458..891788)
FT                   /locus_tag="Tb927.4.3410"
FT                   /gene_family="HOG000260259" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388134"
FT                   /db_xref="GeneID:3656875"
FT                   /translation="MVSEAGRANGSRFKPVLLEVAGALVDNRCADVTRRLRQYRNRYAP
FT                   ILRLVTTLIAPVMEESQLFGDDDSCVESAAVADDGRLKEGVTEMAGATAVVGGDGALRG
FT                   RNGGVKRGRGEPLITAPRCAVVAEKRIIVVHRLHDKEVPDAVEKLERFMSYHFLPLALL
FT                   HNCQPNISPDDVPFVLRHYVHEATRTASFLVADLSKRAAAIIDPQVDVSCYEEDLAFLQ
FT                   VQLVGIVLTHCFVDIAMGHAALLEHHPTAKLLSGTPFVSTGYGCSDGLSLHLSSRLHLR
FT                   CISVPSFSPECLVVELHLDAQLLALFTGTVMGTDAVPRYEFFGDFPLPLEPQGDLQHTS
FT                   AMPAPEVARRFLRERVWDAYFFPDPAAGHVQPWDHVVVFPSHGGYSNVTHQLDLYWAVH
FT                   IGDMKRMKHSRTVMDKILDPEKYAQHMLDRPRLPKPLLVSHVREWNLLSVPSAFGGSGE
FT                   GLLRRRLLPPPACALTSPCPGPVVVDIRSAADHVTMHLKGSVNVPMTFPAAAYGVKKAE
FT                   LWLQCMLKPLQPVVVVCANERQCHLARQRLELISPGASVETFTLQELCPPCGVHAVDGQ
FT                   EKEVFNRVDVTTSLPATVDSRHLPRHLTWVFDSTASAQSRLDCYQKLQFIEPAEDTLVL
FT                   DCRTPYEFRNGSHTRSVFLSLGDLCHITALDLVAQQLTPEADVHCGGWPSPELGRIILD
FT                   RMYEAALASGLKCRPGCRGIRKIVVYCATGYRSLIAASLMRRAFEAASLDIVVYDVAGG
FT                   ALQVMQQRPDLWTVKDRSIICIS"
FT                   /protein_id="XP_844491.1"
FT   repeat_region   892241..892260
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   892263..892286
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<892337..>894148)
FT                   /note="synonym: Tb04.26G5.140; serine/threonine-protein
FT                   kinase, putative"
FT                   /db_xref="GeneID:3656876"
FT                   /locus_tag="Tb927.4.3420"
FT   mRNA            complement(<892337..>894148)
FT                   /db_xref="GI:72388135"
FT                   /db_xref="GeneID:3656876"
FT                   /locus_tag="Tb927.4.3420"
FT                   /transcript_id="XM_839399.1"
FT   CDS_pept        complement(892337..894148)
FT                   /locus_tag="Tb927.4.3420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72388136"
FT                   /db_xref="GeneID:3656876"
FT                   /translation="MLAPKGGNDGSVVPFTAAEGSNSNTNFSTARDGQCTPVPPQQRLN
FT                   SWALPRAPETPAKQRRTRHEERGGQTITYLSGGASHKRGAAPDRRCNLASRKRPSSELS
FT                   QFSALRLDDPSDTVPFPPPECSTSEATRSCLRPHLGPLATGGMSLMNSAPNSPQRDWMA
FT                   RVGSSFPFMPYSPDQPEYSQAESEFSNIFNRRILTDYKEVKELGFGSFGRVTLYEETGT
FT                   GALVAVKTSPPNASREQRQRFARERAVMSITKGFPHVVQLLDSWEEGHAPQVFLQLEYC
FT                   SGGSVAERAEQRRQRGEVWDERELFVFFGHMALALDALHSANIVHVDFKPDNVLIDEAG
FT                   DYKLSDFGCSVFVDDDGFPRKTFAAAGAKTGNLFSAPSSTAGVNNNSMADAGPLSFPTQ
FT                   LSVVSVEEGDCRYLCMDMLNQKRYLKEGDMFSFGISLFELMSGEPLPHHGAGFLELRQH
FT                   PPLHLLERRGYSKRLTAFVAELMHAEPTSRPTARDALCFFQLPPHVPQVMSQWVVGDTP
FT                   PLDSQVGEDETNLLLDVRYTHAALEVAARILDKARRLLRRGSIASSQSTGVAAGRRVFA
FT                   EVDGMCTPKDPATDQNSQGDRGDSAKF"
FT                   /protein_id="XP_844492.1"
FT   misc_feature    894384..894405
FT                   /note="AT_rich"
FT   gene            complement(<894904..>895233)
FT                   /note="synonym: Tb04.26G5.164; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656878"
FT                   /locus_tag="Tb927.4.3430"
FT   mRNA            complement(<894904..>895233)
FT                   /db_xref="GI:72388137"
FT                   /db_xref="GeneID:3656878"
FT                   /locus_tag="Tb927.4.3430"
FT                   /transcript_id="XM_839400.1"
FT   CDS_pept        complement(894904..895233)
FT                   /locus_tag="Tb927.4.3430"
FT                   /gene_family="HOG000260257" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388138"
FT                   /db_xref="GeneID:3656878"
FT                   /translation="MGQDQSMAFANDTISGEQYRAHQVSRQDIIRRAFQKCVVPLNGGA
FT                   GDKNGLGLDSGERACVEEFALLYSAYGKNGFAQFSQLYEQYQRDMFEKARVEMMTQQAR
FT                   KELSR"
FT                   /protein_id="XP_844493.1"
FT   gene            complement(<895875..>897227)
FT                   /note="synonym: Tb04.26G5.180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656877"
FT                   /locus_tag="Tb927.4.3440"
FT   mRNA            complement(<895875..>897227)
FT                   /db_xref="GI:72388139"
FT                   /db_xref="GeneID:3656877"
FT                   /locus_tag="Tb927.4.3440"
FT                   /transcript_id="XM_839401.1"
FT   CDS_pept        complement(895875..897227)
FT                   /locus_tag="Tb927.4.3440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388140"
FT                   /db_xref="GeneID:3656877"
FT                   /translation="MHAHAAAFPAYTTNVAVSAPHFPTQAEMVDRACAQVLLGLRQTQQ
FT                   GVGKEWKNVQPCVMLASQLLLQQAQLHGERLCALESKMDEVQRAVEVLVNDSHLKEERY
FT                   NAERTGTGVALEGVRRNMQQLKEAVEMQRCDTQKFHQEVLFPGMNDLQRQIDNVVARSL
FT                   ARSVLGAAQSLSPTASPGPGDSIPAETDNSVREMVREVKLLRNQWLKLLQRPLPPVRST
FT                   SGCHRCRRSGSAAEATTDRRGKGQASKRFLLDCSVARWRWRGANISSCGSSPDGPIPWG
FT                   SLCVRRTATGEWVRLAASPDSRAAFAELSGGRAELPFVWRAERHPGVIELTRSGICRIV
FT                   VCMIASNAAAASGRGCGHHSAATGTPSAVLRVNSSSVVTFYSSGSTCYTLRPVRGGSRS
FT                   RLCGEGIAFATWTFSDYLLLPAGASVAVCTRGSTGACSVHEVLLELEFVSD"
FT                   /protein_id="XP_844494.1"
FT   repeat_region   897581..897622
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   897582..897622
FT                   /rpt_family="tandem"
FT   gene            complement(<897938..>898282)
FT                   /note="synonym: Tb04.26G5.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656881"
FT                   /locus_tag="Tb927.4.3450"
FT   mRNA            complement(<897938..>898282)
FT                   /db_xref="GI:72388141"
FT                   /db_xref="GeneID:3656881"
FT                   /locus_tag="Tb927.4.3450"
FT                   /transcript_id="XM_839402.1"
FT   CDS_pept        complement(897938..898282)
FT                   /locus_tag="Tb927.4.3450"
FT                   /gene_family="HOG000260251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388142"
FT                   /db_xref="GeneID:3656881"
FT                   /translation="MLRRLGANVSNMARPMNKYAVTVSPRRHLEPMSTWYLASWAMVWY
FT                   YAFFFWMPMVWTDIMVPSFVYNKLPVIHFLQEKRAEQKLRRVLDETYTEWTEELDQAHV
FT                   TDAITRSLNI"
FT                   /protein_id="XP_844495.1"
FT   gene            complement(<898874..>899377)
FT                   /note="synonym: Tb04.26G5.210; ubiquitin-conjugating enzyme
FT                   E2, putative"
FT                   /db_xref="GeneID:3656880"
FT                   /locus_tag="Tb927.4.3460"
FT   mRNA            complement(<898874..>899377)
FT                   /db_xref="GI:72388143"
FT                   /db_xref="GeneID:3656880"
FT                   /locus_tag="Tb927.4.3460"
FT                   /transcript_id="XM_839403.1"
FT   CDS_pept        complement(898874..899377)
FT                   /locus_tag="Tb927.4.3460"
FT                   /gene_family="HOG000170329" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ubiquitin conjugating enzyme activity [goid 0004840];
FT                   go_process: protein modification [goid 0006464];
FT                   go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72388144"
FT                   /db_xref="GeneID:3656880"
FT                   /translation="MRRLQKELRDITVDPPPYCNAAPSSESIFTWYFTLDGPPQTPYEG
FT                   GRYLGELRFPPEYPMEPPKIIMLTPSGRFVINSPICLTITDFHPEEWSPMWGVRTIITG
FT                   LLSFMVSEESGLGGITETAVSRRALAAKSHRYNVERVPVYKELFNSEYQKDLKKLNKKN
FT                   KDTS"
FT                   /protein_id="XP_844496.1"
FT   gene            complement(<899833..>901638)
FT                   /note="synonym: Tb04.26G5.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656882"
FT                   /locus_tag="Tb927.4.3470"
FT   mRNA            complement(<899833..>901638)
FT                   /db_xref="GI:72388145"
FT                   /db_xref="GeneID:3656882"
FT                   /locus_tag="Tb927.4.3470"
FT                   /transcript_id="XM_839404.1"
FT   CDS_pept        complement(899833..901638)
FT                   /locus_tag="Tb927.4.3470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388146"
FT                   /db_xref="GeneID:3656882"
FT                   /translation="MSLRDDILALTATLSRLSRARDTATASDCTETRVDDTISAVSVAA
FT                   EDDETRDNTAPSLMCMPVPRSGGRKMEEDTFTILPNSRDTTALPRGEATADRCCASNDN
FT                   ARSKRLSTPSGQEVAVSQRPPLAPTEGVTWNHSHGRSSIADDETNSCIDPVSSESCGVS
FT                   TEPSGAEPSPCQVEEAYKRIARRLLSEIQRLDLCIATVSARHVDERKEFLHTQRELKER
FT                   LVERDALIGTLQHQLKLAESSESTVRCRCCFGRANCAPVQSRATATVSTERFTSRSRSD
FT                   SGVPTTAAPICHQGLDIATNTQGTDEAKGPRGRSNQHHPATEEVDTYATRASSLAGLAC
FT                   HENVTAVIPKTAIAAGTSEGPVPVTTSGCARARASSLSRSEGRDGSDDPAVRGTVTNSV
FT                   TVPTDRAPSPHASFPTDCCPRVSQASYRVGVAAAVGGRAKGLRRTPKTTPLRRRRQHVL
FT                   ECSGDTAWRGSLHCRTCREDVLPTAPEVQQGTLTGSSANPLPSSFPSPFVSTATTGARF
FT                   NHGVPNRAFSQSPSHRKKRRSSNRVRCPVAASGDELLRGLIAKSAFLEAGLRGVMERLD
FT                   EQQGELHDVTCLLHKLVLSSMHGSA"
FT                   /protein_id="XP_844497.1"
FT   repeat_region   902387..902421
FT                   /rpt_family="tandem"
FT   gene            complement(<902579..>903130)
FT                   /note="synonym: Tb04.26G5.240; hypothetical protein"
FT                   /db_xref="GeneID:3656884"
FT                   /locus_tag="Tb927.4.3480"
FT   mRNA            complement(<902579..>903130)
FT                   /db_xref="GI:72388147"
FT                   /db_xref="GeneID:3656884"
FT                   /locus_tag="Tb927.4.3480"
FT                   /transcript_id="XM_839405.1"
FT   CDS_pept        complement(902579..903130)
FT                   /locus_tag="Tb927.4.3480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72388148"
FT                   /db_xref="GeneID:3656884"
FT                   /translation="MIFFGVLSLLLTLCAFILAGCACFSPIFGRATGYKTIYLFEVGQA
FT                   SSTGKDSCFRNTVYFNLVRGSVVTSSVIGFIAFIVVILTILRGRMAFLMCLSPCFSFIA
FT                   FLLMALCTAIMSVEYFVGFCSDDGGSGKKPLKGVFKLCCGFYLLVTSCAVYLGSLIAQF
FT                   FALLSWAAFLNEMCMYLEEL"
FT                   /protein_id="XP_844498.1"
FT   gene            complement(<903365..>903799)
FT                   /note="synonym: Tb04.26G5.250; DNA-directed RNA polymerase
FT                   subunit, putative"
FT                   /db_xref="GeneID:3656885"
FT                   /locus_tag="Tb927.4.3490"
FT   mRNA            complement(<903365..>903799)
FT                   /db_xref="GI:72388149"
FT                   /db_xref="GeneID:3656885"
FT                   /locus_tag="Tb927.4.3490"
FT                   /transcript_id="XM_839406.1"
FT   CDS_pept        complement(903365..903799)
FT                   /locus_tag="Tb927.4.3490"
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase subunit, putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="similar to DNA-directed RNA polymerases I, II, and
FT                   III 15 kDa polypeptide(EC 2.7.7.6) (RPABC6)
FT                   (Swiss-Prot:P36595) [Schizosaccharomyces pombe];
FT                   go_function: DNA binding [goid 0003677]; go_function:
FT                   DNA-directed RNA polymerase activity [goid 0003899];
FT                   go_process: transcription, DNA-dependent [goid 0006351]"
FT                   /db_xref="GI:72388150"
FT                   /db_xref="GeneID:3656885"
FT                   /translation="MSERDEDEVDRLSLSIGDEHESVAQSDDERSDAGAGVVVSGPAPV
FT                   RGSAKRRDDRDRVTAPVLTKYERARILGTRALQISMNAPVLVALEGETDPLTIAQKELR
FT                   EGVIPLIIRRVLPDNTYEDWRICELDVDFDRPVDERYTNI"
FT                   /protein_id="XP_844499.1"
FT   gene            complement(<904574..>905104)
FT                   /note="synonym: Tb04.26G5.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656879"
FT                   /locus_tag="Tb927.4.3500"
FT   mRNA            complement(<904574..>905104)
FT                   /db_xref="GI:72388151"
FT                   /db_xref="GeneID:3656879"
FT                   /locus_tag="Tb927.4.3500"
FT                   /transcript_id="XM_839407.1"
FT   CDS_pept        complement(904574..905104)
FT                   /locus_tag="Tb927.4.3500"
FT                   /gene_family="HOG000137479" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388152"
FT                   /db_xref="GeneID:3656879"
FT                   /translation="MCCGWLTTLVTLFAVASAVCALVFPVFRMKNETKEAIQTLWYYME
FT                   KVDDVVKQTKVHESPCKEYSVYFQVIEAGVLISVLTGFAALVFIILSNCKIPLCCLRII
FT                   STPLSIISFLVSSVSAVLITVGYGKGFCQWDDQLREDFAPFKERDFSVDAGFYLIVVTA
FT                   VLFLVSSVAGCCL"
FT                   /protein_id="XP_844500.1"
FT   gene            complement(<905340..>905774)
FT                   /note="synonym: Tb04.26G5.280; DNA-directed RNA polymerase
FT                   subunit, putative"
FT                   /db_xref="GeneID:3656886"
FT                   /locus_tag="Tb927.4.3510"
FT   mRNA            complement(<905340..>905774)
FT                   /db_xref="GI:72388153"
FT                   /db_xref="GeneID:3656886"
FT                   /locus_tag="Tb927.4.3510"
FT                   /transcript_id="XM_839408.1"
FT   CDS_pept        complement(905340..905774)
FT                   /locus_tag="Tb927.4.3510"
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase subunit, putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="similar to DNA-directed RNA polymerases I, II, and
FT                   III 15 kDa polypeptide(EC 2.7.7.6) (RPABC6)
FT                   (Swiss-Prot:P36595) [Schizosaccharomyces pombe];
FT                   go_function: DNA binding [goid 0003677]; go_function:
FT                   DNA-directed RNA polymerase activity [goid 0003899];
FT                   go_process: transcription, DNA-dependent [goid 0006351]"
FT                   /db_xref="GI:72388154"
FT                   /db_xref="GeneID:3656886"
FT                   /translation="MSERDEDEVDRLSLSIGDEHESVAQSDDERSDAGAGVVVSGPAPV
FT                   RGSAKRRDDRDRVTAPVLTKYERARILGTRALQISMNAPVLVALEGETDPLTIAQKELR
FT                   EGVIPLIIRRVLPDNTYEDWRICELDVDFDRPVDERYTNI"
FT                   /protein_id="XP_844501.1"
FT   gene            complement(<906430..>906966)
FT                   /note="synonym: Tb04.26G5.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656889"
FT                   /locus_tag="Tb927.4.3520"
FT   mRNA            complement(<906430..>906966)
FT                   /db_xref="GI:72388155"
FT                   /db_xref="GeneID:3656889"
FT                   /locus_tag="Tb927.4.3520"
FT                   /transcript_id="XM_839409.1"
FT   CDS_pept        complement(906430..906966)
FT                   /locus_tag="Tb927.4.3520"
FT                   /gene_family="HOG000137479" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388156"
FT                   /db_xref="GeneID:3656889"
FT                   /translation="MLCCGCLTILMTLLGASTSVCTIIFPVFRMKNETKEAIQTLWYYM
FT                   EKTASTESKTSVRESECYEYSVYFQVSMGAVAAAAAVGLISLLFLCGVVACGKKMKHLK
FT                   AVSLSLVFFSLLGAITCIGLVTLGYLRGYCQGDPKLRDKYAPFKERGFKIDVGSYLLCA
FT                   AVALYLLTTITHCCL"
FT                   /protein_id="XP_844502.1"
FT   gene            complement(<907282..>909414)
FT                   /note="synonym: Tb04.26G5.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656888"
FT                   /locus_tag="Tb927.4.3530"
FT   mRNA            complement(<907282..>909414)
FT                   /db_xref="GI:72388157"
FT                   /db_xref="GeneID:3656888"
FT                   /locus_tag="Tb927.4.3530"
FT                   /transcript_id="XM_839410.1"
FT   CDS_pept        complement(907282..909414)
FT                   /locus_tag="Tb927.4.3530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388158"
FT                   /db_xref="GeneID:3656888"
FT                   /translation="MVHVDTSTEAYRHMAKELTFLSTEEFSRRLHRFSRTNFDPSQTAA
FT                   VHAHVSELLSRRLAEVSYKCVREYGQLAHVAGLHELCLAIYYGRANLVCSSSMAEANSV
FT                   AGSFAVSDSVVDSAYSLGSTSDLVRLGAHCMKHLQHEPSLGWEVMSSFSLARTFWRCVC
FT                   IVAHLEKARSVDAKQALQDAAYIFKEYIAVLYPEASRELSVQDAIYTVRRFVQYASCGD
FT                   EGEMLFFRFCLRRGFLRRGCGTTNLTEEGGSNLSITTSDTGSGEVSYGGSANGATRVDH
FT                   GVISEEQWFYATLIATCRAGQHVHEALHYFDEVGSRLGVESVGCDVLLGHRSRAMRSGT
FT                   AADGQDFRAVGECEKIMEGVSDYLFFQLLTVLHAAKDNRKIVFTARAMLRCGEKLSISV
FT                   WSIVLIAAGEMRAADVALGAFVQAKDALSDATRVEDRRGNEYLLQTSLLALSKCQVPRF
FT                   EEEYLRPCRELLLTHSNEEVYFCALLQHAHNSTDPGGGAGEVSRAVSEKGIPFSSRIVS
FT                   RLMKVYLRTESPKLLELYRYATRSCNTFKASWLDELLLWADRRRYDLTPEERKYILDEV
FT                   YRVYGDNAMESELSGLRTQLALLRYDYEHKPRETFLATLQPPPTEPTVLDSRAHFLVKK
FT                   PYCVHQRRPKNGKDLNEERSGDRIVVANGDQSYGGHSIIQGQNFSGSDGNMRPEEFRVY
FT                   MEKILEVLQRTNNWVS"
FT                   /protein_id="XP_844503.1"
FT   gene            complement(<910085..>911224)
FT                   /note="synonym: Tb04.26G5.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656887"
FT                   /locus_tag="Tb927.4.3540"
FT   mRNA            complement(<910085..>911224)
FT                   /db_xref="GI:72388159"
FT                   /db_xref="GeneID:3656887"
FT                   /locus_tag="Tb927.4.3540"
FT                   /transcript_id="XM_839411.1"
FT   CDS_pept        complement(910085..911224)
FT                   /locus_tag="Tb927.4.3540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388160"
FT                   /db_xref="GeneID:3656887"
FT                   /translation="MHSRGVYNRGEPYNKHGRANYHQPRPSDTSAGAIVAIAPASGGSG
FT                   AVVSQVAGSDRGGPRRLTFNNFRTFSARNKKTPLDANTSAAPNTKLWQLSEQVSFYCNK
FT                   CRRDNIISDSLAIDAVHQLMLCTRCFTRIIRPRTYRPSRVVPFPSLLSWLNYTPSRVME
FT                   MSEDIASRPAEAVAPSADRVAVPTIPGGSRPTHIQQLPATAMNTVSNAGNVGGALLARG
FT                   MTAASQQQQSLESSKHPCHRVWGSCLHGETCLFRGAPYDLCICFLMGLCNGDEATCNLL
FT                   HQRVFALPDAEAPMPLQRCEGDLEDPGSAWGKWVGKKKNSANSAEWQLWNNGPILELIN
FT                   RHAPATPVAVAEEKGGDNVKPRIKLHFADISAALKGLQK"
FT                   /protein_id="XP_844504.1"
FT   repeat_region   911299..911330
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<911751..>912419)
FT                   /note="synonym: Tb04.26G5.360; 60S ribosomal protein L13a,
FT                   putative"
FT                   /db_xref="GeneID:3656883"
FT                   /locus_tag="Tb927.4.3550"
FT   mRNA            complement(<911751..>912419)
FT                   /db_xref="GI:72388161"
FT                   /db_xref="GeneID:3656883"
FT                   /locus_tag="Tb927.4.3550"
FT                   /transcript_id="XM_839412.1"
FT   CDS_pept        complement(911751..912419)
FT                   /locus_tag="Tb927.4.3550"
FT                   /gene_family="HOG000225289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L13a, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_component:
FT                   large ribosomal subunit [goid 0015934]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72388162"
FT                   /db_xref="GeneID:3656883"
FT                   /translation="MVLPSRRSLNRSSRKGFKKHRPDIIVIDLKDHVLGRAAAIVAKQL
FT                   LLGKKITVVRCEKLTIAGSEIRNKIKYLQFLRKRKLSNPKLGPFHHRSPSDVFIRTVRS
FT                   MLPRYTKRGQRALRQLVAYEGVPVNVVRTGGRVVIPKAQRHNCYRNERRFTVLGNMCKH
FT                   VGWKYSDVVEKLEAARIEKSGRHHKKMEKVRVAWKNARKEALKKMPQKNVEVLKKFGLA
FT                   "
FT                   /protein_id="XP_844505.1"
FT   gene            complement(<913574..>914554)
FT                   /note="synonym: Tb04.26G5.380; serine/threonine protein
FT                   phosphatase PP1, putative"
FT                   /db_xref="GeneID:3656894"
FT                   /locus_tag="Tb927.4.3560"
FT   mRNA            complement(<913574..>914554)
FT                   /db_xref="GI:72388163"
FT                   /db_xref="GeneID:3656894"
FT                   /locus_tag="Tb927.4.3560"
FT                   /transcript_id="XM_839413.1"
FT   CDS_pept        complement(913574..914554)
FT                   /locus_tag="Tb927.4.3560"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein phosphatase PP1,
FT                   putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="similar to GB:AAF37821.1:  type 1 serine/threonine
FT                   phosphoprotein phosphatase PP1beta {Trypanosoma cruzi};
FT                   go_function: protein serine/threonine phosphatase activity
FT                   [goid 0004722]; go_function: hydrolase activity [goid
FT                   0016787]; go_process: cell growth and/or maintenance [goid
FT                   0008151]"
FT                   /db_xref="GI:72388164"
FT                   /db_xref="GeneID:3656894"
FT                   /translation="MSTIVRKRGRTNSSEAQSGRWSHGARPDPSNRDRETIQRLVESIL
FT                   KDWQSAQELLDGQIISTILRLVRPILMAQPMLVRLQAPINVCGDIHGQIGDLVEIFRAG
FT                   GMPPATNYLFLGDYVDRGKHGTEVIVVLLGLKILYPDGMCVLRGNHESDSICRIYGFFD
FT                   EVKRRFSVKLFKEFTDVFNCLPIAALIDDIALCMHGGLSPDLRNLRQIERIERPLIVPD
FT                   TGLACDLLWADPEEAGSGWMESERGVSYTFGEDIVKETCERLDIDVVLRAHQVVDKGYQ
FT                   FFAGRQLVTIFSASNYCGEFTNSGAMMIMDENCKCRFEIFRPQYD"
FT                   /protein_id="XP_844506.1"
FT   gene            complement(<915105..>915890)
FT                   /note="synonym: Tb04.26G5.400; translation elongation
FT                   factor 1-beta, putative"
FT                   /db_xref="GeneID:3656892"
FT                   /locus_tag="Tb927.4.3570"
FT   mRNA            complement(<915105..>915890)
FT                   /db_xref="GI:72388165"
FT                   /db_xref="GeneID:3656892"
FT                   /locus_tag="Tb927.4.3570"
FT                   /transcript_id="XM_839414.1"
FT   CDS_pept        complement(915105..915890)
FT                   /locus_tag="Tb927.4.3570"
FT                   /gene_family="HOG000207273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor 1-beta, putative"
FT                   /note="similar to SP:P34827:  25 kDa elongation factor
FT                   1-beta (EF-1-beta). {Trypanosoma cruzi}; similar to
FT                   Probable elongation factor 1-beta (EF-1-beta)
FT                   (Swiss-Prot:O96827) [Drosophila melanogaster];
FT                   go_component: eukaryotic translation elongation factor 1
FT                   complex [goid 0005853]; go_function: translation elongation
FT                   factor activity [goid 0003746]; go_process: translational
FT                   elongation [goid 0006414]"
FT                   /db_xref="GI:72388166"
FT                   /db_xref="GeneID:3656892"
FT                   /translation="MCDHMYSPVFIPFAFFSIVKCHNKCSFVCNRSGKDMSIKDVNVKS
FT                   GKLEEKLKGKLFLGGVKPSEEDVKAFNDLLGGDNTNVFRWVKNIASFTEAERTAWGAPV
FT                   KITPPVAAPVAAPAAAPAAAPAATPARKAAEADDDDIDLFGETTEEELAALEAKKKKDA
FT                   AAKSTKKVIIAKSSILFDIKPWDDTVDLQKLATELHAIKRDGLLWGDHKLVPIAFGVKK
FT                   LQQLVVIEDDKVSGDDLEEMIMSFGDAVQSMDIVAWNKI"
FT                   /protein_id="XP_844507.1"
FT   repeat_region   915505..915548
FT                   /rpt_family="tandem"
FT   repeat_region   915510..915565
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cag"
FT                   /rpt_type="tandem"
FT   gene            complement(<915966..>916277)
FT                   /note="synonym: Tb04.26G5.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656893"
FT                   /locus_tag="Tb927.4.3580"
FT   mRNA            complement(<915966..>916277)
FT                   /db_xref="GI:72388167"
FT                   /db_xref="GeneID:3656893"
FT                   /locus_tag="Tb927.4.3580"
FT                   /transcript_id="XM_839415.1"
FT   CDS_pept        complement(915966..916277)
FT                   /locus_tag="Tb927.4.3580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388168"
FT                   /db_xref="GeneID:3656893"
FT                   /translation="MRRMDPDAGGGDHDLLQCVLRLPLPNPEVASIMLQVLRVEPPVPG
FT                   TSREVQLWADDSARSTVFARLCATQERALRAAVAALLEQTKLVLRTLDAFPVDAPANV"
FT                   /protein_id="XP_844508.1"
FT   gene            complement(<917162..>917947)
FT                   /note="synonym: Tb04.26G5.430; translation elongation
FT                   factor 1-beta, putative"
FT                   /db_xref="GeneID:3656891"
FT                   /locus_tag="Tb927.4.3590"
FT   mRNA            complement(<917162..>917947)
FT                   /db_xref="GI:72388169"
FT                   /db_xref="GeneID:3656891"
FT                   /locus_tag="Tb927.4.3590"
FT                   /transcript_id="XM_839416.1"
FT   CDS_pept        complement(917162..917947)
FT                   /locus_tag="Tb927.4.3590"
FT                   /gene_family="HOG000207273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor 1-beta, putative"
FT                   /note="similar to SP:P34827:  25 kDa elongation factor
FT                   1-beta (EF-1-beta) {Trypanosoma cruzi}; go_component:
FT                   eukaryotic translation elongation factor 1 complex [goid
FT                   0005853]; go_function: translation elongation factor
FT                   activity [goid 0003746]; go_process: translational
FT                   elongation [goid 0006414]"
FT                   /db_xref="GI:72388170"
FT                   /db_xref="GeneID:3656891"
FT                   /translation="MCDHMYSPVFIPFAFFSIVKCHNKCSFVCNRSGKDMSIKDVNVKS
FT                   GKLEEKLKGKLFLGGVKPSEEDVKAFNDLLGGDNTNVFRWVKNIASFTEAERTAWGAPV
FT                   KITPPVAAPVAAPAAAPAAAPAATPAKKAAEADDDDIDLFGETTEEELAALEAKKKKDA
FT                   AAKSTKKVIIAKSSILFDIKPWDDTVDLQKLATELHAIKRDGLLWGDHKLVPIAFGVKK
FT                   LQQLVVIEDDKVSGDDLEEMIMSFGDAVQSMDIVAWNKI"
FT                   /protein_id="XP_844509.1"
FT   repeat_region   917562..917605
FT                   /rpt_family="tandem"
FT   repeat_region   917567..917622
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cag"
FT                   /rpt_type="tandem"
FT   gene            complement(<918023..>918334)
FT                   /note="synonym: Tb04.26G5.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656895"
FT                   /locus_tag="Tb927.4.3600"
FT   mRNA            complement(<918023..>918334)
FT                   /db_xref="GI:72388171"
FT                   /db_xref="GeneID:3656895"
FT                   /locus_tag="Tb927.4.3600"
FT                   /transcript_id="XM_839417.1"
FT   CDS_pept        complement(918023..918334)
FT                   /locus_tag="Tb927.4.3600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388172"
FT                   /db_xref="GeneID:3656895"
FT                   /translation="MRRMDPDAGGGDHDLLQCVLRLPLPNPEVASIMLQVLRVEPPVPG
FT                   TSREVQLWADDSARSTVFARLCATQERALRAAVAALLEQTKLVLRTLDAFPVDAPANV"
FT                   /protein_id="XP_844510.1"
FT   gene            complement(<918599..>919228)
FT                   /note="synonym: Tb04.26G5.450; serine/threonine-protein
FT                   phosphatase PP1, putative"
FT                   /db_xref="GeneID:3656890"
FT                   /locus_tag="Tb927.4.3610"
FT   mRNA            complement(<918599..>919228)
FT                   /db_xref="GI:72388173"
FT                   /db_xref="GeneID:3656890"
FT                   /locus_tag="Tb927.4.3610"
FT                   /transcript_id="XM_839418.1"
FT   CDS_pept        complement(918599..919228)
FT                   /locus_tag="Tb927.4.3610"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein phosphatase PP1,
FT                   putative"
FT                   /note="go_function: protein serine/threonine phosphatase
FT                   activity [goid 0004722]; go_function: hydrolase activity
FT                   [goid 0016787]; go_process: protein amino acid
FT                   dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:72388174"
FT                   /db_xref="GeneID:3656890"
FT                   /translation="MAQPMLVRLQAPINVCGDIHGQIGDLVEIFRAGGMPPATNYLFLG
FT                   DYVDRGKHGTEVIVVLLGLKILYPDGMCVLRGNHESDSICRIYGFFDEVKRRFSVKLFK
FT                   EFTDVFNCLPIAALIDDIALCMHGGLSPDLRNLRQIERIERPLIVPDTGLACDLLWADP
FT                   EEAGSGWMESERGVSYTFGEDIVKETCERLDIDVVLRARFQYFGSC"
FT                   /protein_id="XP_844511.1"
FT   misc_feature    920489..920574
FT                   /note="A-rich"
FT   gene            complement(<921728..>922612)
FT                   /note="synonym: Tb04.26G5.500; serine/threonine-protein
FT                   phosphatase PP1, putative"
FT                   /db_xref="GeneID:3656896"
FT                   /locus_tag="Tb927.4.3620"
FT   mRNA            complement(<921728..>922612)
FT                   /db_xref="GI:72388175"
FT                   /db_xref="GeneID:3656896"
FT                   /locus_tag="Tb927.4.3620"
FT                   /transcript_id="XM_839419.1"
FT   CDS_pept        complement(921728..922612)
FT                   /locus_tag="Tb927.4.3620"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein phosphatase PP1,
FT                   putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="go_function: protein serine/threonine phosphatase
FT                   activity [goid 0004722]; go_function: hydrolase activity
FT                   [goid 0016787]; go_process: protein amino acid
FT                   dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:72388176"
FT                   /db_xref="GeneID:3656896"
FT                   /translation="MTLVQTLLERMLSAKGSATQQQILIREEDIRTILNTVRDVFMSQP
FT                   MLLEITPPVRICGDIHGQYYDLLRVFEKCGFPPYSNYLFLGDYVDRGRHSVETITLLFC
FT                   YKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVVSEK
FT                   IICMHGGLSPDMTSLASVNEIERPLDVPDKGILCDLLWADPEDEVKGFLESDRGVSYLF
FT                   GEDIVTDFLDMVDMDLVVRAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVD
FT                   EKLQCSFLIIPAR"
FT                   /protein_id="XP_844512.1"
FT   gene            complement(<923649..>924533)
FT                   /note="synonym: Tb04.26G5.520; serine/threonine-protein
FT                   phosphatase PP1, putative"
FT                   /db_xref="GeneID:3656900"
FT                   /locus_tag="Tb927.4.3630"
FT   mRNA            complement(<923649..>924533)
FT                   /db_xref="GI:72388177"
FT                   /db_xref="GeneID:3656900"
FT                   /locus_tag="Tb927.4.3630"
FT                   /transcript_id="XM_839420.1"
FT   CDS_pept        complement(923649..924533)
FT                   /locus_tag="Tb927.4.3630"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein phosphatase PP1,
FT                   putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="go_function: protein serine/threonine phosphatase
FT                   activity [goid 0004722]; go_function: hydrolase activity
FT                   [goid 0016787]; go_process: protein amino acid
FT                   dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:72388178"
FT                   /db_xref="GeneID:3656900"
FT                   /translation="MTLVQTLLERMLSAKGNTAQRQILIREEDIRTILNAVRDVFMSQP
FT                   VVLDITPPVRICGDIHGQYYDLLRVFEKCGFPPYSNYLFLGDYVDRGRHSVETITLLFC
FT                   YKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNAKLFKAFTDVFNTMPVCCVVGEK
FT                   IICMHGGLSPDMTSLACVSEIERPLDVPDKGILCDLLWADPEEEVKGFLESDRGVSYLF
FT                   GEDIVTDFLDMVDMDLVVRAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVD
FT                   EKLQCSFAIIAAR"
FT                   /protein_id="XP_844513.1"
FT   gene            complement(<925570..>926454)
FT                   /note="synonym: Tb04.26G5.540; serine/threonine-protein
FT                   phosphatase PP1, putative"
FT                   /db_xref="GeneID:3656897"
FT                   /locus_tag="Tb927.4.3640"
FT   mRNA            complement(<925570..>926454)
FT                   /db_xref="GI:72388179"
FT                   /db_xref="GeneID:3656897"
FT                   /locus_tag="Tb927.4.3640"
FT                   /transcript_id="XM_839421.1"
FT   CDS_pept        complement(925570..926454)
FT                   /locus_tag="Tb927.4.3640"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein phosphatase PP1,
FT                   putative"
FT                   /EC_number="3.1.3.16"
FT                   /note="go_function: protein serine/threonine phosphatase
FT                   activity [goid 0004722]; go_function: hydrolase activity
FT                   [goid 0016787]; go_process: protein amino acid
FT                   dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:72388180"
FT                   /db_xref="GeneID:3656897"
FT                   /translation="MTLVQTLLERMLSAKGNTAQRQILIREEDIRTILNAVRDVFMSQP
FT                   VVLDITPPVRICGDIHGQYYDLLRVFEKCGFPPYSNYLFLGDYVDRGRHSVETITLLFC
FT                   YKIVYPENFFLLRGNHECASINKMYGFFDDVKRRYNIKLFKAFTDVFNTMPVCCVVGEK
FT                   IICMHGGLSPDMTSLAAVNEIERPLDVPDKGILCDLLWADPEEEVKGFLESDRGVSYLF
FT                   GEDIVTDFLDMVDMDLVVRAHQVMERGYGFFANRQLVTIFSAPNYCGEFDNDAAVMNVD
FT                   EKLQCSFAIIAAR"
FT                   /protein_id="XP_844514.1"
FT   gene            complement(<926853..>927362)
FT                   /note="synonym: Tb04.26G5.550; hypothetical protein"
FT                   /db_xref="GeneID:3656902"
FT                   /locus_tag="Tb927.4.3650"
FT   mRNA            complement(<926853..>927362)
FT                   /db_xref="GI:72388181"
FT                   /db_xref="GeneID:3656902"
FT                   /locus_tag="Tb927.4.3650"
FT                   /transcript_id="XM_839422.1"
FT   CDS_pept        complement(926853..927362)
FT                   /locus_tag="Tb927.4.3650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72388182"
FT                   /db_xref="GeneID:3656902"
FT                   /translation="MSVLVKGWGRGTCKINHIRDDDISSSESEGDDANVAVPLEELNVG
FT                   TQHMITEEMRFRLRRKEKLSVQDDELGRLREAMRRQVFASGLLQPGQSAGVAPRRAEII
FT                   FSCAVEIQSSGLMEEAPTASPRVGDTSAWLKQLRKFILDRVPFQRSVRVMVPRTWLARA
FT                   QETDVV"
FT                   /protein_id="XP_844515.1"
FT   gene            complement(<928224..>929669)
FT                   /note="synonym: Tb04.26G5.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656901"
FT                   /locus_tag="Tb927.4.3660"
FT   mRNA            complement(<928224..>929669)
FT                   /db_xref="GI:72388183"
FT                   /db_xref="GeneID:3656901"
FT                   /locus_tag="Tb927.4.3660"
FT                   /transcript_id="XM_839423.1"
FT   CDS_pept        complement(928224..929669)
FT                   /locus_tag="Tb927.4.3660"
FT                   /gene_family="HOG000256541" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388184"
FT                   /db_xref="GeneID:3656901"
FT                   /translation="MRCFGACGRVFFSVSTLHAPSLRRCRSISTGSGANLQKPSWIAQL
FT                   CSDAQKSEKTISCDVKVYDELSWRRRRFSFDKELWDPARMSSIVRRRLCLGNEEAEYTV
FT                   IGEAFAFADREDSPVVNEPQHSCKLLWDHNSSVEKLLIQISDHFPPLLWYAVKPTLESL
FT                   KRIFSEFLDVDAEHMKKNLPYYESVQNAMETSTQERLGVTLSPTSVKDRFVADMRRRDP
FT                   KDLELDYPCEYSVFLGTSPHFRLVEDRMMKSNPFVFGWPLLLSDGNEHLDGTPLRMAAF
FT                   RTVYSKSLLMFHTRLDLQVDHRLASSEAGEETLLDVPIFCNINYPKNTRLCGGKPLVQR
FT                   FNTVMGTTYPLDTPVDILAALAKEQCVKGPNELLEELRFLTAAAERAPDEERVFRISDD
FT                   QLSANRIVGQLAYTIIYVALVNYDRFIKDVFDVYKTHRSDMVRVACARGASIVGRPDLI
FT                   EQLISAEREGPCKNMLRGVVTTP"
FT                   /protein_id="XP_844516.1"
FT   gene            complement(<930042..>931415)
FT                   /note="synonym: Tb04.26G5.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656898"
FT                   /locus_tag="Tb927.4.3670"
FT   mRNA            complement(<930042..>931415)
FT                   /db_xref="GI:72388185"
FT                   /db_xref="GeneID:3656898"
FT                   /locus_tag="Tb927.4.3670"
FT                   /transcript_id="XM_839424.1"
FT   CDS_pept        complement(930042..931415)
FT                   /locus_tag="Tb927.4.3670"
FT                   /gene_family="HOG000256540" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388186"
FT                   /db_xref="GeneID:3656898"
FT                   /translation="MEKEFTKALQSCDKCSTFHDLCDCFDATVRPLVENCLCSALLKPV
FT                   RDHVSPNECNPQVSQLRDVLCNIRGGSDDVWFFLYRTAGSLLSRFTKKRMRNDKCNVST
FT                   LAVNVFVLFYGRALPDLSKLCLRWDFLRDEKKNYESDEAYVHSNAAERRKLMMSSVLSV
FT                   FSERAHRHYFTALWMPCLQHAAEAALHVHILHRMGDVILPYLTNPLVVADYLSGCFASG
FT                   GLIAVLALHGIFILMLDHGLEYPNYYQQLYTLLTPDSFASRHRYDLFRLLDLSLTSLRV
FT                   PAYIAAAFAKKVARVATLSPAPVLYFVLPFIRKVLQRHQNCLALIHRSTKEAFVPANDD
FT                   HEVAHSDAGDRAREAGRLAATLFDGNDPFVPDAPLGESHALHSTLWELTALERHFIPTV
FT                   PLMVSVFSSPAEDQAPLRYEKTYARLFTSEVTRPISKSQLPTVAYREPESEDGALLFV"
FT                   /protein_id="XP_844517.1"
FT   gene            complement(<931755..>932594)
FT                   /note="synonym: Tb04.26G5.600; protein phosphatase 2C,
FT                   putative"
FT                   /db_xref="GeneID:3656899"
FT                   /locus_tag="Tb927.4.3680"
FT   mRNA            complement(<931755..>932594)
FT                   /db_xref="GI:72388187"
FT                   /db_xref="GeneID:3656899"
FT                   /locus_tag="Tb927.4.3680"
FT                   /transcript_id="XM_839425.1"
FT   CDS_pept        complement(931755..932594)
FT                   /locus_tag="Tb927.4.3680"
FT                   /gene_family="HOG000256537" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein phosphatase 2C, putative"
FT                   /note="similar to GB:AAM43836.1:  T-cell activation protein
FT                   phosphatase 2C {Homo sapiens}; go_component: mitochondrion
FT                   [goid 0005739]; go_function: protein phosphatase type 2C
FT                   activity [goid 0015071]"
FT                   /db_xref="GI:72388188"
FT                   /db_xref="GeneID:3656899"
FT                   /translation="MFTPSTRFLCSARPLLWFGRRGVFAAPHPEKAKTGGEDAFVVHTS
FT                   GIGVADGVGGYASYGVDPGVYTRNVMKHTLRALQEDDNRGTIGALQALTYGYTEAQKLK
FT                   QPGGCPVTLVTLLDGRFASVLNLGDCGTICLRSSKLFFATEPQQHSFNCPYQLPEDPPS
FT                   VGDRTTLEVSEGDVFLCASDGLLDNVDMSDILRHLDAVNRDGCQRVAENLVACACRNGA
FT                   NKGFDSPFAKQARAVGYHYMGGKQDDVTVVVAQLTRGTVAPDDCPSLITELLDVHKT"
FT                   /protein_id="XP_844518.1"
FT   gene            complement(<932834..>934153)
FT                   /note="synonym: Tb04.26G5.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656903"
FT                   /locus_tag="Tb927.4.3690"
FT   mRNA            complement(<932834..>934153)
FT                   /db_xref="GI:72388189"
FT                   /db_xref="GeneID:3656903"
FT                   /locus_tag="Tb927.4.3690"
FT                   /transcript_id="XM_839426.1"
FT   CDS_pept        complement(932834..934153)
FT                   /locus_tag="Tb927.4.3690"
FT                   /gene_family="HOG000260546" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388190"
FT                   /db_xref="GeneID:3656903"
FT                   /translation="MLRRTVTSLRNARELHRLLPALLPLLDPPVPTGASVCAAHLIVAT
FT                   GHVSKQREPHMSNCPVLERKIPLSEIASDDNFLKHPCVPCLKHRINFLASEDFCYDFVE
FT                   RCGCGTDGALPPEWRCIVERQFGSMAALVEELVIHASNRREAGWTWLVYDAQQAGERPL
FT                   LVVNMPAQRSPLLLGLWPLAVVNVTEAVLVEAVRAESSGSVAAAPPPPWCRAARASLYD
FT                   TKAAAEAFAMTAPMSEGVGKKLSEIREKVARDAVSRMNWGFILQQLKKAETYYASSDRG
FT                   EKIRVHRMKLEREAVTKAMSGLRDSGATFLTHDTVEVTTTPSANSEPSSPERVPGVQAK
FT                   QPQTEGMDPCENKASAEPDPKCTQLPDGTWQYSYRNGDVTLLKPDGTRVFRKRELTTTA
FT                   YPDGSMLFQYANNTSILDRADGVRVTTFEDGTTKEEMIRR"
FT                   /protein_id="XP_844519.1"
FT   gene            complement(<934467..>936983)
FT                   /note="synonym: Tb04.26G5.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656904"
FT                   /locus_tag="Tb927.4.3700"
FT   mRNA            complement(<934467..>936983)
FT                   /db_xref="GI:72388191"
FT                   /db_xref="GeneID:3656904"
FT                   /locus_tag="Tb927.4.3700"
FT                   /transcript_id="XM_839427.1"
FT   CDS_pept        complement(934467..936983)
FT                   /locus_tag="Tb927.4.3700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388192"
FT                   /db_xref="GeneID:3656904"
FT                   /translation="MRRSLTLWISKLWRPHAEHIQSLIARSVSEPRELQQARTYLHELK
FT                   FEQSIEEVDDATDLLYFMHRVSYPAESHLEMKVGEFLSKCAPQVCGQHILAIGKRIQEE
FT                   PGSGPLWSRVVFERGWFTSSVVAMLSTMTLEEHLTLCASYWHSLLPTPQSRCGRQLVSG
FT                   SFVAVSTRLAALTAQRIEGCGDNRPCAVCLCAKLGIFLRGDTFAELRAVTLSITREMLS
FT                   AAQVLEVANVLATRRSAETANSEWLVALQEALCRRRTGEVEAAHAVGLLHSMAVLNETT
FT                   LSEMFEDLLLQLLPGMSQDEILKCCESLSTLSGTAPRIRTELHRTLCTMAVAGAKGKNF
FT                   VDKAVPWRLRCLSMVAPQEAGKLLGRFEENIQDAEASLSPSDTRDLIRAMRSLRVFPPR
FT                   AVTLCKASYLANPLQSFNQQDAVYMMYAGARTGESATSAFFKEVVNRFTTVRKFDRRKS
FT                   GPHQTSVLTAELLEMVLQALQIAKGRSLLDDARVYAVLRRTLEQLQREGSLSTEANIRL
FT                   LRLLAGLNVGNASLPTVLLTNVSRALTSLTSADVRELCEVLVALKSRDVLMFRALLEHL
FT                   GRCGPDRTSLTAIAVAARKLKFVTYFQQSGLLQNLTSLEGWSVSDIVLIAATCSENRRA
FT                   GFLALPGADVLAQAQAEDLTTLDLFLIISIVADARKQLLSMASALSKRQPLGANDLEAE
FT                   DALRAIVNVVDDKDALAAVCRSATSALQAMDENMLMRTLEAVRRAPELPNVFFRVVGRC
FT                   VLRLANSMTADNAIQWLELYVKHSIRDDSVGKALLSKARTRSSNCADLTDKSIRKAAAM
FT                   YGKSYALHCKLKKNKEKPEWRSFEVG"
FT                   /protein_id="XP_844520.1"
FT   gene            complement(<937266..>937775)
FT                   /note="synonym: Tb04.26G5.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656908"
FT                   /locus_tag="Tb927.4.3710"
FT   mRNA            complement(<937266..>937775)
FT                   /db_xref="GI:72388193"
FT                   /db_xref="GeneID:3656908"
FT                   /locus_tag="Tb927.4.3710"
FT                   /transcript_id="XM_839428.1"
FT   CDS_pept        complement(937266..937775)
FT                   /locus_tag="Tb927.4.3710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388194"
FT                   /db_xref="GeneID:3656908"
FT                   /translation="MRVNRTQPTCLSLLFQVLLYCTCSWCVFWFVTTLSLLIFKGATLY
FT                   FPPTALFMEIISVFLLLVLGISTLALGKRGNLLEEVGSTSLTVFLLLVGIGGAVYYMWL
FT                   QTYVMMLDFIVSLVMLVLDTLTALCGACTAFGLFRSRRSKWNGILLVGKAPPIAVVVDI
FT                   KHGKGD"
FT                   /protein_id="XP_844521.1"
FT   gene            complement(<938073..>938900)
FT                   /note="synonym: Tb04.26G5.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656906"
FT                   /locus_tag="Tb927.4.3720"
FT   mRNA            complement(<938073..>938900)
FT                   /db_xref="GI:72388195"
FT                   /db_xref="GeneID:3656906"
FT                   /locus_tag="Tb927.4.3720"
FT                   /transcript_id="XM_839429.1"
FT   CDS_pept        complement(938073..938900)
FT                   /locus_tag="Tb927.4.3720"
FT                   /gene_family="HOG000260543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388196"
FT                   /db_xref="GeneID:3656906"
FT                   /translation="MPVKNPFAVPLFSLWRGPLELNQLLCTTVHHLSAQFCCHCHYIPE
FT                   TMPSRRVTKNGTRGSHQVHMNKVKFDPYRYKLDDEKVPASVLARMTSLCCRRCCDILQW
FT                   KVDYGKYAQLQRRKKCNHCGENSISHAYHHICQTCAATLRCCAKCQKPPGTPYEATTME
FT                   SSGEDTEDCDSEGDPHGDASVPRQGGGTGAMPVKRSSCSNFLFVDREDSDEDLKPLRGL
FT                   DIRQLKASKQANVRQQERERLGRLRERERRTILRRSAKGPGCDDEDDDSIDEE"
FT                   /protein_id="XP_844522.1"
FT   gene            complement(<938989..>939501)
FT                   /note="synonym: Tb04.26G5.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656909"
FT                   /locus_tag="Tb927.4.3730"
FT   mRNA            complement(<938989..>939501)
FT                   /db_xref="GI:72388197"
FT                   /db_xref="GeneID:3656909"
FT                   /locus_tag="Tb927.4.3730"
FT                   /transcript_id="XM_839430.1"
FT   CDS_pept        complement(938989..939501)
FT                   /locus_tag="Tb927.4.3730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388198"
FT                   /db_xref="GeneID:3656909"
FT                   /translation="MFTGRWVYTKGCTVADLVTDESTQKPIMNETDGMTASCGCVLFLK
FT                   SDVVGAMESDGPQSGKEYDEQDLLFSVVSWARGAGNTHDEYLTTNGAEAPSHFPITSLG
FT                   PWTVIEQCAGDPCSFGVVAGFVLRRPAGGDSDVVLWEWGELASCSTLSQLSLYLDNPTS
FT                   MGGKCLT"
FT                   /protein_id="XP_844523.1"
FT   gene            complement(<940044..>945122)
FT                   /note="synonym: Tb04.26G5.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656912"
FT                   /locus_tag="Tb927.4.3740"
FT   mRNA            complement(<940044..>945122)
FT                   /db_xref="GI:72388199"
FT                   /db_xref="GeneID:3656912"
FT                   /locus_tag="Tb927.4.3740"
FT                   /transcript_id="XM_839431.1"
FT   CDS_pept        complement(940044..945122)
FT                   /locus_tag="Tb927.4.3740"
FT                   /gene_family="HOG000136050" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388200"
FT                   /db_xref="GeneID:3656912"
FT                   /translation="MALLNVISENPLTLQPGQVIAFDHLANGEHWQWALGTVVSSDKHV
FT                   VVVEQWAVNEGSCETLKHNISSEIQKEMKRMGVFQEQLSSARDKLAAIRSENEDRVSAA
FT                   RAVFEDAKARVASVDEVHMREVTSQACPSPVAVEVLKSVLALAQNDPTVTNCSTWDDIR
FT                   MEYRRPNAIADFISADITGKTYPNAEEICSSLNEQRLSSLAASRDSEAISSLHHWVLSA
FT                   LAYQEAYCRLTTDTRVQEQNDAIANCIAGMKGCRLKVMKLKEELERGGTPTFGGQLTSF
FT                   TKTSVQLKAPLSSVISIVGVDPSAQDCVLTDDEVGLILDKAEQTRLQINDHFSHLSNSY
FT                   MEAMAELHCLSMYTSELEERRLNLQERFVFSLFTNAGKTNAPRRERIETDVGLRSVEAP
FT                   RGDSANNIKDLQEIIKELSSHDERWMYRNEPTVTTKHRKSYPGREWSKVVERKPEELLS
FT                   TFRTEQAAACHVPEDAIRNIEFTATSEKLQVSFDVQHPVKQTAAEINKRLQEFPSRGMD
FT                   RMLCDVDQPKKGLDRAIVEVCRAFDLREHAFRGMTFDKFIEEVAMKGRVGDKDAYESEI
FT                   GDLLMLLDKIHNENRSLQYTLEKSAEEFRRQTASTMREQESLRQRNGELHAEIGRLRDL
FT                   VEKLRDLADNQASELELLKLQKTQANQIRAQRNLSTFRGDDTAEPVYCVTLDELREQTE
FT                   HCDQVERELERQREQCQNLLNAQDDLLAELSGVSEEKEKLEAECERLEAELRQMEEKSR
FT                   LSEQGLSEMTQRLEEKQAEIEGLLENLEQLDEQLEALRAAEKSAQAHIEARDREISDLQ
FT                   QRLEGEIDDHIKTTALLEELRKHYNNLEELFDKQEAELMAYREKRQNAHKVRSLEPTLR
FT                   PIGTQTKPFQEMVSADEISSEPLLSVTLDEYNDHMHRSNQFQQENDLLRQQLQQANDER
FT                   ENLHDRLEQLMAENQSLSEQLHNMHEELEREERDRSGVTLQNERLAEEIQRKTAENEQL
FT                   VLENNKSRSDIRNLNVQVQRLMEELELKAAENEKLAEELELKAAENEKLAEELELKVAE
FT                   NEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEK
FT                   LAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAE
FT                   ELELKVAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEELE
FT                   LKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKA
FT                   AENEKLAEELELKVAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAEN
FT                   EKLAEELELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKL
FT                   AEELELKAAENEKLAEELELKAAENEKLAEELELKVAENEKLAEELELKAAENEKLAEE
FT                   LELKVAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELELKAAENEKLAEELEL
FT                   KVAENKRLAEEVTQRLSEKELLAEDTSARLLEADSANSALQCKVKHLEEKLTLLSSEKE
FT                   TALATLEAEIVDLLTQLKGLNGTNSALESLCASKEKELVFLREHCELWTDPTTKKEKVI
FT                   TRHVKVFDGNEWMKLITDRPEALMSAFVIDAGNACHVPGDQIHEVSFLNNKEKH"
FT                   /protein_id="XP_844524.1"
FT   repeat_region   940534..942089
FT                   /rpt_family="tandem"
FT   repeat_region   950657..952505
FT                   /transposon="DIRE"
FT   misc_feature    952734..1017326
FT                   /note="sequence corresponds to BAC RPCI93-30O21"
FT   misc_feature    954064..954183
FT                   /note="A-rich"
FT   misc_feature    complement(954064..954183)
FT                   /note="T-rich"
FT   repeat_region   complement(954217..957771)
FT                   /rpt_family="tandem"
FT   misc_feature    957874..957914
FT                   /note="T-rich"
FT   misc_feature    complement(957874..957914)
FT                   /note="A-rich"
FT   repeat_region   complement(959473..962236)
FT                   /transposon="DIRE"
FT   repeat_region   complement(962248..962500)
FT                   /transposon="RIME-B"
FT   repeat_region   complement(962501..962748)
FT                   /transposon="RIME-A"
FT   gene            <973266..>977090
FT                   /note="synonym: Tb04.30O21.310; receptor-type adenylate
FT                   cyclase GRESAG 4, putative"
FT                   /db_xref="GeneID:3656907"
FT                   /locus_tag="Tb927.4.3750"
FT   mRNA            <973266..>977090
FT                   /db_xref="GI:72388201"
FT                   /db_xref="GeneID:3656907"
FT                   /locus_tag="Tb927.4.3750"
FT                   /transcript_id="XM_839432.1"
FT   CDS_pept        973266..977090
FT                   /locus_tag="Tb927.4.3750"
FT                   /gene_family="HOG000063251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="receptor-type adenylate cyclase GRESAG 4,
FT                   putative"
FT                   /EC_number="4.6.1.1"
FT                   /note="similar to GB:CAD21877.1:  ESAG4 {Trypanosoma
FT                   brucei}; go_component: integral to membrane [goid 0016021];
FT                   go_function: adenylate cyclase activity [goid 0004016];
FT                   go_process: intracellular signaling cascade [goid 0007242]"
FT                   /db_xref="GI:72388202"
FT                   /db_xref="GeneID:3656907"
FT                   /translation="MCNIRSSFLCALSPFLLSTTILPAISVGNKLEQLGGPIMFSFTPR
FT                   VGLSFDISGRRGADNSGLCRPHRLRLATVVMLLLFMAPPALSEDVMTVRVYSLLYNPLI
FT                   PDNLCDAINAGLNASLASRKWTVAPDVKVELISPTSYKIKPVEVLQVALERHKGEFFVV
FT                   IGPVGDGQALASLPLLERENLVGFAPSTGSNAMRGWNPHVYFLSASPNAELLTLVRYAV
FT                   SQLRLLRIGFMYLRGISFGDTEYKMTTSLMSSVGRELCGVFTVDGLMRGRVNDDDFNTA
FT                   WEQFAETRPQGVIAFAPPAKDLIKFVKRLLSDSRTHDAYLLSSSSLEFALDTWREALEA
FT                   DGAEFFLGQLMLTRTGPLARDTHYQAIRRFQDHMRSYLSANPGVTVFNGTDNFDHDDVD
FT                   GELMVYGWIAGEVLSQALSSREWLTSRKAFMESLYNQRRYVIDDLVIGDFGGDCKGGAG
FT                   ERGAACNCNQGGNVLYINVVGNDERFHTVQGGTTVFEPSRCLAESVRLYSPLNTLMFLM
FT                   LDRELAQVSSEALYYGANVLTGNGRFGQSDRLFISMIPSPSNATYLALQSELDTRSVTA
FT                   VFGVVDDAMLSIAEVAFVDPVMLTPRLHHRGRNVIQLSPTLEQQLFVVVGYVTNTSASA
FT                   PMSAIVRGADATIIEVALRKIVWMHGGTLQTVAVLDDNATLVGRLPNRGNAFVIGLAPG
FT                   DPSLLAAHLDRNPDVRVLIPFFDVALMYDELVSAFNGNPNAERVQFATSLPHWADANTS
FT                   SEIVREFHTALPDSSAWKPLPLLGYAAARFAQAVLPRMEYVTPKTLLDTIYMQSIITAD
FT                   EMRYGPFEEEEEKECFTANDPVPEQGEVCVVNYGATRISMWSLARALNASVPPLTSPVT
FT                   PLIRYADPNAIKLSSAQLAGVIVGSLVALALFAAPLVVVLYVLRRGARDNDSAPKEPME
FT                   PVTLIFTDIESSTAQWAAHPELMPDAVSTHHRLIRSLIVQYGCYEVKTVGDSFMIACKK
FT                   PFAAAQLASDLQRCFLRHEWGTTAFDDSYREFERQRADDDNEYKAPSARLDPEVYRQLW
FT                   NGLRVRVGVHTGICDIRRDEVTKGYDYYGRTSNMAARTESVANGGQVLLSRAAYLSLSN
FT                   SERGQLDVTALGSMSLRGVPKPVEMYQLNAVVGRSFAALRLDREVVEDGDLSSTSFSDT
FT                   GSLRGVLSGTSQMIDSCLHAVLGTLGPSQRQKLLMPLCERWQVSLPPSSKATWNEEYCE
FT                   GVIRRIAVKVGRVVDHCAASGSERSASTLRSASLIIISNHGLDGEARTT"
FT                   /protein_id="XP_844525.1"
FT   misc_feature    979475..979498
FT                   /note="AT_rich"
FT   misc_feature    complement(979475..979498)
FT                   /note="AT_rich"
FT   repeat_region   979704..979999
FT                   /transposon="VAS"
FT   misc_feature    980184..980251
FT                   /note="T-rich"
FT   misc_feature    complement(980184..980251)
FT                   /note="A-rich"
FT   repeat_region   980683..980709
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(980683..980709)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    980756..980781
FT                   /note="AT_rich"
FT   misc_feature    complement(980756..980781)
FT                   /note="AT_rich"
FT   repeat_region   981063..981156
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(981063..981156)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   981215..981301
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(981215..981301)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   981398..981427
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(981398..981427)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<981586..>982791)
FT                   /note="synonym: Tb04.30O21.270; hypothetical protein"
FT                   /db_xref="GeneID:3656905"
FT                   /locus_tag="Tb927.4.3760"
FT   mRNA            complement(<981586..>982791)
FT                   /db_xref="GI:72388203"
FT                   /db_xref="GeneID:3656905"
FT                   /locus_tag="Tb927.4.3760"
FT                   /transcript_id="XM_839433.1"
FT   CDS_pept        complement(981586..982791)
FT                   /locus_tag="Tb927.4.3760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72388204"
FT                   /db_xref="GeneID:3656905"
FT                   /translation="MVRNMGGNAPNAARKPTPAVPQYVVFRYPTQNIPSFEPLRPMHPK
FT                   LHDIMTQRRGITSPHVPAPVTGFVSRNDYGGGTLQFRTTTAPPHAPVTRMEGINEKYWD
FT                   KCKRSYGTKLNFAPRVAKKNLHTQHPSQGMVKWVAGTPVMGESPANYPSAHFHQSYVKR
FT                   NFPQTFNSTTVMGMCPQKRMRADGASEPQKNYPPQYKYDEWSERERGEGSNGNSDNNNN
FT                   NINIINNNNNNSNNSDDDPLLLLHGINELGQVQKFRCRKSYLLELAEAVRIADRLRCEI
FT                   PNAINEPYREQQPDTSSRSESADNNDEVQDEEMHSEHLNAQSREQMDGEETSSISSTSS
FT                   SSTSNSISDSPVKDGMHFRDMFRKRAHTLGYEISDNVAVEVAPPYGMEAAGEKRNEIQS
FT                   EG"
FT                   /protein_id="XP_844526.1"
FT   repeat_region   982072..982147
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(982072..982147)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(982094..982139)
FT                   /rpt_family="tandem"
FT   misc_feature    982808..982862
FT                   /note="T-rich"
FT   misc_feature    complement(982808..982862)
FT                   /note="A-rich"
FT   repeat_region   982919..982963
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cagtt"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(982919..982963)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="aactg"
FT                   /rpt_type="tandem"
FT   misc_feature    983002..983024
FT                   /note="AT_rich"
FT   misc_feature    complement(983002..983024)
FT                   /note="AT_rich"
FT   misc_feature    983135..983204
FT                   /note="A-rich"
FT   misc_feature    complement(983135..983204)
FT                   /note="T-rich"
FT   misc_feature    983264..983289
FT                   /note="AT_rich"
FT   misc_feature    complement(983264..983289)
FT                   /note="AT_rich"
FT   misc_feature    983351..983429
FT                   /note="A-rich"
FT   misc_feature    complement(983351..983429)
FT                   /note="T-rich"
FT   repeat_region   983503..983556
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(983503..983556)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(983511..983543)
FT                   /rpt_family="tandem"
FT   misc_feature    983575..983615
FT                   /note="AT_rich"
FT   misc_feature    complement(983575..983615)
FT                   /note="AT_rich"
FT   repeat_region   983862..983898
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(983862..983898)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   repeat_region   984068..984100
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(984068..984100)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    984134..984171
FT                   /note="AT_rich"
FT   misc_feature    complement(984134..984171)
FT                   /note="AT_rich"
FT   repeat_region   complement(984135..984171)
FT                   /rpt_family="tandem"
FT   repeat_region   984258..984289
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(984258..984289)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttaa"
FT                   /rpt_type="tandem"
FT   repeat_region   984392..984423
FT                   /rpt_family="polypurine"
FT   repeat_region   complement(984392..984423)
FT                   /rpt_family="polypyrimidine"
FT   misc_feature    984476..984503
FT                   /note="AT_rich"
FT   misc_feature    complement(984476..984503)
FT                   /note="AT_rich"
FT   misc_feature    984522..984544
FT                   /note="AT_rich"
FT   misc_feature    complement(984522..984544)
FT                   /note="AT_rich"
FT   repeat_region   984593..984619
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(984593..984619)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    984693..984785
FT                   /note="A-rich"
FT   misc_feature    complement(984693..984785)
FT                   /note="T-rich"
FT   repeat_region   984801..984832
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(984801..984832)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(984871..984914)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   984983..985002
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(984983..985002)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   misc_feature    985195..985277
FT                   /note="AT_rich"
FT   misc_feature    complement(985195..985277)
FT                   /note="AT_rich"
FT   repeat_region   985325..985362
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(985325..985362)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   985442..985477
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(985442..985477)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    985605..985646
FT                   /note="AT_rich"
FT   misc_feature    complement(985605..985646)
FT                   /note="AT_rich"
FT   repeat_region   985826..985856
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(985826..985856)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   misc_feature    985979..986018
FT                   /note="AT_rich"
FT   misc_feature    complement(985979..986018)
FT                   /note="AT_rich"
FT   repeat_region   986048..986075
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(986048..986075)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttaa"
FT                   /rpt_type="tandem"
FT   repeat_region   986151..986176
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(986151..986176)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    986184..986261
FT                   /note="A-rich"
FT   misc_feature    complement(986184..986261)
FT                   /note="T-rich"
FT   misc_feature    986501..986551
FT                   /note="T-rich"
FT   misc_feature    complement(986501..986551)
FT                   /note="A-rich"
FT   gene            complement(<986612..>988069)
FT                   /note="synonym: Tb04.30O21.210; protein kinase, putative"
FT                   /db_xref="GeneID:3656913"
FT                   /locus_tag="Tb927.4.3770"
FT   mRNA            complement(<986612..>988069)
FT                   /db_xref="GI:72388205"
FT                   /db_xref="GeneID:3656913"
FT                   /locus_tag="Tb927.4.3770"
FT                   /transcript_id="XM_839434.1"
FT   CDS_pept        complement(986612..988069)
FT                   /locus_tag="Tb927.4.3770"
FT                   /gene_family="HOG000258317" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72388206"
FT                   /db_xref="GeneID:3656913"
FT                   /translation="MSYTTESAFYRKYHLTDRTPIGKGTFALVYKCVNRITKESYAVKI
FT                   VDKNMTLPNDIQSVSLEVHIMKQIGNHPHVARLVDYFETRESIYIVMDLLSGGMVFDRI
FT                   AELSHYDEKIAADLVRNVLSGLVHIHSRGIIHRDLKPENLLLRPQRDSDDTSWLSDVCI
FT                   SDFGLASTGPGKACCGTAKYIAPEVVKVGYYGTVKGTYDNKCDVWSLGVITFVLLSGKM
FT                   PFYGATHREIFRRIVDGKWSFGGPIWNTISLMGKSFIRSCLTRDPAKRPSARELLNHPW
FT                   ITDDQPDKHLGESIEEIRSLTAITKLRGATAVIRTSHEMLGGIDSCASFTKHLRHKDKL
FT                   STIIEVVSQTDPTVVHLVDFGKVLASRGGHKLQDCCSCSSQTVCRHIQNVHEYLFVGNR
FT                   RRKVYPFLYSLRAMQSNAELDVKLSLGKDDRAGKVLSAVEKIIEAAFAFSTALEAVPQE
FT                   RLKGNVPIDCEWRQVSERTKALVSGCK"
FT                   /protein_id="XP_844527.1"
FT   repeat_region   988125..988170
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(988125..988170)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<989012..>989419)
FT                   /note="synonym: Tb04.30O21.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656916"
FT                   /locus_tag="Tb927.4.3780"
FT   mRNA            complement(<989012..>989419)
FT                   /db_xref="GI:72388207"
FT                   /db_xref="GeneID:3656916"
FT                   /locus_tag="Tb927.4.3780"
FT                   /transcript_id="XM_839435.1"
FT   CDS_pept        complement(989012..989419)
FT                   /locus_tag="Tb927.4.3780"
FT                   /gene_family="HOG000259244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388208"
FT                   /db_xref="GeneID:3656916"
FT                   /translation="MFRNRFFIRLQSNKGVGHHKFPRRATHHAVSSAKLGKERFDLMES
FT                   LRRDREEAERNRMLPWRSRLKKLQEYPWKFFIAFMVFWSWLGTYAVPYLKNMRPGELPT
FT                   VWEGRPIPKELKERATPMPHFRRLSKGIDES"
FT                   /protein_id="XP_844528.1"
FT   repeat_region   989623..989671
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(989623..989671)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    complement(990275..990318)
FT                   /note="T-rich"
FT   misc_feature    990477..990551
FT                   /note="CT-rich"
FT   misc_feature    complement(990477..990551)
FT                   /note="GA-rich"
FT   gene            complement(<990552..>991949)
FT                   /note="synonym: Tb04.30O21.180; ubiquitin carboxyl-terminal
FT                   hydrolase, putative"
FT                   /db_xref="GeneID:3656917"
FT                   /locus_tag="Tb927.4.3790"
FT   mRNA            complement(<990552..>991949)
FT                   /db_xref="GI:72388209"
FT                   /db_xref="GeneID:3656917"
FT                   /locus_tag="Tb927.4.3790"
FT                   /transcript_id="XM_839436.1"
FT   CDS_pept        complement(990552..991949)
FT                   /locus_tag="Tb927.4.3790"
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin carboxyl-terminal hydrolase, putative"
FT                   /EC_number="3.1.2.15"
FT                   /note="go_function: cysteine-type endopeptidase activity
FT                   [goid 0004197]; go_function: ubiquitin thiolesterase
FT                   activity [goid 0004221]; go_function: ubiquitin-specific
FT                   protease activity [goid 0004843]; go_process:
FT                   ubiquitin-dependent protein catabolism [goid 0006511];
FT                   go_process: protein deubiquitination [goid 0016579]"
FT                   /db_xref="GI:72388210"
FT                   /db_xref="GeneID:3656917"
FT                   /translation="MVPVKVKWGRETFELTVDLRSTVKCFKEQLQQLTSVPVERQKIMG
FT                   VKASQCNDNEVTLEAAGVAAGKTLMLIGTAAEVVRATPIVATGNKDSAVQAPASHPAEK
FT                   QAVGLQNIANTCYMNAAVQMLRLVPEVRDVLNFNANDPIVSELLKLYNTMDTKRDPVVP
FT                   ASLWSILLAHFPTFAEVNEKGHPMQHDSQEALNALLQRINSCLPESHKRLFTGNLSQKM
FT                   VCKDDPDDQPVLHDVPFLMLSCNIDAEIETLEAGLEAAFNETVKLHSEKLAREALHTRT
FT                   SRIAAMPEYLFIHMVRFSWRSDIQSKAKILKPVTFPMTLDLHALCAEEYKPELEVERKR
FT                   VLKRRDIEMERRRAAKNKTKLDDDEAAPAEDASNTAEPINTTVGNHSGYYELCGVISHK
FT                   GRSADSGHYVFWGKYADQWMVLDDSNTAAVSEEDVKRLRGSGEAHIAYVLMYRSRDPRT
FT                   KQSVIPL"
FT                   /protein_id="XP_844529.1"
FT   misc_feature    991958..992068
FT                   /note="T-rich"
FT   misc_feature    complement(991958..992068)
FT                   /note="A-rich"
FT   repeat_region   993045..993080
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(993045..993080)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(993045..993078)
FT                   /rpt_family="tandem"
FT   gene            complement(<993461..>994429)
FT                   /note="synonym: Tb04.30O21.150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656915"
FT                   /locus_tag="Tb927.4.3800"
FT   mRNA            complement(<993461..>994429)
FT                   /db_xref="GI:72388211"
FT                   /db_xref="GeneID:3656915"
FT                   /locus_tag="Tb927.4.3800"
FT                   /transcript_id="XM_839437.1"
FT   CDS_pept        complement(993461..994429)
FT                   /locus_tag="Tb927.4.3800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388212"
FT                   /db_xref="GeneID:3656915"
FT                   /translation="MEKRVIPTLYRHVLKKVVMITRMGAGRIALDRYAEYLPTAYVVGE
FT                   GDGLSSIARKVFEETPLKACNVTNGFHFVKDVTDSVLDLEVLALWDAYTRKGECELLEG
FT                   IAIVSAALRLAGVPEAKGDGDMTTLVNNTLCGLQSIVSDIRGILESSDFVSKVHRRRSY
FT                   MSFLRSAVSVLQERGYSVSELVVEECSAESLVCSKKASAIVMNAVLVVVLRELGLQCTL
FT                   AGVELQQPWIRVEKSNRAPIFLSFARAGAYTAEEVIGFAHESQRTHRSLHFTPWGMHCR
FT                   RQILLAMLKRQLMMLSSDPKVSVVREKQQHMCQTQILFLLS"
FT                   /protein_id="XP_844530.1"
FT   gene            complement(<994756..>998328)
FT                   /note="synonym: Tb04.30O21.140; DNA-directed RNA polymerase
FT                   II subunit 2, putative"
FT                   /db_xref="GeneID:3656910"
FT                   /locus_tag="Tb927.4.3810"
FT   mRNA            complement(<994756..>998328)
FT                   /db_xref="GI:72388213"
FT                   /db_xref="GeneID:3656910"
FT                   /locus_tag="Tb927.4.3810"
FT                   /transcript_id="XM_839438.1"
FT   CDS_pept        complement(994756..998328)
FT                   /locus_tag="Tb927.4.3810"
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase II subunit 2,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA-directed RNA polymerase activity [goid 0003899];
FT                   go_process: transcription [goid 0006350]"
FT                   /db_xref="GI:72388214"
FT                   /db_xref="GeneID:3656910"
FT                   /translation="MMDDELLLQLNEVEEITDDDVDDIHRVAGMENVNTADIDSEDIWE
FT                   IISSFFREKGLVHQQVDSYNDFLLRIPRMARSLLEIVPRQDDQFDPGVHVESEPDQYRL
FT                   SLEDVVVGNPSHEMSGFSRTEMHPLFPNECRLRDLTYDAVAQVTLAIRVYRSREEQPYR
FT                   TFLQNMELGRIPIMLKSMRCNLLNKDEEELPRLNECPHDQGGYFIVNGTEKVLIAQERQ
FT                   AANHVYAFTRPKGLLCEIKSIVEGSLNKPRTLQILMPYKKSGPGHGYENLLCRVAQMDE
FT                   LIPLFVLFRALDMGSDKEILQTVVPDLKDVAMLEMLRGSMEDASTLEIFTRDEALWFIG
FT                   KRLGKQDSRENLQREAQDLLMRDLLPHMGVDCAADRGKCLFIGYMVHRLLLLALGRRED
FT                   TDRDFLGHKRIDVAGSLLTFQLNQFLVQVRREMAQTVHDYSTNRGGVVSFGRILHNRLI
FT                   TDGMRRCLATGNFGDLKSGNIKTGVSQTLNRLTYSSSLSNLRRIQNPISASSKATRPRN
FT                   LHCTQWGYICPVETPEGGSIGLLKNLALMCLVSRGSDHTGVVQAVQSRITGFHSIALSD
FT                   LADVRVARVFVNGTLIGVHGDPERLLRDLRARRRGGELSNEVSIVRDIRDREIRVFSDG
FT                   GRCLRPLFVVEKSRIKLQKAGIGELLEPSTTLGGRREISWNKVMKKGYVELIDCEEEDS
FT                   LLIAMVPSEVGKNYFYSHCEMDPSMILGICASIIPYPNHNQSPRNTYQSAMGKQAMGIY
FT                   ASNFNMRMDTTAHVLFYPQKPLVRTKAMSYMRSNDLPAGHNAIVAIACYSGYNQEDSII
FT                   MSRSAVERGFFRSVFWRSYKASEEKKREGREMFEIPDRKVCHVKRADYTKLDTDGLIKP
FT                   GMPVIGGDIIVGKTIPVPKTLSEESPVSDTRILKRDCSISSRAAEKGVVDRVMLTENKG
FT                   NRFTKVRIRTIKIPNIGDKFCSRHGQKGTNGIQFRQEDMPFNHDGISPDLIINPHAIPS
FT                   RMTVAHLIETLAGKVACYKGGEVYATPFCSVVVEDFGKALTQLKLNRYGNERLYNGHTG
FT                   LPLDHLIFFGPTYYQRLKHLSSDKIHARPRGPLQPLVRQPTEGRAHEGGLRFGEMERDC
FT                   MLSYGASQWLRERLFRVSDYYSVHVCNMCGTICAADTDQNLYKCQGCDNDSHISQVLMP
FT                   YACKLLFQELMSMAILPRLGTGPL"
FT                   /protein_id="XP_844531.1"
FT   repeat_region   999116..999142
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(999116..999142)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   gene            complement(<999703..>1001052)
FT                   /note="synonym: Tb04.30O21.110; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656911"
FT                   /locus_tag="Tb927.4.3820"
FT   mRNA            complement(<999703..>1001052)
FT                   /db_xref="GI:72388215"
FT                   /db_xref="GeneID:3656911"
FT                   /locus_tag="Tb927.4.3820"
FT                   /transcript_id="XM_839439.1"
FT   CDS_pept        complement(999703..1001052)
FT                   /locus_tag="Tb927.4.3820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388216"
FT                   /db_xref="GeneID:3656911"
FT                   /translation="MIKCPVLTFSPYLLVSQGPPSPLMNDLRQRALRCRAQLTERLQPY
FT                   TEKLDGALQTGFDISLRTLKRAFMILTAVGAALLILLIVLLVCLVASVLGSLFIRWYVL
FT                   LLAPGTELFTLSFNTMPLETEQWRLHKLNNMVSQLEPTRESPLLHRGDENSTASLVGLG
FT                   GGVNANLVSVLQNEAAGLKMSLITKLVRNTVATSTLVIPSRVYRQVFLPHGGVSVEGLF
FT                   KQRKPMFNARGVYAAKMQLVFAKEDIGREVSMFLESSMLMAKDPYISQSLGALDVLFKM
FT                   DSSFTLITGEKPRSWPVELFMWSVSKFLCVPIWCYQKLAPLLNPDVFPMFDPETEVAVV
FT                   TPVYSDFEPPLYLQPHLRAINFTLYQSEEGLQPKVRLRRLHLHTSVELSGLAYYFSNYA
FT                   VSSFVGAAVLLQVLLGGAALVALVFVFIVGRSWGAELMQLNGDAPDDEGY"
FT                   /protein_id="XP_844532.1"
FT   gene            complement(<1001142..>1001618)
FT                   /note="synonym: Tb04.30O21.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656918"
FT                   /locus_tag="Tb927.4.3830"
FT   mRNA            complement(<1001142..>1001618)
FT                   /db_xref="GI:72388217"
FT                   /db_xref="GeneID:3656918"
FT                   /locus_tag="Tb927.4.3830"
FT                   /transcript_id="XM_839440.1"
FT   CDS_pept        complement(1001142..1001618)
FT                   /locus_tag="Tb927.4.3830"
FT                   /gene_family="HOG000259249" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72388218"
FT                   /db_xref="GeneID:3656918"
FT                   /translation="MEPRTVRAYLEQRVQHQYFDVIPSRWRPLLTRLAKLTQTLQRDGA
FT                   LAVGNNKAAAIRSDFDLANALLEEEHEIYREGLTYLRGRNNGEECANTAALRRFLHGML
FT                   SCIAAKEISITHWKNCLTSVSPDTLRVYCHMCVAHPHVQKDDTARICLLYSQPA"
FT                   /protein_id="XP_844533.1"
FT   gene            complement(<1002060..>1003637)
FT                   /note="synonym: Tb04.30O21.90; nucleolar protein, putative"
FT                   /db_xref="GeneID:3656919"
FT                   /locus_tag="Tb927.4.3840"
FT   mRNA            complement(<1002060..>1003637)
FT                   /db_xref="GI:72388219"
FT                   /db_xref="GeneID:3656919"
FT                   /locus_tag="Tb927.4.3840"
FT                   /transcript_id="XM_839441.1"
FT   CDS_pept        complement(1002060..1003637)
FT                   /locus_tag="Tb927.4.3840"
FT                   /gene_family="HOG000224258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar protein, putative"
FT                   /note="similar to GB:AAH00656.1  nucleolar protein 1
FT                   (120kD) Swiss-Prot:P46087 {Homo sapiens}; go_component:
FT                   nucleolus [goid 0005730]"
FT                   /db_xref="GI:72388220"
FT                   /db_xref="GeneID:3656919"
FT                   /translation="MSGNGGISGNYAPYEENEEVEYNDEEFGSYEEEESDYFSDGEEVE
FT                   DDDDFEAKAIKFRQQMDKLHSEAAAEQEGDIRSRTAKPTLFGDAEEQEEDGEQVQLLGQ
FT                   QHTVEELRDRIGETVHVLSHFKEEREEGRTREDYMQLLRADIMELYGYNEFLTDSILLL
FT                   FSPTEAVEFFEAMEKPRPTTIRVNTIKAKRRDLVQALVKRGMNVEPLEKWSKVGLQVFE
FT                   SNVPISGTVEYLAGHYMLQSAVSFLPVMALAPQINERVLDMAAAPGGKTTYIAQLMKNT
FT                   GVIFANDVSEPRTKSLNANLQRLGVTNTVVTNYDGVGFEKVMKNFDRILLDAPCTGSGI
FT                   ISRDKSIKTSKQYEDVQRASQLQRSLLLSAIDAVRVGGYIVYSTCSFLVEENEAVVDFV
FT                   LHRRDVAIVETGLPFGRPGLTKYRHHRFHDKLQNARRLFPHVHNMDGFFVCKLKKLSNN
FT                   AGGPSTNGLKKEESNVAKSENVKTMKGTNKRQREDDSKAKGELKTKNNRISVPPATKKS
FT                   PKSKGKSG"
FT                   /protein_id="XP_844534.1"
FT   gene            complement(<1004733..>1006094)
FT                   /note="synonym: Tb04.30O21.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3656920"
FT                   /locus_tag="Tb927.4.3850"
FT   mRNA            complement(<1004733..>1006094)
FT                   /db_xref="GI:72388221"
FT                   /db_xref="GeneID:3656920"
FT                   /locus_tag="Tb927.4.3850"
FT                   /transcript_id="XM_839442.1"
FT   CDS_pept        complement(1004733..1006094)
FT                   /l