(data stored in ACNUC8465 zone)

HOGENOMDNA: TRBRU1_6

ID   TRBRU1_6; SV 1; empty ; DNA; empty ; INV; 2205233 BP.
XX
AC   NC_007280;
XX
DE   Trypanosoma brucei TREU927 chromosome 7, complete sequence.
XX
OS   Trypanosoma brucei TREU927
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
XX
RN   [1]
RP   1-2205233
RX   PUBMED; 16020726.
RA   Berriman,M., Ghedin,E., Hertz-Fowler,C., Blandin,G., Renauld,H.,
RA   Bartholomeu,D.C., Lennard,N.J., Caler,E., Hamlin,N.E., Haas,B., Bohme,U.,
RA   Hannick,L., Aslett,M.A., Shallom,J., Marcello,L., Hou,L., Wickstead,B.,
RA   Alsmark,U.C.M., Arrowsmith,C., Atkin,R.J., Barron,A.J., Bringaud,F.,
RA   Brooks,K., Carrington,M., Cherevach,I., Chillingworth,T.-J., Churcher,C.,
RA   Clark,L.N., Corton,C.H., Cronin,A., Davies,R.M., Doggett,J., Djikeng,A.,
RA   Feldblyum,T., Field,M.C., Fraser,A., Goodhead,I., Hance,Z., Harper,D.,
RA   Harris,B.R., Hauser,H., Hostetler,J., Ivens,A., Jagels,K., Johnson,D.,
RA   Johnson,J., Jones,K., Kerhornou,A.X., Koo,H., Larke,N., Landfear,S.,
RA   Larkin,C., Leech,V., Line,A., Lord,A., MacLeod,A., Mooney,P.J., Moule,S.,
RA   Martin,D.M.A., Morgan,G.W., Mungall,K., Norbertczak,H., Ormond,D., Pai,G.,
RA   Peacock,C.S., Peterson,J., Quail,M.A., Rabbinowitsch,E., Rajandream,M.-A.,
RA   Reitter,C., Salzberg,S.L., Sanders,M., Schobel,S., Sharp,S., Simmonds,M.,
RA   Simpson,A.J., Tallon,L., Turner,C.M.R., Tait,A., Tivey,A.R., Van Aken,S.,
RA   Walker,D., Wanless,D., Wang,S., White,B., White,O., Whitehead,S.,
RA   Woodward,J., Wortman,J., Adams,M.D., Embley,T.M., Gull,K., Ullu,E.,
RA   Barry,J.D., Fairlamb,A.H., Opperdoes,F., Barrell,B.G., Donelson,J.E.,
RA   Hall,N., Fraser,C.M., Melville,S.E. and El-Sayed,N.M.;
RT   "The Genome of the African Trypanosome Trypanosoma brucei";
RL   Science 309 (5733), 416-422 (2005)
XX
RN   [2]
RP   1-2205233
RX   PUBMED; 16020724.
RA   El-Sayed,N.M.A., Myler,P.J., Blandin,G., Berriman,M., Crabtree,J.,
RA   Aggarwal,G., Caler,E., Renauld,H., Worthey,E.A., Hertz-Fowler,C.,
RA   Ghedin,E., Peacock,C., Bartholomeu,D.C., Haas,B.J., Tran,A.-N.,
RA   Wortman,J.R., Alsmark,U.C.M., Angiuoli,S., Anupama,A., Badger,J.,
RA   Bringaud,F., Cadag,E., Carlton,J.M., Cerqueira,G.C., Creasy,T.,
RA   Delcher,A.L., Djikeng,A., Embley,T.M., Hauser,C., Ivens,A.C.,
RA   Kummerfeld,S.K., Pereira-Leal,J.B., Nilsson,D., Peterson,J.,
RA   Salzberg,S.L., Shallom,J., Silva,J.C., Sundaram,J., Westenberger,S.,
RA   White,O., Melville,S.E., Donelson,J.E., Andersson,B., Stuart,K.D. and
RA   Hall,N.;
RT   "Comparative genomics of trypanosomatid parasitic protozoa";
RL   Science 309 (5733), 404-409 (2005)
XX
RN   [3]
RP   1-2205233
RA   Ghedin,E., Blandin,G., Bartholomeu,D., Caler,E., Haas,B., Hannick,L.,
RA   Shallom,J., Hou,L., Djikeng,A., Feldblyum,T., Hostetler,J., Johnson,J.,
RA   Jones,K., Koo,H.L., Larkin,C., Pai,G., Peterson,J., Khalak,H.G.,
RA   Salzberg,S., Simpson,A.J., Tallon,L., Van Aken,S., Wanless,D., White,O.,
RA   Wortman,J., Fraser,C.M. and El-Sayed,N.M.A.;
RT   "Sequencing, closure, and annotation of Trypanosoma brucei chromosomes 2
RT   through 8";
RL   Unpublished
XX
RN   [4]
RP   1-2205233
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-OCT-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [5]
RP   1-2205233
RA   Haas,B., Blandin,G. and El-Sayed,N.;
RT   "Direct Submission";
RL   Submitted (12-APR-2005) The Institute for Genomic Research, 9712 Medical
RL   Center Dr, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000070.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2205233
FT                   /mol_type="genomic DNA"
FT                   /isolate="927/4 GUTat10.1"
FT                   /note="single VAT derivative of TREU (Trypanosomiasis
FT                   Research Edinburgh University) 927/4 (GPAL/KE/70/EATRO
FT                   1534)"
FT                   /db_xref="taxon:185431"
FT                   /organism="Trypanosoma brucei TREU927"
FT                   /chromosome="7"
FT   misc_feature    1..120741
FT                   /note="sequence corresponds to BAC RPCI93-8P12"
FT   gene            <5..>442
FT                   /note="synonym: Tb07.8P12.10; variant surface glycoprotein
FT                   (VSG), putative"
FT                   /db_xref="GeneID:3658220"
FT                   /locus_tag="Tb927.7.100"
FT   mRNA            <5..>442
FT                   /db_xref="GI:72390691"
FT                   /db_xref="GeneID:3658220"
FT                   /locus_tag="Tb927.7.100"
FT                   /transcript_id="XM_840547.1"
FT   CDS_pept        <5..442
FT                   /locus_tag="Tb927.7.100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="variant surface glycoprotein (VSG), putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_process: antigenic variation [goid 0020033]"
FT                   /db_xref="GI:72390692"
FT                   /db_xref="GeneID:3658220"
FT                   /translation="SLINLEATAAEEAIKLSGAEAKLNGPLPAGLPTKVPPITTVTCEV
FT                   HNKSKTKCLEAQCKWGGKKDDDGPCQASDKQVSEQTKQGGRDTTTGGDVKKEDKCTGKD
FT                   EKTCGGTQGCKWEGTECKDFSLLVNNKISIIVSVSVSLVAF"
FT                   /protein_id="XP_845640.1"
FT   gene            2279..3797
FT                   /note="synonym: Tb07.8P12.20; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658221"
FT                   /locus_tag="Tb927.7.110"
FT                   /pseudo
FT   misc_feature    3861..3898
FT                   /note="AT_rich"
FT   repeat_region   4067..4108
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            5047..6624
FT                   /note="synonym: Tb07.8P12.30; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658222"
FT                   /locus_tag="Tb927.7.120"
FT                   /pseudo
FT   gene            6656..7466
FT                   /note="synonym: Tb07.8P12.40; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3658223"
FT                   /locus_tag="Tb927.7.130"
FT                   /pseudo
FT   gene            7638..9188
FT                   /note="synonym: Tb07.8P12.50; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658224"
FT                   /locus_tag="Tb927.7.140"
FT                   /pseudo
FT   misc_feature    9178..9246
FT                   /note="AT_rich"
FT   gene            10135..11733
FT                   /note="synonym: Tb07.8P12.80; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658225"
FT                   /locus_tag="Tb927.7.150"
FT                   /pseudo
FT   misc_feature    12145..12236
FT                   /note="T-rich"
FT   repeat_region   12287..12310
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttaggg"
FT                   /rpt_type="tandem"
FT   misc_feature    13094..13122
FT                   /note="AT_rich"
FT   repeat_region   15104..16593
FT                   /transposon="DIRE"
FT   gene            complement(18207..19700)
FT                   /note="synonym: Tb07.8P12.125; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3658226"
FT                   /locus_tag="Tb927.7.160"
FT                   /pseudo
FT   gene            complement(<23503..>24285)
FT                   /note="synonym: Tb07.8P12.170; expression site-associated
FT                   gene (ESAG) protein, putative"
FT                   /db_xref="GeneID:3658227"
FT                   /locus_tag="Tb927.7.170"
FT   mRNA            complement(<23503..>24285)
FT                   /db_xref="GI:72390693"
FT                   /db_xref="GeneID:3658227"
FT                   /locus_tag="Tb927.7.170"
FT                   /transcript_id="XM_840548.1"
FT   CDS_pept        complement(23503..24285)
FT                   /locus_tag="Tb927.7.170"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene (ESAG) protein,
FT                   putative"
FT                   /db_xref="GI:72390694"
FT                   /db_xref="GeneID:3658227"
FT                   /translation="MLKVAVTALLTLRSCAGPAESRGTSLKVGTGGVGVTVSTYSGCSE
FT                   SWSPDGRNMVCGSPSTGPSKTVRRSNSVTSTPQKIQGQPVSGSIAGAKRQEMQTAAPSS
FT                   GGAPHLTSVTLDNPREGKTQTKNTSDAVIRGPTERLTDLSSRGEPAHAPVGNGKATERV
FT                   KQVHDGEQRDLEGRGCKDQSPARSEPASGLMRDDGMDVSRPPARRTVSGAEQESTRELM
FT                   TRNLSEQESAENSTQEKKSAANKGHAVMISAALTLISF"
FT                   /protein_id="XP_845641.1"
FT   gene            complement(<27072..>28385)
FT                   /note="synonym: Tb07.8P12.190; hypothetical protein"
FT                   /db_xref="GeneID:3658229"
FT                   /locus_tag="Tb927.7.180"
FT   mRNA            complement(<27072..>28385)
FT                   /db_xref="GI:72390695"
FT                   /db_xref="GeneID:3658229"
FT                   /locus_tag="Tb927.7.180"
FT                   /transcript_id="XM_840549.1"
FT   CDS_pept        complement(27072..28385)
FT                   /locus_tag="Tb927.7.180"
FT                   /gene_family="HOG000130886" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72390696"
FT                   /db_xref="GeneID:3658229"
FT                   /translation="MYAIKIFVISLLLAFHTATSGASDFLNEDEFVALCLMIKVTKNAL
FT                   RRIKEAREVTKDATRIGARCLQVAGLGILNKICENTDDETCGRRRAFWDAAKDLVNRRH
FT                   GGVSMRGADSEAEDEEEEGSESADPEESDWEETDEEESHSKEEDRKSHSHEEKQKIHPK
FT                   EEDQKPHSKEEVQEEARREETISTNTRLDHRTLEKVQQIAGTAAQVYVDITKTPWVPHS
FT                   GDLERKIYQALYGVPREPEEIREGTASRDGVCRQKATRSAVNNPPATLSRDLLCMCATD
FT                   VESREKTKLCCQNCVAGPNLAVWKPNRDSWERWNYLRAQCAVVRDLQIGFKEMVKKFTH
FT                   KFGHRHDNSIGTELYMGFTTRYHMWPLSLFHKPVPGPGVVYVLMGDRRGDEDVPWVRLL
FT                   EQVTKEMGGLPLGVGEEKQYAETLEKLDSELKQLFPVE"
FT                   /protein_id="XP_845642.1"
FT   repeat_region   31054..31087
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <34206..>36263
FT                   /note="synonym: Tb07.8P12.250; thimet oligopeptidase A,
FT                   putative"
FT                   /db_xref="GeneID:3658231"
FT                   /locus_tag="Tb927.7.190"
FT   mRNA            <34206..>36263
FT                   /db_xref="GI:72390697"
FT                   /db_xref="GeneID:3658231"
FT                   /locus_tag="Tb927.7.190"
FT                   /transcript_id="XM_840550.1"
FT   CDS_pept        34206..36263
FT                   /locus_tag="Tb927.7.190"
FT                   /gene_family="HOG000245985" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thimet oligopeptidase A, putative"
FT                   /EC_number="3.4.24.15"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   metalloendopeptidase activity [goid 0004222]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:72390698"
FT                   /db_xref="GeneID:3658231"
FT                   /translation="MTSRLFADIVDASKCAKFFPKTPSAVQEVAAEAKRRALEKLERIY
FT                   SLSSASRTFLNTASVADVAAAEIGVSASLLSVAMNVSPDEATRQEAKQQMVDLQSFSID
FT                   HFESNKRLFESLKAVSQSNAYRDEYVNGGRDREYSYWLDEELKGYKRKGMELPDSELEK
FT                   VVSLQKELSSLCTTFSRNISEDKSEIVVSAEELAGVPENVISGLSKTKDGLFVLKMDYP
FT                   TLFSVMKNCEVASTRREMSRAASNKAYPENLCVLREIVTKRQKLAELLKFSSFSELNLD
FT                   DKMVKSPEAARAFIDDLVPRLQEKWKSELELILRNLHSSCALTEDGRLRDYDVPFMINQ
FT                   VKKFKFNVSETDLQEYFPLDTTVKGLFDIYERFFDVTFTRVDNGDELWHKDAFTLHVLN
FT                   NKTKDTLGHVVLDLFPREGKFSHACCISVVPPVLLEGSESKFSPALSVVLANFPAPSAE
FT                   RPSLFLHDDVVTFFHEFGHAIHSLFGRSKMATFAGTRVKRDFVELPSQMLEEWVWEVDI
FT                   LRNISCHYKTKEKLPTELVESKVNTRNTFSGRDSLRQLEFASYSLELFSAPFARVKDIK
FT                   EMDTSALMADIRSRINPHIKYDDETHFECSFGHLTGYGAGYYGYMWSKVFALDVYDFIK
FT                   NNGGLLNPAVGERYVSEIIGVGGGKDPSEMLRNFLGREPSSDAFFKSLGV"
FT                   /protein_id="XP_845643.1"
FT   gene            <36651..>38267
FT                   /note="synonym: Tb07.8P12.260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658228"
FT                   /locus_tag="Tb927.7.200"
FT   mRNA            <36651..>38267
FT                   /db_xref="GI:72390699"
FT                   /db_xref="GeneID:3658228"
FT                   /locus_tag="Tb927.7.200"
FT                   /transcript_id="XM_840551.1"
FT   CDS_pept        36651..38267
FT                   /locus_tag="Tb927.7.200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390700"
FT                   /db_xref="GeneID:3658228"
FT                   /translation="MPVGWSSSSSSSDEELRMRLMANLRERRVCGRAGPSAPSRFVMYN
FT                   GDSIVVKCGTVFCPLRKRYFHLQAVKRNPAAYFGDGTLRRYERSSLSLDSIYLIDASKE
FT                   RNINNQSRRVNLLQSVDIGFYIYDSQSMSCNSSCVKNSSSKVCTDFRYERVTRPENFMR
FT                   SVSSPEVLRTQSCSWVPVPYQIHPSCSVESYAPGRFAFFERGTQHCLSMVENDTVTHHQ
FT                   IDSIDSGGSAVGFYVRGRVVVILQGKFVRCLTWDPDNSFISPKCVFTANLNAVFSCPIF
FT                   ASLPGDAEEACIIFGTGRSIFSVAVPKEDSPLLKKLCAFSVTPLSSLETFSFGRKDNTL
FT                   LLCGMRNGTIQVLPLCDPNPRGVSGVAPRHDKACVSYVRRIENTFNFVSVGSNGEIKLW
FT                   DLRYMHVNTPVGQMGCDVAASRYCGSEAVFMDDIACVTSANGHISCLNARKWAHIGRLQ
FT                   RIAGGNRRLHIIESSCGYDLLDADELGTVSHALPVTYSSYGMQTDMPLSKVIYLYRVAA
FT                   SLSPSFHCFQFLSVCVLIRNV"
FT                   /protein_id="XP_845644.1"
FT   repeat_region   38945..38971
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   39609..39661
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <39714..>41384
FT                   /note="synonym: Tb07.8P12.290; proline oxidase, putative"
FT                   /db_xref="GeneID:3658232"
FT                   /locus_tag="Tb927.7.210"
FT   mRNA            <39714..>41384
FT                   /db_xref="GI:72390701"
FT                   /db_xref="GeneID:3658232"
FT                   /locus_tag="Tb927.7.210"
FT                   /transcript_id="XM_840552.1"
FT   CDS_pept        39714..41384
FT                   /locus_tag="Tb927.7.210"
FT                   /gene_family="HOG000258056" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proline oxidase, putative"
FT                   /EC_number="1.5.3.-"
FT                   /note="go_function: proline dehydrogenase activity [goid
FT                   0004657]"
FT                   /db_xref="GI:72390702"
FT                   /db_xref="GeneID:3658232"
FT                   /translation="MFRLLCRRSAANVKMQDASLRTMTKVDFSDPSIFRQKSLWWLLRA
FT                   LFVLRICKFEFISNNSVALMKRAEAIFGPFLTYNTLVKGTVYGHFCAGESDREVKNTVK
FT                   SLENLGIGSVLDYAAEAEAEGFAPSPGIAEAPNLSMASLVNNTSVTYLPHKQAFDENMK
FT                   LYVMCVLHAALHKPEGGVGLAAVKVTGMCDPQLLARVSAILHSVHRDWIEYFTEEQPPP
FT                   VEECNVVMGTKTEHKRYITRDQVRKGLTKLASSQKYTEDEINAVLQVLDPNNEGKTNYY
FT                   KFKTVVSEAVLALDPTPVQKIIIDKLPKLTTEERELWRHLHWRLSVIVRTAKDLRVRVL
FT                   FDAEQTFYQLAIDNIVLQFQRQFNKKEAIVYNTYQCYLTYTEDRVFNDLTRAELEGWVW
FT                   GGKIVRGAYMRQERETAEKYHYKSPIWPTYEETNACYKAVAERILREIARLPETRFEAL
FT                   FGTHNQKSLEEITEAVLQLPPVKGYVAFAQLYGMSDNLTIPLKRAGFPVFKYVPYGPVK
FT                   ETVHYLGRRAMENASILSNGGSREVRLMRKELRRRVFWM"
FT                   /protein_id="XP_845645.1"
FT   misc_feature    41681..41709
FT                   /note="AT_rich"
FT   gene            <41928..>43148
FT                   /note="synonym: Tb07.8P12.300; CDP-diacylglycerol
FT                   synthetase, putative"
FT                   /db_xref="GeneID:3658235"
FT                   /locus_tag="Tb927.7.220"
FT   mRNA            <41928..>43148
FT                   /db_xref="GI:72390703"
FT                   /db_xref="GeneID:3658235"
FT                   /locus_tag="Tb927.7.220"
FT                   /transcript_id="XM_840553.1"
FT   CDS_pept        41928..43148
FT                   /locus_tag="Tb927.7.220"
FT                   /gene_family="HOG000209582" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CDP-diacylglycerol synthetase, putative"
FT                   /EC_number="2.7.7.41"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_function: phosphatidate cytidylyltransferase activity
FT                   [goid 0004605]; go_process: phospholipid biosynthesis [goid
FT                   0008654]"
FT                   /db_xref="GI:72390704"
FT                   /db_xref="GeneID:3658235"
FT                   /translation="MKSKSSKQVLLPLQGNISPSAESPRPGSLMTTEGRTRNYKDLINR
FT                   TVFSLIMAYFFLGLVSIGAEAIIFLLIIILCLMFHEVSRINQRERKNKQLPSVFIMKVW
FT                   FLCTTMFSMTAYSIRDPLVATYPGAMRYYRNAWMIAFGFPLVGMVGFVLSLRKGMYRYQ
FT                   FMQLAAIVMTLLYVTAQGYAQISNVMRGMLWFVLPISCVINNDTWAYIFGKLFGRTKLL
FT                   ALSPKKTVEGFVGAFVFTIIWSFWFAGFLSYFPHMYCAKTDFHSAFHCEKDPLFVKRDV
FT                   PMPAFVQALTFNRLTTIRCARVQQHALVFAAFASLIAPFGGFFASGLKRAFKMKDFGDL
FT                   IPGHGGITDRMDCQGIMGFFTWVYLQSYVYRDENCPSWHTISSCALQLPEEQRRSLLST
FT                   LNRSLTE"
FT                   /protein_id="XP_845646.1"
FT   gene            <43393..>43704
FT                   /note="synonym: Tb07.8P12.310; 40S ribosomal protein S33,
FT                   putative"
FT                   /db_xref="GeneID:3658230"
FT                   /locus_tag="Tb927.7.230"
FT   mRNA            <43393..>43704
FT                   /db_xref="GI:72390705"
FT                   /db_xref="GeneID:3658230"
FT                   /locus_tag="Tb927.7.230"
FT                   /transcript_id="XM_840554.1"
FT   CDS_pept        43393..43704
FT                   /locus_tag="Tb927.7.230"
FT                   /gene_family="HOG000224552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S33, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72390706"
FT                   /db_xref="GeneID:3658230"
FT                   /translation="MCSSVAMAEVATAATTAATKKDKKAPQEEVVVQQTDQAQVGVIIK
FT                   VLGRTGSRGNVTQVRVRLMAEEGSPEANRTIVRNVKGPCKEGDMLSLMETEREARRLR"
FT                   /protein_id="XP_845647.1"
FT   gene            <43919..>44230
FT                   /note="synonym: Tb07.8P12.320; 40S ribosomal protein S33,
FT                   putative"
FT                   /db_xref="GeneID:3658234"
FT                   /locus_tag="Tb927.7.240"
FT   mRNA            <43919..>44230
FT                   /db_xref="GI:72390707"
FT                   /db_xref="GeneID:3658234"
FT                   /locus_tag="Tb927.7.240"
FT                   /transcript_id="XM_840555.1"
FT   CDS_pept        43919..44230
FT                   /locus_tag="Tb927.7.240"
FT                   /gene_family="HOG000224552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S33, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72390708"
FT                   /db_xref="GeneID:3658234"
FT                   /translation="MCSSVAMAEVATAATTAATKKDKKAPQEEVVVQQTDQAQVGVIIK
FT                   VLGRTGSRGNVTQVRVRLMAEEGSPEANRTIVRNVKGPCKEGDMLSLMETEREARRLR"
FT                   /protein_id="XP_845648.1"
FT   gene            <45233..>46987
FT                   /note="synonym: Tb07.8P12.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658233"
FT                   /locus_tag="Tb927.7.250"
FT   mRNA            <45233..>46987
FT                   /db_xref="GI:72390709"
FT                   /db_xref="GeneID:3658233"
FT                   /locus_tag="Tb927.7.250"
FT                   /transcript_id="XM_840556.1"
FT   CDS_pept        45233..46987
FT                   /locus_tag="Tb927.7.250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390710"
FT                   /db_xref="GeneID:3658233"
FT                   /translation="MQKQRITFDAAYKFTLWYSLLCEAQRDRAKSVERARHGSHVRDVA
FT                   SVLVRASLPRRAYKSCCLAGVCDRDSLTHKAVHFGRPEVHITHGERDDVYHCLAHSTAC
FT                   IGRSVDLCVKNYCSAAPLSGDCYGGLRCIIQHLQLRSLTFSSITSLHDAQQVVNTLSAA
FT                   VRCGLRWLTRLSIGGIPLYADLGPLLYSLRETDAITELRLEECGIENVDGLGHYLKSSK
FT                   KLQKLSLRGNQGICGDMKSLAVAVSLCSSLQSFDAGLCRLNDTHLSEFLLGLDNFLKRS
FT                   CFSLDMSSNVLTKTCFLCFLEAPLAFRREVTQLDISGHNFNGAGDGAAAMLLELPALRG
FT                   VVFDRCDIGSRDVQRLVRVFTRKDRTWSCLSFRGSALTLNDMKRLVMTTFAERSRLCIG
FT                   GNNIGGGIQKLCLNIVLPFLCELDLSLCDIGDTGVLQLANSIEKAQPVPLRSLRLDNNG
FT                   IGGEGVRGRGGLQFLGRALRSSYSPCLEVLSLAHNKLSLKPLLTLVEQVSSTLRELCIS
FT                   YTPIASDSCEMADLVGRIMRRQKGSHAFDELDVWALRSTDLDSSCGSEATSWLERQRAV
FT                   RVIMEARV"
FT                   /protein_id="XP_845649.1"
FT   gene            <47186..>47710
FT                   /note="synonym: Tb07.8P12.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658239"
FT                   /locus_tag="Tb927.7.260"
FT   mRNA            <47186..>47710
FT                   /db_xref="GI:72390711"
FT                   /db_xref="GeneID:3658239"
FT                   /locus_tag="Tb927.7.260"
FT                   /transcript_id="XM_840557.1"
FT   CDS_pept        47186..47710
FT                   /locus_tag="Tb927.7.260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390712"
FT                   /db_xref="GeneID:3658239"
FT                   /translation="MTERSPALVPAVSLLREELQLLNGVVEGQARSRVYRHHIFFRKAS
FT                   FLRSALRNALPQFARRAADPTDLRTVAGRLLTLTIRCAESATLELSASHIDTVSVALLL
FT                   LAITSRIGCVLCVVLGRKPETFGKLHFIGSKFGVKYKRSRSEAELAEETIGVATPIRRR
FT                   TIGGVIEAVIK"
FT                   /protein_id="XP_845650.1"
FT   gene            <47961..>49073
FT                   /note="synonym: Tb07.8P12.350; ribosome biogenesis protein,
FT                   putative"
FT                   /db_xref="GeneID:3658238"
FT                   /locus_tag="Tb927.7.270"
FT   mRNA            <47961..>49073
FT                   /db_xref="GI:72390713"
FT                   /db_xref="GeneID:3658238"
FT                   /locus_tag="Tb927.7.270"
FT                   /transcript_id="XM_840558.1"
FT   CDS_pept        47961..49073
FT                   /locus_tag="Tb927.7.270"
FT                   /gene_family="HOG000157782" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosome biogenesis protein, putative"
FT                   /note="similar to Ribosome biogenesis protein RPF2.
FT                   (Swiss-Prot:P36160) [Saccharomyces cerevisiae;];
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_function: rRNA binding [goid 0019843]; go_process:
FT                   ribosomal large subunit assembly and maintenance [goid
FT                   0000027]"
FT                   /db_xref="GI:72390714"
FT                   /db_xref="GeneID:3658238"
FT                   /translation="MSSIGGFKRRAPKSLKTRRALKKYDPKVVENPKKILFLRGTKTSS
FT                   VVNDAIVDLTAVTKPYNKRLQKRNAFYPFDGREHLEFLGFKNDCSLFCFGNDSKKRPHN
FT                   LVIGRHFDFHILDMLELGIIAADRMEMPRDEAIDLASLGGKPFFVFEGSEFVSDPTFVR
FT                   LKNLLIDFFRGSSETEINLDGYDRVLSFSLRSANGGDVCVPPATDCYGTGKQQQEKGNT
FT                   ILCMRHYALHKPSTAAGIPRNFGANIRLLDIGPNFDFILRRASFATPAEFKVSTKLPKE
FT                   VLATLRSTAANVSADPLNNLRGQLHVGKQDVQQLNLRRFKAHKRSARSATEGENDTQQR
FT                   EEAEGEPMVKRHRRRRGNENEDDINPDRDI"
FT                   /protein_id="XP_845651.1"
FT   gene            <49637..>50314
FT                   /note="synonym: Tb07.8P12.370; cyclophilin-type
FT                   peptidyl-prolyl cis-trans isomerase, putative"
FT                   /db_xref="GeneID:3658237"
FT                   /locus_tag="Tb927.7.280"
FT   mRNA            <49637..>50314
FT                   /db_xref="GI:72390715"
FT                   /db_xref="GeneID:3658237"
FT                   /locus_tag="Tb927.7.280"
FT                   /transcript_id="XM_840559.1"
FT   CDS_pept        49637..50314
FT                   /locus_tag="Tb927.7.280"
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="go_function: peptidyl-prolyl cis-trans isomerase
FT                   activity [goid 0003755]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:72390716"
FT                   /db_xref="GeneID:3658237"
FT                   /translation="MPLRFTSAFLLGGAMNVFVGGAAYAASKAYTSPYPQNPKNSVVYF
FT                   DTAVQDGHTWFGTASTSPVGRIEMELFDDTVPITARNFRELCRGYTKATPEGKPLHFKG
FT                   SIFHRIIPDFMIQGGDITKANGTGGCSIYGVRFKDESFEAKAGRHCGPGILSMANAGRN
FT                   TNGSQFFICTVPCPWLDGKHVVFGQVLRGFDHVRLIEGHGTPHGKPTKTVIISDSGVLK
FT                   EPA"
FT                   /protein_id="XP_845652.1"
FT   gene            <50638..>52251
FT                   /note="synonym: Tb07.8P12.380; leucine-rich repeat protein
FT                   (LRRP), putative"
FT                   /db_xref="GeneID:3658240"
FT                   /locus_tag="Tb927.7.290"
FT   mRNA            <50638..>52251
FT                   /db_xref="GI:72390717"
FT                   /db_xref="GeneID:3658240"
FT                   /locus_tag="Tb927.7.290"
FT                   /transcript_id="XM_840560.1"
FT   CDS_pept        50638..52251
FT                   /locus_tag="Tb927.7.290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="leucine-rich repeat protein (LRRP), putative"
FT                   /db_xref="GI:72390718"
FT                   /db_xref="GeneID:3658240"
FT                   /translation="MPNAIGLHCMSRMRELHLSGSCVTDRHLCNVGVGKCLVRLSIESC
FT                   TNLTDVSLLTAVETLEEVRLDGCKNVVKGINEFGRMPYLRVLILKETSVTDRCLRGFAS
FT                   SRSLVKLFIESCSQPTDVSPISAVETLEEVRLDGCKNVVKGINEFGRMPYLRVLILREV
FT                   GVTDRCLRGLSCCRSLVELALEYCLQLTDVSPISMLETLQKVRFDGCKNVVKGFGELGR
FT                   VPYLQTLSLNETNVDDRALFTLRATGSLVELSLESCPQLTDVTHLSMIDTLQKIVLEGC
FT                   ANVAKGVGLLGRLPALRELYAGATSIADTSISALSRSGTLTKIDVKFCQGLTDVSPLVD
FT                   MKLLEEINLEGCKNVEHGLPCLEKLNLLRVLHLTETQMTDDYLRGLCASCSIVVLDVSL
FT                   CDQLVDMSPLASIETLEVLRANNCKSVVRGVGALGGLRALRELGLKATMIKNKSLCGLG
FT                   QSRTLVQIDLEACERLTDVTPLSQIRTLEVVNLNGCKNVVSGLKSMAVMPRLRLLHLMD
FT                   VELGSDVLDELKSMNVWVNK"
FT                   /protein_id="XP_845653.1"
FT   misc_feature    52912..52988
FT                   /note="CT-rich"
FT   misc_feature    53364..53410
FT                   /note="T-rich"
FT   repeat_region   54271..54293
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   gene            <54502..>55605
FT                   /note="synonym: Tb07.8P12.430; UDP-Gal or
FT                   UDP-GlcNAc-dependent glycosyltransferase, putative"
FT                   /db_xref="GeneID:3658246"
FT                   /locus_tag="Tb927.7.300"
FT   mRNA            <54502..>55605
FT                   /db_xref="GI:72390719"
FT                   /db_xref="GeneID:3658246"
FT                   /locus_tag="Tb927.7.300"
FT                   /transcript_id="XM_840561.1"
FT   CDS_pept        54502..55605
FT                   /locus_tag="Tb927.7.300"
FT                   /gene_family="HOG000130905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="UDP-Gal or UDP-GlcNAc-dependent
FT                   glycosyltransferase, putative"
FT                   /note="UDP-Gal or UDP-GlcNAc-dependent glycosyltransferase,
FT                   putative : curated by Mike Ferguson; go_function:
FT                   UDP-glycosyltransferase activity [goid 0008194];
FT                   go_process: GPI anchor biosynthesis [goid 0006506]"
FT                   /db_xref="GI:72390720"
FT                   /db_xref="GeneID:3658246"
FT                   /translation="MVWSGHKYKRLLPLCLLTLLWFLSLSRFRRVEVPKQRENIQHSFE
FT                   PTLTTLNEEDLQSVQFIPQATVDVLRRRDFFVAVGFLSPDNNERRRRRYLLRLTSFQYP
FT                   GVATKSNNFSGELMIAFILARHPDHNYTFSAKLKEEAWHWNDIISLPMDEGKVSTNKTT
FT                   GDGTHWGPATEIGMSRKVFHWYDFALRFFRNVTYISKADDDAFLHVPQFLADLHTLPRR
FT                   RVYWGYMKPMTVKDPFYFAAGILYTLSRDVSEAFVAYEPLRKIIRVPYSKEREMEFKPL
FT                   ILENEDIMVARVISYLRLDNLRYYVESCCRFNDLNYGFCSGVRDTSVIIHGVKEGQYAD
FT                   IVNRLGKHRTVANPFYRGYLGWHASCT"
FT                   /protein_id="XP_845654.1"
FT   misc_feature    56527..56547
FT                   /note="AT_rich"
FT   misc_feature    57012..57033
FT                   /note="AT_rich"
FT   repeat_region   57373..57396
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<57553..>58440)
FT                   /note="synonym: Tb07.8P12.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658244"
FT                   /locus_tag="Tb927.7.310"
FT   mRNA            complement(<57553..>58440)
FT                   /db_xref="GI:72390721"
FT                   /db_xref="GeneID:3658244"
FT                   /locus_tag="Tb927.7.310"
FT                   /transcript_id="XM_840562.1"
FT   CDS_pept        complement(57553..58440)
FT                   /locus_tag="Tb927.7.310"
FT                   /gene_family="HOG000258052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390722"
FT                   /db_xref="GeneID:3658244"
FT                   /translation="MQDSVLLSEAFDASHRPWPNRPERKKGVSPSGRDFNMTLYRMKGC
FT                   PYCERVEWLLRYHLVPFEIVEVGPLTTKGFPDQRFVQVPQIGLEAVADPNNPHAAEKSV
FT                   AYVADSQHIIAAISAPLGFTKQLSDPRIMETRKWMMERFQAAGFLAINSTWRDAYTTYP
FT                   HVTPSHYYYQNPIFHVVGATALYALAKYKVAPRFAAEESATSGFPSMENSLQRDPSAWL
FT                   AAELSGFATRLSGGCHQLHGGKEPDIADVEMYGLTRIIDAHPRLRSALHEGPLKEWCAA
FT                   MEAALQKRTHVTKK"
FT                   /protein_id="XP_845655.1"
FT   gene            complement(<59534..>60076)
FT                   /note="synonym: Tb07.8P12.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658241"
FT                   /locus_tag="Tb927.7.320"
FT   mRNA            complement(<59534..>60076)
FT                   /db_xref="GI:72390723"
FT                   /db_xref="GeneID:3658241"
FT                   /locus_tag="Tb927.7.320"
FT                   /transcript_id="XM_840563.1"
FT   CDS_pept        complement(59534..60076)
FT                   /locus_tag="Tb927.7.320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="TbRBP8: pers. comm. C. Clayton, University of
FT                   Heidelberg; go_function: RNA binding [goid 0003723];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72390724"
FT                   /db_xref="GeneID:3658241"
FT                   /translation="MYTSGHPSTRSWGTEGINAPLQQKATYSFPLKQPRRHQQQQQQQQ
FT                   TLGRQFDAESTHQASPTAAKLFVGQLPFETDEKRLYDLFSAYGTVEHIHILRDSQNRSK
FT                   GAAFVTYSNVEEADTAIFTLHNRYKMLANRMIQVSYAKNSANISLFGACNAIAVHRMNP
FT                   TNPVPDMANVTPESRVI"
FT                   /protein_id="XP_845656.1"
FT   repeat_region   59943..59965
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<60375..>60956)
FT                   /note="synonym: Tb07.8P12.510; hypothetical protein"
FT                   /db_xref="GeneID:3658245"
FT                   /locus_tag="Tb927.7.330"
FT   mRNA            complement(<60375..>60956)
FT                   /db_xref="GI:72390725"
FT                   /db_xref="GeneID:3658245"
FT                   /locus_tag="Tb927.7.330"
FT                   /transcript_id="XM_840564.1"
FT   CDS_pept        complement(60375..60956)
FT                   /locus_tag="Tb927.7.330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72390726"
FT                   /db_xref="GeneID:3658245"
FT                   /translation="MDYNEISPSTERRIEDFFAATTQCTRDVALRHASLNVKDVRMTFV
FT                   GSGAMAASTSLGGDASDLNGSVVEWPMKASKTLASHDSLNKTGDVYVDQGVLSFLIDAL
FT                   TSAHLALLVKMKHVSVSLTIDFVRPLLSERPFILVSRLLRSGRRICSLSAEVRQEQNGK
FT                   TVLCARADHTKVFNDTKSPNKTRRAAISKL"
FT                   /protein_id="XP_845657.1"
FT   misc_feature    61324..61347
FT                   /note="AT_rich"
FT   gene            complement(<61527..>62615)
FT                   /note="synonym: Tb07.8P12.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658247"
FT                   /locus_tag="Tb927.7.340"
FT   mRNA            complement(<61527..>62615)
FT                   /db_xref="GI:72390727"
FT                   /db_xref="GeneID:3658247"
FT                   /locus_tag="Tb927.7.340"
FT                   /transcript_id="XM_840565.1"
FT   CDS_pept        complement(61527..62615)
FT                   /locus_tag="Tb927.7.340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390728"
FT                   /db_xref="GeneID:3658247"
FT                   /translation="MPSFTHILFFLRFSQSRAVGGREKKPAYSFRSSDRMGNVRAPVKL
FT                   HSTRVSNTARVSSPENPVHFIFLHGFLSHGGSLMSLARRLHECLATERMAASVEAIVVD
FT                   SRNHGRSPHTSTHTLEDMVADLREWLHWHGYVVAGKRAEGNLMTPRIIAVGHSMGTLTW
FT                   AKYLLDHRHGDVHRAPVAGFVSLDMPPLTKSLFPSSLRNLLHEYIDYMRRVRLSAITDM
FT                   RSAHEEFNRCGIRDRRLQGFLTTNLQIIRKSGGAPPDVSWRCNLPVLDENLRNGSIFLT
FT                   DADARVCARGEIDVPILSILGAESEVGRHKRLQGLWKGCSIATTEEHILPKAGHNVFYD
FT                   DLSGTTSLIAGFARRLETLQTS"
FT                   /protein_id="XP_845658.1"
FT   gene            complement(<62823..>63542)
FT                   /note="synonym: Tb07.8P12.540; hypothetical protein"
FT                   /db_xref="GeneID:3658248"
FT                   /locus_tag="Tb927.7.350"
FT   mRNA            complement(<62823..>63542)
FT                   /db_xref="GI:72390729"
FT                   /db_xref="GeneID:3658248"
FT                   /locus_tag="Tb927.7.350"
FT                   /transcript_id="XM_840566.1"
FT   CDS_pept        complement(62823..63542)
FT                   /locus_tag="Tb927.7.350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72390730"
FT                   /db_xref="GeneID:3658248"
FT                   /translation="MSLASVPCTQFLVLRHWKAPAVISLVWLKYPITITNRNETVTSWA
FT                   LQTFESVTVQHHEVMSPGFWRTVFAAKGKRRTTTFASDRGAYLRFTTPTKVLTTSTDCI
FT                   NFETNHAYRKITSVLACAFSGTNRNHTHTIQTRRKLFCDFVTPHPLSKVTERFPVLECE
FT                   ESLFGKTLQTSLCFHWFGTELWKTETFLIYQIAVGKVVFSRHRSSGASPKGGCECNSSV
FT                   EYKTNGIFLQEACACMQ"
FT                   /protein_id="XP_845659.1"
FT   misc_feature    65447..65468
FT                   /note="AT_rich"
FT   gene            complement(<65972..>67120)
FT                   /note="synonym: Tb07.8P12.560; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658249"
FT                   /locus_tag="Tb927.7.360"
FT   mRNA            complement(<65972..>67120)
FT                   /db_xref="GI:72390731"
FT                   /db_xref="GeneID:3658249"
FT                   /locus_tag="Tb927.7.360"
FT                   /transcript_id="XM_840567.1"
FT   CDS_pept        complement(65972..67120)
FT                   /locus_tag="Tb927.7.360"
FT                   /gene_family="HOG000137394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Ring-infected erythrocyte surface antigen
FT                   (Fragment). (Swiss-Prot:Q26005) [Plasmodium falciparum
FT                   (isolate PALO ALTO / UGANDA)]"
FT                   /db_xref="GI:72390732"
FT                   /db_xref="GeneID:3658249"
FT                   /translation="MTARFLCLLAILTYVTADSIIEEGSQNTVSHVSAACLFSEALHGI
FT                   PFGVKALKALAAANVSDASKAREGCQDAVRRAEDAFSSTPKVEEAVGRARAALKEAESA
FT                   ENAAKTALSDVEQYAARAPLLAAGKTAPVDDYLKSVAEDNSAASTARRIARGCSLPNRG
FT                   VNSWVLKKAVEFGCEFFTGDICKILTDGMADLRAEYDQLEAAVRRASEARVAARAAESN
FT                   AHKAAEEAERTAETEKADVQEISREEFEGNVEVPEDKEKTERTEVEEVPKKDPEGNVEV
FT                   PEDKEKTERTEVEEVPKKDPEGNVEVPEDKEKTERTEVEEVPKKDPEGKVEISDDDHVQ
FT                   ELGDDEGEEAEVGNDGSYAESIGGYTLLILLAALSHSAAAHF"
FT                   /protein_id="XP_845660.1"
FT   gene            complement(<67568..>68038)
FT                   /note="synonym: Tb07.8P12.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658236"
FT                   /locus_tag="Tb927.7.370"
FT   mRNA            complement(<67568..>68038)
FT                   /db_xref="GI:72390733"
FT                   /db_xref="GeneID:3658236"
FT                   /locus_tag="Tb927.7.370"
FT                   /transcript_id="XM_840568.1"
FT   CDS_pept        complement(67568..68038)
FT                   /locus_tag="Tb927.7.370"
FT                   /gene_family="HOG000137395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390734"
FT                   /db_xref="GeneID:3658236"
FT                   /translation="MHDLIAVVECLSTCLTPILQCVERNVELISCFEAVRQLSIKIDST
FT                   PPKVCVGAEDGRNVKNSLCRRDDIAEQINFYTQTELAHIFEQPKVLESFARREAERVED
FT                   LLKDSQSIMKYDRFQVVMNGLMEAVKAVLQFFPDKTLQCVSHLIATMLRPLQ"
FT                   /protein_id="XP_845661.1"
FT   misc_feature    68597..68665
FT                   /note="AT_rich"
FT   gene            complement(<69132..>70202)
FT                   /note="synonym: Tb07.8P12.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658242"
FT                   /locus_tag="Tb927.7.380"
FT   mRNA            complement(<69132..>70202)
FT                   /db_xref="GI:72390735"
FT                   /db_xref="GeneID:3658242"
FT                   /locus_tag="Tb927.7.380"
FT                   /transcript_id="XM_840569.1"
FT   CDS_pept        complement(69132..70202)
FT                   /locus_tag="Tb927.7.380"
FT                   /gene_family="HOG000137394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Anoxia up-regulated protein.
FT                   (Swiss-Prot:Q9VGX3) {Drosophila melanogaster}"
FT                   /db_xref="GI:72390736"
FT                   /db_xref="GeneID:3658242"
FT                   /translation="MTARFLCLLAILTYVTADSIIEEGSQNTVSHVSAACLFSEALHGI
FT                   PFGVKALKALAAANVSDASKAREGCQDAVRRAEDASWNNPKAEEAVGRARAALKEAESA
FT                   ENAAKTALSDVEQYAARAPLLAAGKTAPIDDYLKSVAEDNSAASTARRIARGCSLPNRG
FT                   VNSWVLTQAVESACAIFMGEICRIARTRMVDLRAEYDQLEAAVRRAGEARVAARAAESN
FT                   ARKAAEEAERTAETEEADVQEISREEFEGNVEVPEDKEKTGRTEVEEVPKKDPEGNVEV
FT                   PEDKEKTERTEVEEVPKKDPEGKVEISDDDHVQELGDDEGEEAEVGNDGSYAESIGGYT
FT                   LLILLAALFHSAAAHF"
FT                   /protein_id="XP_845662.1"
FT   gene            complement(<70477..>71742)
FT                   /note="synonym: Tb07.8P12.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658243"
FT                   /locus_tag="Tb927.7.390"
FT   mRNA            complement(<70477..>71742)
FT                   /db_xref="GI:72390737"
FT                   /db_xref="GeneID:3658243"
FT                   /locus_tag="Tb927.7.390"
FT                   /transcript_id="XM_840570.1"
FT   CDS_pept        complement(70477..71742)
FT                   /locus_tag="Tb927.7.390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390738"
FT                   /db_xref="GeneID:3658243"
FT                   /translation="MHDLVAVVECLSTCLTPILQCVERNVELISCFEAVRQLSIKIDST
FT                   PPKVCVGAEDGRNVKNSLCRRDDIAEQINFYTQTELAHIFEQPKVLESFARREAERVED
FT                   LLKDSQSIMKYDRFQVVMNGLMEAVKAVLQFFPDKTLPICVSRWKVALVQSLTFFQPAP
FT                   HTHQTELLERLSALRKIVQQLLLSTQKMCEDYVKSAEVRRLRPTEVESINSQLSEQLWR
FT                   PLNNVLVICAAECQQAIKQTVIAPVIATADGYESQPLWRLQSSNGGSAVISNSVLHTPL
FT                   HLAPSEMVRGFGEAIVEIPLALESLRGGSEGRFDGIEELLEEVTEYWLDDIVRTAVSDF
FT                   IESKVANIIMCFPLNSDDAAALAVEQLVTDLSYLKSILAAVSDDPFERLESVLSRLKTA
FT                   SIKSGSTIAIRELIAEQGQSKE"
FT                   /protein_id="XP_845663.1"
FT   misc_feature    72301..72369
FT                   /note="AT_rich"
FT   gene            complement(<72835..>73746)
FT                   /note="synonym: Tb07.8P12.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658250"
FT                   /locus_tag="Tb927.7.400"
FT   mRNA            complement(<72835..>73746)
FT                   /db_xref="GI:72390739"
FT                   /db_xref="GeneID:3658250"
FT                   /locus_tag="Tb927.7.400"
FT                   /transcript_id="XM_840571.1"
FT   CDS_pept        complement(72835..73746)
FT                   /locus_tag="Tb927.7.400"
FT                   /gene_family="HOG000137394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Anoxia up-regulated protein.
FT                   (Swiss-Prot:Q9VGX3) {Drosophila melanogaster}"
FT                   /db_xref="GI:72390740"
FT                   /db_xref="GeneID:3658250"
FT                   /translation="MTARFLCLLAILMYVTTGPKGGEGFQDTVSHVSAACLMSEALHGV
FT                   PNSVKVFKTSAAANVSDASKAREGCQDAVRRAEDAFSSTPKVEEAVGRARAALKEAESA
FT                   ENAAKTALSDVEQYAANASALANNNVALVDDYLKSVAEDNSAASTARRIARDCNAPLEV
FT                   SSWVLTQAVESGCAVFMTVICNTARARMADLRAEYDQLEAAVRRASEARVAARAAESNA
FT                   HKAAEEAERTAETEKAKVKEVPKKDPEGKVEISDDDHVQELGDDEGEEAEVGNDGSYAE
FT                   SIGGYTLLILLAALFHSAAAHF"
FT                   /protein_id="XP_845664.1"
FT   gene            complement(<74142..>74660)
FT                   /note="synonym: Tb07.8P12.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658251"
FT                   /locus_tag="Tb927.7.410"
FT   mRNA            complement(<74142..>74660)
FT                   /db_xref="GI:72390741"
FT                   /db_xref="GeneID:3658251"
FT                   /locus_tag="Tb927.7.410"
FT                   /transcript_id="XM_840572.1"
FT   CDS_pept        complement(74142..74660)
FT                   /locus_tag="Tb927.7.410"
FT                   /gene_family="HOG000137395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390742"
FT                   /db_xref="GeneID:3658251"
FT                   /translation="MHDLVAVVECLSTCLTPILQCVERNVELISCFEAVRQLSIKIDST
FT                   PPKVCVGAEDGRNVKNSLCRRDDIAEQINFYTQTELAHIFEQPKVLKSFARREAERVED
FT                   LLKDSQSIMKYDRFQVVMNGLMEAVKAVLQFFPDKTLPICVSRWKVALVQSLSFCNRLE
FT                   LFEKHSGCS"
FT                   /protein_id="XP_845665.1"
FT   misc_feature    75219..75287
FT                   /note="AT_rich"
FT   gene            complement(<75754..>76665)
FT                   /note="synonym: Tb07.8P12.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658252"
FT                   /locus_tag="Tb927.7.420"
FT   mRNA            complement(<75754..>76665)
FT                   /db_xref="GI:72390743"
FT                   /db_xref="GeneID:3658252"
FT                   /locus_tag="Tb927.7.420"
FT                   /transcript_id="XM_840573.1"
FT   CDS_pept        complement(75754..76665)
FT                   /locus_tag="Tb927.7.420"
FT                   /gene_family="HOG000137394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Anoxia up-regulated protein.
FT                   (Swiss-Prot:Q9VGX3) {Drosophila melanogaster}"
FT                   /db_xref="GI:72390744"
FT                   /db_xref="GeneID:3658252"
FT                   /translation="MTARFLCLLAILTYVTTGPKGGEGFQDTVSHVSAACLMSEALHGV
FT                   PNSVKVFKTSAAANVLDASKAREGCQDAVRRAEDAFSSTPKVEEAVGRARAALKEAESA
FT                   ENAAKTALSDVEQYAANASALANNNVALVDDYLKSVAEDNSAASTARRIARDCNAPLEV
FT                   SSWVLTQAVESGCAVFMTVICNTARTRMADLRAEYDQLEAAVRRASEARVAARAAESNA
FT                   HKAAEEAERTAETEKAKVKEVPKKDPEGKVEISDDDHVQELGDDEGEEAEVGNDGSYAE
FT                   SIGGYTLLILLAALSHSAAAHF"
FT                   /protein_id="XP_845666.1"
FT   gene            complement(<77061..>77579)
FT                   /note="synonym: Tb07.8P12.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658254"
FT                   /locus_tag="Tb927.7.430"
FT   mRNA            complement(<77061..>77579)
FT                   /db_xref="GI:72390745"
FT                   /db_xref="GeneID:3658254"
FT                   /locus_tag="Tb927.7.430"
FT                   /transcript_id="XM_840574.1"
FT   CDS_pept        complement(77061..77579)
FT                   /locus_tag="Tb927.7.430"
FT                   /gene_family="HOG000137395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390746"
FT                   /db_xref="GeneID:3658254"
FT                   /translation="MHDLVAVVECLSTCLTPILQCVERNVELISCFEAVRQLSIKIDST
FT                   PPKVCVGAEDGRNVKNSLCRRDDIAEQINFYTQTELAHIFEQPKVLESFARREAERVED
FT                   LLKDSQSIMKYDRFQVVMNGLMEAVKAVLQFFPDKTLPICVSRWKVALVQSLSFCNRLE
FT                   LFEKHSGCS"
FT                   /protein_id="XP_845667.1"
FT   misc_feature    78143..78164
FT                   /note="AT_rich"
FT   gene            complement(<78666..>79658)
FT                   /note="synonym: Tb07.8P12.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658253"
FT                   /locus_tag="Tb927.7.440"
FT   mRNA            complement(<78666..>79658)
FT                   /db_xref="GI:72390747"
FT                   /db_xref="GeneID:3658253"
FT                   /locus_tag="Tb927.7.440"
FT                   /transcript_id="XM_840575.1"
FT   CDS_pept        complement(78666..79658)
FT                   /locus_tag="Tb927.7.440"
FT                   /gene_family="HOG000137394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Anoxia up-regulated protein.
FT                   (Swiss-Prot:Q9VGX3) [Drosophila melanogaster]"
FT                   /db_xref="GI:72390748"
FT                   /db_xref="GeneID:3658253"
FT                   /translation="MTARFLCLLAILTYVTADSIIEEGSQNTVSHVSAACLFSEALHGI
FT                   PFGVKALKASAAANVSDASKAREGCQDAVRRAEDAFSSTPKVEEAVGRARAALKEAESA
FT                   ENAAKTALSDVEQYAARAPLLAAGKTAPIDDYLKSVAEDNSAASTARRIARGCSLPNRG
FT                   VNSWVLTQAVESACAIFMGEICRIARTRMVDLRAEYDQLEAAVRRASEARVAARAAESN
FT                   ARKAAEEAERTAETEEADVQEISREEFEGNVEVPEDKEKTGRTEVEEVPKKDPEGKVEI
FT                   SDDDHVQELGDDEGEEAEVGNDGSYAESIGGYTLLILLAALFHSAAAHF"
FT                   /protein_id="XP_845668.1"
FT   gene            complement(<79933..>82245)
FT                   /note="synonym: Tb07.8P12.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658260"
FT                   /locus_tag="Tb927.7.450"
FT   mRNA            complement(<79933..>82245)
FT                   /db_xref="GI:72390749"
FT                   /db_xref="GeneID:3658260"
FT                   /locus_tag="Tb927.7.450"
FT                   /transcript_id="XM_840576.1"
FT   CDS_pept        complement(79933..82245)
FT                   /locus_tag="Tb927.7.450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar over 232aa to Conserved oligomeric Golgi
FT                   complex component 7. (Swiss-Prot:P83436) [Homo sapiens]"
FT                   /db_xref="GI:72390750"
FT                   /db_xref="GeneID:3658260"
FT                   /translation="MQDVPNPNPSIGTSPSTDPASFAFSLDELASENFDVIQWINTSLQ
FT                   CISSANPDGVETDAELEGRITNLYGRLHSYSQEVASSVDDTITQALVRLPRTGLEVGRM
FT                   VTEVQQLQQALCKIREEAQPAVEMISKPYVAQLNDLKKTQKKLMRCSETLKKASEVDSN
FT                   MKQLDDIMEKLRVSVSEVDIDLVAVSIREVRQNLADLQKLEVTFGGKQLEAVERHEQLL
FT                   QRVVETECMEQLRRRVVDRAAHLLKVLDTIGRADAVLQQFSAESIASEKEKVFCLLHHS
FT                   ESKVSRHPISPVRAAEVLKTQLIPSLGCALTDQLDYLMQLAHVYSGNRDITDNAEISEG
FT                   PESQPVKVLRLMADEIVECLSTCLTPILQCVERNPELISCFEAVRQLSIKIDSTPPKVC
FT                   VGAEDGRNVKNSLCRRDDIAEQINFYTQTELAHIFEQPKVLESFARREAERVEDLLKDS
FT                   QSIMKYDRFQVVMNGLMEAVKAVLQFFPDKTLPICVSRWKVALVQSLTFFQPAPHTHQT
FT                   ELLERLSALRKIVQQLLLSTQKMCEDYVKSAEVRRLRPTEVESINSQLSEQLWRPLNNV
FT                   LVICAAECQQAIKQTVIAPVIATADGYESQPLWRLQSSNGGSAVISNSVLHTPLHLAPS
FT                   EMVRGFGEAIVEIPLALESLRGGSEGRFDGIEELLEEVTEYWLDDIVRTAVSDFIESKV
FT                   ANIIMCFPLNSDDAAALAVEQLVTDLSYLKSILAAVSDDPFERLESVLSRLKTASIKSG
FT                   STIAIRELIAEQGQSKE"
FT                   /protein_id="XP_845669.1"
FT   gene            complement(<82554..>84311)
FT                   /note="synonym: Tb07.8P12.660; protein farnesyltransferase
FT                   beta subunit"
FT                   /db_xref="GeneID:3658257"
FT                   /locus_tag="Tb927.7.460"
FT   mRNA            complement(<82554..>84311)
FT                   /db_xref="GI:72390751"
FT                   /db_xref="GeneID:3658257"
FT                   /locus_tag="Tb927.7.460"
FT                   /transcript_id="XM_840577.1"
FT   CDS_pept        complement(82554..84311)
FT                   /locus_tag="Tb927.7.460"
FT                   /gene_family="HOG000258042" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein farnesyltransferase beta subunit"
FT                   /note="similar to Protein farnesyltransferase beta subunit
FT                   (EC 2.5.1.58) (CAAXfarnesyltransferase beta subunit) (RAS
FT                   proteins prenyltransferasebeta) (FTase-beta).
FT                   (Swiss-Prot:P49356) [Homo sapiens]; go_component: protein
FT                   farnesyltransferase complex [goid 0005965]; go_function:
FT                   catalytic activity [goid 0003824]; go_function: protein
FT                   farnesyltransferase activity [goid 0004660]; go_process:
FT                   protein modification [goid 0006464]"
FT                   /db_xref="GI:72390752"
FT                   /db_xref="GeneID:3658257"
FT                   /translation="MSFVPPPASSTTHAQREVELTLLRFLEKYRPEVCDLWGTHSNIYL
FT                   HADSNEKEEEMCTIDNEEGIVHSLNRESHEKYLKSRLVKLPEYAQRLYNAQPWMVYWTL
FT                   QAAEMLGITEKLYEQISQDALGEFILSCLQEQPVEDEQKGCWGSEEGGKHGKGSMPQQC
FT                   GNVYDFLRRCDADHTCAIGFSGGNYGQIPHLATSYAGVCSLCILECPEYLQALPRSAIK
FT                   RWLLSLRCADGSFRMHIGGEADIRASYCVAVITTLLQLQDVDASSGDILREQEAQFVAS
FT                   CQTHEGGFACGRFASEAHGAYTQCGLAALILMKRPELCNYTALRGWLAARQLRFEGGFN
FT                   GRTNKLVDSCYAHWVGASHVLLRVGESLAKITTCGETKRSLTSREMLLLDHAQLVDISN
FT                   LHPESFEAWSQHEEEKQERASRVEAYLSATPLAASWSSSGVPNVLDDDAGDFYFNQRRL
FT                   QLYILACCQNREEGGLMDKPNYPNDFYHTCYSLSGMSSAQNLQGMQVNRDGRDLSGNSF
FT                   YAAAVSRGYIPGRRDSYGIVLPSDERSGVSSELHLSKNCLRPTNPIFNINQSKVLFALR
FT                   TWGAKTFMC"
FT                   /protein_id="XP_845670.1"
FT   gene            complement(<85331..>86224)
FT                   /note="synonym: Tb07.8P12.680; hypothetical protein"
FT                   /db_xref="GeneID:3658258"
FT                   /locus_tag="Tb927.7.470"
FT   mRNA            complement(<85331..>86224)
FT                   /db_xref="GI:72390753"
FT                   /db_xref="GeneID:3658258"
FT                   /locus_tag="Tb927.7.470"
FT                   /transcript_id="XM_840578.1"
FT   CDS_pept        complement(85331..86224)
FT                   /locus_tag="Tb927.7.470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72390754"
FT                   /db_xref="GeneID:3658258"
FT                   /translation="MTRYSLALCMVLSLVFAVVFLRPIAAAPQESNGSNTISVPPIDGD
FT                   TMLLNQNVILFACIVDTPFTQFDADEFIEKALGILTQLPKGEFNRTSQFELLEYCSWDT
FT                   RVADEKSFCGAEDEGPTYAAQTLVRFGVAGVDGESLKRLSFSSLSAILPPFIQGEDPAL
FT                   FPPDKRQHFVERMMNSDNTFDVVAVVVLFLYPILLFYYLLTSCTRERIRDKQCVEFLRN
FT                   SINSELAYRQHMKCAEMYASSGQTVQKCGSDAYNVELEDMDPHNRVNVMSREGMASGEV
FT                   ACNDGRDGGMQKPTQL"
FT                   /protein_id="XP_845671.1"
FT   repeat_region   86470..86509
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   86543..86581
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   86775..86803
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    87099..87119
FT                   /note="AT_rich"
FT   gene            complement(<87350..>90154)
FT                   /note="synonym: Tb07.8P12.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658259"
FT                   /locus_tag="Tb927.7.480"
FT   mRNA            complement(<87350..>90154)
FT                   /db_xref="GI:72390755"
FT                   /db_xref="GeneID:3658259"
FT                   /locus_tag="Tb927.7.480"
FT                   /transcript_id="XM_840579.1"
FT   CDS_pept        complement(87350..90154)
FT                   /locus_tag="Tb927.7.480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390756"
FT                   /db_xref="GeneID:3658259"
FT                   /translation="MRPSRRCSAAEPIKGDVYGKKLPESTSTRSAGPISGTDAEKPVLH
FT                   VWKNLGDDSGTITSFWKTIKSPNCRYSAMLALRITLVAALPLMLISHFYKEKLPMYAVL
FT                   GLLGVANSQDTVGEQVSFTITLVQVGVWSTIWGSFLSLFDIPKNEALWWSLAFLGCFAV
FT                   GLTGNLRCRRQAVLFTIIVMEVQRSKEEWSALTALLVGRDIIMSAFFAQLQAILLPVSM
FT                   NRRVDREMAKACGYLAAIVRDAAKVCWSKDPLEVQLTLPKLSSDPLQDCFITIPGQLTY
FT                   VSYEVWVSTRQLELRRERLKVLQDVMPMLHGLTAVARIMSAEGAYRKHRHRSTEKMGED
FT                   AIMSTALERLNDSVNCFCDALSNTMEQLSTVLEPRDVIERVPFDEFATATSNLQSALDK
FT                   LHYDTMAHDFVPEDTVWYMHLVFAHHMMILLGEEIHKYAENLRNFDPSRFKSGSRRFIE
FT                   FFFLDVFHGFVKMIKNRFTLATPHDVRVFKNAFKIACAYIVGCAYSLYIDKENVYYFGM
FT                   TILMGVGLPTAGESIMSGVQRVAGLLFSTSLAYAVDRNYHHGWESFVCVLFGVFIALFA
FT                   RVAPAYASCALHCAITLPPSLHVVSDFRLTLSRLVSNAFSVMSYYAIVVFIFPVDPIKV
FT                   LHNTEVCVVKALSENFSELMGLVHPPVGEGDDEGSEIMSLLLRIKGRREAVWETLKSVR
FT                   VCMGVAATEPILHGIPYPARGQEEFVPVLRRLAASVDIILLGLLHTHRQRPGGMDHEIQ
FT                   QVFATIQPVVREIDKYSVHVMQDFVDAVHKPMEWSYDLAAEHYSKLRELTVLLRAAFKS
FT                   VYEDIIAGLRRNAVQIKLGKFPNHNFLDMSCTFDGASFAHDANEMSLSFGDTLRLDELL
FT                   DCEELTAPRNASFLLAPKDFTINHDMNMSIAILVGINLFCTQLKKTMEATSQLNAFERS
FT                   RIGS"
FT                   /protein_id="XP_845672.1"
FT   repeat_region   90599..90620
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<90640..>92271)
FT                   /note="synonym: Tb07.8P12.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658261"
FT                   /locus_tag="Tb927.7.490"
FT   mRNA            complement(<90640..>92271)
FT                   /db_xref="GI:72390757"
FT                   /db_xref="GeneID:3658261"
FT                   /locus_tag="Tb927.7.490"
FT                   /transcript_id="XM_840580.1"
FT   CDS_pept        complement(90640..92271)
FT                   /locus_tag="Tb927.7.490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390758"
FT                   /db_xref="GeneID:3658261"
FT                   /translation="MTKLEANAAVYSHRLRNLDRAIVHRLAGDQIIFGEGIITAYQLLA
FT                   GDTKLVDLEKKRRGGKKFSAGVAFAANASRERKLPQRKGNCGTGKEAPLVEALSLVGKV
FT                   DAAIAFCEGKLAAIQQLCPSSNTGMHFRQQRSIHEELMPHALGTGRIELLTNDGITNDV
FT                   PSKPLLSGMSRRPSNYELSPSDFKGECCTPEQIFIEAREDTQFLWLLRCIAEETIQRYV
FT                   IVSEERIYFTSFVVAAREEVTAVISAATPHYTPSSVLSELNNQTLVAQSQEKLIEEKKK
FT                   VWVNGNYIKDSSTDSDECSPVVKGSVKTVCVNMESPILYKKHVRLLPFVQTLLYETEAT
FT                   QRTQIERESHVSLELIDAHRQLMIHHITSKSLMVTEEECMRELIENINDFKLPVEGKVC
FT                   PKQQKIPIPRSDGTLSSMRDIRSCSSSPYAPATQSTHSCGDTPSHGSTLSSNPSTLAVS
FT                   RNVKHVTAGHCFTTEQRHILRLQNHGEVPVYICERVEHVKRQQISTRERRAREQLFSCV
FT                   ESGRGDARKMRISALADNSVLNGHTY"
FT                   /protein_id="XP_845673.1"
FT   misc_feature    92592..92620
FT                   /note="AT_rich"
FT   misc_feature    92787..92838
FT                   /note="A-rich"
FT   gene            complement(<93676..>98391)
FT                   /note="synonym: Tb07.8P12.720; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658262"
FT                   /locus_tag="Tb927.7.500"
FT   mRNA            complement(<93676..>98391)
FT                   /db_xref="GI:72390759"
FT                   /db_xref="GeneID:3658262"
FT                   /locus_tag="Tb927.7.500"
FT                   /transcript_id="XM_840581.1"
FT   CDS_pept        complement(93676..98391)
FT                   /locus_tag="Tb927.7.500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390760"
FT                   /db_xref="GeneID:3658262"
FT                   /translation="MRECDNCGRISEDSRFLKPQQHVPQCFLLIEGKYLQESPASQLFA
FT                   VSTPVKSCDVSFYNEETSQKVTFDLPKIIGGANHNSTNRRDVSSTSSQLHLRPLPNERL
FT                   NLFLPSRELYMRERALQQMESAALNERVIADTRKDIALIRDMLRSAITARPLKEKQHDR
FT                   PNHDETLPPAKVRKAETGKWEKELFDGFGEAADADAVDQLLNSGEATRNRNREEVCVIE
FT                   FNRMVKTSSLCVGKYGLNIKGIEDMDITAPATEFTVCVEEYKVVSSQGPRVLHEVRHRL
FT                   YRSINMKREHNKSFDASFGQPVEFFVTECNDLHVFIIHLLYRGRLFAWSSVNALYEGPW
FT                   VSKLRKPPVDMAVALVVEHINLDDPILRGFISDKASDDLGEAEAYLNRLESQPPAANKT
FT                   VENMNDPSVSAVNLRPRMSAKTGVDKASETIQHTKTQRQNYDENGKVVLAASPVPPVTK
FT                   KSFSHKEERESTSPSGPQNSTAILKPYPREYREERETTSPSGPQNSTATLRPYPREYRE
FT                   ERETTSPSGPQNSTAILKPYPREYREERETTSPSGPQNSTATLRPYPREYKEERESTSP
FT                   SGPQNSTATLRPYPREYREERESTSPSGPQNSTATLRPYPREYKEERETTSPSDPQNST
FT                   ATLRPYPREYREERESTSPSDPQNSTATLRPYPREYKEERETTSPSDPQNSTATLRPYP
FT                   REYKEERETTSPSDPQNSTATLRPYPREYKEERETTSPSDPQNSTATLRPYPREYKEER
FT                   ETTSPSDPQNSTATLRPYPREYKEERETTSPSGPQNSTATLRPYPREYKEERETTSPSD
FT                   PQNSTATLRPYPREYKEERETTSPSDPQNSTATLRPYPREYKEERETTSPSGPQNSTAT
FT                   LRPYPREYKEERETTSPSDPQNSTATLRPYPREYREERESTSPSDPQNSTATLRPYPRE
FT                   YKEERETTSPSDPQNSTATLRRFRRGGMDGRDGRDHTGAVTCQSNGGCVSSKGERSDTK
FT                   TNGASGTRNRGRNNDGNGDKITGGSGSQRFPVEERVSPLSACVLLGLRSEGDAPSSRKI
FT                   GSEREAFASVDLRVNKIVGLPPNCLCARVLVYFVNYISRQTKGLVNDSSDCELFMRPPN
FT                   AIGYQKSGGNGTSPTFDIKFDDIMVTNNTYAIVIIEYITNPKCGPTTFGHVSLPIHTLA
FT                   PVGNFLSRIRLGDPREPEARSVHVDRLSGPTSILTSYRSSKQRQHAVAEGKFDAAALYD
FT                   KLLQPLKSRAECHPCGFISWCVGSDPNAPSFEYPGEPPLSNGEVELFSVREALDTSKSF
FT                   HYTDIGEPMRAFGQQRSQSFRDFSSIVPYDPNRGFFILTEAVHGMCTREALYVVVTSIN
FT                   INGHNNIAYTKKFRWSSDVGAPHFDDPIKAIRMVKAHPFTVAEKYLLRITNLDTIPKYE
FT                   GRQLLVEQVGWTLLKMFPEDGAVRTGRYALALFEGTPPPQLLDEVKSYPMDEVLSYWVL
FT                   SNRVQYITPPASVVVSIGDICFAEQFSVDHPGRPQPQKLMTTKHQEISLPCAGNEGSMG
FT                   YKQDDLLKDMGISVEKAESAIRTALKSFLHRTIQRRREKYGKKDVRFVDGE"
FT                   /protein_id="XP_845674.1"
FT   gene            complement(<99076..>100146)
FT                   /note="synonym: Tb07.8P12.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658263"
FT                   /locus_tag="Tb927.7.510"
FT   mRNA            complement(<99076..>100146)
FT                   /db_xref="GI:72390761"
FT                   /db_xref="GeneID:3658263"
FT                   /locus_tag="Tb927.7.510"
FT                   /transcript_id="XM_840582.1"
FT   CDS_pept        complement(99076..100146)
FT                   /locus_tag="Tb927.7.510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390762"
FT                   /db_xref="GeneID:3658263"
FT                   /translation="MGSGCSTESSTDVRCSFVGLMDEKKESWRGRLLGDIGKDPTGVTR
FT                   DFPRTQVYVAAPNRNNYYREKQDHVSVLVLKDKEDESKYFSDRNERVRESLELLVELCG
FT                   EDSSVIKSEWEKQQKDIPDSSSLLMTVLLESGMMRATEANTENGGAGGETDAVTNIQNG
FT                   GGGYAPKYTVHSKALRLMQYMVQSVAFFSTQHVTDALRFSWCKHMQDVSWAVYVYTEGG
FT                   ACGKERNSSDEILVLRHMHTLRHYVGQSERSTHPRFEVDWACTFHIDLKRLLDANNTAA
FT                   KEATFAPEGEVQRIDGELLAARIESPNRKLCRITSTWKKRRSELEGRLMECFGVELTKV
FT                   DVLDENGPLSALNSGG"
FT                   /protein_id="XP_845675.1"
FT   repeat_region   100419..100456
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   misc_feature    100681..100726
FT                   /note="A-rich"
FT   misc_feature    100881..100916
FT                   /note="AT_rich"
FT   repeat_region   101067..101124
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<102082..>102630)
FT                   /note="synonym: Tb07.8P12.770; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658255"
FT                   /locus_tag="Tb927.7.520"
FT   mRNA            complement(<102082..>102630)
FT                   /db_xref="GI:72390763"
FT                   /db_xref="GeneID:3658255"
FT                   /locus_tag="Tb927.7.520"
FT                   /transcript_id="XM_840583.1"
FT   CDS_pept        complement(102082..102630)
FT                   /locus_tag="Tb927.7.520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390764"
FT                   /db_xref="GeneID:3658255"
FT                   /translation="MSLPDGGNPESPNELSTDSEKEAFSQNPSTAGRSADDEPFRMEVT
FT                   RETLDVMLRAKSSCRAGFSMVDWGGILQSIWRKMKRETNEKKLPYLSISEIRRHNTPDD
FT                   LWIVIGSVVYDCTKFQHFHPGGERMLQLCGGRDATELFNYYHRWVSCESMLQPFAVGLV
FT                   KPEDEERGEREKEKEKGPG"
FT                   /protein_id="XP_845676.1"
FT   gene            complement(<103327..>108015)
FT                   /note="synonym: Tb07.8P12.780; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658256"
FT                   /locus_tag="Tb927.7.530"
FT   mRNA            complement(<103327..>108015)
FT                   /db_xref="GI:72390765"
FT                   /db_xref="GeneID:3658256"
FT                   /locus_tag="Tb927.7.530"
FT                   /transcript_id="XM_840584.1"
FT   CDS_pept        complement(103327..108015)
FT                   /locus_tag="Tb927.7.530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390766"
FT                   /db_xref="GeneID:3658256"
FT                   /translation="MPDNNNNSSSNNSEILTRNEYPTPAPPAFFNASPVLTLPVTLQKV
FT                   TEFDPAKQENLSPHTLPDGSEYYGDMLLDKPHGLGIVIFKDTSSIYGSGDRYGGRWANG
FT                   AFHGEGVLNTTRFTYEGEFNSGRMCGRGKITYKRRPGEVSKRGVVPVSQYELTHPPKEY
FT                   EGDFHHTYHRHGRGILRYANGDVYKGEFNSNSRHGRGRLECASGEVYDGEWLKDERHGG
FT                   GKVSYVDGGEFKGMLVRGKRDGEGCMRYPNGDEYFGNFSNDKIEGRGTMRYKNGDIYEG
FT                   MWKGGLRHGEGKSTLHKLGAIVEGDFVQGLIHGKGVVKYPGVSTFVGVFENGERKHGTM
FT                   FWHRVPADGGICYQGEWVGEMRQGRGLVWYENGDFFFGSFVKNMRHGGGNLRYADGSEY
FT                   SGNFVNDVREGEGILQRKNGSIQAGIWRNDVLVDGYDGEWDGVSFNGVGSLVFRNLLAH
FT                   KGKGSKGGGIPGSLPAGGNSGKSGDGAPSGDVTTSPLLEHFGVFCQGVRHGPGVLRLCG
FT                   HVLIGNWINDTLSCDSGSWEFPSGDLYVGSFKDGFRNGPGGRMWFTDGSYFSGDWRLDS
FT                   PIGVGLYHAVSTKNVTNPAEECLATANTAHQVESQKEEQRDGSNTLMSLFTSFFRNEPL
FT                   KGEKECEVLTTVCHEHYLLRGEWRPTVVPYSSCQLLVAQCAAAAISAPDVTAVVAKVKK
FT                   KKQNDVVIGKPPVTMCLGLQEGSGVVLFNSGVCMRADWVQSHPKLVFPHRANAPYHGEI
FT                   LKQNAEKNISEAPLSESGTGKVCAVCEKPFTFFRKELKCAICDRVCCNSCYNTLDLRDH
FT                   PKLEALMRQCKATPIGDSEAEAPAVVNSPSQLQACTTCISTLQLEAQFITLWLPMRYCN
FT                   CASQEGEETGAVGGGEDEDGKTPVPSTPEGKEESVNPDLWCTTGTEQGTCDPRAQTKED
FT                   EYIIYEGYISSAIPHIFGSLWWGKNEYYLGGFKEGRRHGFGTQILWNGETYTGGFADDK
FT                   WHGEGAYSCSDGTAYAGTWENGALKTIKYHGELDSKGRQHGRGQSYGCGKDGKSRYNGE
FT                   WKHGVWHGSGILQDDDGFLYSGEFTSGRIEGMGKLLLGGSVYYGNFVAGKQHGHGFELF
FT                   SGECAVVGEWRNGVLCGSVAIHDAATESVYETTYANGNERDDCFMLPVMVNDDKASHCS
FT                   LCSATFTFFIRRHHCRLCGEVFCDACSQSRASMPPHFKMDGQQRVCDRCFQRLKCGRML
FT                   AIRRYGRNREVYAGCWSQGQWVSRGLFRRADGSVIVTNMAGRPILDCDPSTDGMGKGPS
FT                   FALHGCAALPPVDELRKLPASPDAEVEAFKLWWEVTSTVIGLAVPLNTEPIESFTLPRP
FT                   PHIRAPNLFSMLDGGNDNAAAVRAANFRPAIPPPPPPFPALDDFKKKTEVKSAPPQKPV
FT                   ITETSVFSRIVDRCAERLPLGSPPLGDDDDSTESVVPSRYTRKDLLPPVPACPPSGMDD
FT                   RIVWSDWAIRRVPKYGGIAALSGTGSSTRLPEELNHVPFACSFVPPVVPDADRVVLGTE
FT                   RRWRPEPFKCPQEFTIDEAPNLEVIVQQRDRLFGRKPASSES"
FT                   /protein_id="XP_845677.1"
FT   repeat_region   108273..108307
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cagaga"
FT                   /rpt_type="tandem"
FT   repeat_region   108817..108845
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<108943..>110316)
FT                   /note="synonym: Tb07.8P12.820; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3658266"
FT                   /locus_tag="Tb927.7.540"
FT   mRNA            complement(<108943..>110316)
FT                   /db_xref="GI:72390767"
FT                   /db_xref="GeneID:3658266"
FT                   /locus_tag="Tb927.7.540"
FT                   /transcript_id="XM_840585.1"
FT   CDS_pept        complement(108943..110316)
FT                   /locus_tag="Tb927.7.540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="similar over 69aa to Chaperone protein dnaJ.
FT                   (Swiss-Prot:P47265) [Mycoplasma genitalium]; go_function:
FT                   protein binding [goid 0005515]; go_process: protein folding
FT                   [goid 0006457]"
FT                   /db_xref="GI:72390768"
FT                   /db_xref="GeneID:3658266"
FT                   /translation="MSSADPKTDVPHGFRLIPMLFYEYFAGSAFNVDVLKAIFRSIGTA
FT                   GSNCGKGLGLFSRTVNIVIAQLSQRVVEWCVVAYFTSSNSLLLHRAAVLHCTFPYVQHY
FT                   RFTNCWITHFPCSVAKIFVPSFLWNWVRNTIVGLPSLGDDGTDGVNDYGESISFYNSSY
FT                   ASSTPTAVVASSLVSEITEHIIQQIAWAVLFYRSRDEKDALWPMVKRYLSTTVESLTHS
FT                   VLIVCARSVGAWFGGRVSRNPSSGCIFWCERTLLLLLGPAIGKSGRRLGVKLLQELERF
FT                   HPTTEAEARADDARSNAESSAHDGEDDWNTGSFFYPTTLSTVDYYEVLGVERTASLEDI
FT                   KRAYRAAALQNHPDHAPKEAEAQNAAQERMAVINQAYETLGTDSKRRKYDQACANIQIP
FT                   GVFSRFNDFPLSTHDGSTVLVAVASLVVKSFVAYAQYYSSFLELTGLGKGPLRYVGFL"
FT                   /protein_id="XP_845678.1"
FT   repeat_region   110928..110947
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<111466..>112965)
FT                   /note="synonym: Tb07.8P12.840; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658268"
FT                   /locus_tag="Tb927.7.550"
FT   mRNA            complement(<111466..>112965)
FT                   /db_xref="GI:72390769"
FT                   /db_xref="GeneID:3658268"
FT                   /locus_tag="Tb927.7.550"
FT                   /transcript_id="XM_840586.1"
FT   CDS_pept        complement(111466..112965)
FT                   /locus_tag="Tb927.7.550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390770"
FT                   /db_xref="GeneID:3658268"
FT                   /translation="MGGGGSIPRKKATSARQVSTDRSVRRLQTKRRVGEPRFNGIGYVT
FT                   IPLCIQEDLPPPPEDDDAPDDSTRKFAWFVEDLDMPGEWELYPPDACERLDEARRSNMT
FT                   ECLVVVKKRMCTVNLVKMEHLCAGSNARPRQVKRVEVEVSNGTTTYQEKRKVPNDPFAE
FT                   DSPRETPSPMELFESEENAVHDVGSATTTKAEPEKVPNLVRSILTEKTTSYAMSLTSNG
FT                   TTVFSGTKAQMLRWDLKTAEVTAEFDVQDSVVLSNALSHDERHVVAGRSDCTASMHSVD
FT                   GSTSCVFSGHQRKVYGVDFLLGDDRVATASMDCTVRIWDASTSTCVQTIGCSAASVFTV
FT                   VTSDLNNHFALSAGDDNIIYAHDLRSGGDCVIDRFIDHASTVWCCALRNDEQVFASCGI
FT                   DGVIRVWDIRNSSSPTLLLRHHEKPVHMVKFTPRGRAILSCGRDDNMRLTDAMTGEPLW
FT                   RAVAHRRFVYRIAFSKEKKFILSSGGDHRVNVWNYDYIDRM"
FT                   /protein_id="XP_845679.1"
FT   gene            complement(<114077..>116398)
FT                   /note="synonym: Tb07.8P12.850; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658267"
FT                   /locus_tag="Tb927.7.560"
FT   mRNA            complement(<114077..>116398)
FT                   /db_xref="GI:72390771"
FT                   /db_xref="GeneID:3658267"
FT                   /locus_tag="Tb927.7.560"
FT                   /transcript_id="XM_840587.1"
FT   CDS_pept        complement(114077..116398)
FT                   /locus_tag="Tb927.7.560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390772"
FT                   /db_xref="GeneID:3658267"
FT                   /translation="MFVLHRGFRRHAIIRVSFASGYLHTFGMQQRRCCDVRGVISLLRR
FT                   QHMRQQNPHNTKVVSSDICDEGNDEGFDCQTTLETSQLIACCENMCQENKLLDLSADER
FT                   VGATQLLISALAKVNKRGFDSVRRHREGASNGPCETKEKGEIKAKTSLEGVVLWDLALR
FT                   LFLNLPSSEGGVSLTAKQQIDLCGSLLQCLIHFGAPQNVVKAAYQTLHTSLMPPSSTSS
FT                   ENFPEEVVRRSSHLHVSYARYLLKCASGGGTGECDLSLHKDAFRILLLDCPERGLPLGS
FT                   DGYLMILEILRRITTGEVPSLKIEPQEENGCHDGVNDMLWSEFDPAHHISDILAAGRAC
FT                   CLRVVQCHGPIGTAQEAFCRFISVGMQLQAVHLNPFLRSRHSIASIVAPEGFCVKFNPQ
FT                   LYIQFLNGISDMLQSELTRRSAISHVLEGPCILSQRQRLAGTAQDVKTSHVCVWLVRHI
FT                   LRRQRDLQKKATGPKGGVEKDKFFMCTNSNDVCKSNYKDSCGDDSLQIWKEGTEAALRC
FT                   LRHLLLRLPEGRSGHRKRQRNRDQVNVRQEVFCLLFEGVLDGLFYTATAEGEITGETGT
FT                   GIPPVMVIFTQSYNQWDWRYPSVSIFVECLYTWGMHDMVKDVFSHIYRYAESRWNIDEQ
FT                   KQLTDEEINSEDCGVTTRWKGYSLPLRTCEMIIESSCKNDDPATAALAVAYMLRQLLSL
FT                   KAVEHNMCSSRNEGCEETDGVNTDVCEVESRCVEEWTRMIKEEIIPQIDEVFRRTGVDT
FT                   NKQWLTDLTDAKNAVGSTLR"
FT                   /protein_id="XP_845680.1"
FT   gene            complement(<116994..>117587)
FT                   /note="synonym: Tb07.8P12.860; prefoldin, putative"
FT                   /db_xref="GeneID:3658264"
FT                   /locus_tag="Tb927.7.570"
FT   mRNA            complement(<116994..>117587)
FT                   /db_xref="GI:72390773"
FT                   /db_xref="GeneID:3658264"
FT                   /locus_tag="Tb927.7.570"
FT                   /transcript_id="XM_840588.1"
FT   CDS_pept        complement(116994..117587)
FT                   /locus_tag="Tb927.7.570"
FT                   /gene_family="HOG000184744" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prefoldin, putative"
FT                   /note="go_component: prefoldin complex [goid 0016272];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72390774"
FT                   /db_xref="GeneID:3658264"
FT                   /translation="MEKYEFPEDYVNPRNIPRIAYIPDVAAYVSNGGGADTVISNLLME
FT                   SSKYEHMEKRLVSSLANLDYKIPTIKKTLNSLEFLQKQLEEAEQQEEDGKRAGIRSYYC
FT                   LTDSVFGEAIVRPQKTVHLWMGAKVMVEYTFEEASALLKKNLSNAEVNMRNTKEDLAWL
FT                   QEQITNLQINISRVYNYDLKNKRAKDNKKETSEK"
FT                   /protein_id="XP_845681.1"
FT   gene            complement(<118594..>120642)
FT                   /note="synonym: Tb07.8P12.880; GTP-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3658265"
FT                   /locus_tag="Tb927.7.580"
FT   mRNA            complement(<118594..>120642)
FT                   /db_xref="GI:72390775"
FT                   /db_xref="GeneID:3658265"
FT                   /locus_tag="Tb927.7.580"
FT                   /transcript_id="XM_840589.1"
FT   CDS_pept        complement(118594..120642)
FT                   /locus_tag="Tb927.7.580"
FT                   /gene_family="HOG000258028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein, putative"
FT                   /note="similar to Guanine nucleotide-binding protein-like 1
FT                   (GTP-binding protein MMR1). (Swiss-Prot:P36916) [Mus
FT                   musculus]; go_component: cytoplasm [goid 0005737];
FT                   go_function: GTP binding [goid 0005525]; go_process:
FT                   ribosome-nucleus export [goid 0000054]"
FT                   /db_xref="GI:72390776"
FT                   /db_xref="GeneID:3658265"
FT                   /translation="MAPFSGKQKKKQLQEKRQRKKEQQNTESESKKRDEHGATEECNTQ
FT                   KYRQEGSSGAEHNSDSQHEKEEYKYGADRVGIRSVFLKETAEEVAERKKLSYERLANRH
FT                   FMGPEGIPFGTWFNMPGPTKAAIIPLSVEIPTRGWSVDRVPMSKPNASDSMSDCNNSSN
FT                   TDDVVDEVGDVLRDGPHVDAREQARFKEYVRALDNYSLPGEMQKLQVSSYERNIDVWRQ
FT                   LWRTVELSDVVIIVTDARYPVVHLPLSLLHYIVRECRKACVVVLNKADLVPPQTLNKWS
FT                   EFLQSYFLTMGVVAASDEEATDTGIVREIPLVPFTALPSEETAIGTDTACDAMKRRKKK
FT                   NRRNKLYEQLRTGKLQVCTDDSSDDGEEDDGDDLEKEISRLVPAAVAKGIVKGGDDESY
FT                   AETDNFRGMRKAERELQRDRRDHKELQIVSNMISSLLQQCRDIGLSRRSAGSGNTSVTV
FT                   HKCDRERGNEEDEEDEYIRIGFVGHPNVGKSSLLNCIRGTKVVSVSSTAGHTKHLQTIP
FT                   IPSENVVLIDSPGLAFPVFGLPRPLQAVFGTHQIAQTRDPQSGVAYLATHLHLERLYGL
FT                   SRSDYYDDDDDDEKSSRRHGPCGAPNVWSPYELCESYARKKGYFVKRGKGTLDVHRGAI
FT                   ELLQEAYEGRLVLFLSPPELSWLQSSEFNNEVRPYLLLRVMPLASSV"
FT                   /protein_id="XP_845682.1"
FT   misc_feature    120742..271944
FT                   /note="sequence corresponds to BAC RPCI93-29K4"
FT   gene            complement(<121221..>122612)
FT                   /note="synonym: Tb07.29K4.780; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658269"
FT                   /locus_tag="Tb927.7.590"
FT   mRNA            complement(<121221..>122612)
FT                   /db_xref="GI:72390777"
FT                   /db_xref="GeneID:3658269"
FT                   /locus_tag="Tb927.7.590"
FT                   /transcript_id="XM_840590.1"
FT   CDS_pept        complement(121221..122612)
FT                   /locus_tag="Tb927.7.590"
FT                   /gene_family="HOG000258024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390778"
FT                   /db_xref="GeneID:3658269"
FT                   /translation="MLSAPRRRHLVAGFRLSALGGACGSHCSGTYSYRFIRCSISGSRC
FT                   AQIMGRNPICVSSRSIAYKTDASSFEREVIQSQQAICLVYYRPDSSGCNAYLAHTERLV
FT                   DRLNEQACGGKNGEGTEASMQRAWLKLCTINADENRNLASAFSVERAKLPITYFIMQGT
FT                   IIDKVTGQVTETRLEGILRKFLDHYQQQLNVDLMGGSPNKQNPLPAAAGADLLHGASTQ
FT                   YLQNQIMAALLGTECIRLPEESEKLDGLRKTIQQAKKKAFDELQELRRELGVDVRRLGE
FT                   AEMMERYYKSSQYSATAVLSGLEALFLARVHATIGNISAENVLFAVKAIQRDFEPALGD
FT                   NTVKRLISLCEALVLRAELHLERKLESESGGEAHVAKLLRWIDELVDARLVPERYPSSE
FT                   VEEMFNLLKLYIPQARRAQGSNKEECLSAKRVRQVKTCLLGVLQLFHDDPKSQEARLRL
FT                   SSLLY"
FT                   /protein_id="XP_845683.1"
FT   gene            complement(<123400..>124941)
FT                   /note="synonym: Tb07.29K4.770; DNA ligase, putative"
FT                   /db_xref="GeneID:3658273"
FT                   /locus_tag="Tb927.7.600"
FT   mRNA            complement(<123400..>124941)
FT                   /db_xref="GI:72390779"
FT                   /db_xref="GeneID:3658273"
FT                   /locus_tag="Tb927.7.600"
FT                   /transcript_id="XM_840591.1"
FT   CDS_pept        complement(123400..124941)
FT                   /locus_tag="Tb927.7.600"
FT                   /gene_family="HOG000258023" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA ligase, putative"
FT                   /EC_number="6.5.1.1"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: DNA ligase (ATP) activity [goid 0003910];
FT                   go_process: DNA replication [goid 0006260]; go_process: DNA
FT                   repair [goid 0006281]; go_process: DNA recombination [goid
FT                   0006310]"
FT                   /db_xref="GI:72390780"
FT                   /db_xref="GeneID:3658273"
FT                   /translation="MWRISNLWRRPQLTTLPKDPSLFFGVGRPRTPEQVERYHAMKNTT
FT                   IESAFPHLAACWVGPSWGTVMLTPHHVAPTCVKSAVWRCSQCLQEFEMSIARFIDQHGT
FT                   CPLCGKEQRRISSTRNEGPERINGKMSEGDNTDVGITTSPTDATNEEDLELEDVNSLRA
FT                   PRMTHTNYKSVLHSNPEWEGRNILPMLAQRWELVAEELLHPADTEEQESLLVSPKIDGI
FT                   RCLIGYNKSQKKLQFFSRSGILLECCHGLVPHAMPLFKADPSLLLDGELFAPHCGFERL
FT                   SGLVRRLEKFTTQTTRRKQAKLLEYFAFDIMASDQLSSPDAPFSERYRLLKELIPHSGA
FT                   DRVFDTMKPNGRRNHQLEKEELSSRKKIPKLYHVPATLVSPDEVESVLEKACSQGYEGV
FT                   IIRRPKFPYEHGKRSLGLLKYKYMHDAEYRIVDFLPGNGKFEGGLGAFVCETSTGIRFN
FT                   ATPKTTTKRRLELWAERDRLLGKYLTVQYQELSSQDVPRFPIAKCVRGESEKDWL"
FT                   /protein_id="XP_845684.1"
FT   gene            complement(<126093..>127541)
FT                   /note="synonym: Tb07.29K4.760; DNA ligase, putative"
FT                   /db_xref="GeneID:3658270"
FT                   /locus_tag="Tb927.7.610"
FT   mRNA            complement(<126093..>127541)
FT                   /db_xref="GI:72390781"
FT                   /db_xref="GeneID:3658270"
FT                   /locus_tag="Tb927.7.610"
FT                   /transcript_id="XM_840592.1"
FT   CDS_pept        complement(126093..127541)
FT                   /locus_tag="Tb927.7.610"
FT                   /gene_family="HOG000258022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA ligase, putative"
FT                   /EC_number="6.5.1.1"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: DNA ligase (ATP) activity [goid 0003910];
FT                   go_process: DNA replication [goid 0006260]; go_process: DNA
FT                   repair [goid 0006281]; go_process: DNA recombination [goid
FT                   0006310]"
FT                   /db_xref="GI:72390782"
FT                   /db_xref="GeneID:3658270"
FT                   /translation="MRFSRPCLSSLFATTVPFLSRSSRSASLAKNLAQFHPTIAQTWIT
FT                   AACNKLLQPQHVLPSSRKLAWWRCPYCEHQHPKRIDLHVAAGGACPKCSRMPTLTCSRK
FT                   RSASSSRTSDNTLAATVKHRCRPDNSLAILDAPNASRVKNSIADNGYLRVSETRNLLPM
FT                   LARNYDKEVKRISNDEQLFVSPKLDGVRCVVAWNLRDRCLSFFSRSGMLFDCCDHIEPQ
FT                   LRPLFEKDNMLVLDGELYNHDASDFEQLTSAIRTTRQHRTAGIEKVQQQLQYHVFDLLY
FT                   AKEFPHMTVVPFGQRYKHLCDLMQKINSGKGQGRRKVVKLVPVMSAKKSDIDRLLRLNV
FT                   DRGYEGIMIRRNGIEDNKCMTSVSSSGGASAAVPGYAYGARSPNLLKYKLMQDSEYIIV
FT                   DGVEGKGKWRGCLGAFVCQTRAGHRFTVAPATTEERKREMWHRLNVYKGKMLTVQYQEL
FT                   STNGVPRFPIGKCVRGTKTGSDWV"
FT                   /protein_id="XP_845685.1"
FT   gene            complement(<127999..>129186)
FT                   /note="synonym: Tb07.29K4.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658272"
FT                   /locus_tag="Tb927.7.620"
FT   mRNA            complement(<127999..>129186)
FT                   /db_xref="GI:72390783"
FT                   /db_xref="GeneID:3658272"
FT                   /locus_tag="Tb927.7.620"
FT                   /transcript_id="XM_840593.1"
FT   CDS_pept        complement(127999..129186)
FT                   /locus_tag="Tb927.7.620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390784"
FT                   /db_xref="GeneID:3658272"
FT                   /translation="MSGSAGASSIWMSSLAQLQRLSWDVGRPPLLNHWLNFFVSLRSRN
FT                   TPQIFTEGPLGVVNNEHKMVNSHTSAAAAAVACTVPLPQEVRQVIAECFVDGVRVAQLK
FT                   NLLTSPTGILTDASSINICEGNDGVFSEGKRDFCGTTEKKCRDCLSTSPGNAAPGADNH
FT                   QCDFDEVLFLWCASHETPCHAQQLEAWLREAVGLLHFFTLRPGSKTEQLHIIRPQECLE
FT                   YSSILCVLLRALCAMFLRSGLNATKGCVAGPTLSISFEEEVGLLSLWLLHSIRCLSVSS
FT                   FTVLLQLVQMLLASGTKTRAWLLEVPSLLRYDGSGMKGHLNDDLSRKGPAQLWDMWERS
FT                   PTCRIARDIVPITPNPSSSPSLQQLFTDPHASVGPNVVLSLNEELSQIATSSMGG"
FT                   /protein_id="XP_845686.1"
FT   gene            complement(<129645..>130397)
FT                   /note="synonym: Tb07.29K4.740; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658271"
FT                   /locus_tag="Tb927.7.630"
FT   mRNA            complement(<129645..>130397)
FT                   /db_xref="GI:72390785"
FT                   /db_xref="GeneID:3658271"
FT                   /locus_tag="Tb927.7.630"
FT                   /transcript_id="XM_840594.1"
FT   CDS_pept        complement(129645..130397)
FT                   /locus_tag="Tb927.7.630"
FT                   /gene_family="HOG000258020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390786"
FT                   /db_xref="GeneID:3658271"
FT                   /translation="MRAGCVACSRIPKLGIAALGSTTTSMQATCQETQELRCATTQMAP
FT                   AVIFPLPPPLRGSYIDRKPTAASFNEHHATASFRHHMIASADVSHRPRHFYFASGTRND
FT                   TGTRSVKEGERKQLKQQTNVEVDSVAYGDQLDELSARWAAKFYGQVTFGPRNYPYPSSR
FT                   WLARRFQMKKHRIIKRFRFRRYKLAAVANLPFAKMIRVGMLPELKSSKTKRGDVVDPTL
FT                   SGQLVSAVKNTGEKRKGQRTRPKSKYQV"
FT                   /protein_id="XP_845687.1"
FT   gene            complement(<132046..>133050)
FT                   /note="synonym: Tb07.29K4.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658278"
FT                   /locus_tag="Tb927.7.640"
FT   mRNA            complement(<132046..>133050)
FT                   /db_xref="GI:72390787"
FT                   /db_xref="GeneID:3658278"
FT                   /locus_tag="Tb927.7.640"
FT                   /transcript_id="XM_840595.1"
FT   CDS_pept        complement(132046..133050)
FT                   /locus_tag="Tb927.7.640"
FT                   /gene_family="HOG000258019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390788"
FT                   /db_xref="GeneID:3658278"
FT                   /translation="MGWWRRGSSSSNGMQRVVETHFWSLTRYRIGRRFLGLDYADNVIF
FT                   FPAYRSKRRGGWAAVTLGVTSSSNYFTNDTSAVNVLEDGYPLHWRANSRLKEFVAEEKK
FT                   LWQARVKEEVAQLAAEKVSASRTGDPNGGAAKEPGDLMGDINCEHRFRDTLAIKCTSPG
FT                   FAQRHLRLSRLWTSLYKFLYFYLWGIGISLVVQAYLLFRSWLNPPARQGLKNIEAHVLH
FT                   IPKLIFGFCVSCVVWAAHHLQPVVSPVLEALEGVFPQVNWSAASPEALATKAQQLAGHD
FT                   VSGGKHGSGQLDQLNVKKTTETMAGNWAVFFSGNFTSIMQGLVFLLAVLLFLL"
FT                   /protein_id="XP_845688.1"
FT   gene            complement(<134015..>136969)
FT                   /note="synonym: Tb07.29K4.720; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658279"
FT                   /locus_tag="Tb927.7.650"
FT   mRNA            complement(<134015..>136969)
FT                   /db_xref="GI:72390789"
FT                   /db_xref="GeneID:3658279"
FT                   /locus_tag="Tb927.7.650"
FT                   /transcript_id="XM_840596.1"
FT   CDS_pept        complement(134015..136969)
FT                   /locus_tag="Tb927.7.650"
FT                   /gene_family="HOG000258018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390790"
FT                   /db_xref="GeneID:3658279"
FT                   /translation="MTERSLLIRCTQAGRYLAVGMDFPSARVFDVATGNLAAVVNVPAQ
FT                   NRFSLAVVSLTSLSLGIVNERVEQQQSTRKRGKEGRKTDCTLYTTFAAVGLSNGTLLLH
FT                   NVGKDELVGHLCVSDTQQAVVATAFTGHFLLCVTADRLLHVVDCIRGERIVTNLRVQHD
FT                   ASAIAAVEDVVTSAGRDDFIPESVFCIFISGPTNALYRLRIGNNATSGDVGGVHSAVTA
FT                   SLDRLITFASHTSRTDIAWMGGTPQQPVVITSNAQEGAVRVWDARPSLDGSTATSRCRR
FT                   SLMCGQRIIGISVREGASSGDDRGLDGMNDLPSAANNGAKGEGDIGRMSDGGALVVVTT
FT                   FTGTVLVWMLGRSLLVAVAEPMPRPPTFQLTSQDESGRLLFASLLPGANAADGSSSSAC
FT                   SSLLLLRGRFAVPQFEVLDLCDAMSKAVKLKGSAAARRRTALVAGGGEVAVYFVPSDTQ
FT                   SKASADLVAYNDLETLDNAWATHDQQQQRRILLAARATRAGTEGFVPAVSYHAKSVSEL
FT                   PQKSLTLEQRLKQLHVSESNESTAGQQQQQHALGLATVPLYQALHANDTSAVMELLTVA
FT                   SRSSGDIRATVMSLQLPYCLQLLQLLGQRVRGASPCSPLFQWIDAIIRYRGVEMYQVQQ
FT                   DLKQKSAVSSSDGATKGIKPDQPSPPKDFVAPLLHQYRNMVSLYDQIAVMYGRLSIFKS
FT                   VFPSERNVSANSHGDIIFPKMFVEKKYSGGLYSTATTERKVDSLSSKRRKSRKDGNKKK
FT                   GARPSSKSKRKAKKGAAASKENEEEDNDMDSDEELDLDALDQMVLSDGDVNEEDDVDDN
FT                   SSGTDDEEEGNSEVSDEEEEGDEDATEDDEEDEGDAIHKKKRARGEQTTAMVAESERGS
FT                   SYGMESRHSGEEDFDSGSDEEVGLAAAPSDGSDDEESADDSESDSTSSGRSGADDIPDG
FT                   NFDDDDDEDDLDEEDDGIGSDVAELLNNGRNGDDESDDEERHELRRYKRAKADG"
FT                   /protein_id="XP_845689.1"
FT   repeat_region   134061..134174
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(134061..134174)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   repeat_region   134428..134572
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(134428..134572)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   gene            complement(<137640..>139040)
FT                   /note="synonym: Tb07.29K4.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658274"
FT                   /locus_tag="Tb927.7.660"
FT   mRNA            complement(<137640..>139040)
FT                   /db_xref="GI:72390791"
FT                   /db_xref="GeneID:3658274"
FT                   /locus_tag="Tb927.7.660"
FT                   /transcript_id="XM_840597.1"
FT   CDS_pept        complement(137640..139040)
FT                   /locus_tag="Tb927.7.660"
FT                   /gene_family="HOG000258017" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390792"
FT                   /db_xref="GeneID:3658274"
FT                   /translation="MPNEKAQTLTVAEAFAETSKALQQFNIERIRVDGLSRGNACDEEK
FT                   FRMLTEQEFMREFVFHSRPCIIVGALCDWPALQRWRDDRYLFDLDEKLPMVYEKERTSK
FT                   GNGEINENDSFHEDEEIVTESDAEDSKNGTSNNEAESQGTLGPRRVTVALTPNGRADAV
FT                   TYVTYNAVKNESQVHDKLEGKSDFVVTEKLFMSAAELRVTLPELYRLLRANPLVPPLKS
FT                   QFVDLRRPQRSIAYAQMQNNCLAEEYQHLHADIDTALDRFGTRVFGGKREAANIWLGTP
FT                   ASVSSMHQDWVENLYAVVRGVKEFILVPPWEGVFVPKPELPAAAFTLKAAANCKEGEEE
FT                   YIFSDSPTRDGTSVPWMDVELTPAAVDDPLHIKEELRDKLHPLIAYVQPGEVLYLPALW
FT                   LHRVAQHADSEDSRVIEEASTEEIAKVSRHDQKHSAPLPLIAAVNYWYDMSFTNPAVVM
FT                   LREFGLLL"
FT                   /protein_id="XP_845690.1"
FT   repeat_region   139224..139273
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(139224..139273)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    139359..139449
FT                   /note="A-rich"
FT   misc_feature    complement(139359..139449)
FT                   /note="T-rich"
FT   repeat_region   139617..139649
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cattt"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(139617..139649)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="aaatg"
FT                   /rpt_type="tandem"
FT   misc_feature    139926..139998
FT                   /note="A-rich"
FT   misc_feature    complement(139926..139998)
FT                   /note="T-rich"
FT   misc_feature    140066..140114
FT                   /note="T-rich"
FT   misc_feature    complement(140066..140114)
FT                   /note="A-rich"
FT   repeat_region   140317..140361
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(140317..140361)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   140362..140390
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(140362..140390)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<140922..>143399)
FT                   /note="synonym: Tb07.29K4.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658275"
FT                   /locus_tag="Tb927.7.670"
FT   mRNA            complement(<140922..>143399)
FT                   /db_xref="GI:72390793"
FT                   /db_xref="GeneID:3658275"
FT                   /locus_tag="Tb927.7.670"
FT                   /transcript_id="XM_840598.1"
FT   CDS_pept        complement(140922..143399)
FT                   /locus_tag="Tb927.7.670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390794"
FT                   /db_xref="GeneID:3658275"
FT                   /translation="MEDFDFLDDAEEILQPLCFCTNQDYSRVGVGHQKGYVIYNVHRGG
FT                   SGAAPSSAKEESWEGRGGSPPSFYTTVEVKFPRRESDCASPYTHFRTPSAASGPDAEMS
FT                   CGVEEKVRASTSVGDRRECDVLLSTFDCNPSTGYGAFLPDFAETTADAYGTSGQPPWKS
FT                   EAAACAVGSDCALTNLQTAGLSWDQTTGDVLKLTTQNVDSSIRHSLVEPLPVEVGVGLM
FT                   ALLYRTQFVALVGGGPYPLGERNEVKIYVAGEIQEERTVPVPDPVVVVHLDHKLIIIFT
FT                   TVELRLHSFETGQCVFSTPAQTDVTVMNRPSLSPFHASGNSSAFNNFATDSLTGNCSMS
FT                   SMKSVNDTVLGATTSSVRPTEGSCDITAPFAIDFHRKFLVFSSSLFGFSLLRYASEDPL
FT                   SAWRGPEMLGTKSPAHANRLVSLAVFVDGGATVDCGGAEYRSVGVGIRCHVASCSSRGT
FT                   LIRVWRYVDDAEGSAEGGNNSGTPLTGHFVMIRELRNVSVPTPIFHMMFLGEVFLFCVA
FT                   HNTLKIFFAGEHEEPKPHDVSTKDPSKAMRVQNVQSSLHSLRSFCKFFSSEWAALECPL
FT                   PLKNEVFLPKWVATMPELWRHLMRVAETSSNRKQTDSQVVGEYGYSSEVTLNSGEASRG
FT                   ESLHQDTGGSKSAVKAPSTSSWFESKGIAGYVWRRVSPLVETVDLTARRCLPTATRDSA
FT                   TSHSQSLAGSVDDVADASCAGKSFRSEKAGESYANRNYATSKELARSFVVWWERPAYRH
FT                   LDVVTQSKSSVGAACLTGETGPSACFGQYGSGSTLLQCVTCDGAAMSIEFNPIDKLLKC
FT                   SDVFPVGFSKGLA"
FT                   /protein_id="XP_845691.1"
FT   misc_feature    143449..143479
FT                   /note="AT_rich"
FT   misc_feature    complement(143449..143479)
FT                   /note="AT_rich"
FT   repeat_region   143892..143920
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(143892..143920)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<144098..>146422)
FT                   /note="synonym: Tb07.29K4.690; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3658282"
FT                   /locus_tag="Tb927.7.680"
FT   mRNA            complement(<144098..>146422)
FT                   /db_xref="GI:72390795"
FT                   /db_xref="GeneID:3658282"
FT                   /locus_tag="Tb927.7.680"
FT                   /transcript_id="XM_840599.1"
FT   CDS_pept        complement(144098..146422)
FT                   /locus_tag="Tb927.7.680"
FT                   /gene_family="HOG000258016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_function: protein binding [goid 0005515];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72390796"
FT                   /db_xref="GeneID:3658282"
FT                   /translation="MRRHVSLVWLNAATGWRLHTATTSEGISEETREQLLEEEEFRAMD
FT                   ASQEDSEMLPIHHRLATKADALEAELKRLSFVLFEKPQLVVDDCPSTWTRRPANVVKII
FT                   RCYGATNACAKGRHQRPVGWVPPVGSSSTIVQTFNRMRHALLNMRKKKLGQPETALNDQ
FT                   LATLSADLDYLNRMKRLHALNFYGRMNLTPRRHIWLALYTLLWNSVIAIQNSLACVFFG
FT                   TLRGIRDHGVVMGAIRGPATGFLRASQFLAYGLVLSPLIHVPSGLINSMYGVWNALSGK
FT                   LFFEAGSGRWHYCSALTALWLHREVSLERRAIRSVGRLEFRRKNMRAENRWKDRLASMG
FT                   FSFDRINEKFGGKHQKAQHTTRGRAENIENPYEVLQVKRNATLEQVKAQYKRLAKVFHP
FT                   DTVQCGSEEERRKAREKFESISQAYQILSNPEKRRSYDLGGAQALRLHESKMGRFMART
FT                   PEEVVQSVFGGEIFKQKVLGQLLRSHWHLRNEAQVSVSLHEFEQLQVLRCFELTLELVR
FT                   IVDVHAMAPAAKGCKHRSGQPQSEVADALIDELSGRKKNQPARERKQTTAQHKNQGDTP
FT                   NNEGTGSPYELTCFTNEFNCFSRDFEDRCDRYTRHLAEACFGRELMYEVGQSYVISSQR
FT                   FLGILPFYAPKLHVYKKIFSGVDRVYAAFREKVDDRAKDNPEWLARKVMTEYFSMEFDS
FT                   VVADASCVLRFAAQNVLQDVAITEEQRRRRCYALWYLGDQMMRKGVPWSRTEVKRDDGE
FT                   LMAYIQQAANSAASTSKPGSF"
FT                   /protein_id="XP_845692.1"
FT   misc_feature    146477..146509
FT                   /note="AT_rich"
FT   misc_feature    complement(146477..146509)
FT                   /note="AT_rich"
FT   repeat_region   147350..147404
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(147350..147404)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   147635..147666
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gagaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(147635..147666)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttctc"
FT                   /rpt_type="tandem"
FT   repeat_region   147938..147975
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(147938..147975)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   148102..148160
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(148102..148160)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   148250..148272
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(148250..148272)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    148414..148448
FT                   /note="AT_rich"
FT   misc_feature    complement(148414..148448)
FT                   /note="AT_rich"
FT   misc_feature    148639..148660
FT                   /note="AT_rich"
FT   misc_feature    complement(148639..148660)
FT                   /note="AT_rich"
FT   misc_feature    148693..148716
FT                   /note="AT_rich"
FT   misc_feature    complement(148693..148716)
FT                   /note="AT_rich"
FT   misc_feature    148881..148942
FT                   /note="A-rich"
FT   misc_feature    complement(148881..148942)
FT                   /note="T-rich"
FT   misc_feature    149347..149376
FT                   /note="AT_rich"
FT   misc_feature    complement(149347..149376)
FT                   /note="AT_rich"
FT   repeat_region   149486..149506
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(149486..149506)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   149531..149553
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(149531..149553)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<149658..>151124)
FT                   /note="synonym: Tb07.29K4.660; zinc finger protein,
FT                   putative"
FT                   /db_xref="GeneID:3658283"
FT                   /locus_tag="Tb927.7.690"
FT   mRNA            complement(<149658..>151124)
FT                   /db_xref="GI:72390797"
FT                   /db_xref="GeneID:3658283"
FT                   /locus_tag="Tb927.7.690"
FT                   /transcript_id="XM_840600.1"
FT   CDS_pept        complement(149658..151124)
FT                   /locus_tag="Tb927.7.690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc finger protein, putative"
FT                   /note="similar in zinc finger region to FYVE
FT                   finger-containing phosphoinositide kinase (EC 2.7.1.68)
FT                   (1-phosphatidylinositol-4-phosphate 5-kinase) (PIP5K)
FT                   (PtdIns(4)P-5-kinase) (p235). (Swiss-Prot:Q9Z1T6) [Mus
FT                   musculus;]; contains Pfam PF01363:  FYVE zinc finger;
FT                   go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:72390798"
FT                   /db_xref="GeneID:3658283"
FT                   /translation="MQKKNCRWKPDETSSECQQCAQAFDFFSRRHHCRCCGGLFCGCCS
FT                   GSFIPRELLHKVCQVKEIKPHHPHVDNNPEEKETQSGGNPSLFAGLINTFMGRLSALQR
FT                   VCLKCHWKARRLLEAFTEPSSSAADPTTTHPSYPIKCTLPGSGRERKIYVISLRGKSLF
FT                   DKRDYVGLSAVFEELERLIGEGTGVPNATDECHDGRSHSATLNPSPSNDSISTLYSSDQ
FT                   STFEATLCFDEAGAHRWKRRRGIMNLEESPRKSYHRVTLQVPVLIPECKGGDTLAGTVS
FT                   NVRVRTRLVGLTQQQSFNREVLQQETIGTDAYVILPDEELGPVPRYSGITPESSFVLDA
FT                   FGTPATGNGSVVSEPSYFAANSTLNPSGVVSRLNRGIDWLAHGTSMDGIRYVWETIEQF
FT                   GGATPICAVIDYTPCDKETSTPGSPVTADTSKCRSDGAYTFGSGPIYVHCHKSEEQRYP
FT                   SVREQASALHRALLLVVGKVIVRDWLQQNV"
FT                   /protein_id="XP_845693.1"
FT   misc_feature    151308..151350
FT                   /note="AT_rich"
FT   misc_feature    complement(151308..151350)
FT                   /note="AT_rich"
FT   misc_feature    152005..152042
FT                   /note="AT_rich"
FT   misc_feature    complement(152005..152042)
FT                   /note="AT_rich"
FT   gene            complement(<152958..>154958)
FT                   /note="synonym: Tb07.29K4.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658281"
FT                   /locus_tag="Tb927.7.700"
FT   mRNA            complement(<152958..>154958)
FT                   /db_xref="GI:72390799"
FT                   /db_xref="GeneID:3658281"
FT                   /locus_tag="Tb927.7.700"
FT                   /transcript_id="XM_840601.1"
FT   CDS_pept        complement(152958..154958)
FT                   /locus_tag="Tb927.7.700"
FT                   /gene_family="HOG000258014" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390800"
FT                   /db_xref="GeneID:3658281"
FT                   /translation="MQVSLHNKVKTYNLTAGKSLPEWIAERRKNKRLAGGEHRVELIHD
FT                   LEFPHFARTIFRTANGTHLFAAGDYPPRLKCFDVNQLSMKYSFNADMPILGGVSLSPDF
FT                   RKFALRGEGRQITIHHSAAIVDRVRVPHTMRCLAFNPHTAELLSSGTSHEIFRLSLETG
FT                   SFVESYKTQCADGVNHVEVFKNHGLVLCAGVDGVVEAWDSRAASCAARLTVAGTGAVSG
FT                   VEERCELRHIAVDDERGLLFSCGTEAGQVLLYDLRLQKPLIVKDHMNSLPIVKTYFFQG
FT                   SSTATGEATHVLSADTRMVKVWSKKDGSNFTSIEAPADITDFCVLRSQHNIVEPFECSD
FT                   SGVICICCDAPRVQVHFIPQLGVAPRWASFLEILTEELEEKEITTVYDDYTFVSKEEME
FT                   NLGMTADDLAGGKVRPVMHGAFIENALYRELKAVVDPGAFSRYVQENSRRKTEKRWEDR
FT                   ISKFKRNANAAETGDNELVGDADSANGGPMTDGKTTLKNQALAAAQADPRFQKAFNGSR
FT                   GTPFALDPSNPEYAKLLQQIKERRAKASERKQRYESELFSIVPEDVGENESGSSDGGGN
FT                   NDSGEDNEDDVNEAKKHLKGVRSSGKQQRRRRQRPEGEKEGASRRVTLYEAKKDSRTNF
FT                   TSTDKVIHAARKRQRLERLPLEERLRRVSSK"
FT                   /protein_id="XP_845694.1"
FT   repeat_region   155256..155279
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(155256..155279)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   155441..155481
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(155441..155481)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   155494..155521
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(155494..155521)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   gene            complement(<156246..>158165)
FT                   /note="synonym: Tb07.29K4.620; heat shock 70 kDa protein,
FT                   putative"
FT                   /db_xref="GeneID:3658280"
FT                   /locus_tag="Tb927.7.710"
FT   mRNA            complement(<156246..>158165)
FT                   /db_xref="GI:72390801"
FT                   /db_xref="GeneID:3658280"
FT                   /locus_tag="Tb927.7.710"
FT                   /transcript_id="XM_840602.1"
FT   CDS_pept        complement(156246..158165)
FT                   /locus_tag="Tb927.7.710"
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock 70 kDa protein, putative"
FT                   /note="similar to SP:O59855: Probable heat shock protein
FT                   C1739.13. [Fission yeast] {Schizosaccharomyces pombe}; 82%
FT                   similar to SP:O59855: Probable heat shock protein C1739.13.
FT                   [Fission yeast] {Schizosaccharomyces pombe}; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72390802"
FT                   /db_xref="GeneID:3658280"
FT                   /translation="MPAPAIGIDLGTTYSCVGVFKNDQVEIVANDQGNRTTPSYVSFSE
FT                   TERLVGDAAKNQVAMNPTNTVFDAKRIIGRKYDDPDLQADMKHWPFKVTVKEGKPVVEV
FT                   EYQGERRTFFPEEISAMVLQKMKEIAESYLGEKVSKAVVTVPAYFNDSQRQATKDAGSI
FT                   AGLEVLRIVNEPTAAAIAYGMDRSSEGAMKTVLIFDLGGGTFDVTLLNIDGGLFEVRAT
FT                   AGDTHLGGEDFDSRLVDYFATEFRTRTGKDLRGNARAMRRLRTACERVKRTLSSSASTN
FT                   IEIDALYEGFDFFSKITRARFEEMCRDQFERCLEPVRKVLKDAEVDASAVDDVVLVGGS
FT                   TRIPRVQQLVQNFFNGKEPNRSINPDEAVAYGAAVQAHIVSGGKSKQTKDLLLVDVTPL
FT                   SLGVETAGGVMSVLIPRNTSVPAQKSQTFSTNADNQRSVEIKVYEGERPLVSQCQCLGT
FT                   FTLTDIPPAPRGKPRITVSFDVNVDGILVVTAVEETAGKTQAITISNDKGRLSREQIDK
FT                   MVAEAEKFAEEDRANAEKIEARNSVENYTFSLRSTLSDPDVQQNISQEDQQKIQTVVNA
FT                   VVNWLDENRDATKEEYDAKNKEIEQVAHPILSAYYVKRAMEQAPPAPPSGEGEGNAPVP
FT                   DDVD"
FT                   /protein_id="XP_845695.1"
FT   gene            complement(<158785..>164163)
FT                   /note="synonym: Tb07.29K4.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658286"
FT                   /locus_tag="Tb927.7.720"
FT   mRNA            complement(<158785..>164163)
FT                   /db_xref="GI:72390803"
FT                   /db_xref="GeneID:3658286"
FT                   /locus_tag="Tb927.7.720"
FT                   /transcript_id="XM_840603.1"
FT   CDS_pept        complement(158785..164163)
FT                   /locus_tag="Tb927.7.720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390804"
FT                   /db_xref="GeneID:3658286"
FT                   /translation="MGEPHRFSNPSFLIFFSQSRACACSGPKDTCQKIKQNQKEDRGEH
FT                   KAEKGHRQFYMALSGHYVCFSGFSDEVDEDDAVSTVTAAPANGEMSGAVSLRQVTNLAS
FT                   SLGAKTQTRITKRTTILVAGRGLTRKRLVAEQQSIPVVSLRWLESHGRLPISDCRVPLL
FT                   HGYVFCATQLTVDEERALTSIIESNGGTFSRTLSACISMLFVSPDWLKQFQQLQQKHGR
FT                   PSTAMRDGAAAGPILPEKIRFAWATNIPVVEHTRFLSLAALQSTCLGGNSNGCDAGLSR
FT                   TDFETIAELCALPSSVVGGVVPHTQVAGSVGNAATSVAGHVVVDIDNKPYRKRARDECN
FT                   SALSSDDSQRAIRIVSPERQATGSHHLSTSQKLFGTWNTSHTGSECCATGFPMGDENAV
FT                   LDAPPPLHLSTSGATLNPFSSVADPHPIPTNSGMTGEVRLQNCMTSSTSLEASRSNGDK
FT                   DIFDFCETFFTHSRPFLQISLLGCTPPQLVDCARMAVRCRFLRTPVVTPFTDVVVVGSE
FT                   LVDEDIKEATRMAAVASEDQKQKAMLLAQLRDHLSVTYGIPVERIVTVGWLRECCQVAA
FT                   QMSASSGHEAEDLIFEPVPLPLEKLPTTGMFSLQPLTNMAAFMDFDRQQQQLQQGKVNR
FT                   AVLRPRPRNNPTNNQATTAESGGRQHDKAVTTSSKSVDDARKRYEADASLAVQKFNELY
FT                   VLLKGSSDDEECRPVFTKSFFCFVENDFSRVDLNIVRALIKYGKGEWTKRSLNEWVKVL
FT                   SRTGAGAGEGEKECTGVKENEPREDNITSMIHYFTSAYRKLIRAHDAGSFSHRKVSRAA
FT                   GETTTLARSDKPGNVDTPSNGTRPAGPFHHVFYVVPHGNQKPSDVLLLGRNQRQADTAP
FT                   ARHPFRFLPSVTQDYILCSLAARHLLQPKSCFLFYRSTPTEAERLARQQLLRRGDVTTK
FT                   GGMPLAPSPWLGRRRNEKAPLIGVTVYFLCLMPSKSGQQGCVIDDQGFETLTALRRVLL
FT                   NCLGAAVSELCGHRAEKLVLEAVTHVVLVDVATIFLSKIPQVVDEVAVGGSSAVSDIRC
FT                   CFRTGDVDERKSMDALLSRGSTWPCEVHQELLPQRLVQYAASDRVSLVGLEWLEASVAW
FT                   GTFLDEKPFALPTTLTRQQPHKENRAVEGETVIGGPLVYSAVTPPATPVRETDVTLLPF
FT                   SSATCHSPVFQSPQLAVNYQFDFTTPGATPARATLRTPGQQRASTPRFASPSAHVKAAL
FT                   VGDEETFPPIGFLCGLSRGKSNTPARLEENMADNSPSSANACTPVRRTLLLGDVSDDEE
FT                   NELKAADSHLLRAGDENRHNKPCDGGSVVDHGPLTSVGRKYSREVQEMPQLWDPEGSRS
FT                   SDAVIDKRLALPSAAAGVVSKQRSKIIFDAPRIYIPHDVPGKDCFVAFCDELNSRAPRR
FT                   NCDGDQDEAADIMGPACPQQQHLHCASETAKVISRVQLVHGTREADILVTHQLTQRESV
FT                   LAAIAAGLWVVTPKILEDCENRQCFGPLHDLSMHEWTPELLPPDAPRCTRQLAMQCRNR
FT                   RLQRQATGKLLFENKYFILVIVAADASPAVTARAHSMRNVLETGGGVVEWAMCWKIGNE
FT                   GTAALQLGESGSEGKKLHGPNEVTGLKKCHIPPRKSPNTLLDFVLVQIKGTEEAVVGGV
FT                   GCGNVFPTKEIILLIDEPHQEDALVGEIRGGIVKVFQNAKEQLVRAKQEAQGKMRGELQ
FT                   QVAQKSESRSTAVGVDPFQQSIKCDGQSTRVAGGKDAWKIAGGCGSSGDSDSNMSGSVI
FT                   RGMPHVGVLSVFKSDWVTLSIQQRRKAPLCTVNISL"
FT                   /protein_id="XP_845696.1"
FT   gene            complement(<164530..>166356)
FT                   /note="synonym: Tb07.29K4.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658276"
FT                   /locus_tag="Tb927.7.730"
FT   mRNA            complement(<164530..>166356)
FT                   /db_xref="GI:72390805"
FT                   /db_xref="GeneID:3658276"
FT                   /locus_tag="Tb927.7.730"
FT                   /transcript_id="XM_840604.1"
FT   CDS_pept        complement(164530..166356)
FT                   /locus_tag="Tb927.7.730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390806"
FT                   /db_xref="GeneID:3658276"
FT                   /translation="MTENSLSTTITTDVIKRICVKTGFYRNPVCNEKLYLHNKGFDSIE
FT                   EGAFDPYTDVKVLWLEGNAFTVIHCGKDSQPCNVQAEGQGAGTEEEVNAYTEASATDTT
FT                   QVMSKSAHLDCCADWLERSQVDSSGAAGCVRSAEYGINSKTDGAAALAFKSTATKSSCN
FT                   AGRATKDVFQSLYPTLRQLYLHNNALRRMPDLSSFQFLDSVNLSSNCIRSVEVSCAPFD
FT                   KKAAQYEEELTTKANAIVANSKSMQRELNSSPTGGKLLQQQSDEITEDATGSPEVTQEE
FT                   GIHINEKVSGDGCDVGNAVNDPGRDGNLEAWCKRLDAYASFCPHKPLDPLEDGKPLSEV
FT                   PDEYRTPCSSLRTLNLACNYLTAANDIIQLLCYKNLSVLDLSNNQLADGEAVLLVLERM
FT                   YRLRALKLSGNPLVRTIPRYRKTVLARCSKLFHLDDRPVFDGERRLVTAWARGGDEAEK
FT                   KELLLMKQEERDQHMRRLREFRETLGLAAHGGLGASETVRLSASGAHVERYNDQGRDNR
FT                   IFIDNDNVGNINDDAELTSSETGEEDSNEAVANGTNNNRRASGNDAPRAFTSNTSHEGI
FT                   SDPEMWRDVSVTNFTGSDDEDDDGDIFIPPRN"
FT                   /protein_id="XP_845697.1"
FT   gene            complement(<167245..>168888)
FT                   /note="synonym: Tb07.29K4.580; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3658284"
FT                   /locus_tag="Tb927.7.740"
FT   mRNA            complement(<167245..>168888)
FT                   /db_xref="GI:72390807"
FT                   /db_xref="GeneID:3658284"
FT                   /locus_tag="Tb927.7.740"
FT                   /transcript_id="XM_840605.1"
FT   CDS_pept        complement(167245..168888)
FT                   /locus_tag="Tb927.7.740"
FT                   /gene_family="HOG000258012" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72390808"
FT                   /db_xref="GeneID:3658284"
FT                   /translation="MSSGLTARRLILQQLTAVTQHIPLQARRTSGKGWWLSSFVRPEGD
FT                   RRVFTLITEEEVAFLKRRCEEEGDEGRVILSTRPTRNIVRAVGGAALNITLSFLVSPLL
FT                   ALSVSLEAIRLRGLRPAALVIAPGVGLFWGAVFMAIAWYAAVQQMLLCGVHTLRAPIFY
FT                   LFCPGCCWNELSCRYEYPSGVVGNSHPLLSLQAPPEKLFERAMKRETRRKRRGKRDVGY
FT                   ERKGGTHPSEGDDYYAILGVTRDATPQQIKEAYNRLALEIHPDRNPSQSAASQFDVLTK
FT                   AYRVLGNAEKRRKYDMGGRSGVEDIGKKKRGAVRALFGGDALYAIVGDVKTGSFSQRVI
FT                   DGLDWTQEELAIFRQRTLERCRDELLSVYLQPLRSEKDSKGAPALQELKGRLQRLLNTG
FT                   LAREVLHAVGHEYMRVVLYGKASGPRERMTLYLNEAGPHRMRRRLDKWRHLCRIRQHTL
FT                   RDSATMVDLAWYTSVEELESTARWVATSLLLDHQVPEEERRQRLEALQALAEIFITYGQ
FT                   SYKGANKQTMDALMNSLRDYYQQQKRGEGG"
FT                   /protein_id="XP_845698.1"
FT   gene            complement(<169510..>172056)
FT                   /note="synonym: Tb07.29K4.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658277"
FT                   /locus_tag="Tb927.7.750"
FT   mRNA            complement(<169510..>172056)
FT                   /db_xref="GI:72390809"
FT                   /db_xref="GeneID:3658277"
FT                   /locus_tag="Tb927.7.750"
FT                   /transcript_id="XM_840606.1"
FT   CDS_pept        complement(169510..172056)
FT                   /locus_tag="Tb927.7.750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390810"
FT                   /db_xref="GeneID:3658277"
FT                   /translation="MFEGAGEGLNVRLATSIKLFLEPDADPSRNDAADTRGSASYASEE
FT                   LLSVADTLRKYANTDECASSPTAVASEEKRSPTAALAAPLRGDRNLRIPTRASEARPRS
FT                   ASNKMGKKTDRGRSAARPKAAQERKRLHQGRQGSKATRKQESAKEKQNEVVVSRAASRR
FT                   ARKHQARATAVSTLRDYTTATPANRKSFIESITVNENECWGAPPLEGSPEAKKQAHTST
FT                   MSPLPRRVARELYLKDAPTLDETSSQAPSQHHGFYSSPDLTFPRWDGFPNNSSKPVNDV
FT                   TTGLSNEAGDALFHHFWGTSGEPPANVVFPGGSIHPSKITRLKEKSRHNDVWHVEDGTP
FT                   AEKANLSSWKQPLQEFGDTEEKPGERGELAVTLANNRMTYTETFDDYQNVFYRLWSCSS
FT                   SRGHIGFLKNLSDKAGATGAVGEQPNSLVACSAILRDPQGLLVSRNLNSMLFAVGSQRG
FT                   PEGSLKKWWLASGGDSAATLDKQTILDQGSCVELSYAARILYVALLYIRTLGGFPTLQR
FT                   ITPLSDSSTVVEKENCLELVFATTRFSPGGKRGKGMQEVNFREERSVIVRSVLAEKSCV
FT                   ERFGKREVVHVLPLLNESVGDAPERVSMQTITSAAADKSFVGFHPRSDKQPTRGPEPSY
FT                   TAAASSPTLNGSALNSLKEKAVDYGDIAVAFLMSVEASKLSGVLPEPMEIEGLRYRVFI
FT                   LDSCKNYRKPQVNVFKNEVGSDTERWINNRMGAFEIELLRKREEARAAQAAHLAQVSLQ
FT                   EMLLKINGPLGRFPWYRPMTIAESTLAKADKESSGTYCTHSDDVQTALPRFYQLRLPRL
FT                   HQDLAYVMCNLLGISLTMVPCPASGGQSQPSSFYSE"
FT                   /protein_id="XP_845699.1"
FT   gene            complement(<172772..>174481)
FT                   /note="synonym: Tb07.29K4.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658285"
FT                   /locus_tag="Tb927.7.760"
FT   mRNA            complement(<172772..>174481)
FT                   /db_xref="GI:72390811"
FT                   /db_xref="GeneID:3658285"
FT                   /locus_tag="Tb927.7.760"
FT                   /transcript_id="XM_840607.1"
FT   CDS_pept        complement(172772..174481)
FT                   /locus_tag="Tb927.7.760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390812"
FT                   /db_xref="GeneID:3658285"
FT                   /translation="MPPKKSELEAREEEEEEEEEEEEEEEEEEEEWEESNDLSQLEDGP
FT                   STFYVGGFSSMQKLQEALDAVTYREDLVIVYPGAYLEKEVVIEESRLDGLRIMSVPVAL
FT                   GRKAGYRKKIHIPRDERRLGPWYAPYGGEAPATATVTPTAPDPQLFPVIEGRLIVRHSR
FT                   PFVSVDEDAEIPEGLQGIKHYDDEQDRVADGDEEEENADDAPEGSTEEAEMVHKAKDNH
FT                   LEMQGLCFFGGIELNPLTRSTFRHCVFGDYALQRKDPLATTEAVETTTCQPSTEPPVLP
FT                   TVVAHPLSEALIEFCIIYGSAKQALYAYPRCSLQIHTSMILGPVEGTPTTYTADQFRAA
FT                   RHAQQSPLFRLKNRWKKVVSQPKIPTKAMCNVALYLDDADVSVRDCFIAHTDIGVMLVD
FT                   GCAGTELKFLRLESHSTVGILFTGECGAAKVKCCAIRWCGRECILVKGRVPPIPPDAEA
FT                   VERVACERAQREAEENENEEVEEEGEEEEDADVPRPPPIPAQHPSLQKNALEGTVRLEG
FT                   DVSCGTMCDNVIYMEKDDTQPPLSGPSEERRFLLKGFHVHVRGSTPLESEDN"
FT                   /protein_id="XP_845700.1"
FT   misc_feature    173019..173074
FT                   /note="CT-rich"
FT   misc_feature    complement(173019..173074)
FT                   /note="GA-rich"
FT                   /locus_tag="Tb927.7.760"
FT   repeat_region   174390..174448
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(174390..174448)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<175574..>176608)
FT                   /note="synonym: Tb07.29K4.520; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658294"
FT                   /locus_tag="Tb927.7.770"
FT   mRNA            complement(<175574..>176608)
FT                   /db_xref="GI:72390813"
FT                   /db_xref="GeneID:3658294"
FT                   /locus_tag="Tb927.7.770"
FT                   /transcript_id="XM_840608.1"
FT   CDS_pept        complement(175574..176608)
FT                   /locus_tag="Tb927.7.770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:72390814"
FT                   /db_xref="GeneID:3658294"
FT                   /translation="MLMPQFEFLRGAECPICIESLLSNAPAATPSSTDVGASGDLNQVG
FT                   DEVNFPMRVWPNGAFGWVGNMPDAFVAAVSLYRLGAGRARLAASSSETSGALEGIAVLP
FT                   CGHLLHFTCAMQLYEYKTGAQCPICRHPLKRKSDILCFHPQCRRRAGQQQGEVVVDMNN
FT                   AGSSETDVAHDVDDEVCITGQRQCPPTEAYVDRLKREVKDLMKRCRNLNSRELNLANSQ
FT                   QQLEDQCIKLQDSLGRAQNRYNALTQNGTVGVERLQKLRTVALETYNSVESLTRELADA
FT                   TREKARQHGRIAHYAQKLDHCRKRCGAGDTDCRAPFETGKPGKPDDFTKVHEEALHPKK
FT                   KPRL"
FT                   /protein_id="XP_845701.1"
FT   gene            complement(<177066..>178982)
FT                   /note="synonym: Tb07.29K4.510; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658287"
FT                   /locus_tag="Tb927.7.780"
FT   mRNA            complement(<177066..>178982)
FT                   /db_xref="GI:72390815"
FT                   /db_xref="GeneID:3658287"
FT                   /locus_tag="Tb927.7.780"
FT                   /transcript_id="XM_840609.1"
FT   CDS_pept        complement(177066..178982)
FT                   /locus_tag="Tb927.7.780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to tRNA pseudouridine synthase C (EC
FT                   4.2.1.70) (Pseudouridylate synthase)(Uracil hydrolyase).
FT                   (Swiss-Prot:Q87MD4) {Vibrio parahaemolyticus}"
FT                   /db_xref="GI:72390816"
FT                   /db_xref="GeneID:3658287"
FT                   /translation="MCYSTKGSMEATRLQLLEEASWNDESKRKLYSTPLFPGFPWYTAT
FT                   SPPKEREQPTRRFVVPYFFTFRVFVKGRWVGRELVDVYSEEHVHHSRSYYEACVEKGRL
FT                   QKISRSRCNVRRNHMKRSHTAGEPSGADASAGDSSNANGPLQHGDVVLHSVHRHEIPVR
FT                   MGATGVEPIVLAAVRICEYGILVVHKPAGLPTHASGRYFMNSCTAMLEYVLAPRRLHAW
FT                   LVEKDPLLQSLVSTIHLTGRERDELLAYYLTDSMEEDTVPIERLPRPCHRLDKVTSGVL
FT                   LLGISKVAARRVGEALMSKTRQMEEILPRRSRFESDEGTITFDKLHMSGATVRKRYLAR
FT                   VRGCFPENSMKIRFENCPGDKNKEGVLADSNEKDTTCPINGGLLIVTKNSHEGRRDATD
FT                   GMNVKTFVNSVGVPVLFTSPLRQYRFSENETIYEDLNESYGTPIKEMFCQDAMTLCQPL
FT                   RHYQSDHSHHKDAGTNTESLVHCVPFSGRMHQIRIHLSDWGHPIVGDVTYNTNERGHDR
FT                   QTFYFCVDELPKSFRDRFYASDELCWECGGKLPVASFDGSNGSRVALHAWRYEMEHKSL
FT                   LACSDVVDSESITEGQILGYGEGPPPSLECCYEDAVRMDVGFVQRQGPVVIFLAPPPPW
FT                   VVE"
FT                   /protein_id="XP_845702.1"
FT   gene            complement(<179121..>180824)
FT                   /note="synonym: Tb07.29K4.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658291"
FT                   /locus_tag="Tb927.7.790"
FT   mRNA            complement(<179121..>180824)
FT                   /db_xref="GI:72390817"
FT                   /db_xref="GeneID:3658291"
FT                   /locus_tag="Tb927.7.790"
FT                   /transcript_id="XM_840610.1"
FT   CDS_pept        complement(179121..180824)
FT                   /locus_tag="Tb927.7.790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390818"
FT                   /db_xref="GeneID:3658291"
FT                   /translation="MHPMNVQEMDLCVDNIIICPFCSLLGTTFHTRMLVSLAPVVGACA
FT                   RHGMMKCQWYIRPIFRRVGRLQPPSLRVVSFSRRCSSIPRSGGVLPLGLEESSDSAPVW
FT                   ERIVVSIQDMLQNVDDTEALRRFCLLWRSHFPRTETTSLLSTLEKELLANHSDPQGTGE
FT                   RVPRDLYCLPVFVQALCSALRLCTLRAGPPSLQMPENVVSVNAAVHGLDEGLLSTVVDE
FT                   IRVVIFYLARERLTHVWHAIHDHLPDEKLATECENGVNTTNDVVPTQAPSPIPSRDGER
FT                   LSHMGVKLSAELLQHAIMLADTGGALLSVDPPVVLLPVVYQLLLPALGACEQLDSKRLG
FT                   RLATAFAQCTDFDDPHVGQASISSADISVNDSDDRDENKSATTSAPATSEALKPVMTSY
FT                   TVLSQMNALARATEVRMREVTTRLRPTPSQTNIEAVKLRLLSLKERKVAERKAAKHEGS
FT                   VVNAEELLEDVAVLCCALASRRYMDDAFWSRVTEFTCLTIEITSTAEVPRDVRHILFSL
FT                   YYVKQLTMYDRLMSVLVRRGMLREPVPPPSEVHEVMKKVRGKTAADFQQE"
FT                   /protein_id="XP_845703.1"
FT   gene            complement(<181532..>183163)
FT                   /note="synonym: Tb07.29K4.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658293"
FT                   /locus_tag="Tb927.7.800"
FT   mRNA            complement(<181532..>183163)
FT                   /db_xref="GI:72390819"
FT                   /db_xref="GeneID:3658293"
FT                   /locus_tag="Tb927.7.800"
FT                   /transcript_id="XM_840611.1"
FT   CDS_pept        complement(181532..183163)
FT                   /locus_tag="Tb927.7.800"
FT                   /gene_family="HOG000258006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390820"
FT                   /db_xref="GeneID:3658293"
FT                   /translation="MRRRVVLCCQDVGSLLSSKHSVHSGIGYHERVFSRNLLYRRYPVV
FT                   TVLPKAGFTVLDTKRWIASSGPPVTGSPLSPVTNPSLNVGTGGGEAVAMEGPLPVSYSP
FT                   GSGVNGSLPVTSTAITAHCDVLSECVAKADELAVQLKAQNALSASAEILTQEGMEEFVE
FT                   ELKTSATNEMTALVKQMQTTPLLQRAGMHELRRTLYYTTSLKERDWLEEKQYTAAMRML
FT                   TVEVLRRDGDGVLSADDVLYVTTHVVTANFYNRHLWNRMEKSLLKFSNYENIDMSSVKA
FT                   FSTRLFKTRRGCAKETLDIRRKVLLAMSRRVGVLANDFDLPSLLGVLQCYTVHDLTPFH
FT                   LEPLAIRATNHVGDFTPHECATLAHVLRKWRTMRLEVCERLVERICTSDQLTHHMANAA
FT                   MIAIRTCFNQVSDGGRNAMNAEPTRQKLRAMGEQIGCRLDEVEYPALPVILSILDVVVT
FT                   LKIYVPKKCLQVIFSQANDMVAIVMEQKDDLVDPKTGKRVRPITAEEGRQLQALLSHYG
FT                   NDLAPELSQRMKEAFREGVLPDEASL"
FT                   /protein_id="XP_845704.1"
FT   gene            complement(<184357..>188907)
FT                   /note="synonym: Tb07.29K4.460; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658292"
FT                   /locus_tag="Tb927.7.810"
FT   mRNA            complement(<184357..>188907)
FT                   /db_xref="GI:72390821"
FT                   /db_xref="GeneID:3658292"
FT                   /locus_tag="Tb927.7.810"
FT                   /transcript_id="XM_840612.1"
FT   CDS_pept        complement(184357..188907)
FT                   /locus_tag="Tb927.7.810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390822"
FT                   /db_xref="GeneID:3658292"
FT                   /translation="MRVIAVGRDAKGHLSDSDFIFRSRQWVSCATPAGAAGRGRAPRRS
FT                   SVVSHKTSRPSSRAQSATPLTRGLDYTPLQRRTRVRSVRPDSEGRGGKSVRGESKPPHS
FT                   FHGCERPTSSTGDEARKRVHAALDIAWQKFGEARVFIQHNCFQQALLRLESAKYLIDTT
FT                   EAVGDCCSVLRRRLAMEQLGKELSAISHSCIIRGYHSRKQDPTVTRPPSSIIDGSFTEG
FT                   CKDGDRHGSRAADCSDADGGGKPCAHGGGNAGSTGVVGNDFPCMKQKQQLFFTKLNNYM
FT                   GNSVRDSRDFDSVRRASYGSGIPVAAHAGSGVVHGSCIQSVPCGSRSPNSLSCGSFGVS
FT                   SHSQPAAQHLFTAAPASPMRVPRSCSGFDGSRCSSCNLSRPGIDHWRPMSGGQSREQEE
FT                   IEGQRQNGYSFCTPHCSRPGTRVDKLSLNPTGETHMRADNGSSTSPVYGEGHQRTDISG
FT                   GYLPSSTYWRALSGNQGNSQSRDGMCTPNASTRRSSGMPNSASTTHWSYSQNWPINASP
FT                   QSPVNGRRMSVSPQRNRRTRVSPGTNVGMPQRMQQDDSIFDLGEPKLVKLYSFERRSPS
FT                   RRVQTPKRFHRFYASGTGDAPMSAYSSMRFNSSSRSRSGATSCDQSRNKLSPSLQQHVG
FT                   GLSFNSNRNKFGVTAADSFAALGVSYPGLSGSTSSRGTGARDITTLRNRRTRGNFSHNR
FT                   PEIEGRGTRDASLFDGRVPGCPLPDGAQMTESVFHRYFDGIRSYQQARMLHKRVVEQLL
FT                   LEHEVEEIERENCGEGGEYDVNRKEVLLHHLEDAYNRWLVSHLGAKQKLLNREEMQGGE
FT                   LGVTLRHVTDEGVEERRIVRPSSCDSAKSVQSTKVLGNQKPHMTGEENLRRYQDFRSAS
FT                   QATVRTDEADTASVKHQLSSDSPAGLPRHTTMGMIVQKSSGAPQNELLGTGHKHESAVE
FT                   GCVTVAPNDKLNRVTDISHGAHLKTCKEKASTVRDTVLKAKETNGMGAAGLSVDRRSGG
FT                   GSNEEAHTGGNVSAGEVSNVASLTKIGKGALSNASDEQEPTTKGVVNPVEGTVIEGSAR
FT                   RADEQQRDLLENTTKSLEPKSEAASEVSDGTQSAASVGQGPTPSDATTKSRATKPYTTS
FT                   DVSDDAKSVTSVEQEPATADTATDIKDTKSDATSDVSDDAKSVTSVEQEPATADTATDI
FT                   KDTKSDATSDVSDDAKSVTSVEQEPATADTATDIKDTKSDATSDVSDDAKSVTSVEQEP
FT                   ATADTATDIKDTKSDATSDVSDDAKSVTSVEQEPATADTATDIKDTKSDATSDVSDDAK
FT                   SVTSVEQEPATADTATDIKDTKSDATSDVSDDAKSVTSVEQEPATADTATDIKDTKSDA
FT                   TSDVSDDAKSVTSVEQEPATADTATDIKDTKSDATSDVSDDAKSVTSVEQEPATADTAT
FT                   DIKDTKSDATSDVSDDAKSVTSVEQEPATADTATDIKDTKSDATSDVSDDAKSVTSVEQ
FT                   EPATADTATDIKDTKSDATSDVSDDTRSETSSGRDSHTNDRTAKSHETESCSSSW"
FT                   /protein_id="XP_845705.1"
FT   misc_feature    188936..188964
FT                   /note="AT_rich"
FT   misc_feature    complement(188936..188964)
FT                   /note="AT_rich"
FT   gene            complement(<189570..>190490)
FT                   /note="synonym: Tb07.29K4.440; dynein arm light chain,
FT                   axonemal, putative"
FT                   /db_xref="GeneID:3658295"
FT                   /locus_tag="Tb927.7.820"
FT   mRNA            complement(<189570..>190490)
FT                   /db_xref="GI:72390823"
FT                   /db_xref="GeneID:3658295"
FT                   /locus_tag="Tb927.7.820"
FT                   /transcript_id="XM_840613.1"
FT   CDS_pept        complement(189570..190490)
FT                   /locus_tag="Tb927.7.820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein arm light chain, axonemal, putative"
FT                   /note="similar to 33 kDa inner dynein arm light chain,
FT                   axonemal (p33). (Swiss-Prot:Q26630) [Strongylocentrotus
FT                   purpuratus;]; go_component: axonemal dynein complex [goid
FT                   0005858]; go_function: microtubule motor activity [goid
FT                   0003777]; go_process: cell motility [goid 0006928]"
FT                   /db_xref="GI:72390824"
FT                   /db_xref="GeneID:3658295"
FT                   /translation="MATLNAPPNVYDEEGTVLYRAVPSNLISDDEPITAAAVNAATAAA
FT                   AGQEAPTIPTTNRQKFGQTQSGVAGTRDAIQSDGGPVRLTQESLTPVKALAKLFPPVPL
FT                   NVPGHDKDRTNTRGQEQECAWMKAAAVDHTSRLDCVHLQEHLERRCQQEHARPSGVVCT
FT                   IREGIYADGMREVIRQVTVLCPERGLLLAELAEEMQQTTNTYDILFDSASQYTVRKAIE
FT                   RDLRSYLFKEKEWMESEVRRLENRVNELRAKHNGMLKRFEEQKQSEQKIHEEEVKYLRK
FT                   ANQQIINEIKRFAAVEKSSTPTPGM"
FT                   /protein_id="XP_845706.1"
FT   gene            complement(<191360..>199780)
FT                   /note="synonym: Tb07.29K4.430; telomerase-associated
FT                   protein, putative"
FT                   /db_xref="GeneID:3658288"
FT                   /locus_tag="Tb927.7.830"
FT   mRNA            complement(<191360..>199780)
FT                   /db_xref="GI:72390825"
FT                   /db_xref="GeneID:3658288"
FT                   /locus_tag="Tb927.7.830"
FT                   /transcript_id="XM_840614.1"
FT   CDS_pept        complement(191360..199780)
FT                   /locus_tag="Tb927.7.830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="telomerase-associated protein, putative"
FT                   /note="similar to GB|AAC53043.1|GP|1835784|MMU86137
FT                   telomerase protein-1 telomerase-associated protein 1 {Mus
FT                   musculus}; similar to GB|AAC51107.1|1848277|HSU86136
FT                   telomerase-associated protein TP-1 {Homo  sapiens}"
FT                   /db_xref="GI:72390826"
FT                   /db_xref="GeneID:3658288"
FT                   /translation="MTSFTGTTFHAQETQVNGGGSTFMVSPMSASSTENMVLEKDELIS
FT                   LVCAALMSEVVFSAPDPENAASLDRSRDAARIATLVHSISAEDGEFVLKLALYVRRDLS
FT                   IRLTAAFLVALCAYERRCQPFLACYMKRIILLPSDWLNIANIAYSKPHLYLLARDGGES
FT                   VTATTGTAECCCAQAIKGVPNALRDALAVTFTMFDEFSLAKYNTERATKRSGRNQTTSC
FT                   DEYVSRSEDGHTEARQVTIPSRLTFKHLIRHLHLSHPVYAINCLLGKRYPNTVDEFVQR
FT                   GLDEGGIRAFNSALCGQRMRLPTPETWERRTSREGNTAAVWDDLVARKCLPFMAAMRNL
FT                   RNIVLCGCNPTTHDSLLQLFSSEEHVFNSRQFPHRFMSAYEALDFDPEDALDKFSGKAM
FT                   ISVKPPGSPLPKIIKKRVGKRIGKLPSLEEVEKVKQMYRGAMQQAAEISARLNIIPISG
FT                   RSLVILNITRYDLPARIQDLKNGVQLAVSFYYACEDCSIILLCRGEFRIVDSEIRRENG
FT                   ILSCVENVCDICRTLLQQRDLEVMAELSRDLEDSHRSRIFNFPYLYLDELIEKRVNLQA
FT                   LIVMDCVHSCYSGENHTPSLGDLPVYLERLRRTCNENLLFVALKVSGSKNADRRTGLRY
FT                   QHKNDFLLTGFSAAALRVVAEGVSCGPRRYVERIDQVYDVNVTTVRAGRCKFESDLRVL
FT                   REVQGIEKERSNKSTEGLVKGASGEFSGSTPTDSAPGATLLSSAAEKVDSVCSDYSIPP
FT                   RSLQSRYKNFRFFLSSTFLDMENERNTLVLDVFPQLRRWAAENNLHINIIEVDLRWGIT
FT                   EDSTRANLSPSVCLNEVSRCAPFFLGVLGSRYGYRPPTLFHTVDDDVDSTDFAWIQTLQ
FT                   QEGNANCMSVTEMEMRHAIFAANRRTKGNKLHTMAFLVRDNAALVKSLPPKHKRAYAPD
FT                   TPTAAASIERLTKYLEEQGAPVIPYTATYKQASLGDRFSHPSLTAPRTAIGNISIGSSG
FT                   MLSSSIEECPLDMADFSRKAFVALKSIILRHMNLPLNFSGDVCEKGGERKQCRGDGENN
FT                   CLSERGSYHSNTLYSRECMNQLSFSSSLLKKLVPPQELMGVLVRFACTGRFSSGGEHES
FT                   IVPPAITEMSAWGGSPLANETRDRSNVLVIQAQEGDGTSTVAAALAMYLRKMDLTSFLV
FT                   THFACQAGDGSLQHLAYYISFSLIYGLGLQEDFRVQETDSVTTLIQLLPRVYEAAGKKR
FT                   DVCVILDGMNRSSHAPEMLQSLSWIIPPEPIGGIRFVVTLTTGNNPFSNAFALRVPPPF
FT                   CVTLPHLTVAEGAELVRKHLASSGKRLQESFHSNQLRLLLRKADASHASYLTYAIMYLR
FT                   LFSTFDTLTNDITQLPSTLAQLQVATYERLEERFGKDTCRAVLVSLYIASDVGGLNEFS
FT                   LYRLVSNVASASRLVVLLSGTCLRIRHRRITVTSTSFASSIAKRYLSRASDVVDACLNM
FT                   LVSELYYKSLSLQASRYELRCSIQSIVDGIKRDSGGELAFDPRRYTAGELLTILHLAKR
FT                   AKEYDVLIALLLYVPLLENLVVSAGYLQRLLSILSQSTLLATPHARKLDPVVDFIQRKY
FT                   HVLVCRPFHLRQCIRNNARSTMIFHGLSHSVCDGSKGCGGSKGSAWVKWINNTRHIEEG
FT                   RLVMFPSIDPVKCFSINSDGEFMAGGGDDMNTYVMPHTSLDQITASLKHSDTVTAVTFL
FT                   TNRPHILVTGSGTGVVRVWNSEDGRMLQQSENFHRRRVSSLSCHPVSNVVCSGSNDCAC
FT                   AFWPVVGSTAEASTRSSLVPTELLQHHKAPISSVAYHISGAILATGSWEGKVYFIDVQQ
FT                   RHDEATVSEEGIVVKSSNREQSSGKGVRTKRYTTPPYSHCVLETWSPVRALAFVPSMVV
FT                   TCAAALCNGDICLYDYASATCGARFSLHAGVPITALAFSPDAKWMASADERGSVLITYA
FT                   GIRGTVLCSLNGHRRAVTAIHFHPKNPLNLYTVSLDGTVRSWSVGEREEQSAYLDHHNQ
FT                   TGAGAATLNGSHAVTVTACAVASDGSFFVTAAADGVALVFTDRRDDRNLFSCLESSDNE
FT                   EVVFEPQFTLLHDQHRISYICIGLQNTRIMCGTAKGEVFVWDSTPGLNRREGRLLQRIR
FT                   VAEEGAHPVVYIGCESCRNTLGQEDETNKPLVTYLPCARITAITTSGMVVSWVAQGGDS
FT                   FVSCLDETQFTNSCTLLPEGELDCQCADGRQPAVAGKKLQRSVLSWVGKPEADSSSKEE
FT                   QSTSSCFLSSTNSDTEGVPSNGAEEIVCAIPLLRATQSPSRETHEESQQPKAVDTIIGL
FT                   GENHSFSGDTTTGSCDEYYIVVGRRQCHFLSARLCSVIQLPMFTSQSQYNDCSDDAFSS
FT                   VACLPAGDVFLCVSNALCVKETGGGGGEYSALFAVSTSCCMIWLLEVTFSPPVADRGKE
FT                   LTAEEEKDAEVLMREYSENTRLSVLHSVAIYGPQGKPTPVDSLNLAVVSPTTVDFSCDH
FT                   APEEVDHSDVSSVLLLTAGCRDGSVRIFVVRPFQNPSKGTEGEVDASQYENAGNTGGKS
FT                   DSIAGKAEGRCVNDNMVWQERGVFFASSSVTAVVTMRKPIYLPTVGPNSCLTVPVTALP
FT                   KKDEVDWGFETNLSSVVHLAGDCLGNVYQLQLKREETKTVSKDSRGKHRFKTALHCPLV
FT                   SADITTVGTPVHGDVMDCSTCKYLPSPSPLTKHYCECANEYGIATDAGNDEEAWRSESR
FT                   RIMAMFAPSAIPSDKSSQVGEGENKLPTAVSDHELSGETKVTVELPPFERILQKAPSSL
FT                   SVEEQRAWVKGQQSLLVEAIRVQRCAVKAREVLAEYSQNVLSQVGLQ"
FT                   /protein_id="XP_845707.1"
FT   repeat_region   199960..199991
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(199960..199991)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<200528..>200902)
FT                   /note="synonym: Tb07.29K4.425; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658289"
FT                   /locus_tag="Tb927.7.840"
FT   mRNA            complement(<200528..>200902)
FT                   /db_xref="GI:72390827"
FT                   /db_xref="GeneID:3658289"
FT                   /locus_tag="Tb927.7.840"
FT                   /transcript_id="XM_840615.1"
FT   CDS_pept        complement(200528..200902)
FT                   /locus_tag="Tb927.7.840"
FT                   /gene_family="HOG000258000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390828"
FT                   /db_xref="GeneID:3658289"
FT                   /translation="MLRRSSAALIRRTPVRHSGGELFVRPKLEEIPPADQCRGFFGPLN
FT                   DSLKFLRLLDIKWMMNRAVAMRREYLIATPTLFTFIWMFTWKGAVIYFWGDRAPPRRMD
FT                   WNTEETGRLPLGFKPTPAPL"
FT                   /protein_id="XP_845708.1"
FT   gene            complement(<201318..>202322)
FT                   /note="synonym: Tb07.29K4.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658290"
FT                   /locus_tag="Tb927.7.850"
FT   mRNA            complement(<201318..>202322)
FT                   /db_xref="GI:72390829"
FT                   /db_xref="GeneID:3658290"
FT                   /locus_tag="Tb927.7.850"
FT                   /transcript_id="XM_840616.1"
FT   CDS_pept        complement(201318..202322)
FT                   /locus_tag="Tb927.7.850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390830"
FT                   /db_xref="GeneID:3658290"
FT                   /translation="MMTLRSSTSLQSDLSRFIFPLARSLRHDKVSGAVTDASPVGSVTA
FT                   SGRHNAAEYVKPEGFCKSHQRTPGVRKTVTYFSPHMNALLNRPFGSTGTIDTNVPLYQC
FT                   PICSCGSSAEGDIKRHMQPWMDPQEMTRHMSWLHASSGYTQSNFSIYNAGEMRRLCKSL
FT                   PCSSADDPREETAMKPRVVLMLDVANIELSLEDVLIQLLTSEESILFFSRVACAIVCVH
FT                   EVFIPHTSRPGHIFFQLSRLNALSDIFTLYAATRIESGDLLTAALMGELLFQDMRGCAP
FT                   SIVLLTRDQQQKLCVSNMFSGVAGRGARVFLPRITAQSILCCLREANLASMGL"
FT                   /protein_id="XP_845709.1"
FT   repeat_region   202549..202592
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(202549..202592)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   gene            complement(<203152..>206274)
FT                   /note="synonym: Tb07.29K4.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658301"
FT                   /locus_tag="Tb927.7.860"
FT   mRNA            complement(<203152..>206274)
FT                   /db_xref="GI:72390831"
FT                   /db_xref="GeneID:3658301"
FT                   /locus_tag="Tb927.7.860"
FT                   /transcript_id="XM_840617.1"
FT   CDS_pept        complement(203152..206274)
FT                   /locus_tag="Tb927.7.860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390832"
FT                   /db_xref="GeneID:3658301"
FT                   /translation="MPVEWPKQNSHYVSSAKGLGRPRRQETRNVDNKTERKTGNASTES
FT                   GLPFLTMTINEMANTQFSHRTQELRLQMMQQTGSLVGLHNSVNSTRKFDMGGTLDAMLD
FT                   TINSRVEENPYSYDKNIKGPPWYLPTLNLHQLTQCCCRPNSRPLFGPLDGDRLSTICHC
FT                   SGASHQNSKKTATSTLTRKRRPSSPRNRSDDVGNCEKVDKVYLLRGRKRFRELTYLQRL
FT                   LLEQWCRTISDVSCRERLELDPTKLHDKVMKEVRRDEHTVQLFEQVQKHERMQEREYTR
FT                   QIQRLEDERMYGANDARYGFAIQSDWRSLLTSWDKGTACAGESAYSASQGSQDGSTPSK
FT                   IVNSPRAPTRNTFVTVGEGTHTGVCPRRAQGFLAGPYHVPGLLGRPMHRSNVGYQLRNS
FT                   GADEENIPLQELQKLLVAVKDGSLMNAVSASRKGARSHRLDAGLLYERAGRNTIFALPI
FT                   TFYMDSNWLECIIFDDDLPAVKLITQKLQEHISSKSSQGAKNMSPFSLAKCSYGVFRAP
FT                   RHLQALSESNDPQSLLKAFMEGNQRPHDLEGASLFLLPLRLCVADTGLPPRVVMTDAAS
FT                   VVSVRKKGSIATIPSSVFTNHKGHGYDTSGKRAAVSKEGIVPPLNLCKYLAGADVSGRA
FT                   LCASEHLTNYSVELQIVIRQSAWRSTTLKQLANEEYDHLKRKILAKVFVMLAMSNAMIE
FT                   HERRRESVSYVTAQTLSGDATVDATPTLLSMPRTKRVAVHSLALPPVTSYPGSVEDSNL
FT                   EFSLSDFVLPLTCAYEYTTQVDVYAAPAHRDHYVVDAKHLFCVAATALEETNNSILPAL
FT                   ARLATEYRCQYSRLARMAEEDVCKTTVSCSSGFTLDDSKRASAHLSGALELLKLESDYS
FT                   KLLVTLLRNESTIIYYNLHHLPHYRFIQQRKLLWGHLYLRTLRLAYAFCVLVQELGLFP
FT                   IPPKYRPFLRPVLLLLEYHGGQEELRSRAEETLLELEMRANELGAMLCRKEVTTHYMPE
FT                   LDAAATVVAEGEYSVSRFISCLASPDDVLSPVLLPVDLPQQLFSDVPSIAG"
FT                   /protein_id="XP_845710.1"
FT   gene            complement(<206982..>208073)
FT                   /note="synonym: Tb07.29K4.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658296"
FT                   /locus_tag="Tb927.7.870"
FT   mRNA            complement(<206982..>208073)
FT                   /db_xref="GI:72390833"
FT                   /db_xref="GeneID:3658296"
FT                   /locus_tag="Tb927.7.870"
FT                   /transcript_id="XM_840618.1"
FT   CDS_pept        complement(206982..208073)
FT                   /locus_tag="Tb927.7.870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390834"
FT                   /db_xref="GeneID:3658296"
FT                   /translation="MLLPFPRLTMLCAKKSSVPKCIQRRCAATTHFPGESQTTPASGRP
FT                   SVTESLNLKPADIEGFLLRHLAHKLEDASLESKGVKSPQWVSNSGDTASGLPPSGNEIV
FT                   GVRDDVRFHRRLSSRFTSQCDQEKYNGTTEVPFDTIQRDVQFCLQGAREALSLLHKCLI
FT                   HHRPSEQSATTVPRRLVALVLYSHTRHNVAVGYHMRRIRDIVRTMLCERHNEVLGVVSA
FT                   AIGVRWRDLEEVGGCSTEESVGGVDKNPSIQHDDSLWYPDAGVYTFNALLQCLCRMDTE
FT                   ADGACRSDTPLGIHRKILIISEGWSHVRTAAELHRSQHEQQQDVNSHNDTVNIEPLPFV
FT                   LGSTHSEDELIQFARYTACRALE"
FT                   /protein_id="XP_845711.1"
FT   gene            complement(<208400..>209233)
FT                   /note="synonym: Tb07.29K4.370; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3658297"
FT                   /locus_tag="Tb927.7.880"
FT   mRNA            complement(<208400..>209233)
FT                   /db_xref="GI:72390835"
FT                   /db_xref="GeneID:3658297"
FT                   /locus_tag="Tb927.7.880"
FT                   /transcript_id="XM_840619.1"
FT   CDS_pept        complement(208400..209233)
FT                   /locus_tag="Tb927.7.880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="similar to Putative RNA-binding protein 3 (RNA
FT                   binding motif protein 3) (RNPL). (Swiss-Prot:P98179) {Homo
FT                   sapiens} ; similar to Glycine-rich RNA-binding protein 7.
FT                   (Swiss-Prot:Q03250) {Arabidopsis thaliana}; go_function:
FT                   RNA binding [goid 0003723]; go_process: RNA processing
FT                   [goid 0006396]"
FT                   /db_xref="GI:72390836"
FT                   /db_xref="GeneID:3658297"
FT                   /translation="MNKLTFTPLTDGEEFSARRGRGHKSAPISLIIDNTCRVYITQIPF
FT                   SRIERDGVNALRSEFEAFGPVEAYKMFTDRSGRFIGTVLCTYRNPADASAAVQHMNDQN
FT                   IDGSILKVSLSRDHGVVLLHNADGGEQSHAGGNDSVDGKWKHDRYHDGTQESTDSVRGG
FT                   RGFGRGHSFPFRNGRGGPHMRRGGGRGRGLGGRSSGFPGRDVDEAFERYIASRDAQRRA
FT                   GSPNENEGDPTGEVACETEAAEVVCEVVGDIGNDSAQVPEADNAPAEAVAGNEES"
FT                   /protein_id="XP_845712.1"
FT   gene            complement(<209706..>210242)
FT                   /note="synonym: Tb07.29K4.350; electron transfer protein,
FT                   putative"
FT                   /db_xref="GeneID:3658300"
FT                   /locus_tag="Tb927.7.890"
FT   mRNA            complement(<209706..>210242)
FT                   /db_xref="GI:72390837"
FT                   /db_xref="GeneID:3658300"
FT                   /locus_tag="Tb927.7.890"
FT                   /transcript_id="XM_840620.1"
FT   CDS_pept        complement(209706..210242)
FT                   /locus_tag="Tb927.7.890"
FT                   /gene_family="HOG000244518" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron transfer protein, putative"
FT                   /note="similar to Adrenodoxin homolog, mitochondrial
FT                   precursor (Mitochondrialferredoxin). (Swiss-Prot:Q12184)
FT                   [Saccharomyces cerevisiae;]; go_function: electron
FT                   transporter activity [goid 0005489]; go_process: electron
FT                   transport [goid 0006118]"
FT                   /db_xref="GI:72390838"
FT                   /db_xref="GeneID:3658300"
FT                   /translation="MAALRYLLAPRRALVTPFLRSVTCVSSGGIFSSQRPHTFPVLWHA
FT                   VRTHSNDSGERSKPLTLHVQLPCGTMRTLTAYEGQTLLDVAMEHGLPIEGACGGSCACS
FT                   TCHVYLENDEAMELFDEATDEENDMLDMAFFPQSTSRLGCQLTLRQQKHDGLKISLPKA
FT                   TRNMYVDGHTITPHH"
FT                   /protein_id="XP_845713.1"
FT   gene            complement(<210773..>212560)
FT                   /note="synonym: Tb07.29K4.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658298"
FT                   /locus_tag="Tb927.7.900"
FT   mRNA            complement(<210773..>212560)
FT                   /db_xref="GI:72390839"
FT                   /db_xref="GeneID:3658298"
FT                   /locus_tag="Tb927.7.900"
FT                   /transcript_id="XM_840621.1"
FT   CDS_pept        complement(210773..212560)
FT                   /locus_tag="Tb927.7.900"
FT                   /gene_family="HOG000257995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390840"
FT                   /db_xref="GeneID:3658298"
FT                   /translation="MFLSLALLAVLVRIQVAASIPVLTADVAHAISFERSNAKSQTDAS
FT                   GGLGQSSFGSKQWLLRGAISQFNPADVSAHAGHTVFIPTEVHLTQADWKQLVSLPVNGV
FT                   VAATSPFDTHNELLLQHQLSRATVSIPVYFLPQDGVAAEKLKKMFATLEVSEYAAVSIG
FT                   NSVREVTPAANASFTGINIYASLKVKPKEASADTPRLLITASFDTLGVAPASLTAGGAS
FT                   AAVAAVDLWWRFNAEAAVNADKNAGVNVNAAPLNPYSVSFLLGNTARFNYAGTRWWLSN
FT                   QQEEDLDRYALVLCLDELLTSDRSDNTFGEDVDGESTDGKQSADDSSRLYMHVHDSFHN
FT                   DPYYSQVKELAEATAIKQGIHLTILVAKTNYHHYDLHFEHEVLAHRQVHAVTISSTRRY
FT                   RSDQLFRAARYPLSTFPNTTKNYTDVAKQLGRRVDFVYAFAKALLRLPEHGATTTNNRL
FT                   WVGNDAYMLGMLRHAAVSHRSPVANGGADQLKFAKSLERHMQNRLVMPSSPLGRRALSS
FT                   SVSLSTYRLKPPGIVLFGPYEDVAHVSVVKRKSMELLVLLAAVVAVGIFAVLEFGFTRT
FT                   IRVLMNCEGELETASSGSS"
FT                   /protein_id="XP_845714.1"
FT   gene            complement(<213070..>215211)
FT                   /note="synonym: Tb07.29K4.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658299"
FT                   /locus_tag="Tb927.7.910"
FT   mRNA            complement(<213070..>215211)
FT                   /db_xref="GI:72390841"
FT                   /db_xref="GeneID:3658299"
FT                   /locus_tag="Tb927.7.910"
FT                   /transcript_id="XM_840622.1"
FT   CDS_pept        complement(213070..215211)
FT                   /locus_tag="Tb927.7.910"
FT                   /gene_family="HOG000136106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390842"
FT                   /db_xref="GeneID:3658299"
FT                   /translation="MRSCSRHALGWRRTATLVFTCYGIHVRRVSHSGVDGQQPGRRPRV
FT                   DQGGSIEPGGRTGETTGINGLYGNRAQSAIRGMLGPQGQADARESKAVPILGRATARGT
FT                   KYTCDRSTVFENWRHICPSPVGWHLSRLGCATCKMPNDINEAVESLQLQIIKGCNVFEL
FT                   DGSMSDVHQSIARAFYEALQAFELDREGFVVVCRCGVIKQQPFQEEITQVESSNTAVVR
FT                   NRIVPIFERYKASSLPSMQLKSGFRISELSDEQLARLNLRRVSKTSAAGLSPDWLEAFF
FT                   TNVAYNTKIECIDVLLLDGFHTLFDGRPDAHIDDDILQLFAYLENQVKLGVLQYYGISS
FT                   PYLAPHIHRDYPTLPPDAMVPDYIRNRQPPPQVINIYRLMELARRAGGDNHHLRFLQYP
FT                   FNLTFSQALNKPLPYDGNHTLRSLTTALGLNTLGHSPLEATDLMELPQRYHNFPMEADL
FT                   KSLRMNFFTVCERCVLKEMEVKESIEKGPSTLPPLEHLFVASVYLAAQRQFTNLFFFSN
FT                   WATYYMIPRFRRALMRFKEASSADLKEWCKQYEQLTNDMLRLRKRMFEHKCGKMALEKN
FT                   AAIDRMSPTLAMCPMLNQKAINFATYGVDTVLAGFHVSRYFHEATELNPARNGELPVPE
FT                   DEIMALCDCMEVSFANSCPPDPYMLEPVLTEGKLSKQKSKSMDYMVKIDPQNPKFPDIP
FT                   EEVEGGDDRAGSSGGSGQV"
FT                   /protein_id="XP_845715.1"
FT   repeat_region   216262..216296
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(216262..216296)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<216317..>228655)
FT                   /note="synonym: Tb07.29K4.310; dynein heavy chain,
FT                   putative"
FT                   /db_xref="GeneID:3658302"
FT                   /locus_tag="Tb927.7.920"
FT   mRNA            complement(<216317..>228655)
FT                   /db_xref="GI:72390843"
FT                   /db_xref="GeneID:3658302"
FT                   /locus_tag="Tb927.7.920"
FT                   /transcript_id="XM_840623.1"
FT   CDS_pept        complement(216317..228655)
FT                   /locus_tag="Tb927.7.920"
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, putative"
FT                   /note="go_component: dynein complex [goid 0030286];
FT                   go_function: microtubule motor activity [goid 0003777];
FT                   go_process: microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:72390844"
FT                   /db_xref="GeneID:3658302"
FT                   /translation="MQSKRDSSSEFLETLYQSTERGKTVSQTYLAAQVEKEINRTLDPV
FT                   QLYEFQKPENFRYNLRHGGVPVANKVCDASSLSRERGLNGPGANGDHMEPESVSGVRPF
FT                   WRTHLDEQDSEILRMIQRAMRPPNKSSVPPVAPDDAAVIRKLKTAEDCITFFAANGSSS
FT                   HLKYVYLCRAPHVLEFRPYDLCVSPMKRGLEQKEHYIMSATGVVHVRPGHPSEVVSLAE
FT                   WMRESSLFDVLRKVHFFKTYLVYKAFFRWYKNVRAKDFLNKRRLLSRNLLISKSTFSTP
FT                   ILEVLNASYDLTTHPLVLYEAQGKHDYTIEDFRTQQAKQRQKTSAAFVACMEKIETGVM
FT                   KLIEVMKSKADVPDINTKEALEQYLLANAIVTGSGSFRSQRKMKSMHDARGEQLQRMRE
FT                   LKRSIVEYSQIDQLIRMVDCVTSETVFRVILSAIKTLYNTLHIQSSQELRSVGFQVLLQ
FT                   PTEDQMLFNPPERAIRTLCTELITECIEVTGSVTRLCSQKRLKGHFTKAPALWVLGGEL
FT                   ESDARTLYLQSSILQLVGDDYAQANTKMQAYAVTLPHIHFLEREWSDILAQWEEETGER
FT                   PLTCSTLFKLYDKIQDAQDTLRVLMASFVGNMLWINAAKLKTEIEPRMRIVRDGIDSTL
FT                   REITRTAISSLHSYFKQKIQVLNERPGQLSQFAEYVAHYKEVVSETTETEAAVAQADAL
FT                   CDLMDRQQVEFLDDEDKQLRERTLGSVSTAMSLQILFDEARLHAEAFIEENLPFHTQTL
FT                   EDSVCNVEDECVTIKQILTNSEFVVLTENVEPIIQYLAELNTKLSEIQASETQLTKYAK
FT                   LFDRPPIDWSTLKEMRSLVFVRREAWTLLDTFMKQREMWFNSPVRELDTAAMEDEVNQL
FT                   IRRTGALNRQVQEKEYEDEVGQHLLTELQELRAIMPVIHDCGNKHMTDSHWNIVLREAT
FT                   GSDNRYHEGLSLRNLQDLNILEYKEVLSEQVGLATGEWKISNDLDKIKQTWNGISFTTK
FT                   PYRNRDGVFILDALEDVIQQLDDNQVELQTIMASRFAAPVRDRVEEWIRNLRHVGNVME
FT                   EWTNLQKNWMYLEFIFSSDDIKAQLPEESMQFSSVDTLLCLLTMKAHNDKNVYQICTEN
FT                   GVLEQLQQANLNIDYIQKKLEECLETKRAAFPRFYFLSNDELLSILSDVRNPKAVQPHL
FT                   TKCFDSIASLIFSGDTYSEISGMMSGDGEEVEFEKVVYPIGNVEKWLCQIESMMRASLL
FT                   MHMRKTVEAYTPEARETWFFNHPAQCIQAVDMVVWTQEVEEAIRAGSLLEYHEHYQQQI
FT                   FQTVNLVKGSLTKLQRTLVCTLIVLNVHNRDIVYTLHESSVTSLSDFAWAQQLRYYWEA
FT                   TDSVKSGMSVGIHHCDAHLWYGYEYLGNQPRLVITPLTDRAFLTCTSALAMNLGAAPQG
FT                   PAGTGKTESVKDLGKALARQVVVFNCSDGINYKTMSRMFAGLAQAGAWACFDEFNRIEL
FT                   EVLSVVAQQMLDITSALAQRLESMSFDGHMIKLSRNFGVFITMNPGYAGRTELPDNLKA
FT                   LFRPICMMIPDYALIAEIMFYSEGFKDARTLARKMVQLYKLSSEQLSKQDHYDFGMRAV
FT                   KSILVLAGGLKRQHPNDDEDMLLIRAMRDANVPKFLRDDTILFMALIKDLFPTVKIEET
FT                   QSDLLVRYVREDMEKKGLQVVEGLITKTLQLYDTLVVRHGVMLVGQTFSGKSTIMHVVQ
FT                   GALTQIKADGHDPEGNIPLFNTIHIHLLNPKSVTMGELYGQVNEITREWTDGIISNIAR
FT                   TITRVAQELPDRQWIVFDGPVDAIWIENMNTVLDDNKLLCLFNGERIKLPSTATFMFEV
FT                   QDLAVASPATVSRCGMVFTEPFYVDGGRGWIPLAKSLVTKKASMFPRFRADRVSELLER
FT                   FLPMSLDFIRKECREWIGSVDAQLAVSCIELLAAFMKTIDEEDLLPPLLRTKEAKPQND
FT                   DVYLLPETTYSGVKLVPSEPEEFKAPEIAYEQVSADDETLLDMYFLMSFVWSVGGNLRD
FT                   DSRERFSAFVKKHFEELLPGKIAADDGNSVYDYVVHKASMRFVTWRHLVPTFCFSPELP
FT                   YFDLIVPTAETVSVITLFGVLVANSRHVLLNGVTGTGKSLAVMDFVTGTLRGDDPEGPW
FT                   EYFDTVLSAQSRARDIEDRLDGKLYKLRSNAIGPKPGKRAVFIVDDLNMPALERYGASP
FT                   PLELLRQLITQGGFYDKRKSPATFKEVHDVVFLTACGVPGGGRNEMTKRLTSRFHLLCQ
FT                   PSFSDHSIRRIFGCILHGFLSAWEQPDVNALSSVLVEAIKECYYLISTEKLPTPKRSHY
FT                   TFNLRDFSKVVQGIMQVSPTSAPTREILLNVFVHEVSRVFHDRMIDDGDRRWWWKTLSG
FT                   VSQRVLKMNWDPRLENVIFGDYMRRDRSQYAEIQTGEGLIEVLREYQNGYNIESNGTCE
FT                   LVFFKDAIHHISRICRIFRQPRGHALLVGMGGTGRQSLCKLAAFMCNLAVHEVTITRSF
FT                   NMAEFRERLKGILMESGCKDNPSVFFLTDNQIVQEEMLEDVNNLLNTGEVPGLMQNEDI
FT                   DQIVEAVRPLASAAGKKEARNAIFSHFVTLCRNNVHVVLALSPVGEPFRRRLRMFPSLV
FT                   NCCTIDWFDQWPADALHSVAQHIFSELPLDEEMKNGLIKLCVSIHIDVQNRSEEFFEEL
FT                   HRRNYTTPSSYLELLNCYHQLLSEQEEQTIAQMKRYQAGLDKLQSTQCTVDEMKEQLVQ
FT                   MQPKLLQAAQDTEEIMTKVKLEQESAQVVRTECSKEEEAAMAIRREADGIRAECQAELD
FT                   KALPILRAAENALAELRPDDIREVKSFQKPAARVVLVLEAVLILLGERDLSWDRAKLVM
FT                   GRMDFIKDLQNYKKDELTERTIRSIQKYVNNPEFQPQEVAKSSKACKSLSMWVLAINNY
FT                   YEVVKVVAPKRERLAEAEAKLSVATATLREAQDRLKSIEDKINGLKRDMQENIEKKNKL
FT                   EADIALTKARLNRSEQLMSGLSREQDRWHSSITFLQDEKLGLPGKVALAAGCIAYLGPF
FT                   TGPYRKRMLTAWWENCKEFGVPIGNSVFDLTTLVSPAKVSSWSAAGLPQDPVSTENGVI
FT                   VTKSKRWCLCIDPQGQACAWIRAMERENNLRTIRLSDPSYMRTLENAIRVGLPVLIENV
FT                   EETVDAALDPVLLRQTYRSQGRLLLKLGDVEIDYDPGFRMYMTSKLPNPHYLPELQIKV
FT                   TVINFTVTQGGLENQLLTDVVRYECAELEAKASNTQKDISDGKTQLKAIEDRILHLLTS
FT                   STGNILDNEPLVRTLSEAKDTSEAVTEALNLAEQTQKDIEVACNRYRPVATRGAVIYTV
FT                   LSHLARVDHMYQISLDFFKQLFVKSMHRTEKVSDVDERVAILLPAVTLDSYRTVCRGLF
FT                   ERDKPLFVALIFSEIYRQEGIISDAEWEFLLKGSEGRSLVDIDNDSWPVWMTEAAWNEL
FT                   TALSMALPETFGDIKDTIYDNEDDWSTWFESDTAYEWFPSTTQGLTLFQKVLVLKACRE
FT                   DLTSHGLSIVCSHYLGKVFTESPAFDLEACFADSSPTAPIIFVLTAGIDPTVLFTEFAE
FT                   RKGFAEKKLVLSLGQDQGPKAEEMIRRGSKDGWWVYLQNCHVYESWMSTLERCVEKLHI
FT                   STTLHSDFRLWLTTMPTRSFPVLLLQSGVKVVKEPPKGLKANIRDSFCNEVTPALWDGR
FT                   PENPTTWRRLLCSLAYFHAVIQERRKFGPLGWNIPYEWNQSDFSASLHTLQVYVPTGVS
FT                   ESVPWSALRYMVGTINYGGRVTDFLDSRALVNILDAFFNENVLQPGQFNITSDGVYCIP
FT                   EDVESLDAVKEYLADLPAFESPELFGMHSNADIACNRTTARNQLAVMLSVQPRTKGTAG
FT                   RSPEDKVLEMVSEFQTRLPEAIDKTKAHPDTYQLTEGGVMISLGTVVSQEIDVFNSIIR
FT                   KLEATLLELKRGIKGEVVMSARLESMFDACLLGQVPQIWHENSYLSRKPLASWFQDTLL
FT                   RVEFFRDWNDNGMPMSFWISGFFFPQGFLTGVLQAHSRENMIPIDDIRFRTNVTRYEVV
FT                   EDIVNTPKAGVLIHGLFLEGARFTFEGMSLCESNPRELYTSMPLINLEPQRLKDQDKSK
FT                   PVYECPVYKTSARAGALSTTGLSTNYVISLDLSPGSSPPEHWIRRGVALLCMLDD"
FT                   /protein_id="XP_845716.1"
FT   repeat_region   complement(231007..233970)
FT                   /transposon="DIRE"
FT   misc_feature    234968..234988
FT                   /note="AT_rich"
FT   misc_feature    complement(234968..234988)
FT                   /note="AT_rich"
FT   gene            <235926..>237158
FT                   /note="synonym: Tb07.29K4.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658306"
FT                   /locus_tag="Tb927.7.930"
FT   mRNA            <235926..>237158
FT                   /db_xref="GI:72390845"
FT                   /db_xref="GeneID:3658306"
FT                   /locus_tag="Tb927.7.930"
FT                   /transcript_id="XM_840624.1"
FT   CDS_pept        235926..237158
FT                   /locus_tag="Tb927.7.930"
FT                   /gene_family="HOG000257994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390846"
FT                   /db_xref="GeneID:3658306"
FT                   /translation="MSRRRPNVMLTIPKNTLQVFDMGLDFRSYLSRVDVNGLPVLGNVV
FT                   SYEASKLTEVFTPTVGLLVTILHMLAHCTSSCSAVAWLKAYDAIQKMYIENSEEENTEA
FT                   VRYAVEARAAIKDYLTGDAVPGTNLLCEKLLTLLDQQSGIHGSQAPSQRKVPREPKGAF
FT                   CNLHLSDQKCYQDFACNQLHLQEVKTVRHRKIFYMRLIEVLKAEKRSRQQIRHRIKDSV
FT                   FFARYGNKVTVQCQGKWIPFFKTVYTDGRLEQALRTQHFACGDSACADENCLGIHPQDR
FT                   RVTTSSKLMDLNNPDVVLQQIEEEAERHLSMEGAFNDHEAEHISAAASSSSMPSPTSEM
FT                   WRNTVREYVRQTGIPQVEADESLLRTLQDANVLATPTASTESLTPLLDELDMRTFSSSS
FT                   PVREHPNAEIG"
FT                   /protein_id="XP_845717.1"
FT   repeat_region   237307..237343
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(237307..237343)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <237819..>239264
FT                   /note="synonym: Tb07.29K4.250; protein kinase C substrate
FT                   protein, heavy chain, putative"
FT                   /db_xref="GeneID:3658303"
FT                   /locus_tag="Tb927.7.940"
FT   mRNA            <237819..>239264
FT                   /db_xref="GI:72390847"
FT                   /db_xref="GeneID:3658303"
FT                   /locus_tag="Tb927.7.940"
FT                   /transcript_id="XM_840625.1"
FT   CDS_pept        237819..239264
FT                   /locus_tag="Tb927.7.940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase C substrate protein, heavy chain,
FT                   putative"
FT                   /note="go_process: protein kinase cascade [goid 0007243]"
FT                   /db_xref="GI:72390848"
FT                   /db_xref="GeneID:3658303"
FT                   /translation="MTDMLFAVLLTISLLVHVSLALDPTYGAQDAYLDHFKGISSSGAF
FT                   QCLTGSKVIKGDQINDDFCDCPDGSDEPGTSACTNHFTKVKFPDGWKFRCRNIGFKSKE
FT                   IPHNRVNDGLCDCCDGSDEYGGIVQCANICAEVQEKEAEELMLEREKMKLSLEEKKKMV
FT                   EQATVKREQDKVALKEEKAELEAAEISRERMSRDLPPLEDHEKKEKQRLSEEFKILQKH
FT                   IQENEANEEGTKLKYRAGCTKWYTTVDCGTKSSVTDEKGCDELIPGNVSGYCECAEAKT
FT                   DATVKYQKNCDHKPLRCSFVCKTAGEEGTLSSSEEQYFDTTNDPSYELPGAKNLRAKIK
FT                   DLDEKMDNLRSSIAAKEARLKRNLNTEDIIRTLEDECFTLDVKVYTYKFCPFKDAHQYS
FT                   KGTEIGNSIGKWVRFGESTYSLWSTTDDHTHMLYEGGDWCWNHDQRTTDVRLVCGPENK
FT                   LLKAEEPISCKYAMVFQTPAICE"
FT                   /protein_id="XP_845718.1"
FT   gene            <239478..>240962
FT                   /note="synonym: Tb07.29K4.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658310"
FT                   /locus_tag="Tb927.7.950"
FT   mRNA            <239478..>240962
FT                   /db_xref="GI:72390849"
FT                   /db_xref="GeneID:3658310"
FT                   /locus_tag="Tb927.7.950"
FT                   /transcript_id="XM_840626.1"
FT   CDS_pept        239478..240962
FT                   /locus_tag="Tb927.7.950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390850"
FT                   /db_xref="GeneID:3658310"
FT                   /translation="MNPKLFSTYVIDCVILFLLVLFAFGYQTVRNQERVDAQFELAASL
FT                   FGAKDKSAGAEKSISSVKDFFTVFKGIIDAYYHIPAAATGTFMHYTYGVGNFTPLVPVV
FT                   EITFHDRPQNSLAKVPLVFSFDVQASDVLGPFISPQSYYYQNGFCGDGVTSRLRYILCQ
FT                   TSSTLDVFDNVDKVKLSFQLYSMRRSDDGRVRPAEWDIEVMFGMGGYGPVITMTTSFSS
FT                   IEERFPQRFPVMISCAVAPLVLLSFLFRMDRISQLVTYVKVVLTTCRRSQWYGRLRPDN
FT                   SGLRGQSFLLLGVFSDIVALTFSITSLVIQFTPKVSGTTEHALTVLLGFAAFMRSTQLI
FT                   SVLKLSPSLCVVVDGFVTASDQLFMYVVAVFPILLGYSVCGFIVYGSYQSYFKTVPYSI
FT                   VTLICAAFGDNLIDTFVDMDRGAYVVQVLFTRIFFGSFLAFFICNVLNVAYSIIQDSYN
FT                   QAIRMHGATSSGTTGANGSGTRLTEELREILGKLRG"
FT                   /protein_id="XP_845719.1"
FT   gene            <241719..>244268
FT                   /note="synonym: Tb07.29K4.230; protein kinase, putative"
FT                   /db_xref="GeneID:3658311"
FT                   /locus_tag="Tb927.7.960"
FT   mRNA            <241719..>244268
FT                   /db_xref="GI:72390851"
FT                   /db_xref="GeneID:3658311"
FT                   /locus_tag="Tb927.7.960"
FT                   /transcript_id="XM_840627.1"
FT   CDS_pept        241719..244268
FT                   /locus_tag="Tb927.7.960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72390852"
FT                   /db_xref="GeneID:3658311"
FT                   /translation="MTRNADAHFSVGTAANRQLNVPAPSHLVTWSADSLAQNQPSIPSL
FT                   GNLNLRNPGIWSKREELTPRRQSPVVAARMARIVSSSNISPRYTTFTQRWSPVSPLDLS
FT                   LTQSSHRAQTAGERGFAFIARYGGIARSPARQAASRSGQSPELETSVASRQTSQHSSLP
FT                   VEMTPRDRSLKRQIITERKLRIVRQESSTPGASSSNLACLSEANGSRTRLLSQEQLKKQ
FT                   GSSIHHGGETGLTDKSPVAAPLTVEQLLRKPPQKASTSVGRRVQTPEISISLRGSFSAG
FT                   NDSLSSAHVAELSTTTARELPSGGVPCVAPHRMSDKSMSASISSCVHPVIVQRRRCSDC
FT                   TTKPAPSATTSPGTMTATTAGATPTTSSNRSQSSVETVTDIPSVGQVAAPYNGQKSSFV
FT                   SSRLVMQQFVQRWSNHYEENKKAYFEGGYMSVVPGKKLNSRYVIVQKLGWGEFSTVWLA
FT                   YDTLHTTLGKPHQAFVAVKIAKCDSVVSESTQYEIKLLRYIGSNTPSHAPLTGLLDSFE
FT                   VAGQYGSHTCMVMPLHGSNLLSIIDQMKAKKGIRSPSEISLIKEIVVSILIGLDELDKL
FT                   DVIHTDIKPENILCSSSDPKVLDTIENFCLRNKDRSSMVPADRVRKAMWQGDPNHLVCI
FT                   ADFGLSVALKPSKGQAVTGKGQKDVAAKAAIESKKEFPVEKAGTVSNVRGTMIQTREYR
FT                   APEILMGMDFNTRTDIWSVGCMVYELITGEFLMDPKRRTRNERMMDVEHLAMMMQILGP
FT                   VPEKIIKLREGCGNGKPPPRYIHRYFDENNRFIYSDKYRLYPRRHIDRELQAYLPPAEA
FT                   KSAAAFIVGCLASYEPTSRPSAGEMLNHTWLYDATNN"
FT                   /protein_id="XP_845720.1"
FT   misc_feature    246028..246079
FT                   /note="T-rich"
FT   misc_feature    complement(246028..246079)
FT                   /note="A-rich"
FT   repeat_region   246508..246611
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(246508..246611)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    246787..246811
FT                   /note="AT_rich"
FT   misc_feature    complement(246787..246811)
FT                   /note="AT_rich"
FT   misc_feature    246846..246886
FT                   /note="GA-rich"
FT   misc_feature    complement(246846..246886)
FT                   /note="CT-rich"
FT   repeat_region   247209..247246
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(247209..247246)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    247587..247615
FT                   /note="AT_rich"
FT   misc_feature    complement(247587..247615)
FT                   /note="AT_rich"
FT   repeat_region   248698..248730
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="aagtg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(248698..248730)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cactt"
FT                   /rpt_type="tandem"
FT   repeat_region   250710..250751
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(250710..250751)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   250751..250774
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(250751..250774)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <250779..>252407
FT                   /note="synonym: Tb07.29K4.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658309"
FT                   /locus_tag="Tb927.7.970"
FT   mRNA            <250779..>252407
FT                   /db_xref="GI:72390853"
FT                   /db_xref="GeneID:3658309"
FT                   /locus_tag="Tb927.7.970"
FT                   /transcript_id="XM_840628.1"
FT   CDS_pept        250779..252407
FT                   /locus_tag="Tb927.7.970"
FT                   /gene_family="HOG000168152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390854"
FT                   /db_xref="GeneID:3658309"
FT                   /translation="MDLDDEFITNRSEATIPKVLCCVCGLLIDSNPSNMCSSCLRSHVD
FT                   ITESVQKEYIIVYCPECSRYLQPPQYWTRADLESRELLTICLKRVKGLSRNVFKLVDAK
FT                   FIWTEPHSKRLKVKLVLQKEVMSNIVIQQACVIEYVVVWQQCPTCQKVATGQPQWDACV
FT                   QLRQKVAHKKTFLYLEQLILKHKLQENFIRVEAQPDGLDFFFAHKSHALNFLEFVSRNS
FT                   PVTRRDAVQLVSHDSKNNTAVQHHTFSLEIAPLCREDLVLLPYQSYYLKLGGLGPLVLV
FT                   HKVYSSVVLVDPRTLRANEFTGTYYWKKPFLPLMNSREMTEFYVLQCTPTGVTNGRYHL
FT                   GVITVCLSSEVGYGREWIVTSHLGGLLQPGDLAMGYLLEGRTFNHEEWENNKYKQDQLQ
FT                   EVVLVRKHFPAQRARRHRRNWKLKRLDVMDPSCAERNARRQEEQEEERLEFEDELERDV
FT                   ELRRDVPIYKMLDSELAERVVKKNEGKGNANPENECDDDADEAPQIALEEMLDELRLSD
FT                   DDETAAADDEEASVENARKKKRPEV"
FT                   /protein_id="XP_845721.1"
FT   gene            <252806..>255682
FT                   /note="synonym: Tb07.29K4.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658304"
FT                   /locus_tag="Tb927.7.980"
FT   mRNA            <252806..>255682
FT                   /db_xref="GI:72390855"
FT                   /db_xref="GeneID:3658304"
FT                   /locus_tag="Tb927.7.980"
FT                   /transcript_id="XM_840629.1"
FT   CDS_pept        252806..255682
FT                   /locus_tag="Tb927.7.980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390856"
FT                   /db_xref="GeneID:3658304"
FT                   /translation="MKVAGSILALLRNRLPTAPLHPVTAAELLCELHPSEDRVVSAHLV
FT                   GCVEGNGVLLSLPVLLGLIRRGYSDSLKSFGSSALSQWGPMEETIFTALWVQLRSQRES
FT                   LVEVGSGPDATDGIGESEAQVSAPERLHADSCLLIERMMLLMISLGKFVLHSTLTLKGV
FT                   RLQLLAEALSPLCDAVESAWCRMAEARNAGEIPSERLLDISKLVARCVHIYGKYFAAYH
FT                   HIFCAILFTGVEASRKLLEAQLPLTDRETLARVRSARDVLLEVKPLLTGLLVRASSRET
FT                   QRYVTEVEEWLEMIVSLVETPVLKAVGLQLRSHICSLGSSGNVDNSEILGAELRNCYIV
FT                   MMHTAAVLLAMRFHRNRFFEECNFCVRANNLIAQGLKTIWWMLDTITMSMGSPNKAVEL
FT                   QDLHSEDSVTWCEWGNCCEVAEVVRRFFPLYSDDARVSKMALTNPYFCVSHHPPVSEIT
FT                   SVLLRILRAACHRLARSVAGDGDLQCSTVPFVVFLQIVRAALSWGDACHEDGGLSPSFV
FT                   WSTIRATLPRQLHASSPPLWTVLVLLEDLGASAYFCAYHCRVKLSIEDRTVIDAMKEMC
FT                   DNCLAYLNKRYLCDDDLADADVICRVLHTLAALKTRERDQSTLFGGDLFSRHSTLMNHL
FT                   RKQLVPLDQGVLRRSGGSSTSSSRTGINNLAGDPQGGDFHGGAYWFICSACETNILWQK
FT                   GTASISSPSSCHCWMRRNDPVEAVVACIELFLPLLGQEDRVGDHEHFMEDAYPTLRSVY
FT                   NAAILSYCTTTPLCGSLGSDELFSSDCALPSKYGTGSERQPLAPTAFLVECHQYLLLLY
FT                   PTAMQPQHAYRILRVMLTTSPLLFAHTPQLARFLFRCLIPVERGRSTSAHDFIESCDPQ
FT                   ELWQVLLCACATQVACAGCKTSSNNVRRDEGGKVPIIPSSIWSEDAEIVFGVLYDVGNS
FT                   DVGDNDTFLTIRGHVVRRAMEILHAQGL"
FT                   /protein_id="XP_845722.1"
FT   gene            <257177..>259513
FT                   /note="synonym: Tb07.29K4.130; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3658308"
FT                   /locus_tag="Tb927.7.990"
FT   mRNA            <257177..>259513
FT                   /db_xref="GI:72390857"
FT                   /db_xref="GeneID:3658308"
FT                   /locus_tag="Tb927.7.990"
FT                   /transcript_id="XM_840630.1"
FT   CDS_pept        257177..259513
FT                   /locus_tag="Tb927.7.990"
FT                   /gene_family="HOG000257984" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_function: protein binding [goid 0005515];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72390858"
FT                   /db_xref="GeneID:3658308"
FT                   /translation="MSDSGDEYERREDILLQDDINLAGANVNGVDTDPCGYYASLGVSQ
FT                   DSSQAAIRRAFLQLSQIFHTDKHVGEDEEIQALMNERFQQLMEAYSVLSDEGKRAAYDA
FT                   SGKLGLNRYSLIPKEITQREDILRYMSTLEREAELLKLSKLLSASSRTTVSYSVDHLTN
FT                   SMWKLGTSANDTLQQQSNGVDTEEAGTDEGETETPPKGDIADAANGAEGSSAQPVPLNT
FT                   SVAVREVQLDGKNLLVLIPGDEVQQQLRQQLQHSTGGGSGGSAAPLSPEQRFGGVPLAA
FT                   KLLLGLLPRKLHFEHSIHHYASPSFSVRTKTEAQHEGMRSVLRCTAIASYQPNPVTLYS
FT                   ISWRLSVARLHIACTWERILNNLWRLKSKLVLFNTQSLLPMYELSLKRMLAAGLEIENT
FT                   WVMSMRNRGLFRTTIGQSTPEGAQRGLQFLVGYRSANVSLFSTAPVVWGGGEPGCGGVS
FT                   RGVLEHSVSVDALRGRAHVGFSSWYTISKYNRIGVGFSTALPCPRGLSRYVSPFVDHPE
FT                   YLSINEMSFLLGRGDHLIRIPVVVFHSPKVQSALLWLTAPVLLYRIGRLVMRPYQSARM
FT                   AALYRQNRLDHRTEMDVARVRATHEQKALQSSSLRSRMAEEQIGGLVIINARYGVLQPR
FT                   YPESLVLPPKQPNAAGNRSEVSGRQRQTWWRFWRAGRGTPTPSESVTVNGKKKDEGEET
FT                   EGDSSSSVLVLDVTVPLQNFVRDSQLVLPEGSKSKLVGFTDPDPFTRERKQLKIVYRFQ
FT                   RRRHVVILDDEDIVRLPQREHLVES"
FT                   /protein_id="XP_845723.1"
FT   gene            <259946..>262027
FT                   /note="synonym: Tb07.29K4.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658305"
FT                   /locus_tag="Tb927.7.1000"
FT   mRNA            <259946..>262027
FT                   /db_xref="GI:72390859"
FT                   /db_xref="GeneID:3658305"
FT                   /locus_tag="Tb927.7.1000"
FT                   /transcript_id="XM_840631.1"
FT   CDS_pept        259946..262027
FT                   /locus_tag="Tb927.7.1000"
FT                   /gene_family="HOG000257983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390860"
FT                   /db_xref="GeneID:3658305"
FT                   /translation="MTRCRLVGASSGGKYISTTNAKTRPVMGCLRFASRLSALGSTQQP
FT                   KFFALPLLATTRGFGHLVREVDMRGFRGDFGQLRHKNLASTQRYVTDALGAKKNVIFCG
FT                   AYHTGKLTILKAIGEACEARGKKVAYVSCNPQRASRFGGFLLYHFVGLRYLFRNEIPSR
FT                   DQLDGALERHARLCESTYAGCVPSLKSVDVLIFDAVDQLEPTILASMDAVCRRLRGKPN
FT                   DAFGGLRVFAAADFWRLPVHPSSDTGGYIFQLDNWGELFPKQHLLKKIYGQTKALTTLV
FT                   NKAYYGQLSAEDIEELEARSSAGRTESGAACGGSKKEASETSGSFSVSDDGSRQVEVEE
FT                   EGAGSGLLPPQRLISNAEAIIKFTSRFPKQPSIRVLPPRFRTLKRTEIGNYIVNMMVQS
FT                   STLHSFGLVDSLNLDIGASVHLLFDGTADFGVTAGTVGEVLQVKEHALVVHFPSVHRTV
FT                   DVPRMRISVYHPFYPEVRYEVQQFPLYPRHCISPINMLTYHHAYQVHIDCHQLADTNDL
FT                   GNILARMRTFDDFTIERVHDFAHLDGMVHEPTRIYYQRIDNQPLSSAAEQWCRNCKSYV
FT                   STSDFYTHWDKCVRQVRWCTVCNTRIPLERLGPHQEKHQIVLCLDCGRAVEWRRWEGHR
FT                   LTCSAMMREVSPENEFLPLRTRQLALEMGLDKRDLHTMKGFNRGMLPKSRKQCNGGEA"
FT                   /protein_id="XP_845724.1"
FT   gene            <262523..>263038
FT                   /note="synonym: Tb07.29K4.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658307"
FT                   /locus_tag="Tb927.7.1010"
FT   mRNA            <262523..>263038
FT                   /db_xref="GI:72390861"
FT                   /db_xref="GeneID:3658307"
FT                   /locus_tag="Tb927.7.1010"
FT                   /transcript_id="XM_840632.1"
FT   CDS_pept        262523..263038
FT                   /locus_tag="Tb927.7.1010"
FT                   /gene_family="HOG000257982" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390862"
FT                   /db_xref="GeneID:3658307"
FT                   /translation="MPPNSATRWLPFVSSDLKDYLNRYWAVMFTVGARPIETGHIRHYV
FT                   SWYCTRMKVVLLDHHVYVEPLRQQLQEVSRTPELPLLFVNKKLVGTLRDVELLEREKKL
FT                   KDVLHFGFEWRVGGSVAATNGQKSLMGALPAPYGDAEFFRGRYRGPPVARPVVSLPTLH
FT                   PFALRSEE"
FT                   /protein_id="XP_845725.1"
FT   gene            <263265..>264218
FT                   /note="synonym: Tb07.29K4.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658314"
FT                   /locus_tag="Tb927.7.1020"
FT   mRNA            <263265..>264218
FT                   /db_xref="GI:72390863"
FT                   /db_xref="GeneID:3658314"
FT                   /locus_tag="Tb927.7.1020"
FT                   /transcript_id="XM_840633.1"
FT   CDS_pept        263265..264218
FT                   /locus_tag="Tb927.7.1020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390864"
FT                   /db_xref="GeneID:3658314"
FT                   /translation="MSSGELQQSTPGAPQDLEEMLTALRNEAEAGASGGSTKPERSHPA
FT                   VAFYCGKRAVRLQVVPDGTDISHSEDSTLYVISLHQALLPAHYNDSFSEEEHSLRLSSS
FT                   EGLELLRTNWELLLWLLMPSVQISASCDPMDGADDSSPISSWRELCCPLTWEDYKCLRR
FT                   HGVMDRVHYSYVVFLRFYGWRLHNEENGVLDRHRNWEARYRLLVSPDQCCKCSLGGGVA
FT                   CDEVVRRWTCDDGVPCPYTALTRILKVLLELCFNRYAVNLVAFIIEEMSKGRLLFLQQI
FT                   LESVWFPIVVNSKQVADADRDYLSRKLHHLTHSDSD"
FT                   /protein_id="XP_845726.1"
FT   gene            <265231..>267843
FT                   /note="synonym: Tb07.29K4.60; heat shock 70 kDa protein,
FT                   putative"
FT                   /db_xref="GeneID:3658316"
FT                   /locus_tag="Tb927.7.1030"
FT   mRNA            <265231..>267843
FT                   /db_xref="GI:72390865"
FT                   /db_xref="GeneID:3658316"
FT                   /locus_tag="Tb927.7.1030"
FT                   /transcript_id="XM_840634.1"
FT   CDS_pept        265231..267843
FT                   /locus_tag="Tb927.7.1030"
FT                   /gene_family="HOG000136107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock 70 kDa protein, putative"
FT                   /note="56% similar to SP:P11141: Heat shock 70 kDa protein
FT                   F, mitochondrial precursor. {Caenorhabditis elegans};
FT                   go_function: protein binding [goid 0005515]; go_function:
FT                   ATP binding [goid 0005524]; go_function: ATPase activity
FT                   [goid 0016887]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72390866"
FT                   /db_xref="GeneID:3658316"
FT                   /translation="MHCCKVFSFRLTAGLLQRLPMPMPPPRPGVSVNMQHAVEIEAKRR
FT                   VELDEATRARYVVVKEETRASGDRVIGIDLGTTNSCISYIDKKTNRPKIIPSPTGSWVF
FT                   PTAITFDKSHKVRLYGEEARACVRTSASATLCSGKRLIGRGVGELGRVQSQLHKTNMVT
FT                   LNERGEVAVEIMGRTYTVTHIIAMFLRYLKKEAEKFLKEPVNAVVVSVPAFFTPQQKVA
FT                   TEDAALAAGFDVLEVIDEPSAACLAHTVLQPSNASSREHLSGSKRIVRSLVFDLGGGTL
FT                   DCAVMENDRRRGTFTLVATHGDPLLGGNDWDAVLSQHFSDQFERKWRVPLEDAEGNVGQ
FT                   GVATYRQLLLEAEKAKIHFTHSTEPYYGYNRAFHFSEKLRDIVPLEATLTLEEYIELTR
FT                   PLRVRCVECLNKLFDHTSIRPADIDNVLLVGAMTRDPPIRHLLTEYFGRHVESEASCPA
FT                   DYAVAIGAAVRGAMLQGGFDDLLSNTRFVTGTAQALKQGGFLRRCCNRIGSLVSSSVNP
FT                   NAIGQRWRGRAKGLSDEEIANYAKELVEFEAACDRRLLLERAENDANFVMRRVTADSSK
FT                   RQGMQEKRVRQLSEQLKFWQYMVHNFHDHEDELLRTVRELEQALDELEGLAEDNTSGLT
FT                   TAGTVDFSSVTPVNHCEEEERDCSSVSAASRSAQLRTAHGDGKLKERTQDEEGEKPKGR
FT                   KIMRRAVPLPRASAEAQELVEAGHPALRGADVSMTESTRSAFFEAQVEERAWREPPTPP
FT                   GEHGSWQEVKRAVDAGEPVGSPIGLQELQRPMTHEEMLQVLNNIAPIDDPVSEEHARKR
FT                   DHSIDMRTMTIVEGAVDMVALQELLEEEAKRAEELQRAQKKGEKQLVADSSAKLFAMD"
FT                   /protein_id="XP_845727.1"
FT   gene            <268228..>268677
FT                   /note="synonym: Tb07.29K4.50; 40S ribosomal protein S16,
FT                   putative"
FT                   /db_xref="GeneID:3658312"
FT                   /locus_tag="Tb927.7.1040"
FT   mRNA            <268228..>268677
FT                   /db_xref="GI:72390867"
FT                   /db_xref="GeneID:3658312"
FT                   /locus_tag="Tb927.7.1040"
FT                   /transcript_id="XM_840635.1"
FT   CDS_pept        268228..268677
FT                   /locus_tag="Tb927.7.1040"
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S16, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72390868"
FT                   /db_xref="GeneID:3658312"
FT                   /translation="MSGEKTHTLKQVQTFGKKKTAIAVATVTKAPQCNIRINGVPISQI
FT                   LPETLRAKIMEAVKVVGARYFSRLRVDVRVRGSGQVAQAYAVRQAIAKGIIAYYQKYHN
FT                   EIEKAALKDKYLEYDKFLLIADPRRCEPKKWGRHSARTRFTKSYR"
FT                   /protein_id="XP_845728.1"
FT   gene            <268952..>269401
FT                   /note="synonym: Tb07.29K4.40; 40S ribosomal protein S16,
FT                   putative"
FT                   /db_xref="GeneID:3658313"
FT                   /locus_tag="Tb927.7.1050"
FT   mRNA            <268952..>269401
FT                   /db_xref="GI:72390869"
FT                   /db_xref="GeneID:3658313"
FT                   /locus_tag="Tb927.7.1050"
FT                   /transcript_id="XM_840636.1"
FT   CDS_pept        268952..269401
FT                   /locus_tag="Tb927.7.1050"
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S16, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72390870"
FT                   /db_xref="GeneID:3658313"
FT                   /translation="MSGEKTHTLKQVQTFGKKKTAIAVATVTKAPQCNIRINGVPISQI
FT                   LPETLRAKIMEAVKVVGARYFSRLRVDVRVRGSGQVAQAYAVRQAIAKGIIAYYQKYHN
FT                   EIEKAALKDKYLEYDKFLLIADPRRCEPKKWGRHSARTRFTKSYR"
FT                   /protein_id="XP_845729.1"
FT   gene            <270035..>271519
FT                   /note="synonym: Tb07.29K4.20; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658320"
FT                   /locus_tag="Tb927.7.1060"
FT   mRNA            <270035..>271519
FT                   /db_xref="GI:72390871"
FT                   /db_xref="GeneID:3658320"
FT                   /locus_tag="Tb927.7.1060"
FT                   /transcript_id="XM_840637.1"
FT   CDS_pept        270035..271519
FT                   /locus_tag="Tb927.7.1060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390872"
FT                   /db_xref="GeneID:3658320"
FT                   /translation="MFRVVSFGSLIQDSRFYFKRNGRVTTMYPDGYTIQRRVFSKGRRT
FT                   RAKITLPGDDAKNDLGEVYYTATIKRRDDGGPCFQVVRSDKPDVIHSGDQCSPAWRKAL
FT                   EAAKQDFPDAHKELAYVGSDDKGCMIVQGAILFGLTAKPVVDELNKMAKALSINEWLST
FT                   ISADTKSLGDPIGSPIPSSSSQPRKPKQQLVTSSQPSQSSSWKTRGKKSVEAPEDDDVP
FT                   YCVRLSNSEVSASVPCSICGSTTPFCPITGKRHDTTGKGGRGRKKSELTEGAVAPSEPT
FT                   GKKRGRRKKQPRDDDGAEGSQNMSASSGDAVKRRRTSDGATERGPSTRDAKRQMLLFEN
FT                   NGNAVDGSLANGEVPYAPPPVLFRPPLSPPQSKEALRVLQRTLQALSVVRTPFTSLLQL
FT                   REPGVKKTTHASSKSDKGAGSQANIISVNGADTDGNDAAAARKQAEEGTQHFLDIVDMD
FT                   KGTRARRYIKFMKLYTSERTKMDLLKKAANSNPDSS"
FT                   /protein_id="XP_845730.1"
FT   misc_feature    271834..271873
FT                   /note="AT_rich"
FT   misc_feature    complement(271834..271873)
FT                   /note="AT_rich"
FT   misc_feature    271945..408821
FT                   /note="sequence corresponds to BAC RPCI93-27M11"
FT   gene            <272237..>274921
FT                   /note="synonym: Tb07.27M11.120; RNA-editing complex protein
FT                   MP100"
FT                   /db_xref="GeneID:3658319"
FT                   /locus_tag="Tb927.7.1070"
FT   mRNA            <272237..>274921
FT                   /db_xref="GI:72390873"
FT                   /db_xref="GeneID:3658319"
FT                   /locus_tag="Tb927.7.1070"
FT                   /transcript_id="XM_840638.1"
FT   CDS_pept        272237..274921
FT                   /locus_tag="Tb927.7.1070"
FT                   /gene_family="HOG000257979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-editing complex protein MP100"
FT                   /note="similar to GB:AAO63565.1: RNA editing complex
FT                   protein MP100; putative exonuclease {Trypanosoma
FT                   brucei}(PMID:12649499) Protein identified by mass
FT                   spectrometry.; 99% similar to GB:AAO63565.1: RNA editing
FT                   complex protein MP100; putative exonuclease {Trypanosoma
FT                   brucei}(PMID:12649499) Protein identified by mass
FT                   spectrometry; go_component: mRNA editing complex [goid
FT                   0045293]; go_process: RNA editing [goid 0016547]"
FT                   /db_xref="GI:72390874"
FT                   /db_xref="GeneID:3658319"
FT                   /translation="MALAQSCRHFAATTYRQSKITDRFQLLITKKEIECDYVAVDATAL
FT                   VATGLRLAKNVTTEQRRHKEVARHVVQSIQQLLKKVRCKKSLLIAMDGAENLLKADRTR
FT                   GSSLTRKVESRLMRLPGTPLMQAVEERIVRMMPERQILPGEVVFAGTCVQGCVEQKMSA
FT                   WALDLASRDTFNGSSDSLNLIGASELYLNVLALSPFYNVSSVVQNNADLRHIRLQDILE
FT                   WLELDKKAKEGESVTIAKMRTDILFLFIIANGASATELNPIPAVGFHEIVDRYMKVLAE
FT                   NGATPPSQSATASAPTASANVPAAPAFLFEDSPGNTLQLNLRMLCRIMQLVARKEAPAR
FT                   VDGLSEAYLEHALQTHAMLCTGQAPQCTYLPAAGTGQLGSTAPSAVQLAGHLAALCAST
FT                   AQRNARCTSLQPSLVTPEKGSCEEDSSATKLPPTPPTSAVAPVEDKPLTAAEYTILCQS
FT                   LPAAVEGLIHQYVGVAPKPDVGKMITTATTEEAYRLVREVLSYANPLRPHKCLCLSPSY
FT                   CWLQNEKTQLWRFEYVDIGVKSHELGTRRQLNAMKGVTLEVNMSRDGPSHFDPLSGTWE
FT                   PIANFPCGAECEYDKHTEECTSSPSAPQTAKEVEGGPVKASLKLLTWNVMFDRYSGKPT
FT                   PLGMPGIDWCSPKRYPVIAKIIEEEDADVVGMQEVEPVFWEFLSKRPLIRQRYYFSCGH
FT                   MSPAIAPWGVLMLIHRRRLPVQSINYLNVPAWTNHVSLMPVVGLKMVHGTVHIAAAHLL
FT                   APYTKSHENARTSQDTALRHHMTKTLGGGDVVTMGDFNDWPTNEFIMPHESQYVDCWPV
FT                   LHPNNPGKTMDETNTFCKLKVEEMFFGRSDKVFLRSRRLVPVEAHLVGTRSVNDENNNA
FT                   DAPAYLFPSDHYGVSITFSLKLP"
FT                   /protein_id="XP_845731.1"
FT   gene            <275408..>276490
FT                   /note="synonym: Tb07.27M11.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658318"
FT                   /locus_tag="Tb927.7.1080"
FT   mRNA            <275408..>276490
FT                   /db_xref="GI:72390875"
FT                   /db_xref="GeneID:3658318"
FT                   /locus_tag="Tb927.7.1080"
FT                   /transcript_id="XM_840639.1"
FT   CDS_pept        275408..276490
FT                   /locus_tag="Tb927.7.1080"
FT                   /gene_family="HOG000257977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390876"
FT                   /db_xref="GeneID:3658318"
FT                   /translation="MMQRCGTSLSRLCFRRLLRTPLLVYSIPPIRDVPSGIAHCPLSCS
FT                   MRMVTSSNDDEFVFDPTLSIQKDAAIHTAKKSFETIVLEYVPAHAPEEARQKVKSYLTQ
FT                   HPIDILITQPKVQITHLEDAESGAETKVSLSPCDLPEALQQARERGMNLVQMGARGDVA
FT                   YCRIRRESARILSLIHTELEALREQEEKQQGKGRGGVQAAAKMGELIDHTFRDAVDAHF
FT                   VGWRSKKIVEDIRRRHPVKLTIKEFQSPECAIGKLREMCQAMQHYAQEKVIYHHFTSIV
FT                   ANDREASITFAPALPMAKSDSWKHIKYPGEKEWTNALRRMEDACRKSGRYGTYAKSNKL
FT                   KLRSLGQTSYRVDKYGRKMD"
FT                   /protein_id="XP_845732.1"
FT   repeat_region   276543..276566
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atggtg"
FT                   /rpt_type="tandem"
FT   gene            <277748..>282373
FT                   /note="synonym: Tb07.27M11.170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658315"
FT                   /locus_tag="Tb927.7.1090"
FT   mRNA            <277748..>282373
FT                   /db_xref="GI:72390877"
FT                   /db_xref="GeneID:3658315"
FT                   /locus_tag="Tb927.7.1090"
FT                   /transcript_id="XM_840640.1"
FT   CDS_pept        277748..282373
FT                   /locus_tag="Tb927.7.1090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to DNA repair protein RAD5.
FT                   (Swiss-Prot:P32849) {Saccharomyces cerevisiae}"
FT                   /db_xref="GI:72390878"
FT                   /db_xref="GeneID:3658315"
FT                   /translation="MVGNGNDTVLTDGDDDECIAEQEDKVTKALQARLRCGMQRFATSA
FT                   TNQGGLVKPSGPPSSVAAAAQRSTTTKRDNLTNSRRQEIFVEHVKHFMRYTVIADKARK
FT                   LVSLEERPKEDPDVGNDRVELLRIHVSLPCVWRYILHEWERVEEASKKSSSLAASRDAS
FT                   VSRLVSLFMKCLNSLDGIHALLFIACAACRALDLTGGVTSVLLHLLLETGRVEEDRLLK
FT                   SDSGELVYKAIEEIDKEMHSRFGGSDCCYFQTHSYLLLLIWYTQRDVSDNGGPLKMSHQ
FT                   VVLSQAFVKATSPYQTARTRRGSKAAASVAPSEESGKRKPRGRRCAGSSEDGAALSGFD
FT                   RHATLVTEVQEHETRWAEDSSKFLFSLYALQNASGSASYGMKKLALREVMGAVFLFHRV
FT                   LSESGVNDFLLESKESRIRELHEWSLSKGFVTPPLTHGGESSNNGTTVNSFASTDVGED
FT                   GLNVMSMAGRTYRECTDVERSFPRVANARAMLQHVTQIAAANYRGNTRAVGEGFPHEYI
FT                   RARLHPHQVESLAYMLERETRGLAQYVELRGFFEATSGLPSEVADRSAGRGSREFSLFY
FT                   SSMSSEWFIVRSDSLSARFARRALHCGFLCDEMGLGKTLVVLSLCATAKKRAIELEETE
FT                   VPTVTTLGTVKGSNVGAVNKAFAESDAGTAGAGEDEPIYLWRHIRVRKTGAPWSDMLEV
FT                   LYGSLPQPVYLPTPKPLPKTTLVVVPLSLLIQWVSEIDRFYPLARYILFHGPSRQRYTY
FT                   EDFCSADFVITTYETVGAHLRVETDAAFRLLTMTLPYMEHKDASLAQWDTFCRGCNERR
FT                   ARAASASQGVNDCDGSADVFDSILSLFESARRQVVLEAEGAPPGPTLDFVSQWDKTFRE
FT                   FLRSDVLYLTDFVFERIILDESQKCSKTSRLQYLQARRRWVVSGTPINNNDVNSLQPLF
FT                   KFLWAELSPSYSVSPLSAFYCSSYDKQRHMISALNAFRSSRKMARYAINSFYVGRHSKS
FT                   SPSDTRHVLTQPAIRKPLCMCRLCNPFTKQTVYPKSPVLTLKDALYRRVTSAASEEETE
FT                   GFISDRGGLFRSWRFSVPLTHLMVRHEKTEELQRALQLSPVTEAHVEVPLLDGERFLYD
FT                   YAGDVVARGVALLQRQGLVGNCSAKLLSWVCLLGRMALHPSTAFADVRNSDQALYVQSH
FT                   QKNEQVASNFLSSVVSVTPNDALAYARKLIANRLNTTGTRKGRGETNVLVPPETTVETL
FT                   RKLTLDPPEVPECAICLDTMLHPTLLSCFHLFCKECLFATIQVARPTLSNETTARCPHC
FT                   RNPKSMREKMMVIQVENTQVSTLGALQDEGMAPPNGENVSHEELKRRVDAVGRGSRIPR
FT                   LIQLLEDIWDEAPDDNVLVFSKVPAILQMGEAALKEAGYQNVHVIDNHVTLVQRKKIFA
FT                   QLHANAATTASATGSASGSTPSGNNRGHVLFLSSRVACSGLNLVFANRLIFMEPNLNPA
FT                   QHQQAVGRIDRCGQLKRTYVYVMYAPRTIEERIMNRTSALLQEASQGTFPDVATGRGAP
FT                   AGNTSSMGQSELITLLQAQQA"
FT                   /protein_id="XP_845733.1"
FT   misc_feature    282481..282511
FT                   /note="AT_rich"
FT   misc_feature    282708..282730
FT                   /note="AT_rich"
FT   repeat_region   282851..282887
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    283436..283499
FT                   /note="A-rich"
FT   misc_feature    284495..284522
FT                   /note="AT_rich"
FT   repeat_region   285260..285282
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <285391..>287604
FT                   /note="synonym: Tb07.27M11.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658322"
FT                   /locus_tag="Tb927.7.1100"
FT   mRNA            <285391..>287604
FT                   /db_xref="GI:72390879"
FT                   /db_xref="GeneID:3658322"
FT                   /locus_tag="Tb927.7.1100"
FT                   /transcript_id="XM_840641.1"
FT   CDS_pept        285391..287604
FT                   /locus_tag="Tb927.7.1100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390880"
FT                   /db_xref="GeneID:3658322"
FT                   /translation="MNTTGEPAKAAAPPAVRRRGRGTFNRPLRAEEPTAPNATASHAGD
FT                   NVSVITTVTTAVLPASTGPSTRVPEEDLAAEYGGQKRDIPLNIRENFGVHEEEQVVDTV
FT                   RQLLFRGEKRRRYCVIVGNLQNPDRPITLKLFGHKGLKPFKLQNKLIRLVNISVSRPRL
FT                   IKQTDASKEEQEVWSGGGSDDEVIADAQADTVTKTENDFDNQGSCDHGQQQKWRKEEQE
FT                   GTPKRDYESEIQRAHERRNPGGDGGVKDGEESQPTIRMSGSEVEKNGSGDMDVKANERP
FT                   PSQSGEGRDQGWEEKTMDTETRDVDDYANEDVVLPLTVEIRDSTATNIGQPSSIANSPV
FT                   LTAARFDTLYGYFFREFQHLLQLEDVRMHQVSINLSLGAVYCCLAREGSYITPLKYATF
FT                   SEFVQRMNEESMQLYFLKDAPICVSRAVDRECGALQSEAAFSLVKIYFFSNERQSRTVA
FT                   RAMWDAHENRFVLLDMENMGVTFTWTVFSVDETDIQNNRKKHQGEGVSNDSGIPDGDSA
FT                   TETDKPMRKKTVAFPFELELRAYRRWKQHTEHPVAPIAEAILDKLSLAEHNLIQYGSTI
FT                   GYENMDLSKVCDADAESEDFNVESIIVEHTSRVKPRGTDLTVDSTSSLWIENFAAARAL
FT                   RERMAKGLVGNEERSNVKTRHGERSGRKGAPVPNVKPVTPASRLTFFRSRGSTVHWKLR
FT                   PGYSTEENLSPLSEALHFVQQVLKTANEIEGRSARGGVAPEPL"
FT                   /protein_id="XP_845734.1"
FT   misc_feature    287968..287988
FT                   /note="AT_rich"
FT   gene            <288012..>289067
FT                   /note="synonym: Tb07.27M11.260; asparagine synthetase a,
FT                   putative"
FT                   /db_xref="GeneID:3658321"
FT                   /locus_tag="Tb927.7.1110"
FT   mRNA            <288012..>289067
FT                   /db_xref="GI:72390881"
FT                   /db_xref="GeneID:3658321"
FT                   /locus_tag="Tb927.7.1110"
FT                   /transcript_id="XM_840642.1"
FT   CDS_pept        288012..289067
FT                   /locus_tag="Tb927.7.1110"
FT                   /gene_family="HOG000284502" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="asparagine synthetase a, putative"
FT                   /EC_number="6.3.1.1"
FT                   /note="go_function: aspartate-ammonia ligase activity [goid
FT                   0004071]; go_process: asparagine biosynthesis [goid
FT                   0006529]"
FT                   /db_xref="GI:72390882"
FT                   /db_xref="GeneID:3658321"
FT                   /translation="MGDDGYSSYVLLQEQILTVKRSFSEALEKELNLVEVRAPILFRVG
FT                   DGTQDNLSGFEKAVQVPVKAIPNASFEVVHSLAKWKRRTLANYKFAPGHGLYTHMTALR
FT                   VDDVLDNIHSVVVDQWDWEMVMKDDQRNLAFLKEVVCKVYAAIRKTELAVCEKYKQKPI
FT                   LPETIQFVHAEHLLLAYPNLTAKEREREIAREYGAVFLIGIGAVLSSGDRHDARAPDYD
FT                   DWTSPVEASQVVFPRTSKPIPTMNSLSSLKGLNGDILLYNPTLDDSLEVSSMGIRVNAE
FT                   ALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVGGGIGQSRMVMFMLRKKHIGEVQCSVW
FT                   PEEIRKKHNLL"
FT                   /protein_id="XP_845735.1"
FT   misc_feature    289705..289727
FT                   /note="AT_rich"
FT   gene            <290302..>290802
FT                   /note="synonym: Tb07.27M11.270; trypanothione/tryparedoxin
FT                   dependent peroxidase 1, cytosolic"
FT                   /db_xref="GeneID:3658323"
FT                   /locus_tag="Tb927.7.1120"
FT   mRNA            <290302..>290802
FT                   /db_xref="GI:72390883"
FT                   /db_xref="GeneID:3658323"
FT                   /locus_tag="Tb927.7.1120"
FT                   /transcript_id="XM_840643.1"
FT   CDS_pept        290302..290802
FT                   /locus_tag="Tb927.7.1120"
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trypanothione/tryparedoxin dependent peroxidase
FT                   1, cytosolic"
FT                   /EC_number="1.11.1.9"
FT                   /note="identical to GB:CAC83347.1:  glutathione
FT                   peroxidase-like protein gpx1 {Trypanosoma brucei} (PMID:
FT                   12466271); go_component: cytosol [goid 0005829];
FT                   go_function: glutathione peroxidase activity [goid
FT                   0004602]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:72390884"
FT                   /db_xref="GeneID:3658323"
FT                   /translation="MSTIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGGYET
FT                   ATALYNKYKSQGFTVLVFPCNEFGGQEAGNEEEIKEFVCTKFKAEFPIMAKINVNGENA
FT                   HPLYEYMKKTKPGILATKAIKWNFTSFLIDRDGVPVERFSPGASVKDIEEKLIPLLEST
FT                   QSA"
FT                   /protein_id="XP_845736.1"
FT   gene            <291229..>291738
FT                   /note="synonym: Tb07.27M11.280; trypanothione/tryparedoxin
FT                   dependent peroxidase 2"
FT                   /db_xref="GeneID:3658317"
FT                   /locus_tag="Tb927.7.1130"
FT   mRNA            <291229..>291738
FT                   /db_xref="GI:72390885"
FT                   /db_xref="GeneID:3658317"
FT                   /locus_tag="Tb927.7.1130"
FT                   /transcript_id="XM_840644.1"
FT   CDS_pept        291229..291738
FT                   /locus_tag="Tb927.7.1130"
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trypanothione/tryparedoxin dependent peroxidase
FT                   2"
FT                   /EC_number="1.11.1.9"
FT                   /note="identical to GB:CAC83348.1:  glutathione
FT                   peroxidase-like protein gpx2 {Trypanosoma brucei} (PMID:
FT                   12466271)."
FT                   /db_xref="GI:72390886"
FT                   /db_xref="GeneID:3658317"
FT                   /translation="MSAASSIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGG
FT                   YETATTLYNKYKSQGFTVLAFPCNQFGGQEPGTEEEIKEFVCTKFKAEFPIMAKINVNG
FT                   ENAHPLYEYMKKTKPGILKTKAIKWNFTSFLIDRDGVPVERFSPGASVKDIEKKLIPLL
FT                   ESTQSA"
FT                   /protein_id="XP_845737.1"
FT   gene            <292140..>292670
FT                   /note="synonym: Tb07.27M11.290; trypanothione/tryparedoxin
FT                   dependent peroxidase 3"
FT                   /db_xref="GeneID:3658326"
FT                   /locus_tag="Tb927.7.1140"
FT   mRNA            <292140..>292670
FT                   /db_xref="GI:72390887"
FT                   /db_xref="GeneID:3658326"
FT                   /locus_tag="Tb927.7.1140"
FT                   /transcript_id="XM_840645.1"
FT   CDS_pept        292140..292670
FT                   /locus_tag="Tb927.7.1140"
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trypanothione/tryparedoxin dependent peroxidase
FT                   3"
FT                   /EC_number="1.11.1.9"
FT                   /note="identical to GB:CAC83349.1:  glutathione
FT                   peroxidase-like protein gpx3 {Trypanosoma brucei} (PMID:
FT                   12466271).   similar to Probable phospholipid hydroperoxide
FT                   glutathione peroxidase(EC 1.11.1.9) (PHGPx).
FT                   (Swiss-Prot:O24031) [Lycopersicon esculentum];
FT                   go_component: mitochondrion [goid 0005739]; go_component:
FT                   glycosome [goid 0020015]; go_function: thiol peroxidase
FT                   activity [goid 0009031]; go_process: response to oxidative
FT                   stress [goid 0006979]"
FT                   /db_xref="GI:72390888"
FT                   /db_xref="GeneID:3658326"
FT                   /translation="MLRSSRKKMSAASSIFDFEVLDADHKPYNLVQHKGSPLLIYNVAS
FT                   KCGYTKGGYETATALYNKYKSQGFTVLAFPCNQFGGQEPGTEEEIKEFVCTKFKAEFPI
FT                   MAKINVNGENAHPLYEYMKKTKPGILATKAIKWNFTSFLIDRDGVPVERFSPGASVKDI
FT                   EEKLIPLLGSARL"
FT                   /protein_id="XP_845738.1"
FT   gene            <293924..>297862
FT                   /note="synonym: Tb07.27M11.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658328"
FT                   /locus_tag="Tb927.7.1150"
FT   mRNA            <293924..>297862
FT                   /db_xref="GI:72390889"
FT                   /db_xref="GeneID:3658328"
FT                   /locus_tag="Tb927.7.1150"
FT                   /transcript_id="XM_840646.1"
FT   CDS_pept        293924..297862
FT                   /locus_tag="Tb927.7.1150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390890"
FT                   /db_xref="GeneID:3658328"
FT                   /translation="MRGSNRAQLSALFSIVSAATHPGVRAGRIPCVTQVTAPNDATAPS
FT                   ATALRPEKSHLTWQEALCEMEGLHEMSVPVRSAVALHEFLTSEAKKLGCDAAQRGELRR
FT                   RAGVFCAKDNARPPRWSSGVFAGDDSRVNGRKLKDVLVEEMEGCRAWATECIQKMGSAA
FT                   GIDQTRCALKPVGGAGEPFEEICGAVACFAGEESGVVESFALASVLLNHLRPMRRCLVE
FT                   LARDAWEEALNVCEQFLNSDDAISSALGAELFRCVASVAPSNSRVKLLSLYVHQRRNQL
FT                   LSNLKDLPNLFRFCSLRCFDEEELLNWRRKLREQMQAMLDIIREMDALDVERAQEFKRA
FT                   CSLGRRAAVNMVPAGGYSQEHHGSHSNRFSFSSPASLSRNMEKRGCGVECEEGKKSVQV
FT                   REISAKGAEYVKGNVEGLDNTSRSGNRFTSSEMAVVSSCWQRTALETWRKQRGSAIRML
FT                   CSQDGKEAKEGGQGKQFRVELGHHEACRADVAEGPHRTPLSRLRATISGGCKDYSDLLT
FT                   ALCSWVRENRRDLNETCYMTFVLEIVVFIFVCELRPSVGVAALSQLTSLLVQFRKEQVV
FT                   NNSVNLFTEPLTVGLAAAALRTSMEAARRGTVRGGIAIDPEDVGNSPFLKDVAALLFEV
FT                   RLPHMLRQTVSILRDGYFTSPLETIGAPPPLGFSNEFYQHTGVIAVLVRMAACRNMRPT
FT                   VSPDFPTVPIQPVAFLIELTEVVGESAILMLREIPLRRKKPIPGVLNEALWGLFVPFAA
FT                   WLLHNGESLAGELPVDGVRRLLKLCEAVVADLAARWNYSVVPTRRRWISMEKPVVSLFT
FT                   QEYVADEVTRRKVVSFASLLEGILSAALRFFPNIFSEARGFSRVCSAVAIILHDVDTHT
FT                   AHQIMEFLLRLSPPPEQMDCSAHHAVVRCLSAMRHGCTLWMQAVHHYTQTLRTIIRDEE
FT                   DASVTASKRSRVSADVSTSLVLRCVGSSNAPRAVRCMLTLRIAALASAAGISLNAQSLV
FT                   SCMHNFVMRRSQPNGIFNGVPWCDVLGWHSNLMTRARRASWAMRDVQFLHAACLQALLA
FT                   QGEWPEALLLLPRVEIPFASDYCREGSKTGTRGFKSCVMSLLALCASDRTRSCRDTAAT
FT                   LIEMVRRRTSEREMCPTWDGTVTKLCQIACVEPPIYRGRDEKSRTPLFRDCAPSFPQPA
FT                   PDAEGELLIRLGSTALSYNHPRYSHEALVKRLEARVARLRSEVAVTLAITCTGTEEPQR
FT                   GHEGEKHCRPSLIRVCERTSVGLHRSRVVWSQNTLMREETDPSHARVHDEAARSLLDTR
FT                   LASVMVPLRRLERIRAEKHHRHDGGKKW"
FT                   /protein_id="XP_845739.1"
FT   gene            <298178..>298570
FT                   /note="synonym: Tb07.27M11.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658324"
FT                   /locus_tag="Tb927.7.1160"
FT   mRNA            <298178..>298570
FT                   /db_xref="GI:72390891"
FT                   /db_xref="GeneID:3658324"
FT                   /locus_tag="Tb927.7.1160"
FT                   /transcript_id="XM_840647.1"
FT   CDS_pept        298178..298570
FT                   /locus_tag="Tb927.7.1160"
FT                   /gene_family="HOG000257975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390892"
FT                   /db_xref="GeneID:3658324"
FT                   /translation="MLCRSPCCAAPVFCRIVDIMRQREPYARPGILYPIRVELGDRVDK
FT                   CTPHELQELIDTMLARSQRYGTVKTGTVYNVNQSVATEIRAYGRYVVTGNMRGGYIKGD
FT                   HRYGPRLTGYSGATTKPGLKWNGEDL"
FT                   /protein_id="XP_845740.1"
FT   gene            <298948..>299427
FT                   /note="synonym: Tb07.27M11.320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658325"
FT                   /locus_tag="Tb927.7.1170"
FT   mRNA            <298948..>299427
FT                   /db_xref="GI:72390893"
FT                   /db_xref="GeneID:3658325"
FT                   /locus_tag="Tb927.7.1170"
FT                   /transcript_id="XM_840648.1"
FT   CDS_pept        298948..299427
FT                   /locus_tag="Tb927.7.1170"
FT                   /gene_family="HOG000257974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar along 111aa to RNA-binding protein 8A (RNA
FT                   binding motif protein 8A)(Ribonucleoprotein RBM8A)
FT                   (RNA-binding protein Y14) (Binder of OVCA1-1) (BOV-1).
FT                   (Swiss-Prot:Q9Y5S9) [Homo sapiens]; go_function: RNA
FT                   binding [goid 0003723]; go_process: RNA processing [goid
FT                   0006396]"
FT                   /db_xref="GI:72390894"
FT                   /db_xref="GeneID:3658325"
FT                   /translation="MITEGAATPCAEVPAIRRVRRTRSRFERLVRPEDVAPGEPTPSVE
FT                   GWVLFLTNLPPNTTMDHITDLFVTREGEGLWNVREVKMPLDKNCECCGYALVELEKREA
FT                   FEAALRDMEGMTLSFAEGEPPNGEDAWRLHIAPTFLGEKDDEEEELVAGGKRERE"
FT                   /protein_id="XP_845741.1"
FT   gene            300549..300619
FT                   /db_xref="GeneID:3658327"
FT                   /locus_tag="Tb927.7.1175"
FT   tRNA            300549..300619
FT                   /db_xref="GeneID:3658327"
FT                   /locus_tag="Tb927.7.1175"
FT                   /product="tRNA-Gly"
FT   gene            <300938..>301450
FT                   /note="synonym: Tb07.27M11.330; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3658329"
FT                   /locus_tag="Tb927.7.1180"
FT   mRNA            <300938..>301450
FT                   /db_xref="GI:72390895"
FT                   /db_xref="GeneID:3658329"
FT                   /locus_tag="Tb927.7.1180"
FT                   /transcript_id="XM_840649.1"
FT   CDS_pept        300938..301450
FT                   /locus_tag="Tb927.7.1180"
FT                   /gene_family="HOG000257972" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="similar to Glycine-rich RNA-binding protein 10.
FT                   (Swiss-Prot:Q05966) {Brassica napus}; go_function: RNA
FT                   binding [goid 0003723]; go_process: RNA processing [goid
FT                   0006396]"
FT                   /db_xref="GI:72390896"
FT                   /db_xref="GeneID:3658329"
FT                   /translation="MQRYKEGRSGAYTETYHKLLGKSPWIVIRNIEHPGGPNKRNREKV
FT                   AAGGNDLNANDDECCSTSLSEGDIATVFSQFGEVIDVRLVRHQRTGRFLGTAFVKFEDY
FT                   RSAILAADEMNSNHEKGKEVSLTTTGRAPSQRGIEVARCEEVEVCALPSGAESYAEWLS
FT                   RVVLEAR"
FT                   /protein_id="XP_845742.1"
FT   repeat_region   301823..301855
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <302109..>305567
FT                   /note="synonym: Tb07.27M11.350; regulator of chromosome
FT                   condensation, putative"
FT                   /db_xref="GeneID:3658330"
FT                   /locus_tag="Tb927.7.1190"
FT   mRNA            <302109..>305567
FT                   /db_xref="GI:72390897"
FT                   /db_xref="GeneID:3658330"
FT                   /locus_tag="Tb927.7.1190"
FT                   /transcript_id="XM_840650.1"
FT   CDS_pept        302109..305567
FT                   /locus_tag="Tb927.7.1190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulator of chromosome condensation, putative"
FT                   /note="similar to Regulator of chromosome condensation
FT                   (Swiss-Prot:P25183) [Xenopus laevis] and to Regulator of
FT                   chromosome condensation (Cell cycle regulatory protein).
FT                   (Swiss-Prot:P18754) [Homo sapiens]; go_component: nucleus
FT                   [goid 0005634]; go_function: Ran guanyl-nucleotide exchange
FT                   factor activity [goid 0005087]; go_process: regulation of
FT                   gene expression, epigenetic [goid 0040029]"
FT                   /db_xref="GI:72390898"
FT                   /db_xref="GeneID:3658330"
FT                   /translation="MRPLVERFLRGDNSVLSQILMRVESQGDPTFGDSSERLYNRLIEM
FT                   LVHEGRRASGSARGSPSNKENCFVAIRVFNIIFERAGVDAPVLRRCLTESGSNNARMMN
FT                   LDHYFSQQGHMNMHVARFALTLTKIYRISVETLLTAAPNIVHVERLAGSRENSNAQSSA
FT                   SSHDDNVSPMRGTFSAARSNLRGEGRSVSNPRAGRGADGARVELFQAVGNSNRHWRELP
FT                   DAPSFVPFSVNPLYSENVGASNHTWMPPQFPTPVLLFSRHFGAGCEAKLPIMGAITAQQ
FT                   TGEQLDAEDAIASPTPERVGDGGEAVEEVVAGEKPPDLLLSRYLAKGAVLTWGNIASVK
FT                   TGKKLQLASPSDGESPPQGSYTLSPTRLAIPVPVVSFSCGAYSCYFVTMERKILSCGND
FT                   DWGQLGAGKSKDSQPPGAVKGSEGKYRLYRVPLRSGDQICKLAAGSAFAVAIGLRSRRM
FT                   YLWGQNSFGQCLVHEGMTVRTPVLVDIPGQYTEVVDVACGGFYAALSFTCGSVGTWGLS
FT                   TMLATNVSPDQLRDADAPNNQKCAKTINLFKPLNEKVVALRAGPCHCLAITSSGAVYSW
FT                   GVERNGRLGHGSGKNEEKMRLIDALSNQVVTDASCGSFHTAVLTKQGQIFVFGENTYGQ
FT                   LGLPTRQPRLLPEILPLPKRAISVSCGREHTCILLEDGDVMACGSLRCSGVGVGFGSRF
FT                   VAPRRAVQNYLILTLASGDLHVLAAGLLRTMALTVVQTPPESPILDDLPKVNEVARRHG
FT                   LRGVSAGNGFTIILAETGEAFSIGQGENGQLGMGDTSLSQKTALRKVVVPDFEELCAVE
FT                   CGFNFAIAIGSSGALYSWGWNTHGQLGHGVAVNLGEAVFTPKEISALKSLAQVVQVACG
FT                   GTFVIALTQCGEVYSWGETLYCGHGTGGERCLTNPKRIAALQDIAAVAAGDRHAAAVSY
FT                   DHVIYAWGRGPVGDGGSPSTVVPVPVAVKFAHPVRQLVCCQVNTFIITDVGDLYVWGLN
FT                   NNGQCGALQSMINSDHSTSTLRQKGDEDGGMKSDQQPLLFPTFVASGVREAAFTKMCGV
FT                   YVKEDGSSYVCGRVRQNGRDVTLKSFTQQWVGRPPSERDGETGAASPSSYFVRCFHGYD
FT                   SIFQLVERKRQTPASLKTTRQNLSAFVRGSKEKAFYQRNNQNREK"
FT                   /protein_id="XP_845743.1"
FT   gene            <306951..>308273
FT                   /note="synonym: Tb07.27M11.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658331"
FT                   /locus_tag="Tb927.7.1200"
FT   mRNA            <306951..>308273
FT                   /db_xref="GI:72390899"
FT                   /db_xref="GeneID:3658331"
FT                   /locus_tag="Tb927.7.1200"
FT                   /transcript_id="XM_840651.1"
FT   CDS_pept        306951..308273
FT                   /locus_tag="Tb927.7.1200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390900"
FT                   /db_xref="GeneID:3658331"
FT                   /translation="MSVTCCAYRRILKHLQRSAVRYGKQEEICFAVFGRALNMNDFAAA
FT                   GYGETAQQVARSMFSRPSISGISCDEPAQRLVGAFDMLRRFAEVTTATGSSKVERSMDE
FT                   TERSQNEPKEPKGSGTTTSSGIRRAVVMDSVKVVGETSKPVSPGVEEDQANGGKGCENG
FT                   IEDDEDQVTDGFHVGEGSVYIESSVSQKVRKISRRVLVCLDLFKIPPYRHMMPPEPLYP
FT                   TNIRVRFKFPLMRDAMLCMAASVGKGNINGTLERKRILNEEDYGVVCNVIPTRTITVTD
FT                   HLEVELRTEYVLSRTYNSAEDDDEHMKVHPVEGDCESIVSGDDSGTNIQHIFRYFVFIR
FT                   NYGPEKNEKKWHAQLLSRHLVIFDEEKEAVTEVIGPGLAGNVPLLPPGGSHFYESGLSL
FT                   YGTSGVMRGTFQINTYNESGESRCIDIHIAPTRLAPKEGSK"
FT                   /protein_id="XP_845744.1"
FT   gene            <309087..>311609
FT                   /note="synonym: Tb07.27M11.390; regulator of chromosome
FT                   condensation, putative"
FT                   /db_xref="GeneID:3658333"
FT                   /locus_tag="Tb927.7.1210"
FT   mRNA            <309087..>311609
FT                   /db_xref="GI:72390901"
FT                   /db_xref="GeneID:3658333"
FT                   /locus_tag="Tb927.7.1210"
FT                   /transcript_id="XM_840652.1"
FT   CDS_pept        309087..311609
FT                   /locus_tag="Tb927.7.1210"
FT                   /gene_family="HOG000257971" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulator of chromosome condensation, putative"
FT                   /note="similar to GB:AAD08657.1:  HERC2 {Homo sapiens};
FT                   weakly similar to Regulator of chromosome condensation
FT                   (PRP20 protein) (Pheromoneresponse pathway component SRM1).
FT                   (Swiss-Prot:P21827) [Saccharomyces cerevisiae];
FT                   go_component: nucleus [goid 0005634]; go_function: Ran
FT                   guanyl-nucleotide exchange factor activity [goid 0005087];
FT                   go_process: regulation of gene expression, epigenetic [goid
FT                   0040029]"
FT                   /db_xref="GI:72390902"
FT                   /db_xref="GeneID:3658333"
FT                   /translation="MHEPREVVPLERAFLDVPDVSEDVHWLLRRFVNEDGVVLGWGLCR
FT                   NGELGTGTRNNVITPFIIGGLDKPIRIGCSSMTSVWLGVRGAVLTMGGGMWGELGVPDP
FT                   QVMPLLSCTEHGVPISTAQIDLRQFNWNEMIVDVKGGHAFFAALSSKGEVLLWGANDYA
FT                   QCTPEVRGACCATPRKRRVAAERIVEVACGNYTVLALSERGEVYGWGYTLLLGEEESTW
FT                   KTLPPNHLKRVIVDGEERGTVVQPVKIRSLSSKSISHIRMGPWHAFAFSSEGRAYSWGL
FT                   GEGGRLGHGDEENVSLPKEVKGLKSAVVEVACGSFHTCLVTSSGLAYACGDNQGGQCGV
FT                   PGEVIVTTFRQLDLPLRHKVISASCGRHHTLLLLETGEVVAYGTGLGVGVGLGHGLRMI
FT                   RGVPIMDNYISLWLTSGSCHNFSLSLPKNLSMLILGLPHRGVHSAISVIGVKEGLLTAA
FT                   LGQGFSIILNRRGVCYAMGMGGWGQLGIDLSKVRDFTHDRVPVVRHATKITSLSSSAIV
FT                   QVSAGICFSAALSDTQRVFTWGSNVYGQCGLGVSPIENPRIAEPQEIGWLADKMIVQVA
FT                   CGCFFALALSATGCVYSWGNIECCGVGDLPLPPEIPDNLVMESLGNDSTASILMPVEVP
FT                   SLSNIVAVAAGAWHAMALNAAGEIYAWGIGACGRLGYGGEDDRITPVKVLLSAFATKIG
FT                   CGPFGSYAITDEGKLYVWGANGRAQLSATGSRILLPTHVLDDVMEATLGKYFALVLTRS
FT                   REFRFSGVMEHQKGVYVSESFNDLRNIPPELSRDNLSMEGCQGVRVFAGVEHAIVLVEK
FT                   DPLPPAVVTELHYTLRDRPAQIIRRSAR"
FT                   /protein_id="XP_845745.1"
FT   misc_feature    312235..312293
FT                   /note="G-rich"
FT   repeat_region   312315..312340
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   312341..312377
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <313889..>317113
FT                   /note="synonym: Tb07.27M11.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658336"
FT                   /locus_tag="Tb927.7.1220"
FT   mRNA            <313889..>317113
FT                   /db_xref="GI:72390903"
FT                   /db_xref="GeneID:3658336"
FT                   /locus_tag="Tb927.7.1220"
FT                   /transcript_id="XM_840653.1"
FT   CDS_pept        313889..317113
FT                   /locus_tag="Tb927.7.1220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390904"
FT                   /db_xref="GeneID:3658336"
FT                   /translation="MEHQNDRCTYSVRPHGKLQEYLLELESKLRNTAALLREFGTTPKG
FT                   SDAEGSPANCTTSAAQSVGAYIEELQGEVEAYDELINERLKQIRHQADAASQVHVAYQK
FT                   MFPDHSLKPNTISPAERKPSASRGVCYDGVRRYLSHFINWDPLEFARVPGGEDEANWDP
FT                   RTSPAPRNSASLYPTEGIKGDGGDRNCGPWSHAHSTPNHQSQWSGAPCGPRGSGQQCGR
FT                   RGIKSVVDDLVVRQLQYDGVPLTTTMEMDLGCYNGLAAACEKNPTRSSHPVSVAVPQEI
FT                   RCGVLRPCSLREESVDILQMVTDAYPRTVQWIVNIVNLCISSADIPRTVMTTAEGLALL
FT                   LEADANGAIPHTQQTRESESQSSKVFFPAVSAPEAEPTPDRDMRETQETPELGDVVRLH
FT                   RSAAFLWSSQLNEEVEDGEDDELAEATSRDAGTDMAPDEEQDYLEEHEYYVGMEDLIHA
FT                   DVEADEVEEDEDDDGDGDDGRIFVNDSAGEEEDEVDEDMLEEGEDVGEEETEDDYRYLQ
FT                   QQRNAEEGDVGGGIRGRGEGGEKQGEPTASTEQNEVQLVAFVMQRLKVFLSDLVIITAL
FT                   QQLALMVSAARATMSDMTINGGEDGDTTSLTLQRAAEFALALCRHPSVAWRLAVENGFH
FT                   QSHTLGDGDPQVSGDAARPSALLLSFRHILVALGYMPLALGNEHRRACEESQVNGNSHG
FT                   GKQAQERLLWCVAPFLRLWGDNQRSYSGVGVPTDPMYGFVEDSRGTGGAAVAVPICTTP
FT                   LVWQESVLMSLLDQVGKLKQLEELLQQEGHNVKQAASSFNTTPQPESLLYRFIYPLSAP
FT                   VLRNLDDCCERGLITTFGGSPSQRTSMSESPQGTPFRLPPPQQQPTSPAAAISTQRRSI
FT                   ISGFRGMLQGWTGSRNNNRRNTDTDPAVTSGDDAQSQDPTASPKPSAPQHTVILELPHA
FT                   STILLQQDELQRRATSALLYPKENLSFHSANPVRLLNSFVVWQPMFQKTMCYCPITRRR
FT                   CIDACVHGITPEQYKEAPTSLTTGAESGFNPAQLLNCGHVISYRAMMALAERPQRLVRG
FT                   SSNGVRCPYCTMVTPLEQSLMLSCIY"
FT                   /protein_id="XP_845746.1"
FT   gene            <318350..>320872
FT                   /note="synonym: Tb07.27M11.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658337"
FT                   /locus_tag="Tb927.7.1230"
FT   mRNA            <318350..>320872
FT                   /db_xref="GI:72390905"
FT                   /db_xref="GeneID:3658337"
FT                   /locus_tag="Tb927.7.1230"
FT                   /transcript_id="XM_840654.1"
FT   CDS_pept        318350..320872
FT                   /locus_tag="Tb927.7.1230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390906"
FT                   /db_xref="GeneID:3658337"
FT                   /translation="MRPTPDQTKEQQNRFRKSLEGLSVVEKITDFLHAVCRVSNGRGSA
FT                   ILVGLPRHHRQQLVFLNNGHTKSRHVGGPEGRDEQREAECSGVLLTTSFVFPNRDEAQG
FT                   SSVTFLEQPVVGTSARHGRPIWSVQAPVCADKVFYQHVNANLPKKHNPQPPPPPPRGMY
FT                   GTHDAESRNNGPYTFADSNISSTFGYEEDGVLGFTFTVCNMKSLHCPRQSAFFSRRSSL
FT                   AGKPQRPPPSGDPFDSFTDFQSSNNSTFQAKSSERVYSPHSSISEMSVCGSFGGNANWR
FT                   SLKGISSRSPIRPLPLPLLLSNLPPVRVGDTHLIVAHINGKERRSVVVVVKSVESEYCE
FT                   YDFFDLEWEYSSGGPIFDMQGNFIGIQHQVGFSAYGIFTTAIVRDLFKSMRLGICRIPI
FT                   GDTSNDMAERSVHSGTGEDALSQLFRVEGGHSNLNVGAGDQIIPFEDFQRLHLRDTIKK
FT                   TKLSSAGDPPTSDAVWEEFHTDFNSIVLMLHAFAHAPQITKTALREMASNEYTKYLPNA
FT                   ASMGGIGILLEIIDEYANDVEIVLAAVIVLARVSLYKLNRETIYRCDGILTLLHIMDEY
FT                   SYYPSIQHWGFCCLRNVMDVDSVVRAEAVELFAQCDGIDLATEVIRLHKDERHVMRQAS
FT                   LALSCVAREHAKHAEAMVVCGIGSTLAEDMRNKAEDSFTFFGLVSLLYELLHCIASSSG
FT                   VVPSSDDPSRLLRTGKHDWDYENSLDLGVVTPRSFLVSESGKLLLQELNEGHVLQLLSD
FT                   VMESTSHETLCGDSLRLMTECAGSVFILLILTGCCEEPIVKRLYGACDRLVVKNPSEAA
FT                   LVRRSKNIMCWVAACAPLCCSKEEICLV"
FT                   /protein_id="XP_845747.1"
FT   gene            <321624..>323933
FT                   /note="synonym: Tb07.27M11.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658332"
FT                   /locus_tag="Tb927.7.1240"
FT   mRNA            <321624..>323933
FT                   /db_xref="GI:72390907"
FT                   /db_xref="GeneID:3658332"
FT                   /locus_tag="Tb927.7.1240"
FT                   /transcript_id="XM_840655.1"
FT   CDS_pept        321624..323933
FT                   /locus_tag="Tb927.7.1240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390908"
FT                   /db_xref="GeneID:3658332"
FT                   /translation="MNANGVPTGSATASPADLQQPLLGAEVSVPIKYRKYEASLTFSQS
FT                   TQRLSIKRTTRSGKTVCMVNIPTWNIVNIVTSTEALAGNGRCRRSKAAARKSEWSQASV
FT                   PPTFPQTFNPADSSQRYQPIARVESSIYPVSRADSFYSSTALPHSRTASGARGGATTYL
FT                   VYYVKKAKGQIPKISTTEFTAATSMAYQQEAHSTVQCILSAIYPRGCKKLLFFISAKSG
FT                   KGNALSIYKRAVLPVVQASRHEFQEIITTRARHAEDYVADLGNDMSDKYVVVAVGGDGM
FT                   FHELVNGLNRRRKAAACCGADAAAGGTVVGRSNGSTNDFSLVGDETEVSGSSNNGIQQK
FT                   ASQDHDAPNDWRDETTNGAATKLCTRGFAYLKANNIDFSLPVVTKLQCPQTLPLIATIP
FT                   AGSGCGMAKTFNVDNIKESVLALVHLNACSKSTMNVTGSQRECAKTQRDCDGANGVRKG
FT                   GVSRRGDQVGVKTRSGRSERSTQHNAEHVERVACMSCSFGIINDIDHGSEKLRWMGNAR
FT                   FTAYAAFLLLKGVQMYQCRLRYLPWVGKQGQQLQKIEPSDKLPNAEELPNCTYTDQCPH
FT                   CSQYKVATESASRVDCVASTLTSFPTLVNEECSVPAVEGKGKHSLPSDSNDSITQPMPS
FT                   QEEQSVDFEDDSLSWVTVEGKFLSIFISNIPNASKDAIMTPYAHLNDNSIDVAFVVEKS
FT                   RKVGRSDFVNIFTRVEKGDHVKLPFVSYVKARAIELEAIEGDIMIDGEVLPVNRVRIEP
FT                   QSRTYEIVRGLSLPGK"
FT                   /protein_id="XP_845748.1"
FT   repeat_region   323944..323973
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <325419..>326405
FT                   /note="synonym: Tb07.27M11.450; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658334"
FT                   /locus_tag="Tb927.7.1250"
FT   mRNA            <325419..>326405
FT                   /db_xref="GI:72390909"
FT                   /db_xref="GeneID:3658334"
FT                   /locus_tag="Tb927.7.1250"
FT                   /transcript_id="XM_840656.1"
FT   CDS_pept        325419..326405
FT                   /locus_tag="Tb927.7.1250"
FT                   /gene_family="HOG000137439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390910"
FT                   /db_xref="GeneID:3658334"
FT                   /translation="MQRRLQCCLMRVARLHSAALMHNTNGWLMISCRTVHITESEAQSL
FT                   VHLSEALFSDEANALGVCLPDTSLNLDGESGEGDLYTETLTTEKYMDVLVSSPTQIDTR
FT                   GNVSASSTDLMMPLTQAVQELKLCQQREDQRAISAALSTAMCALMGSSSSPSSAAAAEL
FT                   LLAGADLKAIISDGTIRHMCIEDKCMSRCDFSTLSLLSVQANRVDFSRSLFYAAAFHNC
FT                   VFRNCSFEGCVLKELRCLGDVCFDGCSFCFANISLRIPHEKPRRISVSSAATEGVGRYS
FT                   AEHAVIFNRCDFDLCDFDGCDTLPASCFTNCTNTHLAAKFSSCVRTS"
FT                   /protein_id="XP_845749.1"
FT   repeat_region   327284..327321
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <327527..>328228
FT                   /note="synonym: Tb07.27M11.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658335"
FT                   /locus_tag="Tb927.7.1260"
FT   mRNA            <327527..>328228
FT                   /db_xref="GI:72390911"
FT                   /db_xref="GeneID:3658335"
FT                   /locus_tag="Tb927.7.1260"
FT                   /transcript_id="XM_840657.1"
FT   CDS_pept        327527..328228
FT                   /locus_tag="Tb927.7.1260"
FT                   /gene_family="HOG000137438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390912"
FT                   /db_xref="GeneID:3658335"
FT                   /translation="MMESMNLEQPPRLNADPWRDMEPKVDAMLGDLLMISERFRRIVNP
FT                   TVSDADELIEAINSVGGEVETMRVALDTTIERPELFSVDAEELKRRTEKTRSWERDVAK
FT                   AIELRSKILSNREGQIQDPLESNVMTPNTWVDLDTTHIHPSAQSSHMPMNSCEATTDTS
FT                   VGVVESQALMPVGIPIREQTVKASEYSTASVEVHTVDDVDDPNNEGSLLKYVLVILLVS
FT                   SILVAISLIFF"
FT                   /protein_id="XP_845750.1"
FT   gene            <329641..>330627
FT                   /note="synonym: Tb07.27M11.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658343"
FT                   /locus_tag="Tb927.7.1270"
FT   mRNA            <329641..>330627
FT                   /db_xref="GI:72390913"
FT                   /db_xref="GeneID:3658343"
FT                   /locus_tag="Tb927.7.1270"
FT                   /transcript_id="XM_840658.1"
FT   CDS_pept        329641..330627
FT                   /locus_tag="Tb927.7.1270"
FT                   /gene_family="HOG000137439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390914"
FT                   /db_xref="GeneID:3658343"
FT                   /translation="MQRRLQCCLMRVARLHSAALMHNTNGWLMISCRTVRITESEAQSL
FT                   VHLSEALFSDEANALGVCLPDTSLNLDGESGEGDLYTETLTTEKYMDVLVSSPTQIDTR
FT                   GNVSASSTDLMMPLTQAVQELKLCQQREDQRAISAALSTAMCALMGSSSSPSSAAAAEL
FT                   LLAGADLKAIISDGTIRHMCIEDKCMSRCDFSTLSLLSVQANRVDFSRSLFYAAAFHNC
FT                   VFRNCSFEGCVLKELRCLGDVCFDGCSFCFANISLRIPHEKPRRISVSSAATEGVGRYS
FT                   AEHAVIFNRCDFDLCDFDGCDTLPASCFTNCTNTHLAAKFSSCVRTS"
FT                   /protein_id="XP_845751.1"
FT   repeat_region   331504..331540
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <331746..>332447
FT                   /note="synonym: Tb07.27M11.520; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658338"
FT                   /locus_tag="Tb927.7.1280"
FT   mRNA            <331746..>332447
FT                   /db_xref="GI:72390915"
FT                   /db_xref="GeneID:3658338"
FT                   /locus_tag="Tb927.7.1280"
FT                   /transcript_id="XM_840659.1"
FT   CDS_pept        331746..332447
FT                   /locus_tag="Tb927.7.1280"
FT                   /gene_family="HOG000137438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390916"
FT                   /db_xref="GeneID:3658338"
FT                   /translation="MMESMNLEQPPRLNADPWRDMEPKVDAMLGDLLMISERFRRIVNP
FT                   TVSDADELIEAINSVGGEVETMRVALDTTIERPELFSVDAEELKRRTEKTRSWERDVAK
FT                   AIELRSKILSNREGQIQDPLESNVMTPNTWVDLDTTHIHPSAQSSHMPMNSCEATTDTS
FT                   VGVVESQALMPVGIPIREQTVKASEYSTASVEVHTVDDVDDSRSSNSAKKTVLIIFFAS
FT                   SLLVAILVIFF"
FT                   /protein_id="XP_845752.1"
FT   repeat_region   332506..332528
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    332720..332766
FT                   /note="T-rich"
FT   gene            <333218..>333946
FT                   /note="synonym: Tb07.27M11.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658344"
FT                   /locus_tag="Tb927.7.1290"
FT   mRNA            <333218..>333946
FT                   /db_xref="GI:72390917"
FT                   /db_xref="GeneID:3658344"
FT                   /locus_tag="Tb927.7.1290"
FT                   /transcript_id="XM_840660.1"
FT   CDS_pept        333218..333946
FT                   /locus_tag="Tb927.7.1290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390918"
FT                   /db_xref="GeneID:3658344"
FT                   /translation="MFGRGCMLTFISTALLLLGVGDAADVKDGQGSVQTTSDDVSYYGR
FT                   LKLHPTLVNNPDFHNPLWHVQGGEVILSNAQHSFRVPTQVDGSFVVHGVPYGSYYLHAE
FT                   YSDHIYPTIRVDVTQKTSHGLVRPLIRTYANEAILQQLQGTGLDESAPATIPFVGIHNY
FT                   FVPREEYTVWGLLTNPMIMMMLVSMALIGMMNLVPEEERRESMREFQNLRKQFSGGGAD
FT                   EIKQPARRAVTAAGHERKHK"
FT                   /protein_id="XP_845753.1"
FT   gene            <334736..>335869
FT                   /note="synonym: Tb07.27M11.560; protein disulfide
FT                   isomerase, putative"
FT                   /db_xref="GeneID:3658342"
FT                   /locus_tag="Tb927.7.1300"
FT   mRNA            <334736..>335869
FT                   /db_xref="GI:72390919"
FT                   /db_xref="GeneID:3658342"
FT                   /locus_tag="Tb927.7.1300"
FT                   /transcript_id="XM_840661.1"
FT   CDS_pept        334736..335869
FT                   /locus_tag="Tb927.7.1300"
FT                   /gene_family="HOG000176389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein disulfide isomerase, putative"
FT                   /EC_number="5.3.4.1"
FT                   /note="similar to Protein disulfide isomerase A4 precursor
FT                   (EC 5.3.4.1) (Protein ERp-72)(ERp72) (Calcium-binding
FT                   protein 2) (CaBP2). (Swiss-Prot:P38659) [Rattus
FT                   norvegicus]; go_function: protein disulfide isomerase
FT                   activity [goid 0003756]; go_function: electron transporter
FT                   activity [goid 0005489]; go_process: electron transport
FT                   [goid 0006118]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72390920"
FT                   /db_xref="GeneID:3658342"
FT                   /translation="MTPFSCRKTSLLKAICIFAYFASAAHANEPDAALEGVVDLTSNNF
FT                   DSSVGKDVAALVEFYAPWCGHCKNLVPEFAKLGRAAAGAKDKVLIAKVDATAQKDLATR
FT                   FEVNGYPTILFFPAGSQKPEKYSEGREAKAFVSYLNNQIKGLNLFLPREHKYVMALDQS
FT                   NFDKVALDEGKDAFVLFYAPWCGHCKRLHPSFESLAKVYQNEKDLIIANVDADDKSNSE
FT                   VTKRYKVEGYPTLVFFPKGNKGNPVNYEEGRTLDDMIKFVNERTGKKRTSSGDFDKTVG
FT                   VDETVTNLMKEMAQSSKNKEERERLLAQIQQAVSPKALGEGAMHYIRIATNVLENGHEY
FT                   ISKEHERVGRLLKGSLTGPKRDSLTIRFNILSAIKGE"
FT                   /protein_id="XP_845754.1"
FT   gene            <336723..>340766
FT                   /note="synonym: Tb07.27M11.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658339"
FT                   /locus_tag="Tb927.7.1310"
FT   mRNA            <336723..>340766
FT                   /db_xref="GI:72390921"
FT                   /db_xref="GeneID:3658339"
FT                   /locus_tag="Tb927.7.1310"
FT                   /transcript_id="XM_840662.1"
FT   CDS_pept        336723..340766
FT                   /locus_tag="Tb927.7.1310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390922"
FT                   /db_xref="GeneID:3658339"
FT                   /translation="MESKRFSVGSETQLPLRFRRSYTSDAAGIAQLRKIASVAQCIPPT
FT                   AMYPWKTESEFTTLIEQSVISITAISTVIDKPVGFICLDDTPHTTLIPGDSWEVLLDDS
FT                   DGDCDKPLSIFPCNTLWVKAVLVPTSTALMSDSTNMTKEDLDLQRKLLLFGYSSEALLQ
FT                   RFLHIALDNLPSIEHLLVPCPMGQTYRVFENIGFRPRPLQPSSFNGTVLHIKSVSIVPQ
FT                   LLLRLGIVEDYDDFVVRILGGDGLITSLPEEFYLDELLKDQNSNNKVIVAEDAVTHRVA
FT                   GIMCLEASIEDQQMISRQYYTELYGKLRPMRGQRNASKGAVTSNMVRIKFFYIDPAYAL
FT                   RAKSFLPVIYKEFPFVEYVIITLPYDTEKPPFLGDFDHIPLRKYYPRNSEGYLIPPPDG
FT                   LWINCRYAADPVVATPVRSEKDITSINVFLDEPHMEFSQHQITLLREDIQRLRSGRETP
FT                   EDVEESNINSFVFSFVTYTENVGSEKQLPIVVGVASARKISVNEMYSLRANYDLDKLVN
FT                   YYSKAPRDYSETDVTLSSEEGRRKFFRNEVRGLLVRSFYVRPVYRSRISFLMRELLRHT
FT                   DCELALLLEDNASSPFTTLLHQLLRIQPRRVVEKPRPPASEPVFTPRSPERIPSKDVSP
FT                   LGCLFAATRRTLGDRKKLVHTRIIVVGAGSTGLTFLYRLLTVPYICFTNLVLISTDGMP
FT                   EHPNQQQNLWSTDRMELLEREHMGLTVGNPIRVIHGSMVDIETAQRYVVVDDSTYEPYD
FT                   YVILTTGRQFGVPLSISSLQQPVQQRQQLSRTSTPPGVLPISGSASVERLQRTLYELDR
FT                   NPENVSNIVVYGSGLDAFAIATSIINLGFSPQRMVLVSPDVTNPFVDKDAFECVVRMWS
FT                   ALGANTMHGYKISRTEYDDDGTTLTTVVLSPVPALAAPAGPGTDSNARSSVEINCSLIV
FT                   CCEDKDIDSNVLSTLNRRSIVFDGRVTVESNYLTTNPCVYATGPVAMFTRRYGTTTSFD
FT                   EFNARDVGTNLAEVILGTLGFEEFATPNLQSCTDKENELLAAHNELYSKVLDENGSRNA
FT                   NYGVDLNSLSAEKDAHEIAKQNQLKQQQKLPVYTTPVASRIRLPGKYVFFSTMRIFFDP
FT                   AQCTRLYYSCIEDNKPYVDDITASYQVATPADRGSIYKDVEQDLLVIYLNKHTRLIDAV
FT                   VYFGNGSPETHNYMCLIGLPHSLLNLIFRYNEARTDLLESDDCGSNSSMSGSKSTASNK
FT                   IDIVAQESTLNLMEYLRSPRLQVVFYDRFVEFYENLRKKMQEHEDVMKMKQSALQRMEV
FT                   TPRISAKNRAIYLEKLTEMQKDFARRVQYELIKFLHESKEYLPQIMYLPDITEHVEKNE
FT                   GRQE"
FT                   /protein_id="XP_845755.1"
FT   gene            <341451..>341753
FT                   /note="synonym: Tb07.27M11.580; 10 kDa heat shock protein,
FT                   putative"
FT                   /db_xref="GeneID:3658347"
FT                   /locus_tag="Tb927.7.1320"
FT   mRNA            <341451..>341753
FT                   /db_xref="GI:72390923"
FT                   /db_xref="GeneID:3658347"
FT                   /locus_tag="Tb927.7.1320"
FT                   /transcript_id="XM_840663.1"
FT   CDS_pept        341451..341753
FT                   /locus_tag="Tb927.7.1320"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="10 kDa heat shock protein, putative"
FT                   /note="go_component: mitochondrial matrix [goid 0005759];
FT                   go_function: unfolded protein binding [goid 0051082];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72390924"
FT                   /db_xref="GeneID:3658347"
FT                   /translation="MLRVSIPALKTLQPLGSRVLVRRTLAAKQTKAGVLIPEQVAGKVN
FT                   EGTVVAVAAATKDWTPSVKVNDTVLLPEFGGSSIKLEGEELFLYNEDSLLGVIQN"
FT                   /protein_id="XP_845756.1"
FT   misc_feature    341937..341961
FT                   /note="AT_rich"
FT   gene            <342229..>343296
FT                   /note="synonym: Tb07.27M11.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658346"
FT                   /locus_tag="Tb927.7.1330"
FT   mRNA            <342229..>343296
FT                   /db_xref="GI:72390925"
FT                   /db_xref="GeneID:3658346"
FT                   /locus_tag="Tb927.7.1330"
FT                   /transcript_id="XM_840664.1"
FT   CDS_pept        342229..343296
FT                   /locus_tag="Tb927.7.1330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390926"
FT                   /db_xref="GeneID:3658346"
FT                   /translation="MFCDAEDGAAIVSHIPISPFVPIQHNNIDVSAVNRLANFAIRFAR
FT                   EHGWCSSHPFKMSSGPKIGENKGESNELDDITVFYAGVEVELAEETPKFKREGTPASLF
FT                   LYAQLWLSHVGVSSNGLCGKLFSFKKDEEDCREFLGSFKLTGVTVSRTTRKPTPIPAPR
FT                   LEMMRSLIAKNTAASELPRVERINFSQLNERCRFASVRSHEEFACALPSHPAVAPLKVG
FT                   YRREFHLRETDFDFNRHVNQVVTITMVINTFRAALGDNTTIFPRLLDTDVHPLDGDLLI
FT                   RRLRIDYVREVPADHAAMAVMLFFQDDVSMDNVIASSTNSRKKSLTELWFIVQGIPAAE
FT                   TNPFVSAVGKVLLRC"
FT                   /protein_id="XP_845757.1"
FT   gene            <343648..>343950
FT                   /note="synonym: Tb07.27M11.610; 10 kDa heat shock protein,
FT                   putative"
FT                   /db_xref="GeneID:3658345"
FT                   /locus_tag="Tb927.7.1340"
FT   mRNA            <343648..>343950
FT                   /db_xref="GI:72390927"
FT                   /db_xref="GeneID:3658345"
FT                   /locus_tag="Tb927.7.1340"
FT                   /transcript_id="XM_840665.1"
FT   CDS_pept        343648..343950
FT                   /locus_tag="Tb927.7.1340"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="10 kDa heat shock protein, putative"
FT                   /note="go_component: mitochondrial matrix [goid 0005759];
FT                   go_function: unfolded protein binding [goid 0051082];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72390928"
FT                   /db_xref="GeneID:3658345"
FT                   /translation="MLRVSIPALKTLQPLGSRVLVRRTLAAKQTKAGVLIPEQVAGKVN
FT                   EGTVVAVAAATKDWTPSVKVNDTVLLPEFGGSSIKLEGEELFLYNEDSLLGVIQN"
FT                   /protein_id="XP_845758.1"
FT   gene            <344482..>345534
FT                   /note="synonym: Tb07.27M11.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658340"
FT                   /locus_tag="Tb927.7.1350"
FT   mRNA            <344482..>345534
FT                   /db_xref="GI:72390929"
FT                   /db_xref="GeneID:3658340"
FT                   /locus_tag="Tb927.7.1350"
FT                   /transcript_id="XM_840666.1"
FT   CDS_pept        344482..345534
FT                   /locus_tag="Tb927.7.1350"
FT                   /gene_family="HOG000257962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72390930"
FT                   /db_xref="GeneID:3658340"
FT                   /translation="MFRYRCRNAKNLLLMRNIRRWYTSAGNDESLPSAQGPPLAGVSSP
FT                   TLWRNGGVLGEGMLGNPRVAATTPQEVEETFRCSVLARTVSNLKLRRYLQKLEPKDHTL
FT                   VLAALRGAQAGGLRLDTKTNEVALSKLMDGGQLQASMEIYRKMIQNRMNPTANTYATLM
FT                   HMCIERDMPEACQKLFEEMVKRGQSPNTRNYEMYIGSLAMENPPKWKNAIEVFDRMSRE
FT                   RHGKHLTAATYESLMRVYLNMTPFDWRVVYNCYYEMRSRQPQIQLRWETYHLVAEALRR
FT                   GQAGYTRRLITYLDAWFCITYFRSWEFFMGFMFYICLMFLIKGLISWVVVWYYGRAVNA
FT                   SRGASESVIL"
FT                   /protein_id="XP_845759.1"
FT   gene            <345940..>347040
FT                   /note="synonym: Tb07.27M11.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658341"
FT                   /locus_tag="Tb927.7.1360"
FT   mRNA            <345940..>347040
FT                   /db_xref="GI:72390931"
FT                   /db_xref="GeneID:3658341"
FT                   /locus_tag="Tb927.7.1360"
FT                   /transcript_id="XM_840667.1"
FT   CDS_pept        345940..347040
FT                   /locus_tag="Tb927.7.1360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390932"
FT                   /db_xref="GeneID:3658341"
FT                   /translation="MPEQLGAEAPQHVVPEGDQSAGSEAGNVTRGTKNHDDSDPFVSLR
FT                   HMEDRKQLETQARAVVTALLAEKGEVYVQGLLQAEIQRVKKKESEAAAIKKKISAATKL
FT                   AGELKGDIRRETEAKAEEEHMCKNLQAEMKRRSTLTEEATRRMESRRLTLKKDVETSVR
FT                   DVREKYDDRKRQAMELVEENKRLTDEVAKMRKEFDEARATYADTCKERETYVESLIRSY
FT                   REVTREVETLEAKIALVRRERQASEQRKASLEKQLESYNSQFGSLSEGQSVEDAERMAK
FT                   EQREEAEARIAQLESEKKEASEIRLRLDKETATWRAALAAHKRELPRLEKAKLAAEKRC
FT                   RQAQERARQQLKEDATTTKDQEDGGM"
FT                   /protein_id="XP_845760.1"
FT   repeat_region   347725..347917
FT                   /transposon="RIME-A"
FT   gene            <350498..>352315
FT                   /note="synonym: Tb07.27M11.650; spliced leader RNA
FT                   PSE-promoter transcription factor, putative"
FT                   /db_xref="GeneID:3658348"
FT                   /locus_tag="Tb927.7.1370"
FT   mRNA            <350498..>352315
FT                   /db_xref="GI:72390933"
FT                   /db_xref="GeneID:3658348"
FT                   /locus_tag="Tb927.7.1370"
FT                   /transcript_id="XM_840668.1"
FT   CDS_pept        350498..352315
FT                   /locus_tag="Tb927.7.1370"
FT                   /gene_family="HOG000257960" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="spliced leader RNA PSE-promoter transcription
FT                   factor, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   transcription factor activity [goid 0003700]; go_process:
FT                   nuclear mRNA trans splicing, splice leader addition [goid
FT                   0045291]"
FT                   /db_xref="GI:72390934"
FT                   /db_xref="GeneID:3658348"
FT                   /translation="MRSSANFFLANSSSGGLSKYRPRFRPRRLVLPVNPSDVHSISRAN
FT                   NPMYAKYQEGIRLRRRAERRGVIALSFVPSERSVGDAFRIMVEVCEKEGFFESKSSTPN
FT                   YLRKVRELIKRAETELGTGERVKNTSANPSFYDIGLSEARDLSRNADKSRHAEGNIETR
FT                   EIDSLWSLLNATPLDSPVHGILALRGKALLESIIANTVQQQYPRLRSKHLQEIIHECCS
FT                   LLACGRAAFRLGFADVCGINGEINMWRELNVLTERFNTARHKAAAHLQRVEKGVTQQRR
FT                   WYWRGVLRSSSKRLKQFPVRQGDLLPRMEWIRESVYAFVAFVDLAEKSGDNVRVVPLIE
FT                   NLFCGQISSFVSTNQTLKKAHRMVDMLSKARIECDATTEKEKIQQLESLSTDIENELAA
FT                   LEQFTDDELGVMSRVVHPLNARSDNRKEQFSSSGGAHAVQSLRDDIFDDYRVTRHNKEA
FT                   PPMVINCMRPQNALKEAQIILRYDPNVSETLSSSPIDVDQVIRRVTEVHETNSYATLYN
FT                   FQQFRQVEYTVCRLYAGKRCIGQGKGETLMEAVNEAAQHTLLNYYLKDVSNANSREKEE
FT                   DAVTEAFSATPPELTEVRVKEATEEEVIF"
FT                   /protein_id="XP_845761.1"
FT   gene            <352592..>353047
FT                   /note="synonym: Tb07.27M11.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658354"
FT                   /locus_tag="Tb927.7.1380"
FT   mRNA            <352592..>353047
FT                   /db_xref="GI:72390935"
FT                   /db_xref="GeneID:3658354"
FT                   /locus_tag="Tb927.7.1380"
FT                   /transcript_id="XM_840669.1"
FT   CDS_pept        352592..353047
FT                   /locus_tag="Tb927.7.1380"
FT                   /gene_family="HOG000257958" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390936"
FT                   /db_xref="GeneID:3658354"
FT                   /translation="MSTMDVPGTAIEQYFNQLIQMRLLTQVIVSDTRGDTTVACLMGLE
FT                   HGGDAVVSSSEDTYGVAESIMESNVALSGARCFQNLDQLNLGVPLYVSFQYHDDVVVQT
FT                   LDGCCMLTLIGSRSQGHFVGGLLTLLDQIRSCEAYQELLTQTQLCFR"
FT                   /protein_id="XP_845762.1"
FT   gene            <353441..>353995
FT                   /note="synonym: Tb07.27M11.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658352"
FT                   /locus_tag="Tb927.7.1390"
FT   mRNA            <353441..>353995
FT                   /db_xref="GI:72390937"
FT                   /db_xref="GeneID:3658352"
FT                   /locus_tag="Tb927.7.1390"
FT                   /transcript_id="XM_840670.1"
FT   CDS_pept        353441..353995
FT                   /locus_tag="Tb927.7.1390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390938"
FT                   /db_xref="GeneID:3658352"
FT                   /translation="MTVNIVARISNLPTSITDAHLRELIEPFARVRCIIMPKSALWQTC
FT                   PTGRAEVVGATTDDTILVYVHLHGSIIDGNRVNVSFGKVAKCVQPTSSSRFAGERRERT
FT                   SRRTRSESRGARKRPKRGDRSGEYCSRGHGKRQTVRRSPTPRKTRRYSTSPSSRSSSSG
FT                   RDSWSSDRSRSRSRSPYPSWS"
FT                   /protein_id="XP_845763.1"
FT   gene            <354449..>356110
FT                   /note="synonym: Tb07.27M11.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658353"
FT                   /locus_tag="Tb927.7.1400"
FT   mRNA            <354449..>356110
FT                   /db_xref="GI:72390939"
FT                   /db_xref="GeneID:3658353"
FT                   /locus_tag="Tb927.7.1400"
FT                   /transcript_id="XM_840671.1"
FT   CDS_pept        354449..356110
FT                   /locus_tag="Tb927.7.1400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390940"
FT                   /db_xref="GeneID:3658353"
FT                   /translation="MNNANDTLDYSGNTSSTYSAAVNEEFLTPTRRTHVSVSTSHVSSS
FT                   EADFVTGSMVDDEEYYNEYTSGYESRVYTHASFTYDEFSSGSPNSDDLSSTFMSYYIDS
FT                   VIGQKTRYFFSVLRKPIVFFSLILPGSNFVGSLGRLVYAVTVSASRRTAVNYSMGVETL
FT                   CVLPKGYGHMPEHLQRARLALPSFVEYFAKMLLRLSGVPSLADLQKRKWLETVRILKSA
FT                   TGEIISQSAHRSSGPMIPLAVFLPVFSLSVITIARGVISRQQTYNEYEEDEDVAYEAAH
FT                   SGSYKGVAASRGLDALQLSGLDDSFPNLGSEKSNEVNYSGVETPKGSPPAPELFPSPKP
FT                   QGERHAPSETQTNPQTVPTSRDLSPDSSAVGDEFKLIMSPTSEDPGRAPSAASREAVRH
FT                   PKQYDLRGDVVIALTGEPSPQEVDVLLMAAAKYKCRRVILPSLVADTALASVHPLVDVV
FT                   KVSDVMEHVMSVEESEGRTTVGVFLRPVTDETEELRLFTHPTSVVYIFVPAAFLEANVI
FT                   AHLVDRSVYYSASLDEPFPINVCLYDRLTKERREGA"
FT                   /protein_id="XP_845764.1"
FT   gene            <356731..>359223
FT                   /note="synonym: Tb07.27M11.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658350"
FT                   /locus_tag="Tb927.7.1410"
FT   mRNA            <356731..>359223
FT                   /db_xref="GI:72390941"
FT                   /db_xref="GeneID:3658350"
FT                   /locus_tag="Tb927.7.1410"
FT                   /transcript_id="XM_840672.1"
FT   CDS_pept        356731..359223
FT                   /locus_tag="Tb927.7.1410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390942"
FT                   /db_xref="GeneID:3658350"
FT                   /translation="MLRPHCTERVPSCIDSGSGNVVFALHPDPFGNQVCWGSCVVTRNL
FT                   ELVFSRPSYGASRLKIPGAHEKGDTSQFFCFSCVNATKLLGVPIEPKWVMSYDLSSNSY
FT                   SEETEMSHANSVLQGLPTVAMLLMTNNAETKLLVVNPVLHVEKKEQIITYRATLLTSPD
FT                   SVQHVVMCRGGRVVLLLEQCVGGNVASQCFGLLIRDGQPHAPFKSVRLTVPGEFIASMP
FT                   AQRIICARARRPLGQTTHAMIETVDTEVTTFTDHGVVIVFRIGVSDAEPQRVTCVWVSH
FT                   LFRRSESQKKLLRPLGVVERWNTTMSFKQATGLAGTKPPLPPLGCEVPQQLQGFKTHSS
FT                   IICASSNGALILVAKPNSPDAFIACLGASVHERSSANAGVGVSLPPSLNLCDASWISGP
FT                   LCGFLLLGNDDGRKVLSLYFLPLTGESPRRVHIEQTDCEWANIENRNVRFFSLSTVVNI
FT                   FGVPQLRISLLFSQHRKRGDTQIEDWSELRTCLFSFPTVASLSSVEDPAHVSTLVYCTG
FT                   LAAFEAIPWPVGTSARTKCTDEVHGFGDVQLSTEAALESQLKRWPHLEESGIEFFCGLI
FT                   HEMIQRLTTSVQRCRFVDSGFGNRAVAALVAVFQGVAEAFVTLGVAYSSTLLKRYLCYV
FT                   HSILVILRQALTVMGQYGAISACFSAVAPFAHLDSSGSEGELQPEWRALLGALFDEALA
FT                   HTCAYPSLAQALLPHCSAGVKQIMEAGRRMEQWTHKQQETAATTLTTADRGESTQVRTL
FT                   QEVLSLVRNGAPALSMLSPADVCCASRRLFFSDGIDTVQAFLKSFVGDYWMNCPDIQAV
FT                   CKEYETVKEDMDIVLQCR"
FT                   /protein_id="XP_845765.1"
FT   gene            <359796..>364544
FT                   /note="synonym: Tb07.27M11.720; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658351"
FT                   /locus_tag="Tb927.7.1420"
FT   mRNA            <359796..>364544
FT                   /db_xref="GI:72390943"
FT                   /db_xref="GeneID:3658351"
FT                   /locus_tag="Tb927.7.1420"
FT                   /transcript_id="XM_840673.1"
FT   CDS_pept        359796..364544
FT                   /locus_tag="Tb927.7.1420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390944"
FT                   /db_xref="GeneID:3658351"
FT                   /translation="MDAINESTLMSRAAPNAPKGISVLNKSVHESMHFPPAWVSLSVGH
FT                   LDDAYSLSSKNNDVLCLAASLVMRGDTERALKMMEALIISSCVVVHERLKGLLSDDCSS
FT                   LKRMSQVLLSHVRGRAALAAALGASIDPTSEECQQAAMGACEIVDWDVIHRWFIIALLL
FT                   HDGDYKASDIVWFHHFFALPPMTTLDGSPKSATSARKRDADTLSAGFLGEGPTAMWAPM
FT                   DASQMKDILLSHCGKDEVLLISTICAWKTRRYRSVTTSATEFLALAGGDQVILDDYMSI
FT                   MVRFVLCMSLIELGERTLAGKEVAILMQHKEPFVAMVGCSIATFLLPLPECVGRITSFN
FT                   GPIPRRRYLIALCEYIHALTLLQLGSMEAAIRVIREALPYSSSHNVGEWLLDILCIACT
FT                   AIEDSKTISEWPVSVHRQLYLALAPAFFGGFNMHELKVNMKSPLGRMVYPRRTALCASI
FT                   KQMLPVYMVRANQKFAKGEYVEAWENVTLAVACAEEIIGSVEFAFTDCSPMLVYAFGCR
FT                   VGEHVIGELMSSSTSEEFSTCSVAGDTAALVQKSDMLGESVIQLCLQWARRIREFHPNA
FT                   RLGALTMSKCTTFAHTDNFLSRAMDVAHRYPGSALAQNCLTLALYGNHNIPEAADSAAN
FT                   ALQTFPHTVEVKALYGYMLKKDGLYYYNYRGLIPVHCSPCNDYKWAKRNITTLILLLIN
FT                   VVVILVTLSLNLPNVFSLSETAREIAVRVQLPTLIPISYTLVVFTYAITASFTKNNLTH
FT                   TILQDLFFDNGPLNRFVFAMRGIAFVNASNALLITIAGNNFLFTSHWYTFLFYLVLFIV
FT                   FVPFTSHLWLLPSSDQPREAMWTWLALVSIDVAATAFLLVPHVILFVIEPLMFALFFLQ
FT                   GSTYRPTQDNVSGNVKKRLVIHTAYRNVMPSRYAVTTGSGFIHLSLLKLLFYKTHSSLS
FT                   TKYLIRAQTDEENYRVFPLIEVFEPISPAPIELDEGTKYMLKSYLHYPGAATTKVERKD
FT                   GTAEGGQQGLESDSSEEEGYDDPDWGDQAPLTRSFAGGNTGGESPAVGEVIDQEALNSF
FT                   LNVGVTVLSEFGKRQGKRKSNHDMPDNPVELSDIRSQRRDSVPGGERRSRRPSAVFRQG
FT                   FSSPRDGCGDGRPNRSKSERRASFAFGDSCAASPRGADKHNRGTADDENRYLGGDCSVA
FT                   GSGGASAAQTKYSSGNTTSTFRDPVVASSSSIGSSKCTSVATGDAKGGNLTEKPSALPK
FT                   SKDKRDKKSKGNASDAPPEELQLKKSLEQLCEVCRSVSFTSLSVSDKKNLEGAKTNVHQ
FT                   SLSSLCKGVEVGPIRLKSEGCCEAVCDALFHLIAEGDVTNPLEGVRGPLAETLLQRVEL
FT                   SCLANLLVAKEIPLQCVLHGRTNILNIVMVPSCVEGMCADRWSTILTALQTDARRERVE
FT                   SLRLLFKGLKYMKGKDCLQSIKPMLQTAVTAVLIAESAHVAGEKLFALLETIKKEGRIP
FT                   IDFWEEEDSRNRTLFSHACASGNAELVDALWCTGFVKCPNKVQGDGTNGLMQAVINNQR
FT                   RVVQWFCDHAMDSTDKSFQHVHPVYGDALNIAKEVDADLHALIEAKVEELKTYQWASTT
FT                   QKR"
FT                   /protein_id="XP_845766.1"
FT   gene            <366013..>367359
FT                   /note="synonym: Tb07.27M11.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658355"
FT                   /locus_tag="Tb927.7.1430"
FT   mRNA            <366013..>367359
FT                   /db_xref="GI:72390945"
FT                   /db_xref="GeneID:3658355"
FT                   /locus_tag="Tb927.7.1430"
FT                   /transcript_id="XM_840674.1"
FT   CDS_pept        366013..367359
FT                   /locus_tag="Tb927.7.1430"
FT                   /gene_family="HOG000257954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390946"
FT                   /db_xref="GeneID:3658355"
FT                   /translation="MLADRINRICGLRGNHRHTIKPGASLATVFDNDSSQDLKIEVSWK
FT                   RLTSKDLDGICRLIAEGDAGALVKVVHLSDNDLGPQGAQKVVTAMNMSGVQDLLLCFND
FT                   VGREGCDALSNIVSISVNLRLLDLRGNGLTPRCVHKLLKAVAVSTSLKRLGLGSNKLGP
FT                   EGAALLARKLEKNTYLTSLDISLNEIGPGGAKPIAKLIEGPECVLECVQLYGNRLGPEG
FT                   VSEILAAVKKNRSIKQLTLGNNHATDAVAADLAAMLRENTSLERLDIRLNTLTAAAVRV
FT                   FAQDGLAQNSVLRSLCLAGNPLDSIGGEDISQALILSQVTVLSHLDLSSCQLGPIGGMR
FT                   IANLIGTSSTITDVNLSDNKLDDEASASLANSILNGVSISSLNLSANEIGEWSASNLIE
FT                   ATQRNFRMMSLVLHGNKINRTVQKKIDTLLEERLARKNAECQRTSSSRA"
FT                   /protein_id="XP_845767.1"
FT   gene            <367712..>369178
FT                   /note="synonym: Tb07.27M11.760; DNA polymerase sigma-like
FT                   protein"
FT                   /db_xref="GeneID:3658349"
FT                   /locus_tag="Tb927.7.1440"
FT   mRNA            <367712..>369178
FT                   /db_xref="GI:72390947"
FT                   /db_xref="GeneID:3658349"
FT                   /locus_tag="Tb927.7.1440"
FT                   /transcript_id="XM_840675.1"
FT   CDS_pept        367712..369178
FT                   /locus_tag="Tb927.7.1440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase sigma-like protein"
FT                   /note="go_function: nucleic acid binding [goid 0003676];
FT                   go_process: DNA metabolism [goid 0006259]"
FT                   /db_xref="GI:72390948"
FT                   /db_xref="GeneID:3658349"
FT                   /translation="MSASDGGRSSKRSGNGWSRVKRWSANVPATYVEGTQMLTVDGAQQ
FT                   TAVVNPSWNRGYNPADCAWTREGGLKRHRTGDNNAEDRRLRHKSKMSTLCPKTEPLGSS
FT                   NMPFDSEGIHTFDEGLLSFLAAVAPDEEAHRKARLVMHDVAQTLYNVGLQVALFGSWST
FT                   GLCIPSSDMDFAAVSVIPHVAGRTNNSNMFRRNYEYGGSCGMVTESLFASLSDPPEFKR
FT                   ERQRNYSLALRTVAKSMRSSNSFCRIVCIPHARVPLVKAVHSCGKAVDVSFQSDGLKTT
FT                   AFLRDEFRREEFRRARGLIMLLKALLDKWELNDPSKNGLGSFPVSIMVLWFLREEAPKE
FT                   CTGESGNNYATQFVALLKYYGTQFDYLKEGIDYAKGCTFTKTSTELFIVNPLKPGANCA
FT                   SSATLFDSRVVPNLREAYRDLLPLLKPNVTACLIERTLGRVFGVSQKALSRGKAMWKHR
FT                   QDARAYVGGATAQHQWDELTNMYVGNPIGV"
FT                   /protein_id="XP_845768.1"
FT   gene            <369679..>370644
FT                   /note="synonym: Tb07.27M11.770; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658356"
FT                   /locus_tag="Tb927.7.1450"
FT   mRNA            <369679..>370644
FT                   /db_xref="GI:72390949"
FT                   /db_xref="GeneID:3658356"
FT                   /locus_tag="Tb927.7.1450"
FT                   /transcript_id="XM_840676.1"
FT   CDS_pept        369679..370644
FT                   /locus_tag="Tb927.7.1450"
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390950"
FT                   /db_xref="GeneID:3658356"
FT                   /translation="MFGELVCGPPGSGKTTYCEGKRQFLSVYEPTRPVVLLNLDPANED
FT                   IFPYPCDVDIREVVSHVRVMETEELGPNGSYLFCAALMERRIDWIIQKVEEAVDRRLRD
FT                   VVITGGGSVHPRPPYLIIDCPGQVEFYLGSPVMHTLFRALQKRLCCTLCTVHLVDASVS
FT                   TRDISTYVSSCLLSITTMIDHELPHINVFSKWDTLSVEDSEEGEAYLRASSFMAEDFDR
FT                   LWKKQLRQRRRNQRLAKLYPTGAEKLDARDEPSAAARDDMEVEAIDLEKDGGHLYRYSK
FT                   AVMEVVDGYGLIGFLPLDVQSQDMMTRLTQQIDDCIGNFL"
FT                   /protein_id="XP_845769.1"
FT   gene            <371415..>374321
FT                   /note="synonym: Tb07.27M11.780; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658357"
FT                   /locus_tag="Tb927.7.1460"
FT   mRNA            <371415..>374321
FT                   /db_xref="GI:72390951"
FT                   /db_xref="GeneID:3658357"
FT                   /locus_tag="Tb927.7.1460"
FT                   /transcript_id="XM_840677.1"
FT   CDS_pept        371415..374321
FT                   /locus_tag="Tb927.7.1460"
FT                   /gene_family="HOG000257952" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390952"
FT                   /db_xref="GeneID:3658357"
FT                   /translation="MDVVLEVLRTSNNNDERKKADAQLRQMQESDPQAFLMLTWDGISS
FT                   TAVDTTTRFFLASTVVQFVEQSWQHSVPKDLQVVMINRYLHLLLCSEPLPSVTLARKVA
FT                   LLLGLMLKRCNARGEPGALPPPLEHAGKMIGESVVHAVNNLSPTLIGLATQYLLVLHVV
FT                   LKEMEGKRVGGVFPRLCASLVPVMSSVFVSSATWDYVTCYMPLLYMMKCVLRVFGSGVF
FT                   DAGFYPHLLDITWRLAHSVSVTGQPTERVERGQRLMEYAIKVQLKMLSVFPSKMDGLPP
FT                   AFFISQGNGDMEDRSLLALLVAIIESPIGTVVTEKLVCRALLTFKALLTVEDSQPFVAN
FT                   CVIALANAPQLLSRVIDRITYFLADATGDAVLRAWDLSPEHHAAELERLIDDTEHVSSC
FT                   AEELLLALTGSTHCSESSLRLTWEVANTLLDRGGVEEVTAALHVIGICCYTMADGPYSA
FT                   SFMNFLAAKLLPIITAAATSTVGDQIYPSPFVLRRVVWVVGMWCESVKGSVARSEVHRA
FT                   LTSLLRAPTHVVLQLCALQAIGHFILDLNFSIEDVPAECVQGTLCAIQNLLPQLSAPAT
FT                   IEQLAGLVQGLIARKLLHVGSGELLLDMMLPAVYRAISGAQRTPDGEADHSGGNDDGDE
FT                   ESDDDVSLQGRCIGLLLECVHSCVTIAAPELEERVWSLFRAIVLPCTEPGSRLALWADE
FT                   QAWELLLSMCCAARSWLPETNDALLFCLDNMTREISSRHIVVRCVYSILLLCPEPAKHI
FT                   SVALVDHAMAELTQTCSSDVASAYFALLAVMLRRGEVTLRCHLLSLALHKFLSIKSVHS
FT                   ESFSEQLALLLAWGFLTYGDCENWEVILLDTVAKVLLHHPNANSFVEWIVLLFDVSPGP
FT                   FVTEQLVRLLQHSLSAQHTVLLQLIGEDDRAMARKVVEGTLLPPSSMQERGADTDEAGE
FT                   LVRDPTEMLMELFGDTALIGASPHVIRLCRLFDVCTIS"
FT                   /protein_id="XP_845770.1"
FT   repeat_region   374627..374658
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   gene            <374765..>375118
FT                   /note="synonym: Tb07.27M11.800; ATPase subunit 9, putative"
FT                   /db_xref="GeneID:3658359"
FT                   /locus_tag="Tb927.7.1470"
FT   mRNA            <374765..>375118
FT                   /db_xref="GI:72390953"
FT                   /db_xref="GeneID:3658359"
FT                   /locus_tag="Tb927.7.1470"
FT                   /transcript_id="XM_840678.1"
FT   CDS_pept        374765..375118
FT                   /locus_tag="Tb927.7.1470"
FT                   /gene_family="HOG000235246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase subunit 9, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="similar to GB:AAC48310.1: ATPase subunit 9 homolog
FT                   {Trypanosoma brucei brucei} Developmentally regulated
FT                   through the life cycle of Trypanosoma brucei(PMID:9574907);
FT                   similar to ATP synthase lipid-binding protein,
FT                   mitochondrial precursor(EC 3.6.3.14) (ATP synthase
FT                   proteolipid P2) (ATPase protein 9) (ATPasesubunit C).
FT                   (Swiss-Prot:Q06055) [Homo sapiens]; 89% similar to
FT                   GB:AAC48310.1: ATPase subunit 9 homolog {Trypanosoma brucei
FT                   brucei} Developmentally regulated through the life cycle of
FT                   Trypanosoma brucei(PMID:9574907); go_component:
FT                   mitochondrion [goid 0005739]; go_component:
FT                   proton-transporting ATP synthase complex (sensu Eukaryota)
FT                   [goid 0005753]; go_component: integral to membrane [goid
FT                   0016021]; go_function: hydrogen-transporting ATPase
FT                   activity, rotational mechanism [goid 0046961]; go_process:
FT                   proton transport [goid 0015992]"
FT                   /db_xref="GI:72390954"
FT                   /db_xref="GeneID:3658359"
FT                   /translation="MMRRLAIQSSVRRTTAAITPIAVPMKVASPMCSAATRQASTVAIS
FT                   VQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIG
FT                   LFALMLAFLMLFS"
FT                   /protein_id="XP_845771.1"
FT   gene            <376109..>377317
FT                   /note="synonym: Tb07.27M11.810; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658358"
FT                   /locus_tag="Tb927.7.1480"
FT   mRNA            <376109..>377317
FT                   /db_xref="GI:72390955"
FT                   /db_xref="GeneID:3658358"
FT                   /locus_tag="Tb927.7.1480"
FT                   /transcript_id="XM_840679.1"
FT   CDS_pept        376109..377317
FT                   /locus_tag="Tb927.7.1480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390956"
FT                   /db_xref="GeneID:3658358"
FT                   /translation="MVVNEAPWLTRWIEALLVVAVFLICCTADMLKCNNGFTYKCSDNG
FT                   YRTCRREPQSSFCDDLVLPTTVMRELRRCSCEDRKFAELLLHVVEVGAPIAAGGSGGEN
FT                   IERIPLAPLLSNALRGSIGDKIVGNRSSGIFRVPVLEALRKEIGLTVDNSTPCLNSEST
FT                   FKVFHSHDSVLVPGSVNLLEEVKAAIPFDDGGKSMPGIRSALEELLKRRQQPNEPGASS
FT                   CMFAHLIFIVVGTPGRGGVWSNNESDTRHAALQLMEVQAHIRRTISRFLRGKRRYTGML
FT                   GTVWYVGVPVGFPVHNNSATDGRAAENGRTRSCDVGDGLPRCTMNCTAHTRRLTLYKSV
FT                   NGELERMVGSHGRRLSARTIILPYNDYFSTIGNLPGESQWVDCFTLSSGGVAEMARLLV
FT                   EGL"
FT                   /protein_id="XP_845772.1"
FT   gene            <377931..>378671
FT                   /note="synonym: Tb07.27M11.830; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658361"
FT                   /locus_tag="Tb927.7.1490"
FT   mRNA            <377931..>378671
FT                   /db_xref="GI:72390957"
FT                   /db_xref="GeneID:3658361"
FT                   /locus_tag="Tb927.7.1490"
FT                   /transcript_id="XM_840680.1"
FT   CDS_pept        377931..378671
FT                   /locus_tag="Tb927.7.1490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390958"
FT                   /db_xref="GeneID:3658361"
FT                   /translation="MRPCAPGVALQLVVADPWQRCARRRTSTSASTNTCKSFTSRIPFK
FT                   LRSDQVNESNIPSAREVSEMIATHEELQEQLPSAKFLESRYIKRPLHTESCGSCPATVC
FT                   GPPLWPDCDTPEEIMDEERYGGPEAMDRVPAPSAEHMLLAWRALMWGTLYAFVGVTLVV
FT                   AVAIYVSGVNGISSVLQHLRSRSERELHRLSAEGQEVHHFVLDLTNPVAFGRQLQEAWQ
FT                   LVQDIANKQEEGEESIAKEIKEEL"
FT                   /protein_id="XP_845773.1"
FT   gene            <379078..>379947
FT                   /note="synonym: Tb07.27M11.840; nucleotide binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3658360"
FT                   /locus_tag="Tb927.7.1500"
FT   mRNA            <379078..>379947
FT                   /db_xref="GI:72390959"
FT                   /db_xref="GeneID:3658360"
FT                   /locus_tag="Tb927.7.1500"
FT                   /transcript_id="XM_840681.1"
FT   CDS_pept        379078..379947
FT                   /locus_tag="Tb927.7.1500"
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleotide binding protein, putative"
FT                   /note="similar to Nucleotide binding protein 2 (NBP 2).
FT                   (Swiss-Prot:Q9Y5Y2) [Homo sapiens;]; go_function:
FT                   nucleotide binding [goid 0000166]"
FT                   /db_xref="GI:72390960"
FT                   /db_xref="GeneID:3658360"
FT                   /translation="MATSLSDVNHIILVLSGKGGVGKSTVACQLALALANVHGKKVGLL
FT                   DVDICGPSVPTICGVTGKDVYRGDAGWEPVSLFHEQHEADTAASATGNVKIMSIAFLLP
FT                   SENDAVVWRGPKKDAMIRQFVTDVHWGALDYLIIDTPPGTSDEHLTLCEVLKPFNTAGA
FT                   VIVTTPQDVATDDVKKELSLCHKLELRCLGVVENMSGFVCPHCAHCTDIFSKGGGKKLA
FT                   EMYEVEFLGAIPIDPTLSLAEDKGQCFVTTATDANSPTVRKTVAAVTGVIDAILKQVEK
FT                   SAQLQQRH"
FT                   /protein_id="XP_845774.1"
FT   gene            <380494..>382350
FT                   /note="synonym: Tb07.27M11.850; pseudouridylate synthase I,
FT                   putative"
FT                   /db_xref="GeneID:3658362"
FT                   /locus_tag="Tb927.7.1510"
FT   mRNA            <380494..>382350
FT                   /db_xref="GI:72390961"
FT                   /db_xref="GeneID:3658362"
FT                   /locus_tag="Tb927.7.1510"
FT                   /transcript_id="XM_840682.1"
FT   CDS_pept        380494..382350
FT                   /locus_tag="Tb927.7.1510"
FT                   /gene_family="HOG000257949" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pseudouridylate synthase I, putative"
FT                   /EC_number="4.2.1.70"
FT                   /note="go_function: pseudouridylate synthase activity [goid
FT                   0004730]; go_process: tRNA processing [goid 0008033]"
FT                   /db_xref="GI:72390962"
FT                   /db_xref="GeneID:3658362"
FT                   /translation="MSKRKNFNTRRACLRKAPRDHTHIGLCVMYCGTAFRGLQLQAHAP
FT                   THHTVEGVLIQALKDAGIVDGVQRGRVSGEEHHFARSCRTDRGVHAVRNLVCLFVPNSK
FT                   LEAAGGCDRLPQLLNAHLPSTVRVERVTTVMGDFIPRFCCVSRIYRYMIPVYALLSPCS
FT                   SWNEFYAEFPQAVETLRCRAQGGSFIDLCPNEEDKLLAALRDVVSRGNGLLAHHVVGTH
FT                   RFHNFSASPGERYGHGWNRKVVMPNDNTSVRTVMRCEIAPRLFLFPQETIGPTRSEYAK
FT                   SLKIFEGDTAAEGERVVAVSERTFPETALLPYLLFQIEGRSFLFNMIRKIVGLIIAVLR
FT                   GARESLMQETLSAERHALCPLAPGSFLYLFHSFYTSYDNRVRRSGSTRFCPLEDEWTGE
FT                   VGEAASAFAVTSIAADVIDLDMNRVPALGTLLSAIDAQRRVTRPCWEEEDAHLTSMKEF
FT                   HPAVVEPHPSCSEMTTFLRSLRVHNWGLSQVKQPVQCGKNKPLDTDNGKESITGCEGVK
FT                   QQRASGDGCVVDEGQVRKRARKEECMCEGCDGTPFSRETHTLGEEEVDDGWLYVASTLE
FT                   EEQRLRHEHHKRVRRSRAWDGTAHGGGVEVAFHSDGDGGGSE"
FT                   /protein_id="XP_845775.1"
FT   gene            <382627..>382917
FT                   /note="synonym: Tb07.27M11.860; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658363"
FT                   /locus_tag="Tb927.7.1520"
FT   mRNA            <382627..>382917
FT                   /db_xref="GI:72390963"
FT                   /db_xref="GeneID:3658363"
FT                   /locus_tag="Tb927.7.1520"
FT                   /transcript_id="XM_840683.1"
FT   CDS_pept        382627..382917
FT                   /locus_tag="Tb927.7.1520"
FT                   /gene_family="HOG000257948" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390964"
FT                   /db_xref="GeneID:3658363"
FT                   /translation="MGGDDQIFRSNVSHNYYSEALQAQRKPLNCPTCKRVGRFAGTLNE
FT                   IYRRIPRTQWESLILCHVCGENVLRREDAVTRQRVWYCESCEICLCTKCQR"
FT                   /protein_id="XP_845776.1"
FT   gene            <383340..>384704
FT                   /note="synonym: Tb07.27M11.870; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658366"
FT                   /locus_tag="Tb927.7.1530"
FT   mRNA            <383340..>384704
FT                   /db_xref="GI:72390965"
FT                   /db_xref="GeneID:3658366"
FT                   /locus_tag="Tb927.7.1530"
FT                   /transcript_id="XM_840684.1"
FT   CDS_pept        383340..384704
FT                   /locus_tag="Tb927.7.1530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390966"
FT                   /db_xref="GeneID:3658366"
FT                   /translation="METHNTEPLGDFAKIRSRCHRYLLAVATHLSPIEKYVVAPGSYKN
FT                   LGLIAINCGVQTGSGPFYLRQQLIAHTALSDASIELFYSSKFPFTLICGDTSFGDGLKP
FT                   LKTRLIEVATTNGGPTAYVYAIPVPHEMLWKGGLLPSSGMSLLYLLCCKGDAVLHTLRR
FT                   VFQPPTIGVGRVCDDPLQPSITGLLSMEEVGSGTSFTSDTAHTSYFYKGAKVRCVECVA
FT                   VSEIPGLYIVSDFITHSEHNAIWNELNGDAASHFEVEHLARRDVAHFNRRFYYGINRVG
FT                   AEGVQVNSRPAFYDWMAQRLCNTDSEVKIHNYPMKQHPEYFDQLTVNYYNYDDPKSKLV
FT                   PGIARHVDSHDAFGDYIAIVSLGSHTVIEFSRYNRPPDVFAPLGVLVKPCSLLLLTGEA
FT                   RYCWTHCIVEKREDVLNDQLPPLQRGNRLSLTWRCGRDTPHARESCLCPSLCDGT"
FT                   /protein_id="XP_845777.1"
FT   gene            <385104..>385898
FT                   /note="synonym: Tb07.27M11.880; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658364"
FT                   /locus_tag="Tb927.7.1540"
FT   mRNA            <385104..>385898
FT                   /db_xref="GI:72390967"
FT                   /db_xref="GeneID:3658364"
FT                   /locus_tag="Tb927.7.1540"
FT                   /transcript_id="XM_840685.1"
FT   CDS_pept        385104..385898
FT                   /locus_tag="Tb927.7.1540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390968"
FT                   /db_xref="GeneID:3658364"
FT                   /translation="MHEKGYADVDVSPSDKGESADCKVAVVSLAEKIASKAWLFAGCFV
FT                   VLAMATSFLWEISDSDQTIGYHLFVSPKFVTDGTTFYGTTAEGKLVRVRLRSVEVPTLR
FT                   QPYGREARDHLKSILLLSVGQSTGVSCFVASVDDVGGVIAEVFFNNVRAFASCGREIDS
FT                   CAASSLPSYFTPLSGGFTADSIVNVGDEMVRSGWAWVIDNGWTRNTKLQAAMDEAKVAK
FT                   RGLWGGNVSKFPYRRSPHSRKIGKKLTEQRQPISRRRLFASR"
FT                   /protein_id="XP_845778.1"
FT   gene            <386422..>387855
FT                   /note="synonym: Tb07.27M11.900; RNA editing 3' terminal
FT                   uridylyl transferase 2"
FT                   /db_xref="GeneID:3658367"
FT                   /locus_tag="Tb927.7.1550"
FT   mRNA            <386422..>387855
FT                   /db_xref="GI:72390969"
FT                   /db_xref="GeneID:3658367"
FT                   /locus_tag="Tb927.7.1550"
FT                   /transcript_id="XM_840686.1"
FT   CDS_pept        386422..387855
FT                   /locus_tag="Tb927.7.1550"
FT                   /gene_family="HOG000257945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA editing 3' terminal uridylyl transferase 2"
FT                   /note="identical to GB:AAO63567.1: RNA editing complex
FT                   protein MP57 {Trypanosoma brucei}  (PMID:12820966); 99.6%
FT                   identical to GB:AAO63567.1: RNA editing complex protein
FT                   MP57 {Trypanosoma brucei}  (PMID:12820966); go_component:
FT                   mitochondrion [goid 0005739]; go_function: RNA
FT                   uridylyltransferase activity [goid 0050265]; go_process:
FT                   RNA editing [goid 0016547]"
FT                   /db_xref="GI:72390970"
FT                   /db_xref="GeneID:3658367"
FT                   /translation="MRLSRLFRQSPLSLPSTKLNPSPDHYAVWGKAIMAENNRRVGPEH
FT                   MFRTAIRAQQQLQGLADKWTPDAKVYCCGSMVTYGQMEWGSDLDLACMFDDPYPSHEVQ
FT                   AKRTDKLWTVIKRYVPHYLRNNLLGLTEARTPVVKLRFANDEKVARARYTPLSEEEDRK
FT                   ARTALLDVRNQCVGDNDVEYIAEKMGRDNVEGIWVDRTTYGCRIAIQCTSKEQMIEAIG
FT                   FFPDGKIMTRGMREDYTRDVLDVRFVPEMFMYRWDISFVGYGVKNSYLIRHYLHNGPVA
FT                   ARHTAMAVKAWGKATNVGAGSAAMLTSYAVTVMFIYYLLVTRQVLWVDPWSLPHPAHLP
FT                   RYPDFSPLYDCDPTELGRLLHGFFIFYAHHFDYEREVVSLNRNRRSYRSDIGWNFPQNK
FT                   KGTFSYNFCIEDPYEDVGTGGLNLGRHLHPAKFQLVKQEFLRAAQCMERFLPTNAPEKS
FT                   ILGVKRADLRHFERDRDRE"
FT                   /protein_id="XP_845779.1"
FT   gene            <388532..>390553
FT                   /note="synonym: Tb07.27M11.910; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658365"
FT                   /locus_tag="Tb927.7.1560"
FT   mRNA            <388532..>390553
FT                   /db_xref="GI:72390971"
FT                   /db_xref="GeneID:3658365"
FT                   /locus_tag="Tb927.7.1560"
FT                   /transcript_id="XM_840687.1"
FT   CDS_pept        388532..390553
FT                   /locus_tag="Tb927.7.1560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390972"
FT                   /db_xref="GeneID:3658365"
FT                   /translation="MTLGAAIMSDESRERLAREHMEKARAMKTDTQEQIEEVMKHLSLA
FT                   IEVKPLSVAVLLQRAHLATRIGRYHVAIADLTFTIQLEEHGIDRRRLAAAYGSRAAVYR
FT                   KLNKHKESIVDYVRAADVEPDNGTWLYELGLVYAAQGMKALAHHFVAASLSEKVTGRMS
FT                   EITRFRALTSLGTCKLASGDITGAVAVLTKGLEFQETAALHNLLGIAHFLRGEYEPARS
FT                   RFERAVEMDHLSSEYHTNCALCLFQLGIHSEAFKQMEYAVIKSVENARYHFYRGNIALL
FT                   LGLHAPAMTDVVKAIELDPQCASHYYSKALILVATQDYEEAMAILNKAIELNPTFRAAW
FT                   VHSGLLHFLRKNLFEALQCFSRALELEEEDATVHECVGLVYFDIKYYDLSAASFTRCID
FT                   LIPDDPVLYFRRGTALLLCGDLQGAYDDLQKTVCKYKFRNPEVLNSLSVVVSKLGRHLE
FT                   ALELAKEAVALNSKNHRYLLQQAECHFAVRDYDAVLEDLANIVSLGYATAELYYLRGRS
FT                   KYALRDFCGAADDLLQAATCQPLLNECSNYCYALGVAYLCSGKNINDAEKALTRAITSH
FT                   SDPPSFFYDERAKARQKLGDTKGMLEDLNFMLQRDQSDPTVLLRRSLGYKALGLYDKAA
FT                   RDFEKAKTLNGAREVLDCVPYEKFFEIEEVLWGNEQVE"
FT                   /protein_id="XP_845780.1"
FT   misc_feature    390797..390887
FT                   /note="T-rich"
FT   repeat_region   391103..391134
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   391136..391163
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <391253..>395452
FT                   /note="synonym: Tb07.27M11.920; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658370"
FT                   /locus_tag="Tb927.7.1570"
FT   mRNA            <391253..>395452
FT                   /db_xref="GI:72390973"
FT                   /db_xref="GeneID:3658370"
FT                   /locus_tag="Tb927.7.1570"
FT                   /transcript_id="XM_840688.1"
FT   CDS_pept        391253..395452
FT                   /locus_tag="Tb927.7.1570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390974"
FT                   /db_xref="GeneID:3658370"
FT                   /translation="MFRVSFPLFCTMPSVETAFRRALGAQSIVLDLVPVKKPLIDGSLS
FT                   WFVDKNVEIVLVSGVCGTSPDLVAERVKSQAVQLLQICGEGDAQKGCHAIKHWVEKAAG
FT                   TRSLLCSMDLQVRLLFSRQVVTDGGKLSATSSSGNQALDKVGNRIHCSIYETDAWEPYS
FT                   RERHLGDVTADALLEEVLHKALQIVQRDAEVKEQHLVSESERELNLVLSCGKEPGVWSP
FT                   DVNAYHLEFSHMKCKDRELCTDLGAIAVSWGVHDRSENVEMFNVPLVRLKDSSGLVYGD
FT                   CLDDPQQSLIDEETVSLLEAKGAIDTITGLVDATCVRKVANSVWSIPLLHAQLLQAGLE
FT                   FLCGYWSPTRVEDYMRSCGRLDIDVWLSERGRPATIPMLPRCASLLGHMCYLQESLPLE
FT                   YVRSPMMLLTSAGRMDFKFYMATTTGGHVVTATSCFSSAEAACSLLFPCHSAMVQSAGV
FT                   GDSHRYTDIDHQRNEHVCTLTEVNSSTNRNKKSGGSGDNDQRPSVTVRVIDVEASLRKL
FT                   GVVRGSFANATVQYFDDTGQVVLQFNEMDSIRGIARMIKRVRWSKGATFTSVDLQNGPR
FT                   APVVIASRALGSTSLPKPPPYSKKFRLPIPLVPGGYSQLRFTSALEMNVIECKILEMFK
FT                   NSAEDPLKWHLHYFAPCYFNKWRMTRGIVSTLMHYDPQFHYMVERCRSSSLSGGSGTGG
FT                   GSNGRDDTSGNDNGGALVLRLYSGERLMEEVKLQESTLLFQVRENLIRYASRWSMEVPS
FT                   LEEAAFPLKEFKKGGACTFRNFVSWFLQNSEVFTTHGENVSLELEITTNVRIQLASCRD
FT                   WSGPSPTRDELCRLFLESQFPLLVPIVEIQKRLYYFFDNCTIPGELTIRCVGSDACVEG
FT                   DRVIRCNYRWELLQVDSGTGVECLLASLEATEGDSRRAALEKLLTKVWTSCCAAPRPTT
FT                   QAKRGSKLEGSGHPSHHCPKSTIAWYQHLLAQQRGLHKVVHEYDAKNNVLTVKGISADT
FT                   NKGVNVSGTVIRVVPLRSEYPLIFLLHRYYRMELGLPDPPQPRGEDELRVVSLLTLYQD
FT                   CNQHFPASFPPISEAITTISGKNHWRVILRLPSNLFALETPSHLEYVYLGKGKHEGKRA
FT                   VVCDFYRSLHGKAPASLQEYLSKVTSLSPPTVGEEKCSSCVLDGIKPVVVAKPRRGGHN
FT                   SMYDELRRLIGEALLQHVGYEGLVECRLSYITGISASYVGQSSSNDDCVDLFRVVINTE
FT                   EWLPFQLLRALASCARRLLSIVDLEASLFRLRSRWPSLFLEASSNERLFCTTFLRRYWG
FT                   LRVYEGDDVDEFTKVPGSIYLVERVRPVSSGRDSGHYEASLLLLQAPFPPSTTAFTKVL
FT                   ALHRNVSAARARFGLWAQVSRKLVRPQESDAPLEAFDRAVISTSGATSSGTEVRGE"
FT                   /protein_id="XP_845781.1"
FT   gene            <395945..>398620
FT                   /note="synonym: Tb07.27M11.940; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658371"
FT                   /locus_tag="Tb927.7.1580"
FT   mRNA            <395945..>398620
FT                   /db_xref="GI:72390975"
FT                   /db_xref="GeneID:3658371"
FT                   /locus_tag="Tb927.7.1580"
FT                   /transcript_id="XM_840689.1"
FT   CDS_pept        395945..398620
FT                   /locus_tag="Tb927.7.1580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390976"
FT                   /db_xref="GeneID:3658371"
FT                   /translation="MIADAEWSEFASVELDDAFIESYIRNGGTARASSGDDASRDESLR
FT                   SGSASMEEIWGECSMQSVCDGFVRNFLTDDTMGTLHYLLKDCDSSLKDIADILHRFISS
FT                   LDTTRQGIEDVRQQLHRVMLQHGNATSAGRAVRTVLQRLLVSPQVVRIITQGGEEELGP
FT                   QFKHSVQELLCILRKSRRYTNILLVKEDSGCYTAVPAGASAIPVLADAGNRETVQVPLL
FT                   EFKMYHEQIELLNRLTVLACTKAKRFLAKKIALLSVKNTNVSIQQEHILKPTTFYSRLI
FT                   DEAVTLLCPSNVGDMSNQTNPESPASLPYCIVKALHSELRRDYYDIMSKLYLERICHYV
FT                   MTLNLMENTASTANKTAPHKVSAVPWVNELPLITDDEAPSSQSAFELGERAVILQNVFA
FT                   PPLVPTVEQAKWRLHSYEETFRSLNILLCDAVTHEFIFTFTFFSGDMSVFVDVFKPTIQ
FT                   FIVDYVAEVLLAQNTNNGVWRGLHEQYPQTAVNTVCGNDCYGLLILIRLCHDFNSLMKD
FT                   VRRLCCLEGFYDSLLLQLWPSFQQTFERQVRALRLADVPTLADSFLRAEDKQGVSDWVA
FT                   RIHPLIKHYAAFTKALVTITSGCGFNGSDTEEGYAKATALANQSVQKDNADGNGATASG
FT                   TTGVGGDGNKNISSEDDVGFEELQQIAWRIIEEERASDMADSSSRFAVLAGNLSFLRVE
FT                   VERLLCSVTAQLLETSRCDPDQREHRNLAFLQNNVRYILNEWQEAIRNGGAPMLGPDYS
FT                   ALEELEKTLRSGLVLSIMKHHFPLINRVLQNDEHIDVLAVAEVFHHKWRIELEELCRNV
FT                   RSLLRDEKCKEELLAQVCTEVLLWNTRFIACLSKATDDAAASGVSTPSSSCFTVTNQQM
FT                   IQHIRTLAAIAESKDDDEEG"
FT                   /protein_id="XP_845782.1"
FT   misc_feature    complement(397167..428596)
FT                   /note="This entire sequence corresponds to a 31,430 bp
FT                   segment of BAC clone RPCI93-29D18."
FT   misc_feature    398840..398927
FT                   /note="T-rich"
FT   repeat_region   399408..399441
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   gene            <399839..>401248
FT                   /note="synonym: Tb07.27M11.950; mitotic cyclin"
FT                   /db_xref="GeneID:3658372"
FT                   /locus_tag="Tb927.7.1590"
FT   mRNA            <399839..>401248
FT                   /db_xref="GI:72390977"
FT                   /db_xref="GeneID:3658372"
FT                   /locus_tag="Tb927.7.1590"
FT                   /transcript_id="XM_840690.1"
FT   CDS_pept        399839..401248
FT                   /locus_tag="Tb927.7.1590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitotic cyclin"
FT                   /note="similar to GB:AAN77908.2: putative mitotic B-type
FT                   cyclin CycB3 {Trypanosoma brucei}(PMID:12665514); 99.6%
FT                   similar to GB:AAN77908.2: putative mitotic B-type cyclin
FT                   CycB3 {Trypanosoma brucei}(PMID:12665514); go_process: G2/M
FT                   transition of mitotic cell cycle [goid 0000086]"
FT                   /db_xref="GI:72390978"
FT                   /db_xref="GeneID:3658372"
FT                   /translation="MSYNTSSSSDSLLCEIDVNIQQQLDNSNFFLPVPKHLWNVQSKKG
FT                   KQRCQGGGTSPKNTAQSNQPSTEMTCVMLQKSMRNALCNLELMYTNDTERLKQRLSEEF
FT                   HRLRESAAERTRQLIDLSTKAQPLSYRVLFVLNLRRWMLCRGFEFALQDLKDWLRLALL
FT                   LRETDTLHFLRECTKKLGPYARQRVEDALILHGSDIDSVCQVVMDIPVPTDETTTFGGP
FT                   YYNLTLNDLIAMGDEDTHSVHVVNAQHTMPSHVREGLVEWMLLVNVELNLQLETFFLAV
FT                   SILDRYLLRATIQPDREYLTAYAILLLASKVEEKCLFPLRDSVRLCGKTYKVGVLIATT
FT                   NRIFEVLDCNVVYATLSNVGFGFLWQQEPVACEKQYSFLTYILTTLAIRTQYRQYRLSA
FT                   LAAAAVYVSRLRFNIPTGRPCDEVVVLLPVIKDAISCNISARSGGVYDLFKRSCFHEAS
FT                   RFPLPDLLYGL"
FT                   /protein_id="XP_845783.1"
FT   repeat_region   402317..402343
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   gene            <402996..>403892
FT                   /note="synonym: Tb07.27M11.970; C-1-tetrahydrofolate
FT                   synthase, cytoplasmic, putative"
FT                   /db_xref="GeneID:3658374"
FT                   /locus_tag="Tb927.7.1600"
FT   mRNA            <402996..>403892
FT                   /db_xref="GI:72390979"
FT                   /db_xref="GeneID:3658374"
FT                   /locus_tag="Tb927.7.1600"
FT                   /transcript_id="XM_840691.1"
FT   CDS_pept        402996..403892
FT                   /locus_tag="Tb927.7.1600"
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C-1-tetrahydrofolate synthase, cytoplasmic,
FT                   putative"
FT                   /EC_number="1.5.1.5"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   methenyltetrahydrofolate cyclohydrolase activity [goid
FT                   0004477]; go_function: methylenetetrahydrofolate
FT                   dehydrogenase activity [goid 0004486]; go_process: purine
FT                   base biosynthesis [goid 0009113]; go_process: folic acid
FT                   and derivative biosynthesis [goid 0009396]"
FT                   /db_xref="GI:72390980"
FT                   /db_xref="GeneID:3658374"
FT                   /translation="MPEAVVIDGRAVAKAIQKELTEEVALLERRYKGRRPGLSTIICGK
FT                   RKDSQTYVRLKRKAAAACGFRNFSVELPANVTQETLEREVIRLNEEEACHSIVVQLPLP
FT                   PHIDKVAALSKIKPEKDADCLLPVNVGQLHIRERNPAIVPCTASAVMELLRCSGVEICG
FT                   KRVVVLGRGDIAGLPVATLLANEDATVTVVHSATPLCDIADIVRASDIVVSAAGQPGLV
FT                   RGEWIKLGAAVIDVGTTPVADPSKVPGYRLVGDVCFDVARKRAAYITPVPGGVGPVTVS
FT                   MLLKNTLTMFKRSVRAL"
FT                   /protein_id="XP_845784.1"
FT   repeat_region   404168..404187
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <404562..>406508
FT                   /note="synonym: Tb07.27M11.980;
FT                   6-phosphofructo-2-kinase/fructose-2,6-biphosphatase,
FT                   putative"
FT                   /db_xref="GeneID:3658375"
FT                   /locus_tag="Tb927.7.1610"
FT   mRNA            <404562..>406508
FT                   /db_xref="GI:72390981"
FT                   /db_xref="GeneID:3658375"
FT                   /locus_tag="Tb927.7.1610"
FT                   /transcript_id="XM_840692.1"
FT   CDS_pept        404562..406508
FT                   /locus_tag="Tb927.7.1610"
FT                   /gene_family="HOG000257938" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphofructo-2-kinase/fructose-2,
FT                   6-biphosphatase, putative"
FT                   /EC_number="3.1.3.46"
FT                   /EC_number="2.7.1.105"
FT                   /note="go_function: catalytic activity [goid 0003824];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   fructose 2,6-bisphosphate metabolism [goid 0006003]"
FT                   /db_xref="GI:72390982"
FT                   /db_xref="GeneID:3658375"
FT                   /translation="MDCLVCSGRLPVQTAFNRMAAIQEEIARIDDQLATLYLTENMAAT
FT                   SPKEAPTDESIDQTIAHMLAVELCQLSASGDTVGIRVLLSGGADCNCVDYHGRTPLHLA
FT                   CLMGHVTVARVLLEFGADVTATDKEGKTPMDLAVRSDTREIVELLMSHCICDSSGGARS
FT                   PPQELDGVLGEGLQEDSPLTATHPDFSSLPRPMMGSLIVIMVGLPARGKMYTARQIQRY
FT                   FQWNGLQSSIFTYDNYVHQLAPRQPASCDITQDVDMELRVAKAIAHDMTHFIHQEDGVA
FT                   VLAGSNVTSVRRMALFNAVMETGHIRQGRVVFVEVINTVSERIRNNVLLAKEMVTGASD
FT                   RFVEEYYEKMEQLEAVYTSLDPVVDKDLTYIRVENGEVFSLNNISGWMPSRLAYMLHNL
FT                   NPCSHNIYLTRSGEYIDLVDQRIGGNSPLTERGRAYGRAIFEYFRREHGAERFVVMSSC
FT                   AVRCTETVHYFDKRNELSQDPYFASGSTSPAVNCRVSYLPTLDDINRGDCEGMLLSDVR
FT                   RTMPGTLRNILDDPYLTAWPNGECTHQVFNARLEPLIHDIQASDHSVLVVSHLHLLQGL
FT                   YSYFVCKDGNVIAPQNAYTIDIPLECVVKIRRVGDNRVAEIIDLSHEVDRIAQLYHGGA
FT                   QRHCRRTEDFNKL"
FT                   /protein_id="XP_845785.1"
FT   gene            <407232..>408134
FT                   /note="synonym: Tb07.27M11.990; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658377"
FT                   /locus_tag="Tb927.7.1620"
FT   mRNA            <407232..>408134
FT                   /db_xref="GI:72390983"
FT                   /db_xref="GeneID:3658377"
FT                   /locus_tag="Tb927.7.1620"
FT                   /transcript_id="XM_840693.1"
FT   CDS_pept        407232..408134
FT                   /locus_tag="Tb927.7.1620"
FT                   /gene_family="HOG000161320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390984"
FT                   /db_xref="GeneID:3658377"
FT                   /translation="MSLKAKIDVFPFDGYLLQDPSVVSVMQAVVRGNKTGGTGVGNSGG
FT                   ASGNETGSGGVGGGNANKRREAGGGTTNSERRIKTPLEKLMSLRARCREQQRVQSVEGV
FT                   LLVHAHDHPHVLLLRHNVKTTNRSRVLPATNTNSTAVYRLPGGRCRNGEPEELCLLRKL
FT                   GRDLLNESKRLTSSSTAEEERSEVVVDVGSAHPNGTAVTASSSSFRVGEVLARWYRPHF
FT                   DPLMYPYVPAHVAENDVREVRTIFLVHMPPRMLLTGTYGDEELVAAPLFDLYDNTAKYG
FT                   VLIASIPTLLSRVNINYCR"
FT                   /protein_id="XP_845786.1"
FT   gene            <408581..>409177
FT                   /note="synonym: Tb07.29D18.110"
FT                   /db_xref="GeneID:4443198"
FT                   /locus_tag="Tb927.7.1630a"
FT   mRNA            <408581..>409177
FT                   /db_xref="GI:72390985"
FT                   /db_xref="GeneID:4443198"
FT                   /locus_tag="Tb927.7.1630a"
FT                   /transcript_id="XM_840694.1"
FT   CDS_pept        408581..409177
FT                   /locus_tag="Tb927.7.1630a"
FT                   /gene_family="HOG000202090" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390986"
FT                   /db_xref="GeneID:4443198"
FT                   /translation="MGQKPSITTLLRQCIYNQDTDGFRALIGEHENELIPGCLEDNIFV
FT                   EVITKKCEPEIVDTVVKLANENQLASLVATAVLYDHSLPLGPLFGMMKERERTIEEHQL
FT                   KYLFLTLCERGRTEAVRVFVENKCYDPSDPRPLRAVVRGQLKNPNVDTDLLMLVLSSHA
FT                   PQPDDVKCLIETYLAEAENGDVRKVVEKCLVGFHQ"
FT                   /protein_id="XP_845787.1"
FT   gene            <408581..>408821
FT                   /note="synonyms: Tb07.27M11.995, Tb07.29D18.110;
FT                   hypothetical protein, conserved"
FT                   /db_xref="GeneID:3658369"
FT                   /locus_tag="Tb927.7.1630b"
FT   mRNA            <408581..>408821
FT                   /db_xref="GI:71750486"
FT                   /db_xref="GeneID:3658369"
FT                   /locus_tag="Tb927.7.1630b"
FT                   /transcript_id="XM_819061.1"
FT   CDS_pept        408581..>408821
FT                   /locus_tag="Tb927.7.1630b"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Should be merged with annotated gene Tb07.29D18.110
FT                   on overlapping BAC to construct the complete gene."
FT                   /db_xref="GI:71750487"
FT                   /db_xref="GeneID:3658369"
FT                   /translation="MGQKPSITTLLRQCIYNQDTDGFRALIGEHENELIPGCLEDNIFV
FT                   EVITKKCEPEIVDTVVKLANENQLASLVATAVLYD"
FT                   /protein_id="XP_824154.1"
FT   misc_feature    408822..414446
FT                   /note="sequence corresponds to BAC RPCI93-29D18"
FT   misc_feature    complement(<408822..>414446)
FT                   /note="This entire sequence corresponds to a 31,430 bp
FT                   segment of BAC clone RPCI93-29D18."
FT   gene            <408824..>409177
FT                   /note="synonyms: Tb07.29D18.110, Tb07.27M11.995;
FT                   hypothetical protein, conserved"
FT                   /db_xref="GeneID:3658368"
FT                   /locus_tag="Tb927.7.1630"
FT   mRNA            <408824..>409177
FT                   /db_xref="GI:71904566"
FT                   /db_xref="GeneID:3658368"
FT                   /locus_tag="Tb927.7.1630"
FT                   /transcript_id="XM_824937.1"
FT   CDS_pept        <408824..409177
FT                   /locus_tag="Tb927.7.1630"
FT                   /gene_family="HOG000202090" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Should be merged with annotated gene Tb07.29D18.110
FT                   on overlapping BAC to construct the complete gene."
FT                   /db_xref="GI:71904567"
FT                   /db_xref="GeneID:3658368"
FT                   /translation="SLPLGPLFGMMKERERTIEEHQLKYLFLTLCERGRTEAVRVFVEN
FT                   KCYDPSDPRPLRAVVRGQLKNPNVDTDLLMLVLSSHAPQPDDVKCLIETYLAEAENGDV
FT                   RKVVEKCLVGFHQ"
FT                   /protein_id="XP_830030.1"
FT   gene            <409618..>411348
FT                   /note="synonym: Tb07.29D18.100; GTP-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3658378"
FT                   /locus_tag="Tb927.7.1640"
FT   mRNA            <409618..>411348
FT                   /db_xref="GI:72390987"
FT                   /db_xref="GeneID:3658378"
FT                   /locus_tag="Tb927.7.1640"
FT                   /transcript_id="XM_840695.1"
FT   CDS_pept        409618..411348
FT                   /locus_tag="Tb927.7.1640"
FT                   /gene_family="HOG000257936" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein, putative"
FT                   /note="go_function: GTP binding [goid 0005525]"
FT                   /db_xref="GI:72390988"
FT                   /db_xref="GeneID:3658378"
FT                   /translation="MRRCIPASVLRRVLLLQTRLVSTNTQTPPSGCATKIQNESPMNGS
FT                   FNLPRERQILGGLHADWRTQMKRSGSILNDITPALPDTKRTEEQRRRVAGWRPVVKLLG
FT                   DQRLRIAIVGRMNSGKSSLFNLLRLEPTVPGRSNVVRDFDGITRDSVEGQAQLEGMHFT
FT                   IIDTPGMVQGRMVEEAFRTVETADAAIFVTAVDEDIMPEELSLMQYLHLKHMPVVLLAN
FT                   KMDLIQEEEEEAVLDRYNSLGFGNAIPFSARRKSGLEMLAAVLEPLYHIHAMHKVENDW
FT                   DIEDLAMQGDESAMEEIRERNCSDRFIRIAIVGRTNSGKSSLVNRLVGFERNRAVDEKN
FT                   STRDPVELPCSYKGRKLKLIDTAGLARHRYRADRDFIGRIHGLSVNEIRFAHVVIVVFD
FT                   ATEGHPNKYDMAVLHSVAAEGRPFLLCANKWDAVLDQSATAEAIDFKIKRQVREVKYSN
FT                   AVVVSAHTGLNLTLLMDQALELYDKWNKRVRRAELTRLWRKMEKSVIIPYHVARIGRIT
FT                   QVNTRPPTFLLQLQTKNDSNTLPKALQEMMKNTLVEEFDFRGVPIRLIQEVKDSNPDYI
FT                   "
FT                   /protein_id="XP_845788.1"
FT   gene            <412010..>414250
FT                   /note="synonym: Tb07.29D18.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658376"
FT                   /locus_tag="Tb927.7.1650"
FT   mRNA            <412010..>414250
FT                   /db_xref="GI:72390989"
FT                   /db_xref="GeneID:3658376"
FT                   /locus_tag="Tb927.7.1650"
FT                   /transcript_id="XM_840696.1"
FT   CDS_pept        412010..414250
FT                   /locus_tag="Tb927.7.1650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390990"
FT                   /db_xref="GeneID:3658376"
FT                   /translation="MGKRRRSIGELPDETGFNGDNRGDIDDVEAGDVMEHILEEGEEEM
FT                   DDDCEDDDDEPTGTGSSPPSLGAYIWGEVSMALYVSMLKQLHHICGCIAIQPSSEERRK
FT                   LIAKARTQTKALWDLEMLSSDSSEQEDLAEYFHSQISSLLDNVTSLAESDMKAGELCQA
FT                   FLQTLNMFGFPEEENLDEVQLQANIRKSAELQCYSYQQRTSNQLNVLRRYEGDRRSEDQ
FT                   YLQPRVGRIVRFPIPHPHEEVNTRIQLIEPKRRRPPLEENRICSHPKRATAFGMEDVLV
FT                   DEELQFRALVMLGRHLDTFCSIQHISPYLRLTVWNLLDRDEEIFERLCEVPKGDDDTAV
FT                   HLQLLTELRQRVARKRMAFESTRVGARECVARLTWSAVSARWRDQVLCAVEEVEDADWC
FT                   LLRDSAKVGTRAIFPNYAVCSAVRDIALKALRRVRDGTIDCGGIDDAADCYEVIARVLV
FT                   PILEGGQPMFPMDDTSDSDGEREREACRKKEPRGKAQRPFHYGELCQRFATLMSRGEDA
FT                   ELTDTKVARSVRWNLNCETLLAEEGVVCTFLTGMFVWPLQCLASFLELVAAGRHSVDGL
FT                   RKFSAAFIPSNWSDERGVLEYLLRREPTNLPLTAFVAFPRLIRDVYISARWLLNDKCFA
FT                   AVVACRREACKLPSNKPAINFIQWKALSSVLAEVGYKDELLALTVRGALPSDADEGKLW
FT                   SVAELQHTVRAWIDGVELMLLAEKSAMVSGATSATGTAFVVGRSDSKSDGEG"
FT                   /protein_id="XP_845789.1"
FT   misc_feature    414447..543343
FT                   /note="sequence corresponds to BAC RPCI93-43M14"
FT   gene            <414453..>417647
FT                   /note="synonym: Tb07.43M14.10; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658373"
FT                   /locus_tag="Tb927.7.1660"
FT   mRNA            <414453..>417647
FT                   /db_xref="GI:72390991"
FT                   /db_xref="GeneID:3658373"
FT                   /locus_tag="Tb927.7.1660"
FT                   /transcript_id="XM_840697.1"
FT   CDS_pept        414453..417647
FT                   /locus_tag="Tb927.7.1660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390992"
FT                   /db_xref="GeneID:3658373"
FT                   /translation="MGGRNTGDVSLSQLSEVSAKAEALRENLRKALIDHAPRFEVCVFE
FT                   SLMCLLDNFLQPPASDNFSHSVREDTNYLIERYYLQEVFAALLLLVGEDDLDGVEVAVG
FT                   SAPHRVASEVPQSAFYVDIHTRRYCRELLLYLCFSRVHKKRRVVRALYPLLLNGSTKQS
FT                   GEVSQNHISEGLFASSRFKSRKKLVSGILNGIVLSFPDGIRSVIDVLLLDDRVDDSMSV
FT                   HAAKHIASLFTIKLDHAWLCGDHWKSEKEEQQENEQIVTVRYCKNISLEEQIRALSSQL
FT                   VAIAVCHAAAPLLAKEKVALPAFLQGKQKLERNLLVKPETLEERLHICLATILNTVSQL
FT                   PLRSEDETYFKRCYKRFYLYNKYFFTPAFRALTLRTSVNAPNIPAANTSAVVTCEGTSG
FT                   SGGIPSNGADEVVKALSRFCALAKGSTLGPSSLALLLALPPVAPGLLELVFVQDSLPPP
FT                   HRFALQQLLSALWKVEGKYEEMAHIFVRGALSPVRGSVTIDRVSGFVGVDLRTASPTVR
FT                   RIRGLQELVMSESTPSGLCRGVLLAAAEECQQRAAKGNTSPDDSSNSRCGGTGGSDVGL
FT                   RPQRRVVNFLYSNTIHDQGEEEVGKEICDRTEEITLVRMVECICLGTSADAVFGAEITL
FT                   GCVCDVLAVVATISFVCWRWTVLLIPKVFCKDVVTAVFAQHATIADRRKAAEDLLLRGE
FT                   RLFSVLTALHAAVDSSSDDVSAAAEGSLAAAMEASRQYSSNVGCEGRCVDDDHDATGNT
FT                   VSYSSEDEVRSTYRRLAVEAEKCLETRSTGSLVVHLLALSRMAEDEASKRRNAPSHYSD
FT                   KLVGAVQPALHVLSRVLAEVDDACAAVAAIKTMVWWALARADSPDSSFIGNLLIYQLSR
FT                   DVRGRSSKFPLQASVAATPVQLDRMKVRLLDVLLGLCDYDTEGRTLRNIDDYSRQMYGY
FT                   SLYDLLRELCGPRHSVAVQVAALHLVGHFVIAVAPRVSVELACVLCKDVFRHTPHAMAK
FT                   AAAAAMLVCISSSLEVFGEGSVEPLLRMADAMRNYRDAAVENTVHEDVIRRHGERIKGL
FT                   LEEKQFMLPVQEIRES"
FT                   /protein_id="XP_845790.1"
FT   repeat_region   417872..417898
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   417902..417926
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   gene            <418176..>418736
FT                   /note="synonym: Tb07.43M14.20; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658384"
FT                   /locus_tag="Tb927.7.1670"
FT   mRNA            <418176..>418736
FT                   /db_xref="GI:72390993"
FT                   /db_xref="GeneID:3658384"
FT                   /locus_tag="Tb927.7.1670"
FT                   /transcript_id="XM_840698.1"
FT   CDS_pept        418176..418736
FT                   /locus_tag="Tb927.7.1670"
FT                   /gene_family="HOG000257932" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390994"
FT                   /db_xref="GeneID:3658384"
FT                   /translation="MAAEATEKPHPLKDRWFVSYFPVVKQKKFSKDSEEQKGVELDWVS
FT                   TAEELHATINAFSPLTLLPPDDNLVFAREKVEPFFENFPNGMRVSVFTRTKVQATQAVP
FT                   LVLAAVMGEHLRTVTDGPSHADVVRIAHKPGTVYPESLRVEVWLRDRSKVDAVTKYFSE
FT                   MLAPHPGIRVAGRPINAEGEEAK"
FT                   /protein_id="XP_845791.1"
FT   gene            <419490..>420455
FT                   /note="synonym: Tb07.43M14.40; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658379"
FT                   /locus_tag="Tb927.7.1680"
FT   mRNA            <419490..>420455
FT                   /db_xref="GI:72390995"
FT                   /db_xref="GeneID:3658379"
FT                   /locus_tag="Tb927.7.1680"
FT                   /transcript_id="XM_840699.1"
FT   CDS_pept        419490..420455
FT                   /locus_tag="Tb927.7.1680"
FT                   /gene_family="HOG000257930" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72390996"
FT                   /db_xref="GeneID:3658379"
FT                   /translation="MEEEVNTTSSNLIVTWRSRRCVAPVVEVLQSRPHLLDCLTMFPNG
FT                   TKALHSPTTCKKMFVLFPGNPGIVNFYEQFVELLSLKDVDVLVMGYSGHSICDRNNGKV
FT                   YGLRDQIDNARDFFDSIQERALSYYGNDIYIGGHSIGAFIAAKILVVFPCIRRCFSLCG
FT                   VLSRIQETPNGRHMFFVGGNVIFYYVFVYLVVAVLVLLPRFVSSWFIRRQAPTLSPVLV
FT                   SQFIEHYNTGALRNCFSMCREEFQVVREPDQQFLGLVGKRMVFYCVQDDGWAPLSHVQE
FT                   AKELCGDCAGFVVESDPSVIHAWCLSNNETVIEKGILPFM"
FT                   /protein_id="XP_845792.1"
FT   misc_feature    421494..421514
FT                   /note="AT_rich"
FT   gene            <421539..>422594
FT                   /note="synonym: Tb07.43M14.60; silent information regulator
FT                   2"
FT                   /db_xref="GeneID:3658380"
FT                   /locus_tag="Tb927.7.1690"
FT   mRNA            <421539..>422594
FT                   /db_xref="GI:72390997"
FT                   /db_xref="GeneID:3658380"
FT                   /locus_tag="Tb927.7.1690"
FT                   /transcript_id="XM_840700.1"
FT   CDS_pept        421539..422594
FT                   /locus_tag="Tb927.7.1690"
FT                   /gene_family="HOG000085952" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="silent information regulator 2"
FT                   /EC_number="3.5.1.-"
FT                   /note="identical to GB:AAC73004.1 and AF102869: Sir2
FT                   homolog {Trypanosoma brucei}(PMID:14592982); 100% similar
FT                   to GB:AAC73004.1 and AF102869: Sir2 homolog {Trypanosoma
FT                   brucei}(PMID:14592982); go_component: nucleus [goid
FT                   0005634]; go_function: NAD+ ADP-ribosyltransferase activity
FT                   [goid 0003950]; go_function: NAD-dependent histone
FT                   deacetylase activity [goid 0017136]; go_process: DNA repair
FT                   [goid 0006281]"
FT                   /db_xref="GI:72390998"
FT                   /db_xref="GeneID:3658380"
FT                   /translation="MTEPKLATTHVVGEPTFEGLARFIERNNITKIFVMVGAGISVAAG
FT                   IPDFRSPHTGLYAKLSRYNLNSPEDAFSLPLLRQQPSVFYNILMDMDLWPGKYCPTTVH
FT                   HFISLLAKKGMLLCCCTQNIDGLERACGIPESLLVEAHGSFSSASCVDCHAKYDINMAR
FT                   AETRAGKVPHCNQCGGIVKPDVVFFGENLPEAFFNVAGLIEETELLLILGTSLQVHPFA
FT                   DLALMVPSDVPRVLFNLERVGGRMFRFPTDRTPNFRASSYRLSTGNGNGSKISSGDSSN
FT                   SSSVDGYDQFTLAENDETGVLRDIFFPGDCQVSVRSFAQALGFGEQLDASVREGREIFE
FT                   RTRRREKVVEG"
FT                   /protein_id="XP_845793.1"
FT   gene            <422812..>424746
FT                   /note="synonym: Tb07.43M14.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658381"
FT                   /locus_tag="Tb927.7.1700"
FT   mRNA            <422812..>424746
FT                   /db_xref="GI:72390999"
FT                   /db_xref="GeneID:3658381"
FT                   /locus_tag="Tb927.7.1700"
FT                   /transcript_id="XM_840701.1"
FT   CDS_pept        422812..424746
FT                   /locus_tag="Tb927.7.1700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391000"
FT                   /db_xref="GeneID:3658381"
FT                   /translation="MYVAPRSCFTSFSLSLSLLRWVQPSLAVMCLWQLALLPFCIALRT
FT                   SLFLFGTSEASIAHIERAENSSSTRNISIPGTTSPLFFRRSGKERQYMRYSVVRTRPSR
FT                   SRRLRHCVLISFLALLLMMLSLSISFYNTRRSVDSLKMKLREDAAGNPLLREGAAQTAW
FT                   SLLNTENGSLWGYVGGIDSLIEKRVDRAYWGPTMFRSNEGTVNESTVTNVVSERFRNLN
FT                   MSEAEMKRRYKRHQLVKEVTGCDSLSVPFNPLHDSRCINFMTNSSNWLDVVPIGQNVDQ
FT                   RTIKFRLLFKPLRINASYSVEYPLETFVKVPQKYFVLEAASEVVAFNVDRLLLVNRVPP
FT                   TGLGCLPLNTLRGSVNKYKHNTSTFKKFLQDSKAENYEQWIEKDLFHFLRRAKHHLRKN
FT                   GNNQTCVLVSIQLKIADVVHFLETPMRIPYRVFSDTWFDYFDLRANVGELEDGLPTFAH
FT                   ERHYPGVLHLAALAMFDYVIGNMDRSPFKNNFVVGGVANQLVSDNTTLLHPNHPTFVYL
FT                   DHGSSFRLRRPERNPIAKSHIGFENGKEDTFCLFRGPLLRRIQELTGPSGEVTHGNKAK
FT                   EEAYGAAHNHRSTETLFTHMLRERVPPEVYSVIDSSNLDLVVVRMKELLAMAGRCLSDE
FT                   RIRRTVLFP"
FT                   /protein_id="XP_845794.1"
FT   repeat_region   424750..424784
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    424928..424950
FT                   /note="AT_rich"
FT   misc_feature    425088..425115
FT                   /note="AT_rich"
FT   repeat_region   425261..425292
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    425585..425607
FT                   /note="AT_rich"
FT   gene            <425709..>426926
FT                   /note="synonym: Tb07.43M14.80; eukaryotic peptide chain
FT                   release factor subunit 1, putative"
FT                   /db_xref="GeneID:3658382"
FT                   /locus_tag="Tb927.7.1710"
FT   mRNA            <425709..>426926
FT                   /db_xref="GI:72391001"
FT                   /db_xref="GeneID:3658382"
FT                   /locus_tag="Tb927.7.1710"
FT                   /transcript_id="XM_840702.1"
FT   CDS_pept        425709..426926
FT                   /locus_tag="Tb927.7.1710"
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic peptide chain release factor subunit
FT                   1, putative"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   translation release factor activity [goid 0003747];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72391002"
FT                   /db_xref="GeneID:3658382"
FT                   /translation="MRLLKKSVTAEGAVEVKLQVSTSEDLWHLYNLVLPGDQVRTNTRR
FT                   KVVKETSIGSQAAEVRTITLQLQVRNTEFSPDELRVQGVNVKENECVKLGAHHTLSVHA
FT                   FPPQDVVILKDEWNDVFAARLKEACDNESRADTVAVLMDSGTASVLLVTPSFMYTKAKI
FT                   EVSIAKKHKNDGTARDRSIQRFFKQVLDALCMHVDFDKAKLILICSPAHVREEFKAYVE
FT                   AAMAHSEAMAMRNLRKNFSKIVLIKVRDNTNDALREAFADPNIANQMESTRCRDEIKVW
FT                   QDFQKTMDEDPDRCVYTPQMVYRAAMLGAVGKLMVSDVVFRSEDPTVRRFYLSLIRFVR
FT                   QGGGGVSVFSSNHVTGEQLTQLGFVAAILHFPCDELDDLEVVENFIDSEEAATFIRENA
FT                   AASVVV"
FT                   /protein_id="XP_845795.1"
FT   gene            <427230..>428072
FT                   /note="synonym: Tb07.43M14.100; HIRA-interacting protein 5,
FT                   putative"
FT                   /db_xref="GeneID:3658388"
FT                   /locus_tag="Tb927.7.1720"
FT   mRNA            <427230..>428072
FT                   /db_xref="GI:72391003"
FT                   /db_xref="GeneID:3658388"
FT                   /locus_tag="Tb927.7.1720"
FT                   /transcript_id="XM_840703.1"
FT   CDS_pept        427230..428072
FT                   /locus_tag="Tb927.7.1720"
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HIRA-interacting protein 5, putative"
FT                   /note="similar to HIRA-interacting protein 5 (CGI-33).
FT                   (Swiss-Prot:Q9UMS0) [Homo sapiens;]; go_component:
FT                   mitochondrial matrix [goid 0005759]; go_function: protein
FT                   binding [goid 0005515]; go_process: iron-sulfur cluster
FT                   assembly [goid 0016226]"
FT                   /db_xref="GI:72391004"
FT                   /db_xref="GeneID:3658388"
FT                   /translation="MIKFTLRYFAVSSSTFYRLPRRMSTPTTRWAAFCALYSHRELLLC
FT                   TICRGVCSGKSSQRSIVVEKNETPNPDCLRFYSMELSFLPPGRSLDLPDAQHAGKSPLA
FT                   ELLFSISGVQSVFLADEYITVGKVPHVDWGSLVPQIQECIVEFAESGVGVLSEEGEACF
FT                   VDNNNDTDPEDDDDEVVLAVKELLSARIRPLLRADGGNVRYISMDDGTVFVLLEGACKS
FT                   CPSSGVTLKNGIERMLMHWIPEVVEVQECTDEMASDLLAEKELRRKLKKDEVSASQSN"
FT                   /protein_id="XP_845796.1"
FT   misc_feature    428096..428119
FT                   /note="GC_rich"
FT   gene            <429045..>429773
FT                   /note="synonym: Tb07.43M14.120; 60S ribosomal protein L7,
FT                   putative"
FT                   /db_xref="GeneID:3658387"
FT                   /locus_tag="Tb927.7.1730"
FT   mRNA            <429045..>429773
FT                   /db_xref="GI:72391005"
FT                   /db_xref="GeneID:3658387"
FT                   /locus_tag="Tb927.7.1730"
FT                   /transcript_id="XM_840704.1"
FT   CDS_pept        429045..429773
FT                   /locus_tag="Tb927.7.1730"
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L7, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: ribosome biogenesis [goid 0007046]"
FT                   /db_xref="GI:72391006"
FT                   /db_xref="GeneID:3658387"
FT                   /translation="MPAKAVPAPESAIKRAAFKQQQTENFKKAIAANKVAAAALKKLAY
FT                   SRGLKYSREYRSTEKKLAGLRRNARQHGNYYLEAKPKVAVVTRIRGIAKVPPKQRKILQ
FT                   LLRLRQIFNTVFVRLNKPMENMLRAVEPYIAYGYPSLSTVRAMVYKRGHLKINGQRVKI
FT                   TDNQMIKDKYHNDDIVCAEDIVNQIYACGKHFRTVTNGLWPFKLAPPAGGMRQKRRHFV
FT                   EGGDYGNRDTLINRFLARMI"
FT                   /protein_id="XP_845797.1"
FT   gene            <430013..>430786
FT                   /note="synonym: Tb07.43M14.130; 60S ribosomal protein L7,
FT                   putative"
FT                   /db_xref="GeneID:3658383"
FT                   /locus_tag="Tb927.7.1740"
FT   mRNA            <430013..>430786
FT                   /db_xref="GI:72391007"
FT                   /db_xref="GeneID:3658383"
FT                   /locus_tag="Tb927.7.1740"
FT                   /transcript_id="XM_840705.1"
FT   CDS_pept        430013..430786
FT                   /locus_tag="Tb927.7.1740"
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L7, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: ribosome biogenesis [goid 0007046]"
FT                   /db_xref="GI:72391008"
FT                   /db_xref="GeneID:3658383"
FT                   /translation="MFMTGLILLGKGREVMPAKAVPAPESAIKRAAFKQQQTENFKKAI
FT                   AANKVAAAALKKLAYSRGLKYSREYRSTEKKLAGLRRNARQHGNYYLEAKPKVAVVTRI
FT                   RGIAKVPPKQRKILQLLRLRQIFNTVFVRLNKPMENMLRAVEPYIAYGYPSLSTVRAMV
FT                   YKRGHLKINGQRVKITDNQMIKDKYHNDDIVCAEDIVNQIYACGKHFRTVTNGLWPFKL
FT                   APPAGGMRQKRRHFVEGGDYGNRDTLINRFLARMI"
FT                   /protein_id="XP_845798.1"
FT   gene            <431026..>431799
FT                   /note="synonym: Tb07.43M14.140; 60S ribosomal protein L7,
FT                   putative"
FT                   /db_xref="GeneID:3658390"
FT                   /locus_tag="Tb927.7.1750"
FT   mRNA            <431026..>431799
FT                   /db_xref="GI:72391009"
FT                   /db_xref="GeneID:3658390"
FT                   /locus_tag="Tb927.7.1750"
FT                   /transcript_id="XM_840706.1"
FT   CDS_pept        431026..431799
FT                   /locus_tag="Tb927.7.1750"
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L7, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: ribosome biogenesis [goid 0007046]"
FT                   /db_xref="GI:72391010"
FT                   /db_xref="GeneID:3658390"
FT                   /translation="MFMTGLILLGKGREVMPAKAVPAPESAIKRAAFKQQQTENFKKAI
FT                   AANKVAAAALKKLAYSRGLKYSREYRSTEKKLAGLRRNARQHGNYYLEAKPKVAVVTRI
FT                   RGIAKVPPKQRKILQLLRLRQIFNTVFVRLNKPMENMLRAVEPYIAYGYPSLSTVRAMV
FT                   YKRGHLKINGQRVKITDNQMIKDKYHNDDIVCAEDIVNQIYACGKHFRTVTNGLWPFKL
FT                   APPAGGMRQKRRHFVEGGDYGNRDTLINRFLARMI"
FT                   /protein_id="XP_845799.1"
FT   gene            <432875..>434089
FT                   /note="synonym: Tb07.43M14.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658385"
FT                   /locus_tag="Tb927.7.1760"
FT   mRNA            <432875..>434089
FT                   /db_xref="GI:72391011"
FT                   /db_xref="GeneID:3658385"
FT                   /locus_tag="Tb927.7.1760"
FT                   /transcript_id="XM_840707.1"
FT   CDS_pept        432875..434089
FT                   /locus_tag="Tb927.7.1760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391012"
FT                   /db_xref="GeneID:3658385"
FT                   /translation="MEHLIAARPLPPAIGRGDKIEGAKAPERMKTSIRDKLAAVQSMRT
FT                   NELQEALAREKQLSYVICELKKRSGEMEVSRETEREINAQKSFYIIKENECLKKQVQLL
FT                   ERELADARRRYERELLRLQTALNNTQEMLVTDRQISKKREGEREEAVQRLVTNLRLMQA
FT                   EIVHYESENKRLEATKQALSESKAECESVRAECSLWKEICQHQQWFLLNEREEFVDALR
FT                   VHELEEKQLWEGTTCAAAKVMAGYAKSVTERMESEVDICFKLKMLMLKDVVSTMKAEQL
FT                   EEQRKLAAEELKELREKRMALMKLFDNYQLQIEQNQRENCESLALLKSVDDATMAYVLK
FT                   QRDQEVVDKICLWKGAYLEGDKLLRALLKRYQPFQRGDEKFVSHVIGYLNKGPHVQEPL
FT                   DIWLD"
FT                   /protein_id="XP_845800.1"
FT   gene            <434534..>436363
FT                   /note="synonym: Tb07.43M14.170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658389"
FT                   /locus_tag="Tb927.7.1770"
FT   mRNA            <434534..>436363
FT                   /db_xref="GI:72391013"
FT                   /db_xref="GeneID:3658389"
FT                   /locus_tag="Tb927.7.1770"
FT                   /transcript_id="XM_840708.1"
FT   CDS_pept        434534..436363
FT                   /locus_tag="Tb927.7.1770"
FT                   /gene_family="HOG000257927" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391014"
FT                   /db_xref="GeneID:3658389"
FT                   /translation="MRRVMDRIYSQPGINAIIREKAAELGSAAAALSYVHRHLREALSS
FT                   AEVATAVHDVFPIGASQDSVGKLCRCRGMIQEVDPSVALYRASPNNFLGAETTDDAVML
FT                   EALQVYVIPVPGNAHFYGIQDQQQTGYQQAQGAATCTEGGGFLPADTSDLGRNSGLDRK
FT                   RRERTPMGDQTHQGEWNSEDPDVERDPKQSRYEGDKLLGTLPAHSAANVPLHHQLNLPH
FT                   PPLCWTLHTACVVTVIYGGSAEEEPLRLNDVVDFFGFIDEPSIVEHSCGPYAEVEDFEN
FT                   FDAWHTEQLPPGVLPRMTCLSWQRVYCQPDRPLCHFYFESKRPLVLQHLKNTVCKGDSL
FT                   LAEYILLHLCARVITQEGGMPVGDLPLRVEGDIVNLDMWSAYMREVAPVGEVLLDLSKL
FT                   TSSSLRVTSSLDEKSNILRAGVLQLANGTHVTLDSRAVAIASSGVQDAIFSAVHKQVLQ
FT                   LEYPYQKLELPIDLSFLVLSTTKLTDEIGFLQLAVSVRWLPELTTEAAISNDISVDEVR
FT                   DYFAQVRRLPRRFEREDDISTTQLSDKLLAFSQSEPRWNNHDSFIHNNSFAMAASMMRA
FT                   YAASVGREVITNESVGFVLALEGQRVARCYDET"
FT                   /protein_id="XP_845801.1"
FT   gene            <436819..>437526
FT                   /note="synonym: Tb07.43M14.180; adenine
FT                   phosphoribosyltransferase, putative"
FT                   /db_xref="GeneID:3658391"
FT                   /locus_tag="Tb927.7.1780"
FT   mRNA            <436819..>437526
FT                   /db_xref="GI:72391015"
FT                   /db_xref="GeneID:3658391"
FT                   /locus_tag="Tb927.7.1780"
FT                   /transcript_id="XM_840709.1"
FT   CDS_pept        436819..437526
FT                   /locus_tag="Tb927.7.1780"
FT                   /gene_family="HOG000036776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenine phosphoribosyltransferase, putative"
FT                   /EC_number="2.4.2.7"
FT                   /note="go_function: adenine phosphoribosyltransferase
FT                   activity [goid 0003999]; go_process: purine ribonucleoside
FT                   salvage [goid 0006166]"
FT                   /db_xref="GI:72391016"
FT                   /db_xref="GeneID:3658391"
FT                   /translation="MSLVEVLPNYFTLSKDSPLRKKFEKVYKWYSPAFSPHDVPRFAEV
FT                   GNITENPEVMRGIRDFFVDRYKNLQQPITHILGFDSRGFLLGPMIAVELNVPFVLIRKA
FT                   NKIAGVIIKSEPYTKEYAAESEECMTVRFGSFDKNSRVVLIDDVIATGGTMLAGVQLVD
FT                   ACGATLVEVAGILGLTFLKGTQPAHTFAGGRYSNVPFVTLVDETVLSDENCGDPLHHKG
FT                   SRIISCAEAKKLI"
FT                   /protein_id="XP_845802.1"
FT   misc_feature    437606..437626
FT                   /note="AT_rich"
FT   gene            <438274..>438966
FT                   /note="synonym: Tb07.43M14.200; adenine
FT                   phosphoribosyltransferase, putative"
FT                   /db_xref="GeneID:3658386"
FT                   /locus_tag="Tb927.7.1790"
FT   mRNA            <438274..>438966
FT                   /db_xref="GI:72391017"
FT                   /db_xref="GeneID:3658386"
FT                   /locus_tag="Tb927.7.1790"
FT                   /transcript_id="XM_840710.1"
FT   CDS_pept        438274..438966
FT                   /locus_tag="Tb927.7.1790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenine phosphoribosyltransferase, putative"
FT                   /EC_number="2.4.2.7"
FT                   /note="go_function: adenine phosphoribosyltransferase
FT                   activity [goid 0003999]; go_process: purine ribonucleoside
FT                   salvage [goid 0006166]"
FT                   /db_xref="GI:72391018"
FT                   /db_xref="GeneID:3658386"
FT                   /translation="MSQYDAILTERHPHHFTLADTHPLAKELHANIFGESDLTHANCAH
FT                   VYDISSLTEKPALFRKVIEFLKCRYETMGDTGPTHIIGVESRGYIIGAPLAVALGIPFV
FT                   TARVTKRFPSSFVPEGDDLKYLPMSRSIRNDSIPPRARVLIVDDFIGTGSTMLAALRLA
FT                   DIVAAQVVEVLTVCDVASLGGIKIIRESDDEMFKETPIFTLIHFKLSPREAEEQLEFVN
FT                   SYITRSRL"
FT                   /protein_id="XP_845803.1"
FT   repeat_region   439675..439713
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   440283..440326
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <440542..>441252
FT                   /note="synonym: Tb07.43M14.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658398"
FT                   /locus_tag="Tb927.7.1800"
FT   mRNA            <440542..>441252
FT                   /db_xref="GI:72391019"
FT                   /db_xref="GeneID:3658398"
FT                   /locus_tag="Tb927.7.1800"
FT                   /transcript_id="XM_840711.1"
FT   CDS_pept        440542..441252
FT                   /locus_tag="Tb927.7.1800"
FT                   /gene_family="HOG000257926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391020"
FT                   /db_xref="GeneID:3658398"
FT                   /translation="MSSLMSANNSGLVFAMALTTNQTFFLTYHMGSYANNAVMLSSRKP
FT                   MLMRDVFLTKSSSFFPNPLSCVYVHSPLDAVLNSLLAWFLVRPIIEIIGWRSGVAIYFG
FT                   SGFFSSFAYIFSSQLGTGRTNTPFDCADTSNGAFSGFATLSLVLPKCYIPTSKRIPTSY
FT                   LGVPYLIKCFYDEYVAPHYVDKREKGAIELRNWGFVGGVFFVMIYTSLVLRTKHDMTTM
FT                   RTFWRNMGITTRKK"
FT                   /protein_id="XP_845804.1"
FT   misc_feature    441453..441473
FT                   /note="AT_rich"
FT   gene            <441500..>442507
FT                   /note="synonym: Tb07.43M14.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658396"
FT                   /locus_tag="Tb927.7.1810"
FT   mRNA            <441500..>442507
FT                   /db_xref="GI:72391021"
FT                   /db_xref="GeneID:3658396"
FT                   /locus_tag="Tb927.7.1810"
FT                   /transcript_id="XM_840712.1"
FT   CDS_pept        441500..442507
FT                   /locus_tag="Tb927.7.1810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391022"
FT                   /db_xref="GeneID:3658396"
FT                   /translation="MGCQRMGTYPIAGVEDVRRAVVLEVNDFCISVKLPPASELRKDSR
FT                   YGINLDAQVVGFNARRVRDEYELAFRMYLTGNDLEKYARRCTVGYLFLPSGEEHYLGPL
FT                   IFGSDSVCSAMLVGEVPSNVEVCFECLSLPRGMTALMPACFRLAEIMATILDADVHNAS
FT                   VASSHMQNLVKLFPSYGDCMMQFDNWTKFVECAEAQLGLWCTRRYTEDEIKKYGFRNVA
FT                   HYEEPRLVSKRFIYDYVDGDVGKDALHHEKFEELKKLVAAALNSCTDCRRPSHLCKKHL
FT                   TEISSMPCVLQLNPPNYLAPVTAEGIVWRIVLQDPLHPLRVVWERKVTRVPDFR"
FT                   /protein_id="XP_845805.1"
FT   gene            <443289..>443576
FT                   /note="synonym: Tb07.43M14.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658397"
FT                   /locus_tag="Tb927.7.1820"
FT   mRNA            <443289..>443576
FT                   /db_xref="GI:72391023"
FT                   /db_xref="GeneID:3658397"
FT                   /locus_tag="Tb927.7.1820"
FT                   /transcript_id="XM_840713.1"
FT   CDS_pept        443289..443576
FT                   /locus_tag="Tb927.7.1820"
FT                   /gene_family="HOG000257922" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391024"
FT                   /db_xref="GeneID:3658397"
FT                   /translation="MPGRRGKQRVKRKKSKRQRPSGMERVLIESIHVRKHKERDILKHH
FT                   IPPSVKPRVKKVSLDATLPMFNAISKNANRSTSSVTMAKGTKSNGTVVGC"
FT                   /protein_id="XP_845806.1"
FT   gene            <444221..>445321
FT                   /note="synonym: Tb07.43M14.260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658392"
FT                   /locus_tag="Tb927.7.1830"
FT   mRNA            <444221..>445321
FT                   /db_xref="GI:72391025"
FT                   /db_xref="GeneID:3658392"
FT                   /locus_tag="Tb927.7.1830"
FT                   /transcript_id="XM_840714.1"
FT   CDS_pept        444221..445321
FT                   /locus_tag="Tb927.7.1830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391026"
FT                   /db_xref="GeneID:3658392"
FT                   /translation="MSRDATPYEGEGDDDDYDGAMRCILVEKIRRHRALEREGSVRVIT
FT                   RKGVPPPTLGELRAIADRRSRHEDLLRLQRRLDGVERRMGLWRDYLSYEPPPFMSSSVP
FT                   ANASETGILEGRAALLSPLSTLFRILLRENRARERLRLLRARPPLPKSQTPSLASARRM
FT                   SLEVARFVGDDIFVPPGDGCRSAITSEQLLVTPAYEVERLRNPLVFLAREYRMERLPEF
FT                   SLNPAKSPDTGHSSVVRKDCGASSAVTLSDFRQPPVMLEAFNIPCGIYDVGRRVHLIQG
FT                   YEPLYSSDGLGSLDSLSKAVKCRRDGPQRGDTAFIDGRLSQSLWCSGTPAKLRGPLQED
FT                   SLSGSDDDEVSPAFCADVSWLPKFPE"
FT                   /protein_id="XP_845807.1"
FT   gene            <445617..>446498
FT                   /note="synonym: Tb07.43M14.270; zinc finger protein,
FT                   putative"
FT                   /db_xref="GeneID:3658393"
FT                   /locus_tag="Tb927.7.1840"
FT   mRNA            <445617..>446498
FT                   /db_xref="GI:72391027"
FT                   /db_xref="GeneID:3658393"
FT                   /locus_tag="Tb927.7.1840"
FT                   /transcript_id="XM_840715.1"
FT   CDS_pept        445617..446498
FT                   /locus_tag="Tb927.7.1840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc finger protein, putative"
FT                   /note="similarity to zinc finger region of
FT                   Myotubularin-related protein 3 (EC 3.1.3.48) (FYVE
FT                   domain-containing dual specificity protein phosphatase 1)
FT                   (FYVE-DSP1) (Swiss-Prot:Q13615) [Homo sapiens];
FT                   go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:72391028"
FT                   /db_xref="GeneID:3658393"
FT                   /translation="MVGERTVSGGWKPDSSAPVCDSCDVTFTVYRRRHHCRCCGGVFCN
FT                   SCSNTYVSIPALHEMKPQRVCRACATALSGATDASATAGSAATDPVSGGSFPSIAEEEE
FT                   EGGDGIVSSGSSRLDDDSGDVDDSSSHSGDVSSAVAAVYSSVEEGPRTSSMTFIAALQE
FT                   NLRHSDDPGVVTILMYASATRQQLILVTVSDGETMSMLAERLADTYLRLENGPFKAASL
FT                   TDRENALKRLRFFSESAAVDNGAQAVSVALQHRRLVLTGCSLSELQCQSAKPLVHDFFC
FT                   SNISAGECGEWE"
FT                   /protein_id="XP_845808.1"
FT   misc_feature    447014..447034
FT                   /note="AT_rich"
FT   gene            <447061..>448068
FT                   /note="synonym: Tb07.43M14.280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658394"
FT                   /locus_tag="Tb927.7.1850"
FT   mRNA            <447061..>448068
FT                   /db_xref="GI:72391029"
FT                   /db_xref="GeneID:3658394"
FT                   /locus_tag="Tb927.7.1850"
FT                   /transcript_id="XM_840716.1"
FT   CDS_pept        447061..448068
FT                   /locus_tag="Tb927.7.1850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391030"
FT                   /db_xref="GeneID:3658394"
FT                   /translation="MGCQRMGTYPIAGVEDVRRAVVLEVNDFCISVKLPPASELRKDSR
FT                   YGINLDAQVVGFNARRVRDEYELAFRMYLTGNDLEKYARRCTVGYLFLPSGEEHYLGPL
FT                   IFGSDSVCSAMLVGEVPSNVEVCFECLSLPRGMTALMPACFRLAEIMATILDADVHNAS
FT                   VASSHMQNLVKLFPSYGDCMMQFDNWTKFVECAEAQLGLWCTRRYTEDEIKKYGFRNVA
FT                   HYEEPRLVSKRFIYDYVDGDVGKDALHHEKFEELKKLVAAALNSCTDCRRPSHLCKKHL
FT                   TEISSMPCVLQLNPPNYLAPVTAEGIVWRIVLQDPLHPLRVVWERKVTRVPDFR"
FT                   /protein_id="XP_845809.1"
FT   gene            <448850..>449137
FT                   /note="synonym: Tb07.43M14.290; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658395"
FT                   /locus_tag="Tb927.7.1860"
FT   mRNA            <448850..>449137
FT                   /db_xref="GI:72391031"
FT                   /db_xref="GeneID:3658395"
FT                   /locus_tag="Tb927.7.1860"
FT                   /transcript_id="XM_840717.1"
FT   CDS_pept        448850..449137
FT                   /locus_tag="Tb927.7.1860"
FT                   /gene_family="HOG000257922" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391032"
FT                   /db_xref="GeneID:3658395"
FT                   /translation="MPGRRGKQRVKRKKSKRQRPSGMERVLIESIHVRKHKERDILKHH
FT                   IPPSVKPRVKKVSLDATLPMFNAISKNANRSTSSVTMAKGTKSNGTVVGC"
FT                   /protein_id="XP_845810.1"
FT   gene            <449782..>450882
FT                   /note="synonym: Tb07.43M14.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658400"
FT                   /locus_tag="Tb927.7.1870"
FT   mRNA            <449782..>450882
FT                   /db_xref="GI:72391033"
FT                   /db_xref="GeneID:3658400"
FT                   /locus_tag="Tb927.7.1870"
FT                   /transcript_id="XM_840718.1"
FT   CDS_pept        449782..450882
FT                   /locus_tag="Tb927.7.1870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391034"
FT                   /db_xref="GeneID:3658400"
FT                   /translation="MSRDATPYEGEGDDDDYDGAMRCILVEKIRRHRALEREGSVRVIT
FT                   RKGVPPPTLGELRAIADRRSRHEDLLRLQRRLDGVERRMGLWRDYLSYEPPPFMSSSVP
FT                   ANASETGILEGRAALLSPLSTLFRILLRENRARERLRLLRARPPLPKSQTPSLASARRM
FT                   SLEVARFVGDDIFVPPGDGCRSAITSEQLLVTPAYEVERLRNPLVFLAREYRMERLPEF
FT                   SLNPAKSPDTGHSSVVRKDCGASSAVTLSDFRQPPVMLEAFNIPCGIYDVGRRVHLIQG
FT                   YEPLYSSDGLGSLDSLSKAVKCRRDGPQRGDTAFIDGRLSQSLWCSGTPAKLRGPLQED
FT                   SLSGSDDDEVSPAFCADVSWLPKFPE"
FT                   /protein_id="XP_845811.1"
FT   gene            <451178..>452059
FT                   /note="synonym: Tb07.43M14.320; zinc finger protein,
FT                   putative"
FT                   /db_xref="GeneID:3658399"
FT                   /locus_tag="Tb927.7.1880"
FT   mRNA            <451178..>452059
FT                   /db_xref="GI:72391035"
FT                   /db_xref="GeneID:3658399"
FT                   /locus_tag="Tb927.7.1880"
FT                   /transcript_id="XM_840719.1"
FT   CDS_pept        451178..452059
FT                   /locus_tag="Tb927.7.1880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc finger protein, putative"
FT                   /note="similar over 81 aa in zinc finger region to
FT                   Myotubularin-related protein 3 (EC 3.1.3.48) (FYVE
FT                   domain-containingdual specificity protein phosphatase 1)
FT                   (FYVE-DSP1). (Swiss-Prot:Q13615) [Homo sapiens];
FT                   go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:72391036"
FT                   /db_xref="GeneID:3658399"
FT                   /translation="MVGERTVSGGWKPDSSAPVCDSCDVTFTVYRRRHHCRCCGGVFCN
FT                   SCSNTYVSIPALHEMKPQRVCRACATALSGATDASATAGSAATDPVSGGSFPSIAEEEE
FT                   EGGDGIVSSGSSRLDDDSGDVDDSSSHSGDVSSAVAAVYSSVEEGPRTSSMTFIAALQE
FT                   NLRHSDDPGVVTILMYASATRQQLILVTVSDGETMSMLAERLADTYLRLENGPFKAASL
FT                   TDRENALKRLRFFSESAAVDNGAQAVSVALQHRRLVLTGCSLSELQCQSAKPLVHDFFC
FT                   SNISAGECGEWE"
FT                   /protein_id="XP_845812.1"
FT   gene            <452593..>453459
FT                   /note="synonym: Tb07.43M14.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658402"
FT                   /locus_tag="Tb927.7.1890"
FT   mRNA            <452593..>453459
FT                   /db_xref="GI:72391037"
FT                   /db_xref="GeneID:3658402"
FT                   /locus_tag="Tb927.7.1890"
FT                   /transcript_id="XM_840720.1"
FT   CDS_pept        452593..453459
FT                   /locus_tag="Tb927.7.1890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391038"
FT                   /db_xref="GeneID:3658402"
FT                   /translation="MNVSEFLKVWKDVKVCDDVVADGGSGGCNLDIGVPSLSEVDDGDE
FT                   VPVEYGDVSRDDFGGDDGGCEVFDEAGSFFYGQRSKRRRYDGLKTDSISLCKPREPYAC
FT                   LKTFSTNEGSYDNFVSGDSGRKRVKVQIAGRGKPRKGSLAAVTALREELLRKKTLLDKS
FT                   CRQEVVDSSTNEEFPTIAEGESTLDELLLSVEDLVPVGNLATIVEKSLAPAQTSSVEDP
FT                   TLSAVSTEAETPLKVDEPGERKESTGSAPKAGKLSMFARAKLYVSGGDALEGKANIEDF
FT                   FGKRFTS"
FT                   /protein_id="XP_845813.1"
FT   gene            <453701..>454579
FT                   /note="synonym: Tb07.43M14.340; protein kinase, putative"
FT                   /db_xref="GeneID:3658409"
FT                   /locus_tag="Tb927.7.1900"
FT   mRNA            <453701..>454579
FT                   /db_xref="GI:72391039"
FT                   /db_xref="GeneID:3658409"
FT                   /locus_tag="Tb927.7.1900"
FT                   /transcript_id="XM_840721.1"
FT   CDS_pept        453701..454579
FT                   /locus_tag="Tb927.7.1900"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_process: regulation of cell
FT                   cycle [goid 0000074]; go_process: protein amino acid
FT                   phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72391040"
FT                   /db_xref="GeneID:3658409"
FT                   /translation="MEKYLLGPSMGEGRFGSVRSAVIRGSGVPVAIKLINVTRVEEGIP
FT                   HMVARELLVSMRLQHPYIIRTYEVFPYGSSVALVMERCATDLSAVLCERSPANPLSPQS
FT                   AKSLFRMLLGALAYMHKEGILHRDVKPSNCFLARDGTLRLGDFGLSRMQDTEESMTHEV
FT                   VSRWYRPPELLLGQRHYGPEVDMWSAGCVFVELLRGYTGAFFASDGDVMQLSRIFDVLG
FT                   TPTQESWPTAELLPDWGKVHFEPKNPCPLGEFFPEASGSAVDLLRGLLCLDPSRRLSAA
FT                   DALCHTYFNEY"
FT                   /protein_id="XP_845814.1"
FT   gene            <454902..>457814
FT                   /note="synonym: Tb07.43M14.350; glycine dehydrogenase,
FT                   putative"
FT                   /db_xref="GeneID:3658401"
FT                   /locus_tag="Tb927.7.1910"
FT   mRNA            <454902..>457814
FT                   /db_xref="GI:72391041"
FT                   /db_xref="GeneID:3658401"
FT                   /locus_tag="Tb927.7.1910"
FT                   /transcript_id="XM_840722.1"
FT   CDS_pept        454902..457814
FT                   /locus_tag="Tb927.7.1910"
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycine dehydrogenase, putative"
FT                   /EC_number="1.4.4.2"
FT                   /note="go_function: glycine dehydrogenase (decarboxylating)
FT                   activity [goid 0004375]; go_process: glycine
FT                   decarboxylation via glycine cleavage system [goid 0019464]"
FT                   /db_xref="GI:72391042"
FT                   /db_xref="GeneID:3658401"
FT                   /translation="MYRSAFRSLRCSTVKYARWSAAGNYVNRHVGPTAADTEVMLQMIG
FT                   KKTISDLMADAIPAELMRPPMKEIEPLSEKDALSSVLSLGARNRVLKSMIGQGYYECIT
FT                   PSVLLRNVIENPGWYTPYTPYQAEISQGRLESLLNFQTMITDLTKMDVANASLLDQATA
FT                   CAEAMYLAFRHHNRKRDTFFVSKDVFPSCIEMIKTRAEPLKIKVVVDDPALFDWGEVSP
FT                   CGMLVQNPDANGTVHDFTELFQKAKDHGVLCCCGADLMASLLIKPPGEMGADVVVGTSQ
FT                   RFGIPLGYGGPHAAFFAAKEQFKRLVPGRIVGVSKDVAGDPAIRMALQTREQHIKRERA
FT                   TSNICTAQALLATVSAFYAVYHGPGGLTDIANEIHQKAKTLAVGMESAGHSVVNTTFFD
FT                   TLTFNLKGITPEDYASQCNEKGINVFLDYGTGTVSISVDEATTETHIMSLLEAAGLKLP
FT                   VFAALTKIGRNKTAFPEALARTSSFLQHSVFCKYRSEGELMRYIHRLQRKDYGLTHGCI
FT                   PLGSCTMKLNPASAMLPLSWGTFTNLHPLAPSDQVQGYSAMCFDLEQKIRDVTGLDAVS
FT                   LQPNSGAQGEYAGLRVVRAYHQSKGEGQRNVCLIPVSAHGTNPASAVLAGMKVVTLKCL
FT                   EDGRIDVEDLKQLCEKHSKELSCIMLTYPSTYGLFDRDILSVTSLVHQHGGQCYIDGAN
FT                   LNAMVGYTGPGFIGGDLCHINLHKTFSIPHGGGGPGMGPIAVRQHLAPFLPNSVLRQKV
FT                   GGSQSFGQVSQAAYGSASILTVSYMLMLMLGTRGMKVCTEHAILNANYLKKRLEKHYRI
FT                   MFLGEEDLCAHEFIIDLRPFKKSAEVEAEDVSKRLMDYGIHSPTVAFPIPGTLMIEPTE
FT                   SESKQELDRLADALISIRGEIAAIERGEQDKTNNVLKNAPHTAKCVTAENWDRPYSRRT
FT                   AAFPAPHSNIEKYWPTVGRIDGAYGDRHLMCNCMSLDSFK"
FT                   /protein_id="XP_845815.1"
FT   repeat_region   458406..458426
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   gene            <458754..>460385
FT                   /note="synonym: Tb07.43M14.360; leucine-rich repeat protein
FT                   (LRRP), putative"
FT                   /db_xref="GeneID:3658403"
FT                   /locus_tag="Tb927.7.1920"
FT   mRNA            <458754..>460385
FT                   /db_xref="GI:72391043"
FT                   /db_xref="GeneID:3658403"
FT                   /locus_tag="Tb927.7.1920"
FT                   /transcript_id="XM_840723.1"
FT   CDS_pept        458754..460385
FT                   /locus_tag="Tb927.7.1920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="leucine-rich repeat protein (LRRP), putative"
FT                   /db_xref="GI:72391044"
FT                   /db_xref="GeneID:3658403"
FT                   /translation="MLQAAEQRNSLRLANAVALVADASDQPITEYVAENGGAAPRTSST
FT                   LTLAERAIRNMEIRALCEDKNYQRVKLTSCRGSVDLKLFTCMTSLRDIHVEMDGDICNI
FT                   PSLQDLPDIRRIYLSSKTMNDSDVRPLCNIETLEEINICNSPNVVNLGNVGRLPRVHTL
FT                   MVNRTGVIDEFLCGLTLSNTLRRIDLSECLRLTDVEPLASIETLEEIDVSGCFPCVCGI
FT                   GALGALPRLKILNASLTGITDECLARLSASQSLKKLLLSKCERLTNVSRLDTVTTLQEL
FT                   DLAECKNVVSGIGSLGTLPVLQCLDLSGTGVADDDLCALSCSATISKLIMKRCVLLTNV
FT                   SPLEKLRTLQHVNIGECINVIEGLNSFSELPSLRTLYMHYTPVTNECLSVISTSQSIVS
FT                   LNIAACTRITDISCLANLKTLEDVNINMCESVEKGLGDISGLSNLRMLSARSTVLDDEC
FT                   VKIMSSSSNLERSSLEGCAKITDVTPLAAVKSLEYVNLDNCPVVKGIAELGKLPLLRVI
FT                   SLRETNICEEDIKNLKKFNRRLYIER"
FT                   /protein_id="XP_845816.1"
FT   misc_feature    460794..460816
FT                   /note="AT_rich"
FT   repeat_region   460889..460910
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <461662..>462993
FT                   /note="synonym: Tb07.43M14.370; nucleoside diphosphatase,
FT                   putative"
FT                   /db_xref="GeneID:3658404"
FT                   /locus_tag="Tb927.7.1930"
FT   mRNA            <461662..>462993
FT                   /db_xref="GI:72391045"
FT                   /db_xref="GeneID:3658404"
FT                   /locus_tag="Tb927.7.1930"
FT                   /transcript_id="XM_840724.1"
FT   CDS_pept        461662..462993
FT                   /locus_tag="Tb927.7.1930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside diphosphatase, putative"
FT                   /EC_number="3.6.1.6"
FT                   /note="go_function: nucleoside-diphosphatase activity [goid
FT                   0017110]; go_process: nucleoside metabolism [goid 0009116]"
FT                   /db_xref="GI:72391046"
FT                   /db_xref="GeneID:3658404"
FT                   /translation="MVTLRMAARRRGLHAKRNWHVSVFLFLGLTFLVALFALLSLITGK
FT                   GSDNSDLPKSTTGLCDTPLMYDILLDAGSTGTRVHIFEYNKWRLVGEVYNSTHPGLSQL
FT                   ASDDSANISANLQPLMATAVRAIPEVYHPCTKVTLKATAGLRLLPPEKVEFILRETKKV
FT                   LRRYPFVVGSVSVMDGDEEGMDAWLTVAYLLGRFDRSAEGTPNSTAKRIATIDMGGAST
FT                   QLVLQMSPGYTGETQFITSLHFGVTEIPLYTYSFLGLGLRQATLEVLRELTAVERTSFP
FT                   CFPSRYRHRIDGEGGVSFVENIDGNAQGFGACLRFFHRFINTRSSEHLAALRGGRHVLK
FT                   FAEGAQSVEIFAFSFFHRLWRLRPADNVTVQYYKELGEQVCSAGGKHNSGTNCMDVAYL
FT                   YGFLTSGLGLSDKTKLNVPYVLSDVKVTWALGASLLSVEGKVRR"
FT                   /protein_id="XP_845817.1"
FT   misc_feature    463048..463085
FT                   /note="T-rich"
FT   gene            <464036..>464509
FT                   /note="synonym: Tb07.43M14.380; hypothetical protein"
FT                   /db_xref="GeneID:3658410"
FT                   /locus_tag="Tb927.7.1940"
FT   mRNA            <464036..>464509
FT                   /db_xref="GI:72391047"
FT                   /db_xref="GeneID:3658410"
FT                   /locus_tag="Tb927.7.1940"
FT                   /transcript_id="XM_840725.1"
FT   CDS_pept        464036..464509
FT                   /locus_tag="Tb927.7.1940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72391048"
FT                   /db_xref="GeneID:3658410"
FT                   /translation="MDNIHHRPASRKNGFLLSEVFSSFTAFLVNGVHFNVTVRFPAPSC
FT                   RGKPEAARIFHVKNNSIACEPPMPSYGTGRQLHHGAVPFPVGSTSHSIMLLPGRCGNWF
FT                   FFHPQLQTGEGPPTSSFRIISSASKISTSSLAPSQRYITSGNSTVIGGPTATC"
FT                   /protein_id="XP_845818.1"
FT   misc_feature    465346..465366
FT                   /note="AT_rich"
FT   misc_feature    465663..512454
FT                   /note="RHS array, number of copies uncertain. May contain
FT                   misassembly."
FT   gene            complement(<465663..>467735)
FT                   /note="synonym: Tb07.43M14.390; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658412"
FT                   /locus_tag="Tb927.7.1950"
FT   mRNA            complement(<465663..>467735)
FT                   /db_xref="GI:72391049"
FT                   /db_xref="GeneID:3658412"
FT                   /locus_tag="Tb927.7.1950"
FT                   /transcript_id="XM_840726.1"
FT   CDS_pept        complement(465663..467735)
FT                   /locus_tag="Tb927.7.1950"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Belongs to the RHS family. (PMID:12455980).
FT                   Part of an RHS array that may contain misassembly, number
FT                   of copies is uncertain; go_component: nucleus [goid
FT                   0005634]"
FT                   /db_xref="GI:72391050"
FT                   /db_xref="GeneID:3658412"
FT                   /translation="MIQNNGNMRNTQNVFNERFNRAQGEVQEQGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKMGWPSDRFQCSLISLYGGNGGHIYVRREMMRVWYIIQRKLNAWWVE
FT                   KTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGN
FT                   EEGRVVLHKREDVTNVIEEMRLKKRGHIIFDINSRKETLPYEIPRNVWGVTVLAPPDGV
FT                   RYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARLKVKEELEDEWR
FT                   LVERRVDFVGPLPRYVFSNGAGCREAAVIEYLSSLSCNRRDGYDMMMGKYFEWKGNHFT
FT                   ESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAY
FT                   SLKTRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPEAG
FT                   QNAIGNCKYKVLYRSLEKSKLFVDGFFFVEDCSRRVADMRDGFPQLGVASKTIVLIQIT
FT                   DNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNT
FT                   ADAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRKRGHE"
FT                   /protein_id="XP_845819.1"
FT   repeat_region   470269..470289
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    470930..470950
FT                   /note="AT_rich"
FT   gene            complement(<471247..>473319)
FT                   /note="synonym: Tb07.43M14.400; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658405"
FT                   /locus_tag="Tb927.7.1960"
FT   mRNA            complement(<471247..>473319)
FT                   /db_xref="GI:72391051"
FT                   /db_xref="GeneID:3658405"
FT                   /locus_tag="Tb927.7.1960"
FT                   /transcript_id="XM_840727.1"
FT   CDS_pept        complement(471247..473319)
FT                   /locus_tag="Tb927.7.1960"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Part of an RHS array that may contain
FT                   misassembly, number of copies is uncertain; go_component:
FT                   nucleus [goid 0005634]"
FT                   /db_xref="GI:72391052"
FT                   /db_xref="GeneID:3658405"
FT                   /translation="MIQNNGNMRNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKICNPSCGFQCSLISLYGGNGGHIYVRREMMRVWYIIQRKLNAWWVE
FT                   KTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGN
FT                   EEGRVVLYEREDVTNVIEEMRLKKRGHIIFDINSPKETLPYEIPRNVWGVTVLAPPDGV
FT                   RYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSVFPNYTTLDENARLKVKEELEDEWR
FT                   LVERRVDVVGPLPRYVFSNGACCREAAVIRYLSSLSCNRRDGYDMMMGKYFEWKGNHFT
FT                   ESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAY
FT                   SLKTRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPEAG
FT                   QNAIGNCKYKVLYRSLEKSKLFVDGFFFVEDCSRRVADMRDGFPQLGVASKTIVLIQIT
FT                   DNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNT
FT                   ADAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRKRGHE"
FT                   /protein_id="XP_845820.1"
FT   repeat_region   475854..475874
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   475874..475900
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   misc_feature    476521..476541
FT                   /note="AT_rich"
FT   gene            complement(<476850..>478910)
FT                   /note="synonym: Tb07.43M14.410; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658411"
FT                   /locus_tag="Tb927.7.1970"
FT   mRNA            complement(<476850..>478910)
FT                   /db_xref="GI:72391053"
FT                   /db_xref="GeneID:3658411"
FT                   /locus_tag="Tb927.7.1970"
FT                   /transcript_id="XM_840728.1"
FT   CDS_pept        complement(476850..478910)
FT                   /locus_tag="Tb927.7.1970"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Part of an RHS array that may contain
FT                   misassembly, number of copies is uncertain; go_component:
FT                   nucleus [goid 0005634]"
FT                   /db_xref="GI:72391054"
FT                   /db_xref="GeneID:3658411"
FT                   /translation="MIQNNGNMRNTQNVFNERFNRAQGEVQEQGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKMGWPSDRFQCSLISLYGGNGGHIYVRREMMRVWYIIQRKLNAWWVE
FT                   KTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGN
FT                   EEGRVVLHKREDVTNVIEEMRLKKRGHIIFDINSRKETLPYEIPRNVWGVTVLAPPDGV
FT                   RYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARLKVKEELEDEWR
FT                   LVERRVDFVGPLPRYVFSNGAGCREAAVIEYLSSLSCNRRDGYDMMMGKYFEWKGNHFT
FT                   ESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKVGAY
FT                   SLKTRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTG
FT                   QNAIGNCKYKVLYRSLEESELFVDGFFFVEDCSRRVADMRDGFPQLGVASKTIVLIQIT
FT                   DNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNT
FT                   ADAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRK"
FT                   /protein_id="XP_845821.1"
FT   misc_feature    482097..482117
FT                   /note="AT_rich"
FT   gene            complement(<482414..>484495)
FT                   /note="synonym: Tb07.43M14.420; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658408"
FT                   /locus_tag="Tb927.7.1980"
FT   mRNA            complement(<482414..>484495)
FT                   /db_xref="GI:72391055"
FT                   /db_xref="GeneID:3658408"
FT                   /locus_tag="Tb927.7.1980"
FT                   /transcript_id="XM_840729.1"
FT   CDS_pept        complement(482414..484495)
FT                   /locus_tag="Tb927.7.1980"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Part of an RHS array that may contain
FT                   misassembly, number of copies is uncertain; go_component:
FT                   nucleus [goid 0005634]"
FT                   /db_xref="GI:72391056"
FT                   /db_xref="GeneID:3658408"
FT                   /translation="MIQNNGNMGNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKMGWPSDRFQCSLISLYQRIGILDNNVYIRREMMRVWYIIQRKLNAW
FT                   WVEKTESTPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVFFTGSKAYLIYNK
FT                   KGNEEGRVVLYKREDVTNVIKEMRLKKRGHIIFDINSRKETLPYEIPRNVWGVTVLAPP
FT                   DGVSYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARLKVKEELED
FT                   EWRLVERRVDFVGPLPRYVFSNGAGCREAAVIGYLSSLSCNRRDGYDMMMGKYFEWKGN
FT                   HFTESLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFADVAESMSSHEFMMEYGKV
FT                   GAYSLKTRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLP
FT                   KTGQNAIGNCKYKVLYRSLEESKLFVDGFFFVEDCSRRVADMRDGFPQLGVASKTIVLI
FT                   QITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVN
FT                   NNTADAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRKRGHE"
FT                   /protein_id="XP_845822.1"
FT   repeat_region   487028..487048
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    487685..487705
FT                   /note="AT_rich"
FT   gene            complement(488002..490083)
FT                   /note="synonym: Tb07.43M14.430; retrotransposon hot spot
FT                   protein (RHS, pseudogene), putative RHS7: pers. comm.
FT                   Frederic Bringaud, CNRS/BordeauxII University. Part of an
FT                   RHS array that may contain misassembly, number of copies is
FT                   uncertain."
FT                   /db_xref="GeneID:3658406"
FT                   /locus_tag="Tb927.7.1990"
FT                   /pseudo
FT   repeat_region   490140..490178
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    493296..493316
FT                   /note="AT_rich"
FT   gene            complement(<493613..>495688)
FT                   /note="synonym: Tb07.43M14.440; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658407"
FT                   /locus_tag="Tb927.7.2000"
FT   mRNA            complement(<493613..>495688)
FT                   /db_xref="GI:72391057"
FT                   /db_xref="GeneID:3658407"
FT                   /locus_tag="Tb927.7.2000"
FT                   /transcript_id="XM_840730.1"
FT   CDS_pept        complement(493613..495688)
FT                   /locus_tag="Tb927.7.2000"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Belongs to the RHS family.(PMID: 12455980) Part
FT                   of an RHS array that may contain misassembly, number of
FT                   copies is uncertain; go_component: nucleus [goid 0005634]"
FT                   /db_xref="GI:72391058"
FT                   /db_xref="GeneID:3658407"
FT                   /translation="MIQNNGNMGNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKMGWPSATFQLGINDESGIMDNNVYIRREMMRVWYIIQRKLNAWWVQ
FT                   KTESTPPTHIVIGIPGTGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDVDAYLIYNKKGN
FT                   EEGRVVLYKRKDVTNVIKEMRLKKRGHIIFDTDGPDETPPYETQYLGWGITTLNTPDTY
FT                   YYKHWEKDYFSWNVILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARAKVKEELEDEWR
FT                   LVERRVDVVGPLPRYVFSKQSYTNRLQDISDYLRSLENEKKEEYETILEKYFTWKSEKV
FT                   VHSLVKIVREGGRYDDLESYHCRPLSVAIGNMILCTLFSTVATLMVEKHSESVYGKVGA
FT                   YSLETRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKT
FT                   GQNAIGNCKYKVLYRSLEESKLFVDGFFFVEDCSRRVADMRDGFPQLGVASKTIVLIQI
FT                   TDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNN
FT                   TADAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRKRGHE"
FT                   /protein_id="XP_845823.1"
FT   repeat_region   495745..495783
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    498899..498919
FT                   /note="AT_rich"
FT   gene            complement(<499215..>501287)
FT                   /note="synonym: Tb07.43M14.450; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658416"
FT                   /locus_tag="Tb927.7.2010"
FT   mRNA            complement(<499215..>501287)
FT                   /db_xref="GI:72391059"
FT                   /db_xref="GeneID:3658416"
FT                   /locus_tag="Tb927.7.2010"
FT                   /transcript_id="XM_840731.1"
FT   CDS_pept        complement(499215..501287)
FT                   /locus_tag="Tb927.7.2010"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Belongs to the RHS family. (PMID:12455980) Part
FT                   of an RHS array that may contain misassembly, number of
FT                   copies is uncertain; go_component: nucleus [goid 0005634]"
FT                   /db_xref="GI:72391060"
FT                   /db_xref="GeneID:3658416"
FT                   /translation="MIQNNGNMRNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKMGWPSATFQLGINDESGIMDNNVYIRREMMRVWYIIQQKLNAWWVQ
FT                   KTERPPTHIVIGIPGTGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDAKAYLIYNKKGNE
FT                   EGRVVLYKRKDVTNVIEEMRFKKRGHIIFDTDGPDETPPYETQYLGWGITTLNTPDTHY
FT                   YEHWEKDYLSWNVILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARAKVKEELEDEWRL
FT                   VERRVDVVGPLPRYVFSKQSYTNRLQDISDYLRSLENEKKEEYETILEKYFTWKSEKVV
FT                   HSLVKIVREGSGYGNLESYHCRPLSVAIGNMILCTLFSTVATLMVEKHSESVYGKVGAY
FT                   SLETRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKTG
FT                   QNAIGNCKYKVLYRSFEESKLFVDGFFFVEDCSRRVADMRDGFRQLGVASKTIVLIQIT
FT                   DNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNNT
FT                   ADAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRKRGHE"
FT                   /protein_id="XP_845824.1"
FT   repeat_region   501344..501368
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   501610..501727
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tataa"
FT                   /rpt_type="tandem"
FT   repeat_region   503822..503842
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<504809..>506872)
FT                   /note="synonym: Tb07.43M14.460; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658413"
FT                   /locus_tag="Tb927.7.2020"
FT   mRNA            complement(<504809..>506872)
FT                   /db_xref="GI:72391061"
FT                   /db_xref="GeneID:3658413"
FT                   /locus_tag="Tb927.7.2020"
FT                   /transcript_id="XM_840732.1"
FT   CDS_pept        complement(504809..506872)
FT                   /locus_tag="Tb927.7.2020"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Belongs to the RHS family. (PMID:12455980);
FT                   go_component: nucleus [goid 0005634]"
FT                   /db_xref="GI:72391062"
FT                   /db_xref="GeneID:3658413"
FT                   /translation="MIQNNGNMRNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSKMGWPSATFQLGINDESGIMDNNVYIRREMMRVWYIIQQKLKEWWVQ
FT                   KTESTPPTHIIIGIPGTGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDAKAYLIYNKKGN
FT                   EEGRVVLYKRKDVTNVIKEMRLKKRGHIIFDTDGPDETPPYETQYLGWGITTLNTPDTH
FT                   YYEHWEKDYLSWNVILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARAKVKEELEDEWR
FT                   LVERRVDVVGPLPRYVFSKQSYTNRLQDISDYLRSLENEKKEEYETILEKYFTWKSEKV
FT                   VHSLVKIVREGGRYDDLESYHCRPLSVPIGNMILCTLFSTVATLMVEKHSESVYGKVGA
FT                   YSLETRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQIFEQKFLPKT
FT                   GQNAIGNCKYKVLYRSLEESKLFVDGFFFVEDCSRRVADMRDGFPQLGVASKTIVLIQI
FT                   TDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNNN
FT                   TADAEQQTEETQVFWDGIDQYQITFDNKIQKELIIAYHEERKYRDAPAFTRK"
FT                   /protein_id="XP_845825.1"
FT   misc_feature    510060..510080
FT                   /note="AT_rich"
FT   gene            complement(<510388..>512454)
FT                   /note="synonym: Tb07.43M14.470; retrotransposon hot spot
FT                   (RHS) protein, putative"
FT                   /db_xref="GeneID:3658414"
FT                   /locus_tag="Tb927.7.2030"
FT   mRNA            complement(<510388..>512454)
FT                   /db_xref="GI:72391063"
FT                   /db_xref="GeneID:3658414"
FT                   /locus_tag="Tb927.7.2030"
FT                   /transcript_id="XM_840733.1"
FT   CDS_pept        complement(510388..512454)
FT                   /locus_tag="Tb927.7.2030"
FT                   /gene_family="HOG000100994" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="retrotransposon hot spot (RHS) protein, putative"
FT                   /note="RHS7: pers. comm. Frederic Bringaud, CNRS/BordeauxII
FT                   University. Belongs to the RHS family. (PMID:12455980).
FT                   Part of an RHS array that may contain misassembly, number
FT                   of copies is uncertain; go_component: nucleus [goid
FT                   0005634]"
FT                   /db_xref="GI:72391064"
FT                   /db_xref="GeneID:3658414"
FT                   /translation="MIQNNGNMGNTQNVFNERFNRAQGEVQERGGRQMQNPSVTGKRKS
FT                   REEELYESLYYAKWSYVMSGYNQEPLGMKVFFGRPQHIWTEEEVDITPEHCEVDAELEE
FT                   RPTGLEIFVLTSMMGWPSDRFQGGLISLYQRIGILDNNVYIRREMMRVWYIIQQKLNAW
FT                   WVQKTERPPTHIVIGISGIGKSCGVGSFLLHSLLHFHEGMLDVVVYFTDAKAYLIYNKK
FT                   GNEEGRVVLYKRKDVTNVIEEMRLKKRGHIIFDINSPKETLPYEIPRNVWGVTVLAPPD
FT                   GVRYKYWMKNLEQTRIILNCDDVRDIKAFVAWKKLSLFPNYTTLDENARAKVKEELEDE
FT                   WRLVERRVDVVGPLPRYVFGNRGNCRELEVIRYLSRLSCNRRDGYDMMMGKYFEWKGND
FT                   FTQPLIKIVRERSRYGNLESYHCRPLSVAIGNMILCTLFATVAKSMSSLEFMMGYGKVG
FT                   AYSLKTRALVSLLFPRVFCVVTKHLNYLRRLGETEDKRSILKDMTPQQFQLVEQKFLPE
FT                   AGQNAIGNCEYKVLYRSFEESKPLVGGFFFVEDCSRRVADMRDGFPQLGVASKTIVLIQ
FT                   ITDNYRKEASVSELQEFMTNIARYFSDWDTFSRNMAWEMIYVNAIYGGVIKTRQRCVNN
FT                   NTADAEQQTEETQVFWDGIDQYQITFDKKIQKELIIAYHEERKYRDAPAFTRK"
FT                   /protein_id="XP_845826.1"
FT   gene            complement(<514253..>515074)
FT                   /note="synonym: Tb07.43M14.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658415"
FT                   /locus_tag="Tb927.7.2040"
FT   mRNA            complement(<514253..>515074)
FT                   /db_xref="GI:72391065"
FT                   /db_xref="GeneID:3658415"
FT                   /locus_tag="Tb927.7.2040"
FT                   /transcript_id="XM_840734.1"
FT   CDS_pept        complement(514253..515074)
FT                   /locus_tag="Tb927.7.2040"
FT                   /gene_family="HOG000257265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391066"
FT                   /db_xref="GeneID:3658415"
FT                   /translation="MWRQILQRMGIVPHPKLVRRLKPDKPVHGLFCCPGRYGIEAGEVL
FT                   CSVPCCLCVAPNISNHIHYGPALMRAVSSHSTTEGMVRVEYSRESALTTVLCAIHMSHG
FT                   PSDLREYLEWIVVERPDDISMNHALGTELYGHLRTIERINAEIITQLCVDARSVGVPIS
FT                   IETMKRAHAICSSRCVDVPTHADIFGGPALVPFVDLINHSSEDPNITVAVESFPFLHCE
FT                   QNQMLLEHFYVTVRAEGGIHPEEELHYQYLEPTDRQSTNPLYWASRFHMFD"
FT                   /protein_id="XP_845827.1"
FT   gene            complement(<515353..>517776)
FT                   /note="synonym: Tb07.43M14.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658417"
FT                   /locus_tag="Tb927.7.2050"
FT   mRNA            complement(<515353..>517776)
FT                   /db_xref="GI:72391067"
FT                   /db_xref="GeneID:3658417"
FT                   /locus_tag="Tb927.7.2050"
FT                   /transcript_id="XM_840735.1"
FT   CDS_pept        complement(515353..517776)
FT                   /locus_tag="Tb927.7.2050"
FT                   /gene_family="HOG000257267" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391068"
FT                   /db_xref="GeneID:3658417"
FT                   /translation="MNCSTAGDQDGSSYDAVVQRINGIAEQLKSLRYECANCLNKIRHD
FT                   KAVFSCRDCYCIFHLYCIKRWAKEDASGDGNAFRCPHCQVVQRSDLKYYCFCGKVRDPK
FT                   YDPHITPHSCGDTCGKARPNNCPHSCPLPCHPGPCVPCSAVSGPGSCGCGSTSYTWRCG
FT                   QPDPLKTCDRICGKMLSCGKHLCPDKCHHGACRGCSKQSTTSCHCGSEVRPMRCGSTVF
FT                   SCGKVCGRELKCGVHHCERMCHEGTCPPCKTDPSVVATCPCGSVPLVVVRTRCSDPVPV
FT                   CGNVCGRWLDCGEHKCDAKCHEGGCEPCQQQVAATCSCGKTQATLPCLMRRSFRCNKVC
FT                   KAALSCGKHQCRARCCPARKGNNADAHCCRQVCNKKLSCGHNCMELCHRGPCPSCPNVV
FT                   SERLRCRCGAEELMPPQPCGTKPPQCNRPCSVPLPCGHPTGSHICHFGDCPPCMFPVER
FT                   LCAGGHRIVRNVPCSAESTTCTYKCGKQLSCGHKCVRFCHGGPCVDEQRPCGQPCGKIQ
FT                   DVCGHACASKCHGSANCPVCIVVEELHCECRRRVVQVSCGKLIQFKKEHQGQRYLIKCD
FT                   AECLAVQRLEILSKRIKPHPPIKYSVFLWEAALTDVEQIRKFERILHTFVVGCEGVMCL
FT                   GAMAAPKRAIVHNMCHYYHINSESVDPEPRRGCLLTRTPKTKLPDPLLSVAIATPEQHS
FT                   PLFFMERICQEDKLVAAHVIVVNGEHANTVTIARVLHDFAGEFVCEEGGLNNGVPRLRL
FT                   FFVQKAKRGEAYRHLQAVKPPFEFYIPSADDGKEFRKLQNPWSKITSWRERETR"
FT                   /protein_id="XP_845828.1"
FT   gene            complement(<518221..>519021)
FT                   /note="synonym: Tb07.43M14.510; DNA repair protein,
FT                   putative"
FT                   /db_xref="GeneID:3658418"
FT                   /locus_tag="Tb927.7.2060"
FT   mRNA            complement(<518221..>519021)
FT                   /db_xref="GI:72391069"
FT                   /db_xref="GeneID:3658418"
FT                   /locus_tag="Tb927.7.2060"
FT                   /transcript_id="XM_840736.1"
FT   CDS_pept        complement(518221..519021)
FT                   /locus_tag="Tb927.7.2060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair protein, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA binding [goid 0003677]; go_process: DNA repair [goid
FT                   0006281]"
FT                   /db_xref="GI:72391070"
FT                   /db_xref="GeneID:3658418"
FT                   /translation="MPPLPRGVVKVVGALRGDNIIRIMQRHRYVIEEADDPTYDFLCGG
FT                   TCVVFVDDADDLSDAARRTKVSQQLSVLKTHTGASWRCVVLLLRVVSEEVRPDILAWLN
FT                   LHCSVEQGCGVMLFWTDEECAAYLEGLSDSNVATADYCVGVRRDSTPMQLLIDALTQTP
FT                   QLMTRNDVVRAVNSFGSVAGLLTATAEQLTELPGFAQKKAGRLHAVLNAPFNTSRCLVA
FT                   DVLQRDQDESNDESSERRPAQETMKQALRCIYDREDEDVQEGGQ"
FT                   /protein_id="XP_845829.1"
FT   misc_feature    519337..519370
FT                   /note="AT_rich"
FT   gene            complement(<519594..>520580)
FT                   /note="synonym: Tb07.43M14.520; heat shock protein DnaJ,
FT                   putative"
FT                   /db_xref="GeneID:3658419"
FT                   /locus_tag="Tb927.7.2070"
FT   mRNA            complement(<519594..>520580)
FT                   /db_xref="GI:72391071"
FT                   /db_xref="GeneID:3658419"
FT                   /locus_tag="Tb927.7.2070"
FT                   /transcript_id="XM_840737.1"
FT   CDS_pept        complement(519594..520580)
FT                   /locus_tag="Tb927.7.2070"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein DnaJ, putative"
FT                   /note="go_function: unfolded protein binding [goid
FT                   0051082]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72391072"
FT                   /db_xref="GeneID:3658419"
FT                   /translation="MFAFSDHMDDVFNAFFSGGDMFSGGDMFSGGGGRGRRRQPKDTVH
FT                   GLPVTLKDLYNGRSIEIPHTRTTPCVGCDGRGAKSRKNVTCTACRGAGRRMLARQMGMM
FT                   IQQVTVPCDACGGEGRRMDPRDICPVCDGRRVNQVESSLTVVVEPGMEHREQIVFHGEG
FT                   SYQPAADAAGDIVIVLEQMKDDRFEREGDDLLYTHTISLAESLCGFQLVLTHLDGRQLV
FT                   VRRERGEITRPGERKVVLGEGMPIRGRKGKFGDLVIKFAVSFPERIEEAQVEILRQALP
FT                   APRSVDLSHCDMAQECYVSRKELDHLRQELENDVEEQETTSVGCTAQ"
FT                   /protein_id="XP_845830.1"
FT   gene            complement(<520963..>524115)
FT                   /note="synonym: Tb07.43M14.530; methyltransferase,
FT                   putative"
FT                   /db_xref="GeneID:3658420"
FT                   /locus_tag="Tb927.7.2080"
FT   mRNA            complement(<520963..>524115)
FT                   /db_xref="GI:72391073"
FT                   /db_xref="GeneID:3658420"
FT                   /locus_tag="Tb927.7.2080"
FT                   /transcript_id="XM_840738.1"
FT   CDS_pept        complement(520963..524115)
FT                   /locus_tag="Tb927.7.2080"
FT                   /gene_family="HOG000257269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase, putative"
FT                   /note="similar to SP:P40997: mRNA capping enzyme alpha
FT                   subunit (mRNA guanylyltransferase)(EC 2.7.7.50) (GTP--RNA
FT                   guanylyltransferase) (GTase){Schizosaccharomyces pombe};
FT                   50% similar to SP:P40997: mRNA capping enzyme alpha subunit
FT                   (mRNA guanylyltransferase)(EC 2.7.7.50) (GTP--RNA
FT                   guanylyltransferase) (GTase){Schizosaccharomyces pombe};
FT                   go_component: nucleus [goid 0005634]; go_function: mRNA
FT                   guanylyltransferase activity [goid 0004484]; go_process:
FT                   mRNA capping [goid 0006370]"
FT                   /db_xref="GI:72391074"
FT                   /db_xref="GeneID:3658420"
FT                   /translation="MESTSSLSDLHKYAERRFGRSLLIPVDEEFVKAVHPPVPSEASEV
FT                   APAVDFVEAYRNLVSRNLQRKRTANNAPTSPASSGVPKFIYAHAAEAVVGTRVGEFMGP
FT                   LCSPLRKSHASMLRSAPYFVTEKSDGTRVVLVSLIAPLGPSWSIEDKNGGDVLLKHVGR
FT                   LDDVVALEEARQQLCQENTAQVGDLHQKIHLSFGHFAVERWHEKSSYGTVELFALRCCE
FT                   NGSSSSQGGGDVIRAERLIGKRHMAYCFDRSMDYAYLLLEEHAVPSLHSFVVDAELMVP
FT                   IQKGSARLLLGCFDVFRYVIVGESAPRDVVLTRAHTSARHAALRKDIIEPMEEFQRGTV
FT                   GVPLLRIFAKEMFPLNKFGDCVLRLRCGESANHIGGVVYLYDGPYGWTKSDGFIFTPEK
FT                   FDILQGASKTQLKWKWPSMLSVDWSLTAFEGQNNFFVVDSFFRKKRFGHQPDSCGHVRL
FT                   SSKMSLLNPFSLPIPTRGSVVAECVFDREQKCWSIERLRNDKAEANSIVTIISVMESLV
FT                   EDITLSTLFDLIGLNDTPLPSEKVHELESAADMVNRGGERGNTAAIQDVEEKHEKKRCQ
FT                   FTLRATQLQAQGEHEIHLYWAVRLPSEKAHVPCIHCKVSECTGFGFACPAEDPTSRLRE
FT                   YLYIALANAGGSCAWSDFTVEAVFNGGTGRWNIASMQPNGDNKRSTCVGVIHHLQWLLQ
FT                   RGVDSASPESTETPERVIPLHLQGVERPAVLQVEQVNAHYACKTKELSTGKNRSILRHY
FT                   NNWIKGVLISTSVSYLRSNNKGGEFDNDGMVVADLCSGRGGDLHKWRAHQPKLLFMTDC
FT                   CLEAVAEAAARYSITKGLSIKVVPHDKNPPGIRAQFCVLDVFDEKGSLVTKLEEFLKQC
FT                   HDGGKLDVVSCQFSIHYGCSNEERVRVFLSAVSSTLKSGGIFIGTTVSDTELLRRLRQY
FT                   GTTFGNGIYTVRFPTDAVPNDSFGVEYSVSFESSVSEMPEYLVPWNRFVNLCGAYNLQL
FT                   VESFGFVEYGDMHYNSALGQELRDASMNGGRRDSDGHLRLRLSPDEAEAAGLFRTFLFV
FT                   KI"
FT                   /protein_id="XP_845831.1"
FT   misc_feature    525058..525096
FT                   /note="AT_rich"
FT   repeat_region   525335..525386
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    525861..525939
FT                   /note="GA-rich"
FT   repeat_region   526048..526091
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    526346..526406
FT                   /note="A-rich"
FT   misc_feature    526467..526496
FT                   /note="AT_rich"
FT   misc_feature    526575..526663
FT                   /note="A-rich"
FT   misc_feature    527174..527216
FT                   /note="AT_rich"
FT   misc_feature    527454..527491
FT                   /note="AT_rich"
FT   repeat_region   527665..527700
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   527967..528014
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    528045..528100
FT                   /note="A-rich"
FT   misc_feature    528355..528388
FT                   /note="AT_rich"
FT   repeat_region   528510..528557
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ggaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    528633..528700
FT                   /note="T-rich"
FT   misc_feature    528804..528829
FT                   /note="AT_rich"
FT   misc_feature    528915..528970
FT                   /note="A-rich"
FT   repeat_region   528999..529021
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    529365..529420
FT                   /note="T-rich"
FT   repeat_region   529831..529968
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   529834..529966
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<530182..>530997)
FT                   /note="synonym: Tb07.43M14.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658423"
FT                   /locus_tag="Tb927.7.2090"
FT   mRNA            complement(<530182..>530997)
FT                   /db_xref="GI:72391075"
FT                   /db_xref="GeneID:3658423"
FT                   /locus_tag="Tb927.7.2090"
FT                   /transcript_id="XM_840739.1"
FT   CDS_pept        complement(530182..530997)
FT                   /locus_tag="Tb927.7.2090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391076"
FT                   /db_xref="GeneID:3658423"
FT                   /translation="MDNVVKNLMHNSPQKQCTATCGKRGNTFTVSHANRHPDATRARFF
FT                   LDEANLPMRPDMELQQDTVLRHHINKTQEFVGQFAGGMSFDDQMAAVKLLVRTAAERDV
FT                   RLVRGWGCDEPTVKFTRRVWASLLHQVEAFFNGNNGIEPLRRPQTALEYVSALGLWFGG
FT                   DMSLPFRRHIVRVQGVDGTTGDAIVIGFAWFNYSSYVMDSRRGAQSATMMELERMSERL
FT                   GVKLLFFPPLVLPESVPCKNQVNATWQVVAAVEEANKRVEENVLVPAMQ"
FT                   /protein_id="XP_845832.1"
FT   repeat_region   531013..531061
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    531135..531163
FT                   /note="AT_rich"
FT   misc_feature    531308..531331
FT                   /note="AT_rich"
FT   misc_feature    531361..531382
FT                   /note="AT_rich"
FT   misc_feature    531500..531530
FT                   /note="AT_rich"
FT   misc_feature    532241..532269
FT                   /note="AT_rich"
FT   gene            complement(<532663..>534639)
FT                   /note="synonym: Tb07.43M14.550; GMP synthase, putative"
FT                   /db_xref="GeneID:3658422"
FT                   /locus_tag="Tb927.7.2100"
FT   mRNA            complement(<532663..>534639)
FT                   /db_xref="GI:72391077"
FT                   /db_xref="GeneID:3658422"
FT                   /locus_tag="Tb927.7.2100"
FT                   /transcript_id="XM_840740.1"
FT   CDS_pept        complement(532663..534639)
FT                   /locus_tag="Tb927.7.2100"
FT                   /gene_family="HOG000223965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GMP synthase, putative"
FT                   /EC_number="6.3.5.2"
FT                   /note="go_function: GMP synthase (glutamine-hydrolyzing)
FT                   activity [goid 0003922]; go_process: purine ribonucleotide
FT                   biosynthesis [goid 0009152]"
FT                   /db_xref="GI:72391078"
FT                   /db_xref="GeneID:3658422"
FT                   /translation="MSVQQEPVTECVVILDAGSQYGKVIDRKVRELRVESRVMPLDTPT
FT                   DILRSDPSIKGIIISGGPSSISDADAPSYNTDLFSVGKPLLGICYGVQLLTRAFGGKVG
FT                   CAGVREDGQDEITVDTNSPIFHGLSNKEKVLLTHGDSITEAGPHLKVTARSSAHIIAAV
FT                   QHESLPLFGVQFHPEVELTENGVQILKNFLTFCGCKFTFTMEDREEKALRLIRERTTQG
FT                   QKVLCLASGGVDSTVCAVLLLKALGPERVVCIHIDHGFMRLNESQEVVAALRAAGVNVT
FT                   LIDATKQFSEATTEFPAKRGKGAYQTGKLCEAIDPEEKRVIIGNTFMSVCDAAVKDLNL
FT                   DVNNLLLAQGTLRPDLIESGSAYASKVADAIKTHHNDTAVVRQLRAEGRIIEPLCDYHK
FT                   DEVRELGTRLGIPTHLVQRQPFPGPGLAIRVLCSDGSLFKDEHYARTEENVRAVCAGDE
FT                   RFELLKPLCKELRSLQPASCILPIRTVGVQGDGRTYAYAAALSIGRLPNKEEWNSLGRL
FT                   ALVIPKLTSNVNRIVFMFGPKRAEAPLKATKSSLVPEVLDKLRLADDTVNRALIKYGLV
FT                   RRLSQVPVVLLPIGFEEKGPFSVVIRPFITNDFMTGVPAAPGSADMPLEALKEIVETLQ
FT                   GFDFISRVMYDLTGKPPGTTEWE"
FT                   /protein_id="XP_845833.1"
FT   repeat_region   534819..534840
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    535810..535868
FT                   /note="CT-rich"
FT   gene            complement(<536243..>536998)
FT                   /note="synonym: Tb07.43M14.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658426"
FT                   /locus_tag="Tb927.7.2110"
FT   mRNA            complement(<536243..>536998)
FT                   /db_xref="GI:72391079"
FT                   /db_xref="GeneID:3658426"
FT                   /locus_tag="Tb927.7.2110"
FT                   /transcript_id="XM_840741.1"
FT   CDS_pept        complement(536243..536998)
FT                   /locus_tag="Tb927.7.2110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391080"
FT                   /db_xref="GeneID:3658426"
FT                   /translation="MTRPRLTSAPRGSALKEAISAHQALRNAVAQEQSALDDELKKNEQ
FT                   ILAEHEQLMRDWSCDKEGVLATIQKMKEKIAENESKTTEARAEVKQNEEIVKRLHARNE
FT                   EYEPRLEASAIEIAERLKKREEEEKEMREQLLTFQIACQEREQQYRDQIHKLEETNAQE
FT                   AVDHQQKVQQLRSKIAEVEATMEEERRAWVVETEMRKQQRLIERHKFFTEEAEEARKGK
FT                   EACAAIMKEASALRMDSNLLTSLDDLLCC"
FT                   /protein_id="XP_845834.1"
FT   misc_feature    537370..537403
FT                   /note="AT_rich"
FT   repeat_region   537408..537451
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    537620..537642
FT                   /note="AT_rich"
FT   repeat_region   537830..537856
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    538368..538427
FT                   /note="T-rich"
FT   misc_feature    538534..538555
FT                   /note="AT_rich"
FT   repeat_region   539363..539385
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    539521..539552
FT                   /note="CT-rich"
FT   gene            complement(<539581..>540828)
FT                   /note="synonym: Tb07.43M14.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658421"
FT                   /locus_tag="Tb927.7.2120"
FT   mRNA            complement(<539581..>540828)
FT                   /db_xref="GI:72391081"
FT                   /db_xref="GeneID:3658421"
FT                   /locus_tag="Tb927.7.2120"
FT                   /transcript_id="XM_840742.1"
FT   CDS_pept        complement(539581..540828)
FT                   /locus_tag="Tb927.7.2120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391082"
FT                   /db_xref="GeneID:3658421"
FT                   /translation="MHQTSATVTTRLRSSRGEIIDLVLPRDCTVERLVNFLVNQYDYPK
FT                   GTRIVHDYQEIGPRSALSDFPDGSLIIELPTNVSQRSRVQSHHQHPYCTQQQTDSPRQQ
FT                   GQPQQNDNLPYNRTMESAYSPKQRTFASGVRLSGGSPPLASLSGWQSPKRQPTSEHQSV
FT                   GNDTRYSAPSAFESANSRPQTSHHNNAATGRQTIPSPMGVPSNITRSSFTTESESAKAA
FT                   DDFQPDMKQQSQPSEPLSPRSVVSLRCLSPGLKRNVLLTLPDEATLDDVLLAAVAQEPR
FT                   LAGCKLVFRGKQLNNLSTKLSSCGIRSGVGTIEPVPINPDADGIYSLYFSPNEVNGVQK
FT                   TMLIEIESNIAAMEPMVNQDGLTLNQRQGYYEELMRILFRTDGLNDLEDEWRLRRKQAV
FT                   KRLTELQDNLKVDGVV"
FT                   /protein_id="XP_845835.1"
FT   misc_feature    541160..541182
FT                   /note="AT_rich"
FT   gene            complement(<541724..>543106)
FT                   /note="synonym: Tb07.43M14.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658428"
FT                   /locus_tag="Tb927.7.2130"
FT   mRNA            complement(<541724..>543106)
FT                   /db_xref="GI:72391083"
FT                   /db_xref="GeneID:3658428"
FT                   /locus_tag="Tb927.7.2130"
FT                   /transcript_id="XM_840743.1"
FT   CDS_pept        complement(541724..543106)
FT                   /locus_tag="Tb927.7.2130"
FT                   /gene_family="HOG000257273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391084"
FT                   /db_xref="GeneID:3658428"
FT                   /translation="MARVTLREDFDDCAADYRILSVSADHFKEITCKVAACKQTGEEMG
FT                   KINETHHEATTLMTMKGGSQLLLCDDERTFRVRRVEYSNTLLLAEAKAAKMHDTNGIIE
FT                   SDNASDAGEGREHVVVCSSERVFEVKPSVAYNDISQHLLESPLTLKELDTLGTVERSDE
FT                   NVEYIKREELENGTSSSAQRFYTFPQLVALNRSSARELAVILSDMGAVVFNGYVRLLKP
FT                   ALMREALRASLNFFDAYDTMSWEGVMEQLCPSVYPHIVLRAVRAAYGNATASGETPRGM
FT                   AAFLQVPKVLQALAASVLLADDAEQNTQFTEAELQDKKLSKSVNRRGSLFPELDFDIFY
FT                   DSWTSSIPSSLFADGTLPSQSDRNALLKFLYGSVIVVRNAEGDSHVGARAVWAPSNVLS
FT                   TDVSLRTRQLFEIRPGRWEAEELRAYVAPLLDPGVAFDHIIVRYAKEYRVPGRPVMYGN
FT                   LS"
FT                   /protein_id="XP_845836.1"
FT   misc_feature    543344..557748
FT                   /note="sequence corresponds to BAC RPCI93-28I8"
FT   misc_feature    544412..544437
FT                   /note="AT_rich"
FT   repeat_region   544824..544856
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    544864..544908
FT                   /note="A-rich"
FT   misc_feature    545130..545163
FT                   /note="AT_rich"
FT   misc_feature    545856..545879
FT                   /note="AT_rich"
FT   misc_feature    545918..546035
FT                   /note="T-rich"
FT   misc_feature    546091..546142
FT                   /note="GA-rich"
FT   repeat_region   546433..546480
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    546651..546691
FT                   /note="GA-rich"
FT   repeat_region   546935..546960
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   547153..547176
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   547325..547361
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    547485..547584
FT                   /note="T-rich"
FT   misc_feature    547735..547762
FT                   /note="AT_rich"
FT   misc_feature    547935..548006
FT                   /note="CT-rich"
FT   repeat_region   547976..548005
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<548228..>549358)
FT                   /note="synonym: Tb07.28I8.10; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658427"
FT                   /locus_tag="Tb927.7.2140"
FT   mRNA            complement(<548228..>549358)
FT                   /db_xref="GI:72391085"
FT                   /db_xref="GeneID:3658427"
FT                   /locus_tag="Tb927.7.2140"
FT                   /transcript_id="XM_840744.1"
FT   CDS_pept        complement(548228..549358)
FT                   /locus_tag="Tb927.7.2140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391086"
FT                   /db_xref="GeneID:3658427"
FT                   /translation="MSFSMNTVTHSPHSLGSQHNVMTASPFVTPAYVDALDHLSTKLRI
FT                   PGSAVEPTNAMYDDGLVPGVCRLYMEGRCRQGSRCFQVHANPEVVEKLRQEALEQPTCC
FT                   FFHGAPCTSSGLPLNLQVNVGGTSITLPRMNSTNCLWSAYAERGDSTLDLPREKVCREH
FT                   RRGLCRFGEECGFLHICREIAFVGEDASSTGSGLHHSRTSASASPLGSGRKRQVPNSSF
FT                   GSPPFMQSTSSRDSQCSRKRSFDPNAPDWCNGGYPQRGGRYADDGGVGFFPPQANSCPP
FT                   AANYPYWPPYGDMTHVHYGHGLSYSNSYMGPGMEQQHPHSFSRTCQSFSHHQVCENVGA
FT                   GASMFGGPLLRPLANAPRRNTGSVRHNPYGATSLGQ"
FT                   /protein_id="XP_845837.1"
FT   repeat_region   548527..548573
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   549292..549311
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttta"
FT                   /rpt_type="tandem"
FT   misc_feature    549489..549549
FT                   /note="T-rich"
FT   repeat_region   550209..550240
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   550445..550466
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   550496..550555
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   550628..550661
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    550864..550918
FT                   /note="GA-rich"
FT   repeat_region   551168..551197
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   551378..551406
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<551648..>555760)
FT                   /note="synonym: Tb07.28I8.20; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658431"
FT                   /locus_tag="Tb927.7.2150"
FT   mRNA            complement(<551648..>555760)
FT                   /db_xref="GI:72391087"
FT                   /db_xref="GeneID:3658431"
FT                   /locus_tag="Tb927.7.2150"
FT                   /transcript_id="XM_840745.1"
FT   CDS_pept        complement(551648..555760)
FT                   /locus_tag="Tb927.7.2150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391088"
FT                   /db_xref="GeneID:3658431"
FT                   /translation="MERTNRARVTFGDVTVVPYAGTRPGPAGNKRASQADESSSYSYSD
FT                   YSDDYSYYGSYTQSSRTNSNESSSYSQTIESSGTKTQPPPAREQQQQQQQQQQQQSYTQ
FT                   SGQLQPQLQVQPLAPQHPPRAPVAPQQPVPSKSVQGPRGNSAARVSTESYTGSYSSYSY
FT                   SYSDSTDEGHNVVASARSGHVAGAAQLDSEKKRAAAGTTTNISAPKAPIGSMQMPTITQ
FT                   QTSQTSGHQHPPMAQPHLQMGVQQVSPWAQQVPVGNQQPPAVHSQPPANIQQRHGDDPL
FT                   MSARSRQQPPTGSRRPSLRTPEIPKEDQQQTHTSVQQRPANAKYQQAVVGHQHPPMAQP
FT                   HLQMGVQQVSPWAQQVPVGNQQPPAVHSQPPANIQHPRVGSQQPVGMAHKYQAARTQQM
FT                   PSKTQLGRAPATSTEGLKIDNFSGSGSDYYSYSPYGSHSGSYTGSYSSYSYTQRMPGQS
FT                   YSSGGDYTTTVKAAAPARPVEPPKPETHSHTAPPAASPIVRGRVQDDDSYSYSYSYSYG
FT                   SVSSPEVKHPLPPSHVVKAPQPEQDANVVSVSSSELGYTGSYYDSEYDYSYDYSESATK
FT                   TQKAVEEPKGAEQHSKSTVETTTSLIKPTTSGYTGSESYSASKSGDYSIELSGEGGVTS
FT                   SESTEIPSPARIRKTILLAAPSEAEPRFHSLPRGCIVPHSSMEDTLSSFLDQLAELQVE
FT                   TMERNRVLKVLNTEVEAAKDLKERKVSDSQRIASDEANSPADIVEAPISVIPSRNLTRK
FT                   SLMFALRAVGVEKAKERYKILEDVDTVVPREKARTILEYYGSRCLTEKVMSMFVAYDEF
FT                   YSGEVPLSIAFEILEYCGLVTQTVGKFKIFLRPQVSQGQILLCVADQPQEATENIVDDA
FT                   EGEKRWIQPQTYETTVRCCGEGWKYGDHKVYWNGESGDVFVGSFIVAKGITERKVAVQL
FT                   LRYIEAFLYVCHAIMVVTVGTGMKLRVLYTPLVEKLLNPTVKGVTDATSFLYELAFGSV
FT                   FNPKKYVKLLANNSNLRDRYLCEGDDAVLHDTIRPKHLVPKAPFMINGDKDDELNTLLM
FT                   STANSYTTVSANIWTQKGVEGCYLEVGVEKLRISEKVPENARCYCLVSVRKSKDSEWMT
FT                   AEVLQAVSVGKANKGGFKWKFGKSSSDRLFFTGAIEDSLYVEACYDIVDASGETTTYCV
FT                   GHVLVPCGKLKSGKLPVRPGSCYTYTPLDEALKQPVEASGGFCAPRRKTAGPPAKSLTV
FT                   TIKRLRSKDVPDLKTLPSRCLSLHRHVSLMSLMCAAVISGRDGGSHPLRWLRQQQVQCC
FT                   FMVTADSELMDILQGLWKRVMKGKLGPKPQNLGQKYKRILILATKVVAAHNNITGGDQG
FT                   IITDVVAGKKGIPFTENMNRPLRPVCV"
FT                   /protein_id="XP_845838.1"
FT   repeat_region   555461..555498
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   555863..555903
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    556279..556306
FT                   /note="AT_rich"
FT   misc_feature    556759..556781
FT                   /note="AT_rich"
FT   misc_feature    557064..557116
FT                   /note="A-rich"
FT   misc_feature    557684..>557748
FT                   /note="T-rich"
FT   misc_feature    557749..689681
FT                   /note="sequence corresponds to BAC RPCI93-22O10"
FT   repeat_region   557836..557855
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttta"
FT                   /rpt_type="tandem"
FT   gene            complement(<557952..>558977)
FT                   /note="synonym: Tb07.22O10.80; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658425"
FT                   /locus_tag="Tb927.7.2160"
FT   mRNA            complement(<557952..>558977)
FT                   /db_xref="GI:72391089"
FT                   /db_xref="GeneID:3658425"
FT                   /locus_tag="Tb927.7.2160"
FT                   /transcript_id="XM_840746.1"
FT   CDS_pept        complement(557952..558977)
FT                   /locus_tag="Tb927.7.2160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391090"
FT                   /db_xref="GeneID:3658425"
FT                   /translation="MQASESGDHGDILPNGGHRSRHHRHKGKHPQHEETAALRVEGAES
FT                   VDAEKAEREQVQEPPQQQQQEQEQQENKSDADSQNIGSVVEEFVSRLPAGDAVRATSEK
FT                   ARKLATEGKQLVKDVLENSNIRAVASGCVAKGKQVVDGARAYQHTAMEVAAKTVPHCRK
FT                   PMEMCAATARSTVNSARSVAEKSTRCVAQTGGELRERAKSYVETMKSIRGKLFNFFEAS
FT                   KPRVAEVQRTGMKAVGERDLQLFVTALAQATACVVVLSRVITVEMCKVNRVNSTMRYIQ
FT                   GSTCMRLGASLWNCINPSLVQHVPVVGERVASAAAAFVAEVKQYTSDDRDDVQDEQKVA
FT                   A"
FT                   /protein_id="XP_845839.1"
FT   misc_feature    558901..558962
FT                   /note="T-rich"
FT   repeat_region   558987..559016
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    559041..559102
FT                   /note="T-rich"
FT   repeat_region   559127..559156
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<559785..>564230)
FT                   /note="synonym: Tb07.22O10.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658429"
FT                   /locus_tag="Tb927.7.2170"
FT   mRNA            complement(<559785..>564230)
FT                   /db_xref="GI:72391091"
FT                   /db_xref="GeneID:3658429"
FT                   /locus_tag="Tb927.7.2170"
FT                   /transcript_id="XM_840747.1"
FT   CDS_pept        complement(559785..564230)
FT                   /locus_tag="Tb927.7.2170"
FT                   /gene_family="HOG000257278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391092"
FT                   /db_xref="GeneID:3658429"
FT                   /translation="MSGSFAQHGSKGGTSGGPRRNVKPSAKMGKATNVKKEAKRYHKEK
FT                   YAREQVERRGHHAQQHTAVGNHEGRSHQRSARTKDIDIHLAAKVSSELRSDLSSFKTRL
FT                   NATNIFGADLSEIFKFVPPPFIQQHLPEDVRSLRSYLSKFERGAPNSVQAFIVWYEWAE
FT                   YELNKGKGRGGGTKKHYDNKAQGLTSGDEEEEAAAASDQKDGEQVETHGKVSRSRAVLA
FT                   KNVKEREHVRALLQMCLRHNSTRRKEGQHSLINHLKAKLVDGVDCRSLKSMRDTAHHAL
FT                   PYALSRMLLGMVTEDMAMIVLHAHILFLALRETDITPSIVLSLIGEEIALDARLKVTKA
FT                   RLEARAARRDTQGEQQKEDQGDWDDFDPDTINDPTRGERNQRIVAAVFAMGAVVANRGK
FT                   MRVEDARHAAQYLCFAYVEQKATRVMTAALLLITLQKFPKLWEDESVMEWISYAFFLYP
FT                   KLEYFRPEGVQLLLRLMAMETKPPAIKKFLPTTVQKYAAMDPLEPTTVEQIANALFRKE
FT                   QVIAVYPMVHPVWDDWFDLLVQRCAAGESLQEHLSTMMHNAIAPYRRGNSDIPRRALFQ
FT                   QLVARLGQLVVKNDDADQRQEMLKIASQAVGYGRKIVAKASDPNELRMMPLEMLDAKVR
FT                   DLIKQYFCIRDSDPSAHANRTWVLRELRACLSVPLREGVTCTYVDEAVRALLRFGFYPT
FT                   PKSSDEKCMNRAIYLFSDVFSFTYTAALSRPKCTLSALSVIRDYLAAEEKGITRYTTGA
FT                   TERNFRKARNCIVEALESSSTRSVLFYEERDIHVLLVLLFLILSTDDPSNEEAKNLANS
FT                   TVPDLCQFFRTGTLETLDLFYDVLMALVMRPSSALHVLPLMVCVRRIATGYLLRFARYV
FT                   RERPTLDLVLAPLREAYHTDDRELIRQAKAKGVAAEAEDSSADEEEGDEEDENNEGTQV
FT                   DEKDEDEEDEGGDVPSEDEADKTETETETEADESEEPTEEDEATEPEEGADEEQLNPDV
FT                   EDEESDTGDEEEEEAPTQQYIDALKGMIGNVDLQFVYPTDTANKEKGDVVRAIQVATRV
FT                   GVAMRSPLTVHIFQVLLAVCRENVKAADDVIFNSTVSSLQMLMMTKNRYFGRFLVAESL
FT                   FQLLSDIQSYCRKLDRVLVNKESRSARHALVVRRRMTRLKDVALRVFHFIAFLAHKNHA
FT                   GEDVRVTLMEFYKSIFCDRGWDGKKRMPSVKRDMHHYRHGFAWALLPAALEKFSEVEVL
FT                   EGPQRVRVFQGCCQMVEAVLPRLSGLGATLRASAASAISSFLQSVTPTSVYNMKYTLLY
FT                   DYLHCLKMVLKYNSRVQLDTAWASNIVKEVVDDDSLMTSAATIRLLAAMENLLNLTPRA
FT                   RETKAPSPVSVLYKQYEKSGRKEKAAFYRRAKRVRKKVVRALAAHRNGELTDEEKAAKR
FT                   RRRETLRINDRLERQMIRTERSQILTKEEREEKRKRIMVAKQERIAKNRERKRRLHEQR
FT                   EKAFQRWREQKLAAAAVADE"
FT                   /protein_id="XP_845840.1"
FT   misc_feature    564192..564218
FT                   /note="AT_rich"
FT   misc_feature    564332..564358
FT                   /note="AT_rich"
FT   repeat_region   564605..564634
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   564745..564774
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<565094..>565846)
FT                   /note="synonym: Tb07.22O10.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658430"
FT                   /locus_tag="Tb927.7.2180"
FT   mRNA            complement(<565094..>565846)
FT                   /db_xref="GI:72391093"
FT                   /db_xref="GeneID:3658430"
FT                   /locus_tag="Tb927.7.2180"
FT                   /transcript_id="XM_840748.1"
FT   CDS_pept        complement(565094..565846)
FT                   /locus_tag="Tb927.7.2180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391094"
FT                   /db_xref="GeneID:3658430"
FT                   /translation="MSQVPITAEPAVLESISVVDGTEVNEAPNCVSLLTEEVAPVNKVP
FT                   QNINSEEMIAVVPPSPVSEEKEGTSDESKPPFEKIMEEEREEVVAVVNKAVTPSTIVNE
FT                   DEEGKADVQQPPATDEVETMTTTEAEEISQAQIADAETPKASAQGKVEVATSKEAETDA
FT                   DSKVYEDIIGEETIATTVDDETSFNCRKRSRSESGAGELLLDSANYNGVSGAAVQKSDT
FT                   EVNLKEMDYAGASTTESEPVKQMLSSVE"
FT                   /protein_id="XP_845841.1"
FT   misc_feature    566084..566181
FT                   /note="T-rich"
FT   misc_feature    566224..566321
FT                   /note="T-rich"
FT   misc_feature    566830..566868
FT                   /note="AT_rich"
FT   misc_feature    566970..567008
FT                   /note="AT_rich"
FT   gene            complement(<567798..>568598)
FT                   /note="synonym: Tb07.22O10.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658424"
FT                   /locus_tag="Tb927.7.2190"
FT   mRNA            complement(<567798..>568598)
FT                   /db_xref="GI:72391095"
FT                   /db_xref="GeneID:3658424"
FT                   /locus_tag="Tb927.7.2190"
FT                   /transcript_id="XM_840749.1"
FT   CDS_pept        complement(567798..568598)
FT                   /locus_tag="Tb927.7.2190"
FT                   /gene_family="HOG000257280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391096"
FT                   /db_xref="GeneID:3658424"
FT                   /translation="MACRRSLMLLLLFAAATSSLLAAVPASATEADGAAKTAESDDAER
FT                   EGEAEEEKLFLPTVQAIFPKVRGGSTPTFHAGSRVDALIAFRNNDQRQNSTVLLVSASV
FT                   APAHTPNQILQNFSAIRHARIVQYRESASFHYTFTPHALLEPNDYHLIVGVYYKNGETE
FT                   QPQFVAAFNETVAIEASLDTDPSTILTYLTLLAITCAVVYVLASKYGILSLLRGKNESS
FT                   SERRRVEVGTKGDGYDPDYVSEEHLRYKEAVLMRRSSQSPKKKK"
FT                   /protein_id="XP_845842.1"
FT   repeat_region   568477..568499
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   568617..568639
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   568647..568679
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   568787..568819
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<569781..>570017)
FT                   /note="synonym: Tb07.22O10.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658432"
FT                   /locus_tag="Tb927.7.2200"
FT   mRNA            complement(<569781..>570017)
FT                   /db_xref="GI:72391097"
FT                   /db_xref="GeneID:3658432"
FT                   /locus_tag="Tb927.7.2200"
FT                   /transcript_id="XM_840750.1"
FT   CDS_pept        complement(569781..570017)
FT                   /locus_tag="Tb927.7.2200"
FT                   /gene_family="HOG000257282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391098"
FT                   /db_xref="GeneID:3658432"
FT                   /translation="MRLAVKQESFRLEVLMSRLQSECFTFCCKNLSSKELTMDEVKCVE
FT                   RCAVKYLQASDIINRALDKGESGGGAVKQMLKL"
FT                   /protein_id="XP_845843.1"
FT   repeat_region   569931..569953
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   570071..570093
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   570710..570749
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   570850..570889
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   571099..571128
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctca"
FT                   /rpt_type="tandem"
FT   repeat_region   571146..571179
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   571239..571268
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctca"
FT                   /rpt_type="tandem"
FT   repeat_region   571286..571319
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   571881..571907
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   572021..572047
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<572049..>572423)
FT                   /note="synonym: Tb07.22O10.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658436"
FT                   /locus_tag="Tb927.7.2210"
FT   mRNA            complement(<572049..>572423)
FT                   /db_xref="GI:72391099"
FT                   /db_xref="GeneID:3658436"
FT                   /locus_tag="Tb927.7.2210"
FT                   /transcript_id="XM_840751.1"
FT   CDS_pept        complement(572049..572423)
FT                   /locus_tag="Tb927.7.2210"
FT                   /gene_family="HOG000257283" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391100"
FT                   /db_xref="GeneID:3658436"
FT                   /translation="MRRSVFFMGRTFTQRHLNACRSPLLTGYVRPTSLACALPTPSVLR
FT                   GALLGPEASSAVPPGAASDALEGVLSHAMAVMLQSNSITSATLNGFSCLQNISTCVLAC
FT                   ERVFKVLRQCDGKFNGVTCA"
FT                   /protein_id="XP_845844.1"
FT   gene            complement(<573084..>575093)
FT                   /note="synonym: Tb07.22O10.150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658433"
FT                   /locus_tag="Tb927.7.2220"
FT   mRNA            complement(<573084..>575093)
FT                   /db_xref="GI:72391101"
FT                   /db_xref="GeneID:3658433"
FT                   /locus_tag="Tb927.7.2220"
FT                   /transcript_id="XM_840752.1"
FT   CDS_pept        complement(573084..575093)
FT                   /locus_tag="Tb927.7.2220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: mitochondrion [goid 0005739]"
FT                   /db_xref="GI:72391102"
FT                   /db_xref="GeneID:3658433"
FT                   /translation="MRGFRSNPHSAVTMACGALLNSMRLRLTQKEDDMLWENMRVILRR
FT                   HGALPLPRVSALLSDEMLELVSNNTGGLGQYVKERPSKFQVEVASSGLTVVMLASELRR
FT                   AGSSTPLIAKVLANVAASPQQQLSVSQLYRSLPALEQRKCGNERLLEAFLLQHASLVLV
FT                   QNGIVKASPTSFVTRMGLNPIPPTSTSNPLAASAPAFSTAGHATRQAESIHESTLTISA
FT                   FDDPKLNRILLLLQKTVPFSFYIPLRSVMQSPRSGMCFSPDATLKEILEELQRVPATIL
FT                   DCRVTGDDINDVFLRMMDADRRPYVGSEALSAQGFEVLNLGQPLIEAFRNFASASPENL
FT                   QRLRSGIAMTELDDVLPSDLMERLHIYPATHKDAACIFVFDRLRHLFDVNMTAYMVRPW
FT                   EVMERHEQPSSLTWQTTPIPVVLRQCLQLLGEKPLSVEELVASLSTSSRGQLQCAYASV
FT                   EAFVKQHSLYLLLKEGFVWTPFLAAASHGVRIPASSAGARSVCGPGRQLSEKEKARMLM
FT                   QVMPIEHPVLWTRFRHSPAARELPFDVWECKQEFFERHREFFKIYEVIFSTVLVVGRRD
FT                   GQPPPAELLHSPCRTLADLVRLIAMFTVGGAQEATVLNYLPRDARQLVRRYGSIVLIAR
FT                   QLPMWFDVRGDESGSGTGSAIISYIGADGGSREQ"
FT                   /protein_id="XP_845845.1"
FT   repeat_region   575820..575855
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   575960..575995
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<576578..>577714)
FT                   /note="synonym: Tb07.22O10.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658434"
FT                   /locus_tag="Tb927.7.2230"
FT   mRNA            complement(<576578..>577714)
FT                   /db_xref="GI:72391103"
FT                   /db_xref="GeneID:3658434"
FT                   /locus_tag="Tb927.7.2230"
FT                   /transcript_id="XM_840753.1"
FT   CDS_pept        complement(576578..577714)
FT                   /locus_tag="Tb927.7.2230"
FT                   /gene_family="HOG000257285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: membrane [goid 0016020]; go_component:
FT                   integral to membrane [goid 0016021]; go_function: binding
FT                   [goid 0005488]; go_process: transport [goid 0006810]"
FT                   /db_xref="GI:72391104"
FT                   /db_xref="GeneID:3658434"
FT                   /translation="MTTQDEKNRDSFLLTAGPALISGAAQAVLFNPFDRALYVRVMYRR
FT                   HHFLDRRNFEHPFQGFVNAAVYRTLVAASYLFWQDSTRIFIDRYMPACFHASNSPGVNA
FT                   FLIGAVAGTLNGSLLNGMQVVKYRMWSVEEKFSFFHVTRNVYEEKGLSIFFRGIVATIL
FT                   RDSVFGIVYEMCRNSRNVHCFFTFLGQSITQKAQYLGLASPACSHATDNNSPSPFVAAS
FT                   HNSGEALSTHRAEKPSVDSAVFASNLFAAMLASVFSSPFNYVRSVVYGVPSGSGPVRYI
FT                   QLLQFLYLQTLFVYRSGESYTSVHATHGGSERVAMNQQDPLRTRLMERSTQRHRYPMAA
FT                   LRWMNSRLNIGWGSARVGLGMAISQSIFVFVQSCWKAV"
FT                   /protein_id="XP_845846.1"
FT   gene            complement(<578992..>580626)
FT                   /note="synonym: Tb07.22O10.180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658435"
FT                   /locus_tag="Tb927.7.2240"
FT   mRNA            complement(<578992..>580626)
FT                   /db_xref="GI:72391105"
FT                   /db_xref="GeneID:3658435"
FT                   /locus_tag="Tb927.7.2240"
FT                   /transcript_id="XM_840754.1"
FT   CDS_pept        complement(578992..580626)
FT                   /locus_tag="Tb927.7.2240"
FT                   /gene_family="HOG000257286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391106"
FT                   /db_xref="GeneID:3658435"
FT                   /translation="MPVKKKVATAKNDEKEDLTTSPVMAAETTPTASSPTMQHLDTPQG
FT                   TTSASELYAVLQAAVAEDPAKVNDFAEEIAQTFVEAEKAETPLLLRVRMLEFFAKYGQH
FT                   MRDGNALKKVVTSLVKILSGPDNTQQLLVAAVQGIAALGPVSMLDKKWEYLSREGADVL
FT                   MQVMIDENGFAEPVRSAASKALDTLVSTAFRPVVTKLLHWLSDDREAEEEDQLQKERRT
FT                   AMARLRKVAQTASFRPQWTEEIQEHVLALIIRVLSAVTITEFAQLARIAASLPSVEEKK
FT                   GLPLLTAFLASTKLNTDRALESLSLVAQHVGAVAYDLTPMLDEAGLLSAPVDGTTVRGM
FT                   WHAKLLLLAARSATPENTDTLYKTLLEHVMNLIGDGNTLPEYLTTLEALLLALTSVGQK
FT                   KPLDFVKQLKDKQFTAKCRNMLAAVEKVEPLLIYAVKRLVQKSSAGAKEAEMLGSCHNL
FT                   RIILSSFSSSHIPMGAITESWAHKHKLPVLRQGREGLLPSAKGGRSGYDAQLPAVNKRP
FT                   RTESNYRPQSNRGSSRDLQGRSRGWKY"
FT                   /protein_id="XP_845847.1"
FT   gene            complement(<581709..>583715)
FT                   /note="synonym: Tb07.22O10.200; carnitine
FT                   O-palmitoyltransferase II, putative"
FT                   /db_xref="GeneID:3658437"
FT                   /locus_tag="Tb927.7.2250"
FT   mRNA            complement(<581709..>583715)
FT                   /db_xref="GI:72391107"
FT                   /db_xref="GeneID:3658437"
FT                   /locus_tag="Tb927.7.2250"
FT                   /transcript_id="XM_840755.1"
FT   CDS_pept        complement(581709..583715)
FT                   /locus_tag="Tb927.7.2250"
FT                   /gene_family="HOG000007446" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carnitine O-palmitoyltransferase II, putative"
FT                   /EC_number="2.3.1.21"
FT                   /note="similar to Carnitine O-palmitoyltransferase II,
FT                   mitochondrial precursor(EC 2.3.1.21) (CPT II).
FT                   (Swiss-Prot:P23786) [Homo sapiens;]; go_function: carnitine
FT                   O-palmitoyltransferase activity [goid 0004095]; go_process:
FT                   fatty acid metabolism [goid 0006631]"
FT                   /db_xref="GI:72391108"
FT                   /db_xref="GeneID:3658437"
FT                   /translation="MRLSSVCWRLEALKDFTDWSLWGPLVQRISTGVCTDCTALHTSVL
FT                   PTRHLQRSLFRLPVPKLEKTCARYLEAVKPLVPPKQYDFTAKVVQEFEANEGIVLQDEL
FT                   VRTNKANRHTSYVSADWCDRYLMDRTPLPINRNPCLVTRRDADKQDMLTRATFWISSSV
FT                   IFQQKYLDNTLQPDIYYSAPPNHYCRSDWFQRTVALSPEYVSAKVMSVGSNFHAFPLDM
FT                   SRYDYLMCSTRVPGVLRDEIKAVGFAQHIIVLYRGQQYVVTVADKDCRPLPDEQIYARL
FT                   KAIAELNAAPPDIDVGIFTSMDRTSWHAVRLSMARHQVNQQNLELLDSALFVVCLDDDV
FT                   VVDYLKPGGATGATRSMLAKETNRWFDKSISIIVTKDGTLGVSFEHSWGDGLVVKRYVE
FT                   DVFNHSIMRPSKDMPRDVSPTEPVRQLKWCLPPELQHQALKAKTRMSGDMRRLDFCTSL
FT                   LPGTGFNDPLLRNLRIGLDGLMQVAMQLAWWRLNKSTVSTYESCSTAAYLRGRTDCIRP
FT                   ATIESQAFTMLMDSPGVPISEKRGAFLCAVKKHRTNVKNTRTGQGVDCHLFALSKVAER
FT                   RNPQRVPLLFSDPSYATLTSNILSTSSLFSNAVVGGGFGPVSAGYGVGYAAGPECLLFN
FT                   VSCWKECGPIHSAEEFSRAICTAVVDCYDMLED"
FT                   /protein_id="XP_845848.1"
FT   gene            complement(<584389..>585228)
FT                   /note="synonym: Tb07.22O10.210; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658438"
FT                   /locus_tag="Tb927.7.2260"
FT   mRNA            complement(<584389..>585228)
FT                   /db_xref="GI:72391109"
FT                   /db_xref="GeneID:3658438"
FT                   /locus_tag="Tb927.7.2260"
FT                   /transcript_id="XM_840756.1"
FT   CDS_pept        complement(584389..585228)
FT                   /locus_tag="Tb927.7.2260"
FT                   /gene_family="HOG000257288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391110"
FT                   /db_xref="GeneID:3658438"
FT                   /translation="MSGGGPSKDTDKKKGVSYFVGGGPSSGQQVDAPADSSSVKGMIDS
FT                   LFRSAPVAASDGRSTAPQAFYGYGRRLGHTQANSPFISPTALQERTVNVRVYRDGYTID
FT                   DGPLLSMDSPESVEFFESVREGIVPARLTAMYPITKISLRLIDCMHLDCKSDVRFPGTG
FT                   RRLDEGTSGGASKAEVNAEMGAVALPVDARPFEFHEGEEQAKIAIVNLFGERKEFKVNP
FT                   KRHTVADVYGLAAAYANVHLGAFKLVVRDVPPRQLSDESKTVDEARLSNCTVIVRTL"
FT                   /protein_id="XP_845849.1"
FT   repeat_region   585895..585932
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   585932..585957
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   586035..586072
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   586072..586097
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<586310..>587011)
FT                   /note="synonym: Tb07.22O10.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658439"
FT                   /locus_tag="Tb927.7.2270"
FT   mRNA            complement(<586310..>587011)
FT                   /db_xref="GI:72391111"
FT                   /db_xref="GeneID:3658439"
FT                   /locus_tag="Tb927.7.2270"
FT                   /transcript_id="XM_840757.1"
FT   CDS_pept        complement(586310..587011)
FT                   /locus_tag="Tb927.7.2270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391112"
FT                   /db_xref="GeneID:3658439"
FT                   /translation="MIERTDVVTGTETQEGSTVPQEARQFLQIIATMQSESEERARIIG
FT                   ELRYRKLLVEEERDKNFMEREAVVAKLADARAQLLQLDVEHRELQKRQRSSESEILENS
FT                   RQSQRCRTLLSTCRGDLTVHPMVPNSASELAAEATAAGTSSAAHNAYTEEAKWLKHLFI
FT                   TYGQLYNGTDFLQELRVSMKNLYVEVSKETHNTVQRNLSDWEATCLQSLPHLTADERTL
FT                   LHFQLMLHPFV"
FT                   /protein_id="XP_845850.1"
FT   gene            complement(<587653..>588546)
FT                   /note="synonym: Tb07.22O10.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658440"
FT                   /locus_tag="Tb927.7.2280"
FT   mRNA            complement(<587653..>588546)
FT                   /db_xref="GI:72391113"
FT                   /db_xref="GeneID:3658440"
FT                   /locus_tag="Tb927.7.2280"
FT                   /transcript_id="XM_840758.1"
FT   CDS_pept        complement(587653..588546)
FT                   /locus_tag="Tb927.7.2280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391114"
FT                   /db_xref="GeneID:3658440"
FT                   /translation="MGQKGRMSAAPKSVGSSIIGGRSVTTMRSSLLPTLPGNFDDAMAT
FT                   PWPIANSNRRASEYPSSLPGLPHVATTASTAYGSNYYLDQYWDRGMPDVWQNSVVGSSD
FT                   NMVLDRERSRRLMALQRRKYKELVKAEKEAFMVLMQKEEGSVESINAFTAFRISLQRKQ
FT                   EQYRAKNGPWLAQSFAIRVEQLIEQEQEERRMIQRAEFRVRDSRQCVERIVGAKMRFQR
FT                   AIESLFRSEEQYRSIIEEWETSEARHISALRPFVTLKSVRALGQCPFVSVKDCPFHHRG
FT                   EGVRSNHYRFSVRDVD"
FT                   /protein_id="XP_845851.1"
FT   gene            complement(<589157..>589792)
FT                   /note="synonym: Tb07.22O10.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658441"
FT                   /locus_tag="Tb927.7.2290"
FT   mRNA            complement(<589157..>589792)
FT                   /db_xref="GI:72391115"
FT                   /db_xref="GeneID:3658441"
FT                   /locus_tag="Tb927.7.2290"
FT                   /transcript_id="XM_840759.1"
FT   CDS_pept        complement(589157..589792)
FT                   /locus_tag="Tb927.7.2290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391116"
FT                   /db_xref="GeneID:3658441"
FT                   /translation="MKTAKVNSTIKKGKAKKVKTTKSTEKTPLTWTFSFHEVKRQQASL
FT                   LFIAWDEDDSGRIPRQHLLSILYALFPSANSMGDGKVGERPSALSLREIRDAFLMTVGR
FT                   PLSEMSYVTLKDVCSVLDSLWASPARRERMAQGCLYSVFTSVADSGHMMTRSALVEACN
FT                   HIAGAAISEGMAEAILSPHGIAAGLLNEGESKINFSGFCKIMLPLLAV"
FT                   /protein_id="XP_845852.1"
FT   gene            complement(<590576..>594187)
FT                   /note="synonym: Tb07.22O10.260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658445"
FT                   /locus_tag="Tb927.7.2300"
FT   mRNA            complement(<590576..>594187)
FT                   /db_xref="GI:72391117"
FT                   /db_xref="GeneID:3658445"
FT                   /locus_tag="Tb927.7.2300"
FT                   /transcript_id="XM_840760.1"
FT   CDS_pept        complement(590576..594187)
FT                   /locus_tag="Tb927.7.2300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391118"
FT                   /db_xref="GeneID:3658445"
FT                   /translation="MFAFLPPAKAARTERSPLGSTELGCDVSQLTTPSVTAVSPFPVGQ
FT                   VRPVTIAEADIRVGGVSVRPSIFLSGIGTNSCWMVDENTRLLRVWDMRKPFWHRTAPRV
FT                   AHIPFFTESEGLPLFVTELGPNDESIAFCTDYGVVSSLDHSVEFQVSTENEPVKVSAFA
FT                   CRREQQATLTAVGTLSGAIFVAIKIDGERFVISFERTSCNVSVRTSTSSSGGSWWSSFL
FT                   PKRLLSTDSRESNNDEADGSRLEFTLLRFRGEHPTQLWAVNAASEFFLLDIGPLRRRRP
FT                   KNNGSAEGGIRAKWITNISSVLQRRGRVVAFDETPLSLCCLVYLFSCSRWDASLEVVTM
FT                   EPSTGAVRRVVSMQSIALLAHSVASAPLHHTKIYLDESSHMITILSGQCCVFLNNDLGV
FT                   RNPCSSEDVHMLRNVEFPIVSALLPDGHIVTMGINGPVVSNTRADELLHEAAEDSREAA
FT                   DDRGSRGSGIRQNSDAWKQSRFTGGRDGLNDVTRLLNNLLDSLRIDCKMSIDSAVLDAG
FT                   EAICLYSTPHKGNWARADLNIEDDNIIMHVTHSVVQRQQEHRRFLLTVLLHKEIALRLQ
FT                   PQTIARLLSMQEALLVMVAIRRLQNDTTHCSSSATTTVEGFEVMTPLYQLASAGSNNIN
FT                   SSLLAANLSQNGDSCSVEDYRRLVRSAVERERCQLLLRRAINCVADQARSELSSANSMC
FT                   AQATSAEIVFGDPSRLSQLLQVLCDNLHETQGSVLIDRRSKFDDALSVASVFVLVARAI
FT                   DESREDIESLCPIPQNVRALMWTSSDASDYGIQLHLSSAAKCFSDALAGSLMWSKSEME
FT                   TMSAPADPLSEKMNTSELSSWLVPVQDQLRLLDFIAVIIHFTFRNHSEGGPTFFASAMR
FT                   STLFREPFLIEPLGYPFGAPVPTETTVGACVLRLCEELALDFVVDDVVSAFCLAEPVEN
FT                   PLQPSGKYDRLGLYCERNPKIFEVALRTLLTQRREWELQLLPELLPQYEAGAVARDEFL
FT                   AKEAPQLLWLMRPQAFYSLVEEGARLPSSSSASYFLYGDDLVTHRSRCLALSRLAWVAS
FT                   GSGNSSSYYGLELDTAVVAAQKRFLMPDTKNVVLGPAELVQRLLQLPSPDAWMSATGVV
FT                   CLVEEELRKDLLTQIARRAKQHDGEVLLQIKREGTSELEVARALEVTAIGRILLAATGR
FT                   GEGCATATAKACAGIFDNAEQQLLMSWLRARSAGLVS"
FT                   /protein_id="XP_845853.1"
FT   gene            complement(<594766..>596031)
FT                   /note="synonym: Tb07.22O10.270; DNA primase small subunit,
FT                   putative"
FT                   /db_xref="GeneID:3658442"
FT                   /locus_tag="Tb927.7.2310"
FT   mRNA            complement(<594766..>596031)
FT                   /db_xref="GI:72391119"
FT                   /db_xref="GeneID:3658442"
FT                   /locus_tag="Tb927.7.2310"
FT                   /transcript_id="XM_840761.1"
FT   CDS_pept        complement(594766..596031)
FT                   /locus_tag="Tb927.7.2310"
FT                   /gene_family="HOG000257296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA primase small subunit, putative"
FT                   /EC_number="2.7.7.-"
FT                   /note="go_component: alpha DNA polymerase:primase complex
FT                   [goid 0005658]; go_function: DNA primase activity [goid
FT                   0003896]; go_process: DNA replication [goid 0006260]"
FT                   /db_xref="GI:72391120"
FT                   /db_xref="GeneID:3658442"
FT                   /translation="MIDETSLREFYEFVYPVDLVVQWLSYNLQHADKIISSPPGSVANG
FT                   NDPKVLPSTGEDVTEGGRGSTSSADGYLARREFCFTLLGDIFTRFRSYSSVTELRRELI
FT                   RSFPEKIDVGAVYNIRPNQKQKVGTIVPVERELVFDIDMSDYDNSRSCCTGKSICRWCW
FT                   TWMSCAAAVLRKVLEDDFGFRYLFPVFSGRRGIHLWVCDKRACKMHDDERSALVSYLTV
FT                   VVPKASQHAVVADFVNGKPIHPTIQHVQATVLDPAFTSLFLNSTPENPNRVTHPKGARI
FT                   VYKAIVSALKMGTRRDVEQRFLRNVPFEEGNILDWTYVLRTLGDAATNVIAAAQILLMY
FT                   PRLDEHVSTRRDHLLKLPFCVHPATGSLCCPLEWDNVPTFDPVSDPPKLQDMLLHRHMD
FT                   EKWLAPLQRMLQEMGRDPAEER"
FT                   /protein_id="XP_845854.1"
FT   gene            complement(<596569..>598386)
FT                   /note="synonym: Tb07.22O10.280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658444"
FT                   /locus_tag="Tb927.7.2320"
FT   mRNA            complement(<596569..>598386)
FT                   /db_xref="GI:72391121"
FT                   /db_xref="GeneID:3658444"
FT                   /locus_tag="Tb927.7.2320"
FT                   /transcript_id="XM_840762.1"
FT   CDS_pept        complement(596569..598386)
FT                   /locus_tag="Tb927.7.2320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391122"
FT                   /db_xref="GeneID:3658444"
FT                   /translation="MSIVNQLTPAERRILNEALENAEKRACNGALAAAEGTQFPLIPGV
FT                   ATAGARRAKPKACNTMERISQQERQERELWMAVERSLEHPFVYRTDSSKELAVNMLRRI
FT                   PRLKDLSLRDLETMSSTMRIAHVGDGVVLAGNQPRKTEANVETMDYIDRYSLVVNEDTA
FT                   TTAGWSSDVDLAPKAEREVTSAQEASEQGRDDSSCSPSKSSARHDMARYVYVLLRGNVL
FT                   LRLPFKCPMDALVEPYEMFGLPTTLAALPEDAYYQTCSDCVLLCFPRNKEYVMDGVLKR
FT                   LDKRLVQEQTTFLQQHLRVKVLTHWTPQEYERCARALVPLRVSWRQMVVEQDMESDAMY
FT                   FIKEGQCVVVRNVPLPRGRARYGRRVHEGSVTCFPSTGAKARQSRQLNESVTSFGHFPS
FT                   SVPRGQQHNLPSQTMKFVEVATLREGEFFGELGLLSHEVDRKPDVEKIRSEAYWRNTLA
FT                   AAKDAPTDYAPLDGELPLQKVLQPLSSGSPSPRGIEGDPTSFALGLEPTNKFSMFPQPT
FT                   MGRQASVYTRCPCVFYMLPYDRCRELFGAREYAQLKEFANGYPSREDIEIHYERQRKWS
FT                   KYRKTLVNDVLNDASNMRQKSHEGCSRVK"
FT                   /protein_id="XP_845855.1"
FT   gene            complement(<599448..>602747)
FT                   /note="synonym: Tb07.22O10.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658446"
FT                   /locus_tag="Tb927.7.2330"
FT   mRNA            complement(<599448..>602747)
FT                   /db_xref="GI:72391123"
FT                   /db_xref="GeneID:3658446"
FT                   /locus_tag="Tb927.7.2330"
FT                   /transcript_id="XM_840763.1"
FT   CDS_pept        complement(599448..602747)
FT                   /locus_tag="Tb927.7.2330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391124"
FT                   /db_xref="GeneID:3658446"
FT                   /translation="MRSRNTDAPSRRRGGLARAAGLLKRAATRRDSLESKTVASFTSSP
FT                   PPSAPQDRVSRTSTVGMWEDVDTRSASRYYEKNPPSPIRLNSAFHRSYGGQVGQGFKAA
FT                   RAHPMSATTSIGRFGSILFSGDTVSVPRGRGHSKSPALSPAADIIAHIVTDDLKGSVER
FT                   SRREVSTDPPCWRVQHDEDIARHELHIEEMEAYSALIQKMMTHRVLQVKAYQQRLDAEE
FT                   KMWLALQNVHAVIEKEEERRNLIVSKESVDRRNLTRKVDGGECSDEEEPAVEINPGEWI
FT                   SYAYPLQTEKLRIQESAQRQRMYLEHAIAIHKLQTRMRLALKMLNAARIKKEEIDEKGH
FT                   PTEKYPVRKSNTNESLLLWNSWDSDLDEAMDQEIYELINILWKNDKVSHSTPTTLNETQ
FT                   DMASTQSPTKRHIKADDEEPEKIKTTEREGIINTHEQRKNYKQRIICREEHERDKIMEN
FT                   EVNAMFNILRNTNKTQKEEIYEDANKEKIQKKIEEKKKDEYSHEIKENNHQGISDKDNE
FT                   NSTKNNSAETNNKSNETRIRSTSTKVDCAFDLHDQFTDDMLAISMDNATTTETQDREGL
FT                   QGDECRERFALCASAIEGEEDASRKDIVCAYDDCAFDLHDQFTDDMLAISMDNVTTTET
FT                   QDREGLQGDECRERFALCASAIEGEEDASRKDIVCAYDDCAFDLHDQFTDDMLAISMDN
FT                   VTATETQDREGLQGDECRERFALCASAIEGEEDASRKDIVCAYDDCAFDLHDQFTDDML
FT                   AISMDNVTTTETQDREGLQGDECRERFALCASAIEGEEDASRKDIVCAYDDCAFDLHDQ
FT                   FTDDMLAISMDNVTTTETQDREGLQGDECRERFALCASAIEGEEDASRKDIVCAYDDCA
FT                   FDLHDQFTDDMLAISMDNATTTETQDPKGLYFFAETLITFSAGESTESTFGDKAGDVPY
FT                   SGFDSERRGLALGAFNTYGAGTSLQNDGLRAGEGVDSLRPFSAGETAESTFGDKAGDVL
FT                   YSGFDSDRRGLALGAFNTYGAGTSLQNDGLRAGEGVDASGSFSCSLMDVEEDERILLLQ
FT                   EEDRRFKRLLKRFVSRPVNDLEKRRGTPNMRVDVASFTCGCVLERWVIRNR"
FT                   /protein_id="XP_845856.1"
FT   misc_feature    601118..601204
FT                   /note="T-rich"
FT   misc_feature    601258..601344
FT                   /note="T-rich"
FT   gene            complement(<604152..>604610)
FT                   /note="synonym: Tb07.22O10.320; 40S ribosomal protein S15,
FT                   putative"
FT                   /db_xref="GeneID:3658443"
FT                   /locus_tag="Tb927.7.2340"
FT   mRNA            complement(<604152..>604610)
FT                   /db_xref="GI:72391125"
FT                   /db_xref="GeneID:3658443"
FT                   /locus_tag="Tb927.7.2340"
FT                   /transcript_id="XM_840764.1"
FT   CDS_pept        complement(604152..604610)
FT                   /locus_tag="Tb927.7.2340"
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S15, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72391126"
FT                   /db_xref="GeneID:3658443"
FT                   /translation="MASNITQERYEQLKKERTFHKFTYRGHEIDPLLALTEEEFKALVH
FT                   ARARRRMNRHADRRAPVLLKRLREAKKNVKAGEKPKAVKTHLRDVVITPEMVGSVVGIY
FT                   NGRQFNAVEIKGEMIGHYLGEFSLTYKPVAHGRPGFGATHSSRFIPLK"
FT                   /protein_id="XP_845857.1"
FT   gene            complement(<605377..>608436)
FT                   /note="synonym: Tb07.22O10.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658447"
FT                   /locus_tag="Tb927.7.2350"
FT   mRNA            complement(<605377..>608436)
FT                   /db_xref="GI:72391127"
FT                   /db_xref="GeneID:3658447"
FT                   /locus_tag="Tb927.7.2350"
FT                   /transcript_id="XM_840765.1"
FT   CDS_pept        complement(605377..608436)
FT                   /locus_tag="Tb927.7.2350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391128"
FT                   /db_xref="GeneID:3658447"
FT                   /translation="MSDDAKTTLSRSVLQSCSLESTLANARSLTRTMSFVPQIPLRFDT
FT                   PNKKRKATRDAHLATPTKPSEQPVCMPLLKSGRGALEHKVWNTDATPTEGTTSTKKRVQ
FT                   EIETSMCTTCARHVPEPQRSINMAKALDDMGRVYPSLSGVMLITRRYVKELASALEAMQ
FT                   ESHTSEVKRLEETVYKKYEKFFEGKVLQLIRENRKTEAVAKQLREEVFTLRKQRDDELS
FT                   KAKEIVMTRLNDCERKEDEFNMLKRLVTLVFKTNQGLVNQVEDLSSLLRKHRIDVPKID
FT                   DALFLYNKPKTSNAINSNEDGVKKLSEQVSPQFIEASRKEMSNSRLTLQRELLNNAFDD
FT                   CSAYRLQINGLRTSNNNLRLQVASLQGQIVDLEKYIHEKRFMNTEVEGDDVPLTPRPRN
FT                   LPFAIQTDLGVDLKKSTCGIVAELTAVAMNLKHQLNSSVLALRRLANVLEWIDDENLLK
FT                   TVGDEGVWGLIPVFPNSMWNEIPHFLRTNVDCDIPNLNWSGEDVSSLLYDFFSRFEALR
FT                   LACRFKRDSKMFIPRVYQLFERIENYLVRLDATVSEVEERVENVPFGYVVTYFLNNFLR
FT                   TYTYGSPHQHLFQSGTVAPTYPSNNSAAAVEMEFAKVSYNLWYAARRHKDTQPLCYLFV
FT                   NVLDGRLPLGLFGLMERVLRNAEAGILKYDTDGSNLFTYNKLVSSVLKVVGDMDAQVGR
FT                   CVVLAVAETFRESDVPVVGGRINFKDVSADEAAPRADERKVRHRPSYQGQGIVKVEPNS
FT                   SHYRVGASVLTRFWRRLVIRSHEYVYDIIESILGPFIVESQVVAGVFLLPIVTSTAAMQ
FT                   AFDENKYEPSETYLQRSCPFMRSKADKQRDSSPNKENPQPLNLSESYDMLRLERTAFIQ
FT                   PFKDISLEAVFTDVLTRVKHIGSSIHFSIDASGSKLVSSPTVSAVKTNHPSPRENKNQR
FT                   ENSEGVKGRRSRSKSISKGKQRANESNVPSPPTSSLRDPTNDCVPLSLVVQSDKDVVEW
FT                   YDFCAALRQTVISIPNSVFSDGDAKTERED"
FT                   /protein_id="XP_845858.1"
FT   gene            complement(<609925..>610851)
FT                   /note="synonym: Tb07.22O10.340; N-acetyltransferase,
FT                   putative"
FT                   /db_xref="GeneID:3658448"
FT                   /locus_tag="Tb927.7.2360"
FT   mRNA            complement(<609925..>610851)
FT                   /db_xref="GI:72391129"
FT                   /db_xref="GeneID:3658448"
FT                   /locus_tag="Tb927.7.2360"
FT                   /transcript_id="XM_840766.1"
FT   CDS_pept        complement(609925..610851)
FT                   /locus_tag="Tb927.7.2360"
FT                   /gene_family="HOG000257300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-acetyltransferase, putative"
FT                   /note="similar to L-A virus GAG protein N-acetyltransferase
FT                   (EC 2.3.1.-). (Swiss-Prot:Q03503) [Saccharomyces
FT                   cerevisiae]; go_function: N-acetyltransferase activity
FT                   [goid 0008080]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:72391130"
FT                   /db_xref="GeneID:3658448"
FT                   /translation="MPKKGKKNATKNNVKDVDIDALVAAIEGTSVPSKNSKEGMTRKQA
FT                   MALEEKQMEEVLTKPVAAAQPLVDEHRLRMSLLAERLMHEKAIRDAEVAKALVPLKEEE
FT                   KAWQKVSDNKYIRYEQFDGDEEVMNFIVQLFTKELTEPYSSFTYEYFIFGWPDLTIVAY
FT                   GYDGEDVPDASVKGKRVGAVVSRVSRKHIDSPLRGYVAMFAVIPEFRGFRLGSRLVTLT
FT                   IELMREKGCDEVYLETPTNNERALSLYLNLGFAKSKFLPRYYLDHSDAVRLKLWLKDPP
FT                   FCTPVQPATPAVAVAAAASPSTSTSPI"
FT                   /protein_id="XP_845859.1"
FT   gene            complement(<611294..>611752)
FT                   /note="synonym: Tb07.22O10.360; 40S ribosomal protein S15,
FT                   putative"
FT                   /db_xref="GeneID:3658452"
FT                   /locus_tag="Tb927.7.2370"
FT   mRNA            complement(<611294..>611752)
FT                   /db_xref="GI:72391131"
FT                   /db_xref="GeneID:3658452"
FT                   /locus_tag="Tb927.7.2370"
FT                   /transcript_id="XM_840767.1"
FT   CDS_pept        complement(611294..611752)
FT                   /locus_tag="Tb927.7.2370"
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S15, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72391132"
FT                   /db_xref="GeneID:3658452"
FT                   /translation="MASNITQERYEQLKKERTFHKFTYRGHEIDPLLALTEEEFKALVH
FT                   ARARRRMNRHADRRAPVLLKRLREAKKNVKAGEKPKAVKTHLRDVVITPEMVGSVVGIY
FT                   NGRQFNAVEIKGEMIGHYLGEFSLTYKPVAHGRPGFGATHSSRFIPLK"
FT                   /protein_id="XP_845860.1"
FT   gene            complement(<612382..>612750)
FT                   /note="synonym: Tb07.22O10.370; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658451"
FT                   /locus_tag="Tb927.7.2380"
FT   mRNA            complement(<612382..>612750)
FT                   /db_xref="GI:72391133"
FT                   /db_xref="GeneID:3658451"
FT                   /locus_tag="Tb927.7.2380"
FT                   /transcript_id="XM_840768.1"
FT   CDS_pept        complement(612382..612750)
FT                   /locus_tag="Tb927.7.2380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391134"
FT                   /db_xref="GeneID:3658451"
FT                   /translation="MDKDLAGDMKALLAALGKEDDVSCGNGTGTAGSTYPSDSLEGKLD
FT                   QLLGALRANGSDVWEGKPLQDDLGIRFDFKQKGSSGEQSHKPSAGSEESAKASLDSLME
FT                   EYVEAVGKVRMTEGSPDE"
FT                   /protein_id="XP_845861.1"
FT   repeat_region   612813..612864
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   612953..613004
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<613867..>616722)
FT                   /note="synonym: Tb07.22O10.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658450"
FT                   /locus_tag="Tb927.7.2390"
FT   mRNA            complement(<613867..>616722)
FT                   /db_xref="GI:72391135"
FT                   /db_xref="GeneID:3658450"
FT                   /locus_tag="Tb927.7.2390"
FT                   /transcript_id="XM_840769.1"
FT   CDS_pept        complement(613867..616722)
FT                   /locus_tag="Tb927.7.2390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391136"
FT                   /db_xref="GeneID:3658450"
FT                   /translation="MYRPRGGAKQDRKESAASRKADHSGSQTSDATSPDVSFVNSIVGL
FT                   KTRLLTPFMKYDKTLKQVVINPEHDRVFRSEVSRVQGVVLRELRRILEFDSRLTPKEAL
FT                   YLVQKSVMLAFASCAVGSDGEVLVPCGSDEEAEVFMPRLEKIFAERSACAKAVVSLTAV
FT                   LCTGVVRDNYGVVCQRLEARLAAEEASPANSRRTDVELQALAATKKNTQDFLQFRAALV
FT                   TAFDSISAPLTSNGSNSIPRETAAADGTTANLVVQSFYSLLGWMLMVQPDRLNLETTRI
FT                   TPSLPFPPQDISDPPVTVTYYDPSSGKITIERSASSFKWGLLINMASKLIGVENTLRTA
FT                   TSTGGELFHALQLSEGGLPIYNINGVTIREPGEQEADGDVSEEVRVSRLEKLQNILKSK
FT                   VTKVSLLVAGVSGMHDPQEVSFNIIPQGGEGASGQEACLILKRPSVSVDWKLKLVANGE
FT                   NQLILDSVSPNISLSNAASEFINTHLGNLHVAQVNGCEPKNNSFLDDVMRSSLFLILRL
FT                   QTVATVNSDSKDGSVAVGVGNSRRQPKAMEIEKLEGAELAERGGSKSNVMRSAADDEIK
FT                   NAGNLDSQHRHGTDSDRPLPEGQGTREQGDEETQHEGSEKTEPKKRGRRRKTLHSSETD
FT                   DRTAETSGEVRSSTVATKETKKVGTTEGEEKGEATKKRKAEKKASEKKKKDKEDARKKA
FT                   GKKLSKAAKKSGKEKKGGKTKKGKDKEEGEEKRTRGRKSNKAKDSESKDGEAKEETPEG
FT                   GKKADSGAGTSLKEAAEAQGVVDKPLVDVKPRSDAAVVVSRKSESKKESSSSTSPGGGD
FT                   AAAVRIAVAPKGSVAMTPEVMAELKEAPPLTFENAVTLDHFDGMNMELRRPDLKTSWDI
FT                   SMTHGGDKLVLTRLPPVSAALKTHPFMKTLVPDDAGQISWQVDGVNGIDLHNATKSIRL
FT                   QAMDSIKKSSKVSLILRQLIK"
FT                   /protein_id="XP_845862.1"
FT   misc_feature    614370..614538
FT                   /note="CT-rich"
FT   misc_feature    614510..614678
FT                   /note="CT-rich"
FT   gene            complement(<617417..>618694)
FT                   /note="synonym: Tb07.22O10.390; tyrosyl-tRNA synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3658455"
FT                   /locus_tag="Tb927.7.2400"
FT   mRNA            complement(<617417..>618694)
FT                   /db_xref="GI:72391137"
FT                   /db_xref="GeneID:3658455"
FT                   /locus_tag="Tb927.7.2400"
FT                   /transcript_id="XM_840770.1"
FT   CDS_pept        complement(617417..618694)
FT                   /locus_tag="Tb927.7.2400"
FT                   /gene_family="HOG000257301" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tyrosyl-tRNA synthetase, putative"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   tRNA binding [goid 0000049]; go_process: tRNA
FT                   aminoacylation [goid 0043039]"
FT                   /db_xref="GI:72391138"
FT                   /db_xref="GeneID:3658455"
FT                   /translation="MYKYVLQEKSPFCKVLRDVLNMFGVPAENVNSGGECFAVVTGPKT
FT                   HSGLVPLVSALRKTAVDAKLKEFVGAAPDVAPLVNQWLLWASLLVSNEPTQTFKDSGCT
FT                   SFMGHLLLQVEKCIDLSDGKKGFLTGGTFPTIADLLLYVAVHNHPLWTPEAYPCVKAWA
FT                   LHTRSNERVAPLIPNLEGDAFSQFNPVATGGKAGATGGGKAKGDKPVFAKPSDEEILRR
FT                   KQEKEKAKLAKAANAAASAASATTAKDGISSPEKKKEVVPLNPNQLDLRVGRFLNVRRH
FT                   PNSDRLFVEDMDIGTETRTVVSGLVDYYKAEEVEGTLCITVCNLKPRSLRDINSHGMIL
FT                   CASNETSLRIVQPPEGAKPGDRILFGEAYNKEALLETKQLSGNAATGLLGPLRVDDQSI
FT                   VRWGDIPAQHPLGVLTVPGITNAIVK"
FT                   /protein_id="XP_845863.1"
FT   misc_feature    619337..619360
FT                   /note="AT_rich"
FT   misc_feature    619477..619500
FT                   /note="AT_rich"
FT   gene            complement(<619930..>621732)
FT                   /note="synonym: Tb07.22O10.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658449"
FT                   /locus_tag="Tb927.7.2410"
FT   mRNA            complement(<619930..>621732)
FT                   /db_xref="GI:72391139"
FT                   /db_xref="GeneID:3658449"
FT                   /locus_tag="Tb927.7.2410"
FT                   /transcript_id="XM_840771.1"
FT   CDS_pept        complement(619930..621732)
FT                   /locus_tag="Tb927.7.2410"
FT                   /gene_family="HOG000257302" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to EH-domain containing protein 1 (mPAST1)
FT                   (Swiss-Prot:Q9WVK4) [Mus musculus]"
FT                   /db_xref="GI:72391140"
FT                   /db_xref="GeneID:3658449"
FT                   /translation="MRQLGSAVLACGNFNTPLKSLRSITLPTTSSLKRLLRRSQLGANC
FT                   STNRMCFATTTTVMMLNKFGLKSSGDESASDGYNGIYRMESGSNKSGQHALEGVEEDLN
FT                   SLKRRVQQRYSDELRFLSHDSNRQPMVIVLGNHSAGKSTMINRLLGIELQRSGVSPTDD
FT                   GFTVIQSGEDDITEDGPTAVSDPRYSFQELRKFGIHFVNKFKVKTRKLPATSLLPPGLM
FT                   IVDTPGMIDTPIHLNDRTSVEGQLRGYDLFAVTRWFASRCDLIILMFDPANPGTTGETL
FT                   DVLTKSLAGVEHKLLIVLNKSDMYDKAADFARVYGVLCWNLSKVLQMKDIPHIYTTYFL
FT                   PRGDEFDDTRDAAGFAAFNKSSSTEETAVGGRKTASGSPQKESTSIIARDELLRQRSEV
FT                   VSEILQAPLRRYDNLITELEEGVKRVLLAGRVCTEIVSTYRKMKVVATLAPPAIFCVSG
FT                   LLLAVGGFTEVAALLASATAIAAVFAALKTRKSLVDFENDVLTNIDVIFDRLYVRHEKT
FT                   MDTQLRWKDTVKPEILEFLNSSSVAGRQSIASLPTLSKKSQDSIISILKNDIPQLRVRV
FT                   ANYKVKNFLRAGERQPLGNEVRVK"
FT                   /protein_id="XP_845864.1"
FT   misc_feature    622214..622262
FT                   /note="A-rich"
FT   misc_feature    622354..622402
FT                   /note="A-rich"
FT   misc_feature    622923..623009
FT                   /note="A-rich"
FT   misc_feature    623063..623149
FT                   /note="A-rich"
FT   misc_feature    623169..623326
FT                   /note="A-rich"
FT   misc_feature    623309..623466
FT                   /note="A-rich"
FT   misc_feature    623446..623467
FT                   /note="AT_rich"
FT   repeat_region   623544..623571
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    623586..623607
FT                   /note="AT_rich"
FT   repeat_region   623627..623647
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   623684..623711
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    623747..623827
FT                   /note="A-rich"
FT   repeat_region   623767..623787
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   623877..623950
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    623887..623967
FT                   /note="A-rich"
FT   repeat_region   624017..624090
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    624172..624224
FT                   /note="AT_rich"
FT   misc_feature    624312..624364
FT                   /note="AT_rich"
FT   misc_feature    624523..624553
FT                   /note="AT_rich"
FT   misc_feature    624663..624693
FT                   /note="AT_rich"
FT   misc_feature    624670..624700
FT                   /note="AT_rich"
FT   misc_feature    624810..624840
FT                   /note="AT_rich"
FT   misc_feature    624908..624930
FT                   /note="AT_rich"
FT   repeat_region   624959..624984
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    625048..625070
FT                   /note="AT_rich"
FT   repeat_region   625099..625124
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   625308..625393
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   625448..625533
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   misc_feature    625877..625904
FT                   /note="AT_rich"
FT   repeat_region   625950..625974
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    626017..626044
FT                   /note="AT_rich"
FT   repeat_region   626053..626084
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   626090..626114
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   626193..626224
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<626238..>627743)
FT                   /note="synonym: Tb07.22O10.450; glycogen synthase kinase-3
FT                   alpha, putative"
FT                   /db_xref="GeneID:3658454"
FT                   /locus_tag="Tb927.7.2420"
FT   mRNA            complement(<626238..>627743)
FT                   /db_xref="GI:72391141"
FT                   /db_xref="GeneID:3658454"
FT                   /locus_tag="Tb927.7.2420"
FT                   /transcript_id="XM_840772.1"
FT   CDS_pept        complement(626238..627743)
FT                   /locus_tag="Tb927.7.2420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycogen synthase kinase-3 alpha, putative"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72391142"
FT                   /db_xref="GeneID:3658454"
FT                   /translation="MSERILPSTLRGVTNGQKEVTASVGERVPLLPRRFSARPQGNQEA
FT                   QERTAVKCEQVRYAIQEVIGRGAFGEVSSAEVVGTRDLVAIKRVIHDGRLRQRELTLMR
FT                   DHLGPNTQQGGVSSLDVGNGVGAHATSVTGSNGEEANGTTAIDGLESWNMPTIVPYHPC
FT                   VVKLLDHFFASDPSGVQYLFMVMDYIPLDVRRLHHMFLRQREQQMPIILVKVIMFQLAR
FT                   ALAFLHARGICHRDVKPNNILVDQETGVVKLCDFGSAKKMQAVGGEGPREKNVPYIFSR
FT                   YYRAPELLLGSQYYHFHVDMWAFGCVLAELLCGKVLFKGSSSTMDQLVEIIKVLGKPSE
FT                   RELFALNPQSAGSALIRTWGDSHNASQLSPTPSGPLPSSNSANADYMQRRSAPRVKSLL
FT                   WVEVLPPNTSQAALSLIEQLLRYTPEERLTSAEVLEHVFFDELFSDDARLPNGAPLPAS
FT                   MFQVTREEAEILPPWLLERMAAAEGVAKGRELNQSATAPENAI"
FT                   /protein_id="XP_845865.1"
FT   misc_feature    627892..627940
FT                   /note="T-rich"
FT   misc_feature    628028..628050
FT                   /note="AT_rich"
FT   misc_feature    628032..628080
FT                   /note="T-rich"
FT   gene            complement(<628064..>628657)
FT                   /note="synonym: Tb07.22O10.460; hypothetical protein"
FT                   /db_xref="GeneID:3658453"
FT                   /locus_tag="Tb927.7.2430"
FT   mRNA            complement(<628064..>628657)
FT                   /db_xref="GI:72391143"
FT                   /db_xref="GeneID:3658453"
FT                   /locus_tag="Tb927.7.2430"
FT                   /transcript_id="XM_840773.1"
FT   CDS_pept        complement(628064..628657)
FT                   /locus_tag="Tb927.7.2430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72391144"
FT                   /db_xref="GeneID:3658453"
FT                   /translation="MTVWLETAWAAQKEKKRCANNSRCCFFFMLSNLSQILWEFVCRSI
FT                   FSPRCSPIEMYRNAFYMSLLLKSSSFFSFFLLFSFVASLASSFFLFLFWFSCLCDLSPL
FT                   RNCFLLVLTVIYPVPSTKKTPPTYIYIYIYISITIKYQKGSSNKRDSSPLKGLYIYIYI
FT                   CFRGIERITQKKNKGELRQIRGLSRKQREQKKKK"
FT                   /protein_id="XP_845866.1"
FT   repeat_region   628112..628137
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    628168..628190
FT                   /note="AT_rich"
FT   misc_feature    628225..628310
FT                   /note="A-rich"
FT   repeat_region   628252..628277
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    628365..628450
FT                   /note="A-rich"
FT   misc_feature    628569..628589
FT                   /note="AT_rich"
FT   misc_feature    628709..628729
FT                   /note="AT_rich"
FT   gene            complement(<628766..>630100)
FT                   /note="synonym: Tb07.22O10.470; pyrroline-5-carboxylate
FT                   reductase, putative"
FT                   /db_xref="GeneID:3658456"
FT                   /locus_tag="Tb927.7.2440"
FT   mRNA            complement(<628766..>630100)
FT                   /db_xref="GI:72391145"
FT                   /db_xref="GeneID:3658456"
FT                   /locus_tag="Tb927.7.2440"
FT                   /transcript_id="XM_840774.1"
FT   CDS_pept        complement(628766..630100)
FT                   /locus_tag="Tb927.7.2440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyrroline-5-carboxylate reductase, putative"
FT                   /EC_number="1.5.1.2"
FT                   /note="go_function: pyrroline-5-carboxylate reductase
FT                   activity [goid 0004735]; go_process: proline biosynthesis
FT                   [goid 0006561]"
FT                   /db_xref="GI:72391146"
FT                   /db_xref="GeneID:3658456"
FT                   /translation="MGMCTDRCVGVCKLNLALMHFVGMGEVCVWRRCGERGKKKERNIE
FT                   DKRKGEGGVHLNCLFCLLMCNMFFTFCASSFVLFYLNQMLPPLGEAHICVKIYKLKYIY
FT                   IYIRSYLYCFLFLCKCVWDGSICVSEVFYLALDFVLLFVQTYIKGQGGNYTHAHTQKKE
FT                   KDNCHTKSVTIMKISFIGCGNMGECILGGLIQSKQYPPESIRVFNRTKATVDRLCERYG
FT                   VGGAQSATDAAAYADVIVIGVKPKVVCELLASIQSSVTANKIIVSVAAAISIASMEKAL
FT                   GSEARKIVRTMPNLPTRVGAGVTSITSNAHVTASEKETIFQLFRTIGIVVEVLESQIPA
FT                   VSSVAGASPAYVFMFMEAMADAAVHGGLPRAQAYELAAQAVLGSAIMLQKCDMSPAQLK
FT                   DMVCSPGGVTIEAVRILEKGGMRSAVIEAMIACTDKSKELEKGLN"
FT                   /protein_id="XP_845867.1"
FT   misc_feature    629639..629675
FT                   /note="AT_rich"
FT   misc_feature    629779..629815
FT                   /note="AT_rich"
FT   gene            complement(<630506..>631963)
FT                   /note="synonym: Tb07.22O10.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658457"
FT                   /locus_tag="Tb927.7.2450"
FT   mRNA            complement(<630506..>631963)
FT                   /db_xref="GI:72391147"
FT                   /db_xref="GeneID:3658457"
FT                   /locus_tag="Tb927.7.2450"
FT                   /transcript_id="XM_840775.1"
FT   CDS_pept        complement(630506..631963)
FT                   /locus_tag="Tb927.7.2450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391148"
FT                   /db_xref="GeneID:3658457"
FT                   /translation="MSGDDDDVLDLLLSSGGENSEVGEEGDRPLNLSIENDDETEVVGI
FT                   GDRGAAASSEAVQTPTDDELRFIQNKADAKEFGPEVYKRWKKLQRRLHRAHGGEDDRRG
FT                   KPRKRSKSRRSTHKTKEGKRGSRKSKRNRDDIEHYSADVEVYEGFDTKDGVRHSREKRR
FT                   RKSSRTDYRLVDEGIADTNQASSSELLDSFQQDYRSDVLENRTRKGTKKGTQLSSTTTN
FT                   GARPKKLSVEAQQNLLNKRAAAVVDAMRKARVDDKCAMAGNEPPLQRVRICDRVAAYAH
FT                   CRVLQRYLIENGILQELSTWLYDFERRELAPYELRTAALDILLSFPIQGELEGTVLANG
FT                   DEIIDDFTGMTRDHLFNTDLGAAVNKVREDKDEIHENRAKAVLLMGRLSRAMAGGVSRA
FT                   GRRGWTTSSARSPHDAGEELSGNKKALSWKCQGDPTVAPPFHIVQTATEVFQRALAQPD
FT                   PLDPLSYLRTPSWRPPKPTATNVSQRN"
FT                   /protein_id="XP_845868.1"
FT   gene            complement(<632858..>634153)
FT                   /note="synonym: Tb07.22O10.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658460"
FT                   /locus_tag="Tb927.7.2460"
FT   mRNA            complement(<632858..>634153)
FT                   /db_xref="GI:72391149"
FT                   /db_xref="GeneID:3658460"
FT                   /locus_tag="Tb927.7.2460"
FT                   /transcript_id="XM_840776.1"
FT   CDS_pept        complement(632858..634153)
FT                   /locus_tag="Tb927.7.2460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391150"
FT                   /db_xref="GeneID:3658460"
FT                   /translation="MSTHRESAQALVRRLNAPHVCLQPTILHNATGSGLKRGDVLVVGG
FT                   MAGSGKSHWASRVAASHLSKGGAVTFLFAPGGAGFNMRRFMEHLEAVSGGSTHPGTPSG
FT                   WCGVGNGSDNFVVGDGIDRVDGAVSSCDSEVRRGVLLEALNRLTVVHCMDVNDLAVFCM
FT                   HGRATAVTELCEAVPLVVVECGYGRGGYLHHFERAVGHQVPLCHWLFGCLQRRWRCALI
FT                   LVEEWGTASIDCVDTATSTRHSHTNTHIVSGMDELSYLVERESEILRAVQVDAASWNDA
FT                   RRGSTLSLGGPCGKSLGSVTTPSTPAVGSTNTELCFSLNVGNAISSPSLQTSLSACGNI
FT                   SRGQPGGSFNFNGTSRFYYLYIQSVPADRSPPSMTRSNVLVGRLLQWRRDELSTTDPNI
FT                   VGSIEVLSEQQRRQKRAKAPRLRGDVLCGVQL"
FT                   /protein_id="XP_845869.1"
FT   gene            complement(<634852..>637008)
FT                   /note="synonym: Tb07.22O10.520; GTPase activating protein,
FT                   putative"
FT                   /db_xref="GeneID:3658458"
FT                   /locus_tag="Tb927.7.2470"
FT   mRNA            complement(<634852..>637008)
FT                   /db_xref="GI:72391151"
FT                   /db_xref="GeneID:3658458"
FT                   /locus_tag="Tb927.7.2470"
FT                   /transcript_id="XM_840777.1"
FT   CDS_pept        complement(634852..637008)
FT                   /locus_tag="Tb927.7.2470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTPase activating protein, putative"
FT                   /note="similar over 190aa to GTPase-activating protein GYP7
FT                   (GAP for YPT7). (Swiss-Prot:P48365) [Saccharomyces
FT                   cerevisiae]; go_function: protein kinase activity [goid
FT                   0004672]"
FT                   /db_xref="GI:72391152"
FT                   /db_xref="GeneID:3658458"
FT                   /translation="MDVGSKVFVDQLLSRVSFSDIISSHAHIVIEAHRGSGKKSPAGML
FT                   MLVRDDKHMNWASGRNKNSNNNTYVDISATAAELPSRGQPPREGSSQNVPAHTEDIFLV
FT                   WVPYSYIPRECPKLLPAFPRNSPILGVTVVGKPGDSSTELSHITCIEMKCIDKIRRVAS
FT                   VGGKSVIEVYRLDSAEIVMLSFCQGGLTSFLAEMRVLSPMSQSHLDTNDFIVYGHHPKN
FT                   LTTKFSSSEEERTTVMSHLNKLRSYTRSSFLNELWGTASGTGTPTALQPPTHETGDTRD
FT                   MQIMLYGKKDSNPLATVATKLTNVFNSLLEPSPNSRDEFASNVEVDPSLLFPCSDTPPK
FT                   GDERGDFFHGEGGVAAQISQVELQVPRISRCENLRQMGPRLTANEWNTCFVGDERRVDV
FT                   ERFEHAKIVAYMGGIDSDIRLEVWCFMLDVYGCHTSSTESQRQRVRDEYRRRYEVLTGQ
FT                   WKSIFPEQEENFTVFREARVAVEKDVLRTDRFLPAYADECGEKLCMLRNVLLSRVMLNL
FT                   DLGYCQGMSDILSPIALLAQDEVEAFMIFSCFIANHCCNDILKDVKRGMEQHLTALRAL
FT                   VAFSAPLLFNHLRIQGADDMFFCFRWLLVLFKREFPVEDAMLLWDVIICCPYTPRFEIF
FT                   VAAALLKAFTPQILEMNLSHDELLKFVNSASCQLDVRHVIVLSQDFYLEVAKHVTTLGG
FT                   GMVFRRGRLPTLEEVLQILEGNTT"
FT                   /protein_id="XP_845870.1"
FT   gene            complement(<637504..>638655)
FT                   /note="synonym: Tb07.22O10.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658459"
FT                   /locus_tag="Tb927.7.2480"
FT   mRNA            complement(<637504..>638655)
FT                   /db_xref="GI:72391153"
FT                   /db_xref="GeneID:3658459"
FT                   /locus_tag="Tb927.7.2480"
FT                   /transcript_id="XM_840778.1"
FT   CDS_pept        complement(637504..638655)
FT                   /locus_tag="Tb927.7.2480"
FT                   /gene_family="HOG000136166" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391154"
FT                   /db_xref="GeneID:3658459"
FT                   /translation="MVTSTGLLSRVAAVEKAAEIAKPPPPKVVELTEAAKQLPQHIIGV
FT                   TDPTKLNAQVSYFQCPPWAALPSVACHLQCTRDGLPLPALGLHRFPFYLFGRSKVCDYV
FT                   LEHPSISSVHAVLVFHGGQRCFVLMDLGSTNGVKLNGNRIEKRRPLPAPVGSSIQFGFS
FT                   SRVYKVQLGPPSSSKRLREEQERQEAEEGKRKCVEEDQQNGTLGDTRVSPSTSGAVSNE
FT                   ERIEGNVVVDRTVVESVAAETKEVVTCDGVLETSVQAGAPPPTERHFYHVLVKHKDVRR
FT                   PSSLAPRNKGEKITRSRADAINLAQAILAQHKERKTWSLDEFVQVVRDFSECGSAKRDG
FT                   DLGMVESGTYTEGFDTVAFSLKSGEVSAPVETELGVHLIYRVE"
FT                   /protein_id="XP_845871.1"
FT   gene            complement(<638932..>641043)
FT                   /note="synonym: Tb07.22O10.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658464"
FT                   /locus_tag="Tb927.7.2490"
FT   mRNA            complement(<638932..>641043)
FT                   /db_xref="GI:72391155"
FT                   /db_xref="GeneID:3658464"
FT                   /locus_tag="Tb927.7.2490"
FT                   /transcript_id="XM_840779.1"
FT   CDS_pept        complement(638932..641043)
FT                   /locus_tag="Tb927.7.2490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391156"
FT                   /db_xref="GeneID:3658464"
FT                   /translation="MLQKAGRHGGYATQFWTKRRTAYRTRHEALTAHSVKSIQRRLVLP
FT                   LEAHDWSRALEVLRARYALLGRTTLDYQRVIRGIAADNVSPFRIQTGVKLLNELRDEVY
FT                   AGDVKADGVWVTLLWAYVHLGRPLEGYECLLQAKRRVKMSALTWHHMGETLIPLLAEFG
FT                   MLAEARYVFENFMQVGGSLQEKERMSHIIAEAAARSGSWTEAIQAICRSTGDVAVEKVE
FT                   PIVTKPTNPTLASLFVAEAPGSTPGVGRVRTPIDSGSLQNKRLTTEAVRSMMYSMARDG
FT                   QWTLALGCLHELWGRQMPCAQQDSHTPRCASISVDGVAPASVSSTSGDVALQPLIMTSS
FT                   EMQQLLNALGDQKRWKEAVRLFRDCYLSGCTHPLVRTSHPLKPLTLNLLFSAFPRETRE
FT                   LTLTNSGEEPELSHLDHMDSKRQQISGVEKVQITLQLDVVCHPDQVVVLLDQLLLERDD
FT                   IVITDCMMGTVGPALVQLGQWDRALHLLRQVPELFPTKEKHLRQHEQLESAETKRRIRQ
FT                   HLVALLFYLYSAVSLEARYYTILHFPHVFPAEMFSSMPPPKELAASLRELQQQRIEKCE
FT                   KKEALRHFASRRRSRTVQRTEQMDAELRERLTLLHSKRANAFCVEDDPERDPRPIPKGL
FT                   HDTASGWNFYGRGGEMVFMNHRRTAHPFSMHPKVMRSLADPYRGWGLKQNSCWAHRERV
FT                   KKWNGNSAV"
FT                   /protein_id="XP_845872.1"
FT   misc_feature    641843..641912
FT                   /note="GA-rich"
FT   misc_feature    641983..642052
FT                   /note="GA-rich"
FT   gene            complement(<642312..>643625)
FT                   /note="synonym: Tb07.22O10.570; proteasome regulatory
FT                   ATPase subunit 1"
FT                   /db_xref="GeneID:3658463"
FT                   /locus_tag="Tb927.7.2500"
FT   mRNA            complement(<642312..>643625)
FT                   /db_xref="GI:72391157"
FT                   /db_xref="GeneID:3658463"
FT                   /locus_tag="Tb927.7.2500"
FT                   /transcript_id="XM_840780.1"
FT   CDS_pept        complement(642312..643625)
FT                   /locus_tag="Tb927.7.2500"
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome regulatory ATPase subunit 1"
FT                   /EC_number="3.6.4.8"
FT                   /note="similar to:GB:AAF91243.1: proteasome regulatory
FT                   ATPase subunit 1 {Trypanosoma brucei} (PMID:11854272); 100%
FT                   similar to:GB:AAF91243.1: proteasome regulatory ATPase
FT                   subunit 1 {Trypanosoma brucei} (PMID:11854272);
FT                   go_component: proteasome regulatory particle (sensu
FT                   Eukaryota) [goid 0005838]; go_function: ATPase activity
FT                   [goid 0016887]; go_process: ubiquitin-dependent protein
FT                   catabolism [goid 0006511]"
FT                   /db_xref="GI:72391158"
FT                   /db_xref="GeneID:3658463"
FT                   /translation="MASEKGGCQTKNTVRIKGENEEEKEIIPLDQDDIALLKLYGSGPY
FT                   HATVKELEEFVKTKAEAVNKLAGTRDNELGLAPPVQWDLNSDQEVMRSENSLHVARCTR
FT                   IINKGQDDAKYVVAIRDTAKYVVKLGNRVARQDIEESMRVGVLVGYSSIHIEIPLPPRV
FT                   DPSVSMMQVEEKPDVTYNDVGGAKEQIDRIREVVELPLTNPEKYTQLGIDPPKGVLLYG
FT                   PPGTGKTLLAKAVANRTDATFIRVIGSELVQRYIGEGARMIREIFQLARTKKAAIIFFD
FT                   EVDAVGGARGGGDGDDEIQRTMLEMVNQMDGFDSRGNIKVIMATNRPDTLDPALTRPGR
FT                   MDRKLEVGLPDLEGRTKILRIHAKSLSCEKAIRFELIARLCPNATGADLRSVCTEAGMF
FT                   AIRARRKTINEKDFLDAVNKVIKGHHKFSATAKYMVYN"
FT                   /protein_id="XP_845873.1"
FT   misc_feature    643572..643610
FT                   /note="AT_rich"
FT   misc_feature    643712..643750
FT                   /note="AT_rich"
FT   misc_feature    644080..644106
FT                   /note="AT_rich"
FT   misc_feature    644220..644246
FT                   /note="AT_rich"
FT   repeat_region   644345..644376
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   644485..644516
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<645093..>645641)
FT                   /note="synonym: Tb07.22O10.590; endoplasmatic reticulum
FT                   retrieval protein, putative"
FT                   /db_xref="GeneID:3658461"
FT                   /locus_tag="Tb927.7.2510"
FT   mRNA            complement(<645093..>645641)
FT                   /db_xref="GI:72391159"
FT                   /db_xref="GeneID:3658461"
FT                   /locus_tag="Tb927.7.2510"
FT                   /transcript_id="XM_840781.1"
FT   CDS_pept        complement(645093..645641)
FT                   /locus_tag="Tb927.7.2510"
FT                   /gene_family="HOG000163668" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoplasmatic reticulum retrieval protein,
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_process: protein transport [goid 0015031]"
FT                   /db_xref="GI:72391160"
FT                   /db_xref="GeneID:3658461"
FT                   /translation="MSSKDIIGQKSAARKFTDNIKMTWSRLLDQTVPHRPLRWVMFVFM
FT                   LSLYILRVYFCGGFYVISYVLGIHLLFLLVQVITPLADEDLGSEGQLPHTAASPDEEFR
FT                   PFVPRMQEFVVWCSMMKSVLVCTFLTLFRILDIPVFWPVLLLYFIFLTIIQVGERIRHM
FT                   IRHRYVPWSAGKPKFVPKS"
FT                   /protein_id="XP_845874.1"
FT   repeat_region   645513..645532
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   645653..645672
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<646588..>647763)
FT                   /note="synonym: Tb07.22O10.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658465"
FT                   /locus_tag="Tb927.7.2520"
FT   mRNA            complement(<646588..>647763)
FT                   /db_xref="GI:72391161"
FT                   /db_xref="GeneID:3658465"
FT                   /locus_tag="Tb927.7.2520"
FT                   /transcript_id="XM_840782.1"
FT   CDS_pept        complement(646588..647763)
FT                   /locus_tag="Tb927.7.2520"
FT                   /gene_family="HOG000136165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391162"
FT                   /db_xref="GeneID:3658465"
FT                   /translation="MEESTERSLIRVDSHRDSQPEPVEDAHGEDVVLKGGKTRPRPMRF
FT                   GVRPHYFLPNDIVWIRPPGLPYWPGEVLVADVKSNRITARLFDPPPSLVSSGDADDGLK
FT                   RDCITAPASAVYFFDRLRTPEDVADCIEQRLQRTKHKVDAYEAAFHRAVMHANRLVRIV
FT                   LSPEKLQPYSICGVGIVYSLMRTHISAPRQPHTENFMPQTAVIRLRVGLENAVRDLKGF
FT                   EYIWVLFSFSYALPVDEECTQAKDSATAADDTGGVKGDRAEVAVGAKRQRPRQGAERSA
FT                   GFKTMLVPPRDSELRGVFATRSPHRPNFIGLSCVRLVDVRGLEVHIADHDLLHGTPVLD
FT                   IKPYLPFCDAHPDAYAGWVAELDAAGRGGSDHKYDKQSLQVDRVFEEEAVA"
FT                   /protein_id="XP_845875.1"
FT   gene            complement(<648306..>649232)
FT                   /note="synonym: Tb07.22O10.620; N-acetyltransferase,
FT                   putative"
FT                   /db_xref="GeneID:3658466"
FT                   /locus_tag="Tb927.7.2530"
FT   mRNA            complement(<648306..>649232)
FT                   /db_xref="GI:72391163"
FT                   /db_xref="GeneID:3658466"
FT                   /locus_tag="Tb927.7.2530"
FT                   /transcript_id="XM_840783.1"
FT   CDS_pept        complement(648306..649232)
FT                   /locus_tag="Tb927.7.2530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-acetyltransferase, putative"
FT                   /note="go_function: N-acetyltransferase activity [goid
FT                   0008080]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:72391164"
FT                   /db_xref="GeneID:3658466"
FT                   /translation="MNNKNVLVSGQRLRLVPYLHHHVPRYHCWMSDPKMLELTASEPLT
FT                   LQEEYENQQEWLCAEDKLTFIILAPVSVRQGEMEVHEGVCGKCSATAEENVEGGKKILH
FT                   SSTGGASQHSKIPVDAATALTTRDGEEGLYVMIGDCNLFLLSSGEGEMEGDGSTDSTVD
FT                   TAFHILSSDKISSVEPTTTNPTAADCGRCFEVEAMIAEGNFRRRGFGEEAVRLLMSYAL
FT                   DKLRASRFVAKVRANNFSSIQLFTSKLGFTLLKEVPVFGEIHYIKFFIDSDGESWKEEA
FT                   GYLIGTYDESVERKLRITNLVPENEQT"
FT                   /protein_id="XP_845876.1"
FT   gene            complement(<651108..>651788)
FT                   /note="synonym: Tb07.22O10.640; ubiquitin-conjugating
FT                   enzyme E2, putative"
FT                   /db_xref="GeneID:3658462"
FT                   /locus_tag="Tb927.7.2540"
FT   mRNA            complement(<651108..>651788)
FT                   /db_xref="GI:72391165"
FT                   /db_xref="GeneID:3658462"
FT                   /locus_tag="Tb927.7.2540"
FT                   /transcript_id="XM_840784.1"
FT   CDS_pept        complement(651108..651788)
FT                   /locus_tag="Tb927.7.2540"
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ubiquitin conjugating enzyme activity [goid 0004840];
FT                   go_process: protein modification [goid 0006464];
FT                   go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72391166"
FT                   /db_xref="GeneID:3658462"
FT                   /translation="MDNESTNEAAINISRQTARVAIDGEETAPHGIEVTAEAEAEAEAV
FT                   VRSIPQPQATVENSHNFASAQRRLMNDLQVIHMNKCEQFWTRPLEGDLFQWKAVVLGPD
FT                   GTAWEGGVFKLLLQFPPEYPFSPPSVRFTTKIFHPNVYGNGDICLDTLKDKWCPSLSVE
FT                   SVLLMIISLLSDPNPNSAANAEAASMYVQSRDKYEERVRRVVEESLEQSFSDADDDDAT
FT                   EGAE"
FT                   /protein_id="XP_845877.1"
FT   repeat_region   652011..652035
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   652151..652175
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   652644..652680
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   652784..652820
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<653351..>654688)
FT                   /note="synonym: Tb07.22O10.660; proteasome regulatory
FT                   ATPase subunit 5"
FT                   /db_xref="GeneID:3658471"
FT                   /locus_tag="Tb927.7.2550"
FT   mRNA            complement(<653351..>654688)
FT                   /db_xref="GI:72391167"
FT                   /db_xref="GeneID:3658471"
FT                   /locus_tag="Tb927.7.2550"
FT                   /transcript_id="XM_840785.1"
FT   CDS_pept        complement(653351..654688)
FT                   /locus_tag="Tb927.7.2550"
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome regulatory ATPase subunit 5"
FT                   /EC_number="3.6.4.8"
FT                   /note="identical to GB:AAF91247.1: proteasome regulatory
FT                   ATPase subunit 5 {Trypanosoma brucei} (PMID:11854272); 99%
FT                   similar to: GB:AAF91247.1: proteasome regulatory ATPase
FT                   subunit 5 {Trypanosoma brucei;} (PMID:11854272);
FT                   go_component: proteasome regulatory particle (sensu
FT                   Eukaryota) [goid 0005838]; go_function: ATPase activity
FT                   [goid 0016887]; go_process: ubiquitin-dependent protein
FT                   catabolism [goid 0006511]"
FT                   /db_xref="GI:72391168"
FT                   /db_xref="GeneID:3658471"
FT                   /translation="MTQDTARATGGAAEGDRGGTSDASAAAQLSPEELENIDSLTNQQL
FT                   RNRSTQLQREIHQLKNEERTMSSELAGLRREVEESQKRVRDSNKLPYLVASIAEVLDLE
FT                   ADDQDVEELNVGKKKSRHPQKSAIIKTSSRQTVFLPVVGLVDANKLSPQDLVGVNKDTF
FT                   LVLEELPPEYDSRVKAMEIVEKPKEKYTDVGGLDKQINEMIEAVVLPITEKEKYVRIGI
FT                   KPPKGVLLYGSPGTGKTMLARACAAATDACFLRLAGPQLVQMYIGEGARILRDAFALAK
FT                   KRAPTIIFIDELDAIGSRRSDEGSKHGSREVQRTMLELLSLLDGFGSTDDVKVIAATNR
FT                   IDVLDPALLRSGRIDRKVEFTLPDEEARAHILQIHSRRMALHGDVNFEEISRMTEDMNG
FT                   AQLKAVCVEAGMLALRNERVYVAHEDFAEGVTAVQARKKSSLNYYA"
FT                   /protein_id="XP_845878.1"
FT   gene            complement(<655397..>659014)
FT                   /note="synonym: Tb07.22O10.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658468"
FT                   /locus_tag="Tb927.7.2560"
FT   mRNA            complement(<655397..>659014)
FT                   /db_xref="GI:72391169"
FT                   /db_xref="GeneID:3658468"
FT                   /locus_tag="Tb927.7.2560"
FT                   /transcript_id="XM_840786.1"
FT   CDS_pept        complement(655397..659014)
FT                   /locus_tag="Tb927.7.2560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391170"
FT                   /db_xref="GeneID:3658468"
FT                   /translation="MQRLLHAKPPLLSSSSQLSQRFQQTSNSVVDVFVFGDSEILFLVS
FT                   SDKSGTGSRDQVFFPDKVSRGHDGGSAAHKDRGGTLLCELQRVAAVEVKKEQRAAKKCL
FT                   ICSLCGGYCGIAAASTVRVEGLHVVVFFVLECDCLVFASFTLNTATPGPGLEVRSLGKA
FT                   SLLAARWFRNGAGGLACSADAFRQNYVPISSVIDCCDDAAVTGAAATAASVPTFPPPSS
FT                   SSTLQRQNRPLSMGPHSNSYRGHLAVLRIAFVRVVGWVEYVELVWWEKGTADDRDGSSQ
FT                   QWRELRGFSQVAAGALFMQVAGWTNDSFAAVREARAVHWLPCSYDYEQQYPLLAVLHQH
FT                   MHVKGDALVDRLSIFALSMRRQSVDQSESDLRGQCSWNGWREKVSGFCMNGPWRLEALT
FT                   LAHPCFLLHVSDAATSHAPPTRFLSYSKACAGDVLGVFLRPAHVMYPRSSFLREDSAYA
FT                   TWEPVAVRAMEVCEKGGGFDFVLYGECGEVARCPVGGFIESAVSCAVEPFEERRVSGAA
FT                   SGVQRIVAAVAAIRSGGALLFLEVISNASPLGNKGKRPSGDVPVVFSILARVVTLCEPR
FT                   GCNPFQHLSQLVAVRWDGGKGSVVTSVVCDEPDDKTVEGTYSRDVRHMYCSLTHGELLA
FT                   KDKGALQLKYGETGQRVSGKQQCNSGCLWPRVGIRPTLQFSSDTDIYYSVGAQRSVDFD
FT                   VLSHCILPPAKAATCGYVLDDGEEHVGGEEIAVFRSGDIYLCRHFSSEPASELFPAVSR
FT                   SEKNYKWLSKVHWPSADELDMSAALTLLFSSATVDVCMAAMRNRKRVGGGGVDVKAGGN
FT                   TFDSLDEINLLFVCWSTAIIVTAGGKVLWVGDLRASPSETIGAFPSLFACMLRPFAMYD
FT                   SSFFFLLSASTTPYVHGDVGSAGVNSVFLLLQVPWLLSESSEGTEHVIAVCVTDVCFLT
FT                   TDGHPLFAFMPSVCPQQHVTLNHLEKQVAGHTLCRGEMMYCSSGVLRAVTSALLFVTSA
FT                   TGLDLVARFLPSCEDRVDHASRDNTKVVLDLRNVIADECHVDVTPFFTETTLIQCVRLP
FT                   AGDCQLYAIVISFLSGLTLVAVSHSFHCGWWDLQLVAIPPVASTGVSEVGNKNVPIVAP
FT                   FVRLQRAPATVVADRGILFCAQDACGGKWAFCFRLTDGASQECGKQREVGGESLFARLN
FT                   FLHNQTQRSLGESHTSGETGERVVVTRSAGGPFTFFLIE"
FT                   /protein_id="XP_845879.1"
FT   gene            complement(<659885..>661306)
FT                   /note="synonym: Tb07.22O10.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658469"
FT                   /locus_tag="Tb927.7.2570"
FT   mRNA            complement(<659885..>661306)
FT                   /db_xref="GI:72391171"
FT                   /db_xref="GeneID:3658469"
FT                   /locus_tag="Tb927.7.2570"
FT                   /transcript_id="XM_840787.1"
FT   CDS_pept        complement(659885..661306)
FT                   /locus_tag="Tb927.7.2570"
FT                   /gene_family="HOG000257317" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391172"
FT                   /db_xref="GeneID:3658469"
FT                   /translation="MLRLLRRSIVGSTFNIMVRRQNQGSVSQGALNMRDQQAAAAENVT
FT                   PERVWALWNEGNLFSLSLAQLQGFLSRCGVRTDPAAKKAAVVRQVEEYLHSKDTTVKGG
FT                   GQGAASPQQHQQHGQQGGYGRWNQASVMQPETLLDLSQAGFYEGAANMVPKAFQLLVSD
FT                   TAPDVVVSRVNTTAFPGFPSNTECYTLGASEKDVAIRSRYSKVLQWCCLNMSNLQMDGE
FT                   LYVDFGKLLLKPSVMRKNRRIVSSYTLQQRLQVNHPYTWVPTLPESCLSKIQEQFLQPE
FT                   GFAPIGKGVQLTYSGTIKRSKDQLHVDLDNKGKVLAVNSAWVNLQTAWCTHAKGPDVRL
FT                   LLRSRPPIRRQDVELFASTPIIKLADDDVADVLPPEHGQLVYLSEDETRLFERVSDRGV
FT                   TITVREVKRQPLIILRDEEEDPRVEYSLSAHIPANAAKATDVRAVGLTAFELAGRLAGL
FT                   VAEDFVREYGCEAKL"
FT                   /protein_id="XP_845880.1"
FT   misc_feature    661730..661773
FT                   /note="CT-rich"
FT   misc_feature    661870..661913
FT                   /note="CT-rich"
FT   misc_feature    661892..661927
FT                   /note="AT_rich"
FT   misc_feature    662032..662067
FT                   /note="AT_rich"
FT   repeat_region   662151..662180
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   662291..662320
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   662635..662682
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   662683..662725
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   662775..662822
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   662823..662865
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   misc_feature    663060..663085
FT                   /note="AT_rich"
FT   misc_feature    663200..663225
FT                   /note="AT_rich"
FT   repeat_region   663420..663446
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   663560..663586
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<663662..>665578)
FT                   /note="synonym: Tb07.22O10.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658472"
FT                   /locus_tag="Tb927.7.2580"
FT   mRNA            complement(<663662..>665578)
FT                   /db_xref="GI:72391173"
FT                   /db_xref="GeneID:3658472"
FT                   /locus_tag="Tb927.7.2580"
FT                   /transcript_id="XM_840788.1"
FT   CDS_pept        complement(663662..665578)
FT                   /locus_tag="Tb927.7.2580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391174"
FT                   /db_xref="GeneID:3658472"
FT                   /translation="MRHGASPVASANSWRGREECQKCGKFGHHGGQCLQCHTTPSTRRV
FT                   SNAVVTHYRRHYATPVMAERAMNAEKTYTSSGAIAAGNVYTSALTPPRYGHLIAAATVS
FT                   RRGSEEAAANGAGVELSPCGPLLQCRKSQQSYDSPSGIPYTLSYGCRPHHPISGDFPPS
FT                   GNAVASPSYMFTSDPSVCSEDVSLGDPSSSFATTTRGRRGTGGAKQHVECSLLSHFPGS
FT                   IPPQQSLKTDPTARLSVGAVEKELLEAGVEELVGILLELGSRHAEAAQFIEDKARLMAI
FT                   RRSHYANTSIATRSRSSSVPVADTSHDSSWAHRREGRPVAGRLPASIHAADSSAVSSEN
FT                   VSHDQRIGSISATPEDQRGKRRVLHEELVEVPSESPLFSVELHPCLRWYGGCRYPTECA
FT                   FAACPRNLCLSWVRGCCDSESQCGGVHQLPGNCSPEVRAIFDLNHGADRGKLGQQKLEG
FT                   AGHQQWGHNHRHHQKPYGQSTVCVGEGKRSDTLDSVHEGNGAAVTFTPRGQIISDPTGV
FT                   PGSFERFVREIPGGEGECNEGKEISSLRGCRGYQSWFCDCDEGVEVRLTPQGALSTVRS
FT                   LNDDFGEAADPSFESFTADVGLVWSSPLKRSGSCSIMACSADCEPEIPSFNSRTRSASP
FT                   IDA"
FT                   /protein_id="XP_845881.1"
FT   misc_feature    665679..665705
FT                   /note="AT_rich"
FT   misc_feature    665819..665845
FT                   /note="AT_rich"
FT   gene            complement(<666864..>667376)
FT                   /note="synonym: Tb07.22O10.720; prefoldin, putative"
FT                   /db_xref="GeneID:3658467"
FT                   /locus_tag="Tb927.7.2590"
FT   mRNA            complement(<666864..>667376)
FT                   /db_xref="GI:72391175"
FT                   /db_xref="GeneID:3658467"
FT                   /locus_tag="Tb927.7.2590"
FT                   /transcript_id="XM_840789.1"
FT   CDS_pept        complement(666864..667376)
FT                   /locus_tag="Tb927.7.2590"
FT                   /gene_family="HOG000257319" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prefoldin, putative"
FT                   /note="go_component: prefoldin complex [goid 0016272];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72391176"
FT                   /db_xref="GeneID:3658467"
FT                   /translation="MSGQQGEGSGGAINIAQLPLEQLEELRKQLQFEVQNLSAAYESLR
FT                   GVHSRFVSNREVLGEYKKVCEAAASNEQKPQEALVCISSALYVMGEIVPSDRVLVDVGT
FT                   DYFVEKPMDAAATYFTGRAEAVQENMNSIEQKLRVKQGQLGKVVDTMRARQAQLQQQQQ
FT                   QQAQTVA"
FT                   /protein_id="XP_845882.1"
FT   gene            complement(<668373..>668783)
FT                   /note="synonym: Tb07.22O10.740; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658470"
FT                   /locus_tag="Tb927.7.2600"
FT   mRNA            complement(<668373..>668783)
FT                   /db_xref="GI:72391177"
FT                   /db_xref="GeneID:3658470"
FT                   /locus_tag="Tb927.7.2600"
FT                   /transcript_id="XM_840790.1"
FT   CDS_pept        complement(668373..668783)
FT                   /locus_tag="Tb927.7.2600"
FT                   /gene_family="HOG000257320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391178"
FT                   /db_xref="GeneID:3658470"
FT                   /translation="MPTVQPCRWDNKTLPYVPEQPCLLYYLIPGDDVSHMAVPNARGEY
FT                   PNLIPGMPYLEELLLELDNEEEIEDNAVLPLVEYAPPPLTADAGVQVEWTDVPIPPPPH
FT                   MMRYVKPLTETTQSVTGSDCSPSTTQEFGGED"
FT                   /protein_id="XP_845883.1"
FT   gene            complement(<669788..>670675)
FT                   /note="synonym: Tb07.22O10.770; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658476"
FT                   /locus_tag="Tb927.7.2610"
FT   mRNA            complement(<669788..>670675)
FT                   /db_xref="GI:72391179"
FT                   /db_xref="GeneID:3658476"
FT                   /locus_tag="Tb927.7.2610"
FT                   /transcript_id="XM_840791.1"
FT   CDS_pept        complement(669788..670675)
FT                   /locus_tag="Tb927.7.2610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391180"
FT                   /db_xref="GeneID:3658476"
FT                   /translation="MDGEGCTAERGEKEFDPIFDEAEKHHRRWLQRRTVGDDGNSDVVE
FT                   EDRGVTTEFEELDESDVEMAVRREAENNKDGDIEVVNEEASPEPEAVEDDVKDDVSGKR
FT                   FRKCDAVAARAWLKTLGTEDLAHDDNGAPQSIDAADEGEGEKSPSSVRSPVARGDVVGK
FT                   FHARSLSREGRGTSSVIVDSAVEKENFREIISTLAPLKPLPTGIRPKTTQSSGMGDSGL
FT                   GSDSGKVEANSSNQTNCMKEAEEEVGDHVEAIREGRGEQSDVGTEGSKTEESIGVEVEG
FT                   DGGNETTGEEMDLR"
FT                   /protein_id="XP_845884.1"
FT   misc_feature    670836..670862
FT                   /note="AT_rich"
FT   misc_feature    670976..671002
FT                   /note="AT_rich"
FT   gene            complement(<671427..>672311)
FT                   /note="synonym: Tb07.22O10.790; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658473"
FT                   /locus_tag="Tb927.7.2620"
FT   mRNA            complement(<671427..>672311)
FT                   /db_xref="GI:72391181"
FT                   /db_xref="GeneID:3658473"
FT                   /locus_tag="Tb927.7.2620"
FT                   /transcript_id="XM_840792.1"
FT   CDS_pept        complement(671427..672311)
FT                   /locus_tag="Tb927.7.2620"
FT                   /gene_family="HOG000257323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391182"
FT                   /db_xref="GeneID:3658473"
FT                   /translation="MEVYRRITERVRGALWAHHGRLMSERQFHRILAFVYNNKYEYQIR
FT                   FDRMEVVGREWGGRVEVVTTPAGYLKRVRVNPCVEDLTLYQQQQLILSAYASACADGRK
FT                   LMEQAEMNIYKQFLKDLKPIVMGIRDNPEFYTVPENSIETIGGVLQTGDSNNLCHTHRT
FT                   IPAAKARQPTDEVRARQEWEQKWINSPRGQSWALTLRGKTYFTLHGPQYRPRGAPGAKK
FT                   ETLPLDIPAPYTAMDEKRLLKKNWMAYLDNKHVAEVMWTRVKIADREKRQRLLQETGRA
FT                   WHRPINEEAINRW"
FT                   /protein_id="XP_845885.1"
FT   gene            complement(<672683..>675385)
FT                   /note="synonym: Tb07.22O10.800; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658477"
FT                   /locus_tag="Tb927.7.2630"
FT   mRNA            complement(<672683..>675385)
FT                   /db_xref="GI:72391183"
FT                   /db_xref="GeneID:3658477"
FT                   /locus_tag="Tb927.7.2630"
FT                   /transcript_id="XM_840793.1"
FT   CDS_pept        complement(672683..675385)
FT                   /locus_tag="Tb927.7.2630"
FT                   /gene_family="HOG000257324" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391184"
FT                   /db_xref="GeneID:3658477"
FT                   /translation="MPLRSRPRYTQQQSDTRKVMDGDALLASSKRRDPNGARLALMDAD
FT                   SGCASDVLCTVPDTTDDDIVLDPSHGRQLQEVSAAGKRMKFGEHHPATRGIGTDVIDLV
FT                   TDAFKEARERLVEKRRRVLYQVTHPDPSDYTYNGKLVPAPPLSFGRITEEAISLGNKVM
FT                   LGQHYSLVKQAGMYRDDEEGGSAGHSTATSVEQRRCGRRRTTLYDQHTFFFEINDLYQE
FT                   IVLVGKACAGKSSLLNALLGQQVAKTSSTPNTTRKLSFYQSVSPEQMQRYLNVKGNGLV
FT                   KLPGGGLQLTFVDVPGFGLEGMSEQWRDKAIELTDAYLGVRRSVNTLLLCIDCERGLTK
FT                   VDLRYFTWLENLHGVFFVVLTKCDSVPHSRVCSVMRQIYSVITKNRRKYRKVFPFIIPT
FT                   SANDGTNIEMLRGLIAETSGLIPGDRLRKILKAKADAEMRLGLEKEEERIREARCLEAR
FT                   MAKAYFESTRSAREVAGKDAKAPGLSLVPSTASPHPPPQPPLHTKPSAKERKFVLSLDC
FT                   DEEGTVEAVPTPVSDSMADEPLLTFQNDDDAPHIGKSRGDSKLKRRERFLAWRRAHPLQ
FT                   RHASAYGVFRLNTGLERPDTSTLELTYVDGTPDQTDAQLREFDRDSALKGKVIDLEVGG
FT                   TSYVGGPVDVANHGAQLGVGHGPGNGDGGAAPGRTTELSAVIGAGNTNGGGNRTLPASS
FT                   KGGVSRFLNLIDQYAQRETQKPRSKREQAKEARWRARLQKGSGTKFFAEESDGRVAEYK
FT                   AGKKFGPSLISAACDDVAGRRAQWEAHTYMRQAVAARPTAPWAALEVLKRRTERVKQDA
FT                   AMRGMTKKECEAYLRNCGRVTEKFEEFEGEVTAAKYMNETRHTKTLRSQQQMHLNSTSK
FT                   ISYRSMPVGLWKHYGERETYWPTPRVKGR"
FT                   /protein_id="XP_845886.1"
FT   repeat_region   676036..676056
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   676176..676196
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<676956..>678317)
FT                   /note="synonym: Tb07.22O10.840; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658478"
FT                   /locus_tag="Tb927.7.2640"
FT   mRNA            complement(<676956..>678317)
FT                   /db_xref="GI:72391185"
FT                   /db_xref="GeneID:3658478"
FT                   /locus_tag="Tb927.7.2640"
FT                   /transcript_id="XM_840794.1"
FT   CDS_pept        complement(676956..678317)
FT                   /locus_tag="Tb927.7.2640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391186"
FT                   /db_xref="GeneID:3658478"
FT                   /translation="MSTTALSSAKNARSPGSNAAVSPGSKLASLREGASTGVAKDEAES
FT                   AALGGLAGGDAEGLAAGAMSGLAETATEAAADELGDAASEDQANFFSEKLVEVIPQCNE
FT                   IEGERDLNGELLGEEAPRTDEGDVNNVGCSSAAESLPQEEVEETEEQIIIRLQKELREF
FT                   EAYEKEMQPNLNIYEDIIELRREAEQLEDDRKRALLQIDLGDISSYYDGDVEREVEELE
FT                   AAVENSYLQACWTKERQRYIARNETDLPEWWRVNVKDLPSRLKDARASFDSSNRVAQDL
FT                   YRAHEVKVNATTDSRDKAKAEIFNGMKAEIEATKGERERLRQLQKDQLFHLRRGTHVKD
FT                   QLLTTTKERDIREARVADMESKLVQQRYALNNEMKELNGDIEGLKRLLTDQKHASRETL
FT                   ETLKKQHVAVDSSRGELSEAREKYERENSELMLLKHDLQTVLHYIRVRAREADK"
FT                   /protein_id="XP_845887.1"
FT   misc_feature    678695..678793
FT                   /note="A-rich"
FT   misc_feature    678835..678933
FT                   /note="A-rich"
FT   gene            complement(<680735..>682348)
FT                   /note="synonym: Tb07.22O10.860; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658474"
FT                   /locus_tag="Tb927.7.2650"
FT   mRNA            complement(<680735..>682348)
FT                   /db_xref="GI:72391187"
FT                   /db_xref="GeneID:3658474"
FT                   /locus_tag="Tb927.7.2650"
FT                   /transcript_id="XM_840795.1"
FT   CDS_pept        complement(680735..682348)
FT                   /locus_tag="Tb927.7.2650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391188"
FT                   /db_xref="GeneID:3658474"
FT                   /translation="MSTTALSSAKNARSPGSNAAVSPGSKSVSLREGALRSDRKSTREL
FT                   SPQSELKSDRKSMREISHSELKSDRKSTRELSPQSELKSDRKSMSGVSPQSELKSDRKS
FT                   MREISHSELKSDRKSTRELSPQSELKSDRKSVRDSEMRSAGKSGRSVEARYGVRDDGDG
FT                   EWSELGSEVTSELRSKAKSGRRSERRQGGADEFELSESDVDAHGENFFDSSRRSDRQPS
FT                   SGAPEEEEETEEQIIIRLREELREFEAYEEEMQPNLNMYEEVIELRREAEQLEDDRKRA
FT                   LLQIDLGDISSYYDGDVEREVEELEAAVENSYLQACWTKERQRYIARNETDLPEWWRVD
FT                   IMKLGFRLREAKRSFDSSNRVAQDLYRAHEVKVNATTDSRDKAKAELRQEIAAELNELR
FT                   QRRERLLVIDKEQRFHLRRGTHVKELQVTSKRRQDALEARVVGEENRHFGASVELKRTV
FT                   KDLEMELIQLRRELKDAKVSGESIVQELRKHLLDVTRSGEEVRKARQDYEEENSDLMSL
FT                   KHELQCVLHYIRVRAREANY"
FT                   /protein_id="XP_845888.1"
FT   misc_feature    682726..682824
FT                   /note="A-rich"
FT   misc_feature    682866..682964
FT                   /note="A-rich"
FT   misc_feature    683238..683285
FT                   /note="T-rich"
FT   misc_feature    683378..683425
FT                   /note="T-rich"
FT   repeat_region   683622..683674
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   683675..683728
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   683762..683814
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   683815..683868
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   683923..683947
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   684063..684087
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   684530..684555
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   misc_feature    684589..684618
FT                   /note="AT_rich"
FT   repeat_region   684670..684695
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   misc_feature    684729..684758
FT                   /note="AT_rich"
FT   repeat_region   684748..684790
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   684888..684930
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   684954..684980
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tataa"
FT                   /rpt_type="tandem"
FT   repeat_region   685094..685120
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tataa"
FT                   /rpt_type="tandem"
FT   misc_feature    685103..685178
FT                   /note="GA-rich"
FT   misc_feature    685243..685318
FT                   /note="GA-rich"
FT   repeat_region   685351..685467
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   685491..685607
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   685615..685643
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   685755..685783
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   685816..685893
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   685956..686033
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    686126..686352
FT                   /note="A-rich"
FT   misc_feature    686266..686492
FT                   /note="A-rich"
FT   misc_feature    686461..686533
FT                   /note="T-rich"
FT   misc_feature    686601..686673
FT                   /note="T-rich"
FT   misc_feature    686703..686786
FT                   /note="A-rich"
FT   misc_feature    686818..686873
FT                   /note="AT_rich"
FT   misc_feature    686843..686926
FT                   /note="A-rich"
FT   repeat_region   686879..686932
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    686958..687013
FT                   /note="AT_rich"
FT   repeat_region   687019..687072
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   687082..687113
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   687222..687253
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    687492..687557
FT                   /note="CT-rich"
FT   misc_feature    687632..687697
FT                   /note="CT-rich"
FT   gene            complement(<687888..>689105)
FT                   /note="synonym: Tb07.22O10.880; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658475"
FT                   /locus_tag="Tb927.7.2660"
FT   mRNA            complement(<687888..>689105)
FT                   /db_xref="GI:72391189"
FT                   /db_xref="GeneID:3658475"
FT                   /locus_tag="Tb927.7.2660"
FT                   /transcript_id="XM_840796.1"
FT   CDS_pept        complement(687888..689105)
FT                   /locus_tag="Tb927.7.2660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391190"
FT                   /db_xref="GeneID:3658475"
FT                   /translation="MQLVASPLETRRDIMCFEKGVECMVVVDPATRKLRIPLSCVYPTR
FT                   AHQRTTIPSLCLLFLDGRCRQGTQCHQVHAALNVVAALRSQVDYLPICCALHGDRDYVN
FT                   ALDNRSWMSRVVVHVPDATYGGGYIPLARFSYTTPISRLLDALFHSTPQAEGQDGAQWE
FT                   SRAFGTPPSCLVLEAGDITLCRLHVQDRCRYAEECNYLHICKEVARCDRGLTLGQRPRS
FT                   WKKPPSSSPSGGCFVVTASGTSMPPPPAAAAACDAPTPVSGGWTCPGSPTGSLFGANRS
FT                   VTLGDASVTTQPAVVRCCDPSSCTEAHSVVDCGQAHIPFSLSRQVSDIHMRQVSSTFFP
FT                   SDNLSLDVDPSTSGDCLAEQGCGMTPNIVVVTRNGKGGRERWHYNPYGTNGTDRGIEKG
FT                   EGRGRN"
FT                   /protein_id="XP_845889.1"
FT   misc_feature    689682..840836
FT                   /note="sequence corresponds to BAC RPCI93-13M20"
FT   misc_feature    690077..690138
FT                   /note="CT-rich"
FT   misc_feature    complement(690077..690138)
FT                   /note="GA-rich"
FT   misc_feature    690276..690375
FT                   /note="A-rich"
FT   misc_feature    complement(690276..690375)
FT                   /note="T-rich"
FT   repeat_region   690654..690676
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(690654..690676)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    690734..690761
FT                   /note="AT_rich"
FT   misc_feature    complement(690734..690761)
FT                   /note="AT_rich"
FT   repeat_region   690872..690903
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(690872..690903)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   691435..691477
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cagt"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(691435..691477)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="actg"
FT                   /rpt_type="tandem"
FT   STS             691446..691467
FT                   /db_xref="UniSTS:98955"
FT   misc_feature    691671..691693
FT                   /note="AT_rich"
FT   misc_feature    complement(691671..691693)
FT                   /note="AT_rich"
FT   repeat_region   692155..692175
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(692155..692175)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    692364..692435
FT                   /note="CT-rich"
FT   misc_feature    complement(692364..692435)
FT                   /note="GA-rich"
FT   misc_feature    692631..692665
FT                   /note="AT_rich"
FT   misc_feature    complement(692631..692665)
FT                   /note="AT_rich"
FT   misc_feature    692967..692995
FT                   /note="AT_rich"
FT   misc_feature    complement(692967..692995)
FT                   /note="AT_rich"
FT   gene            complement(<693074..>694459)
FT                   /note="synonym: Tb07.13M20.860; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658479"
FT                   /locus_tag="Tb927.7.2670"
FT   mRNA            complement(<693074..>694459)
FT                   /db_xref="GI:72391191"
FT                   /db_xref="GeneID:3658479"
FT                   /locus_tag="Tb927.7.2670"
FT                   /transcript_id="XM_840797.1"
FT   CDS_pept        complement(693074..694459)
FT                   /locus_tag="Tb927.7.2670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391192"
FT                   /db_xref="GeneID:3658479"
FT                   /translation="MSHPQSHRYFSVNAPAGGERHLALDEKGVLCLTVVDPATRKLLIP
FT                   LSCVYPTQAQQRTTIPSLCQLFLNGRCRQGTQCHQVHAALDVVAALRSQVDYLPICCAL
FT                   HGDRDYVNALDNRSWMSRVVVHVPDATYGGGYIPLARFSYTTPISRILREVNARLESGV
FT                   SVAAVDGGGHPKRMVLNACDFKICGLHTLDRCRYAEECIFLHICKEIVVDVNNGSGDYS
FT                   LTSQARDGGEPGPRGAKKGSVFVSVSRQQRVRGRPLSYPTVEYQTPFPLRSYEGSMSYN
FT                   AVSDINSDCSWVSGRYPTGAYMESRMDAAPLPSLAPRFVQGHPGVPRCYSSTTTSTTTT
FT                   AAAREDAAMYGAGGCWDRWSSPESGCAPCAFVGSCSDCHYADNNNYSGCNGYAYGSRNG
FT                   YGSDGPNCYFCPGDECSSTHLCPNGTSSSVPQPVESVSSASVSARAWQHNPYGVTPTGG
FT                   ISD"
FT                   /protein_id="XP_845890.1"
FT   repeat_region   693430..693463
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(693430..693463)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   694939..694979
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(694939..694979)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    695820..695858
FT                   /note="AT_rich"
FT   misc_feature    complement(695820..695858)
FT                   /note="AT_rich"
FT   misc_feature    696391..696412
FT                   /note="AT_rich"
FT   misc_feature    complement(696391..696412)
FT                   /note="AT_rich"
FT   misc_feature    696883..696919
FT                   /note="AT_rich"
FT   misc_feature    complement(696883..696919)
FT                   /note="AT_rich"
FT   misc_feature    697006..697059
FT                   /note="CT-rich"
FT   misc_feature    complement(697006..697059)
FT                   /note="GA-rich"
FT   repeat_region   697042..697103
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttctg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(697042..697103)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cagaa"
FT                   /rpt_type="tandem"
FT   misc_feature    697320..697377
FT                   /note="T-rich"
FT   misc_feature    complement(697320..697377)
FT                   /note="A-rich"
FT   repeat_region   697609..697633
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(697609..697633)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   697663..697705
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(697663..697705)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    697934..698008
FT                   /note="A-rich"
FT   misc_feature    complement(697934..698008)
FT                   /note="T-rich"
FT   misc_feature    698081..698160
FT                   /note="A-rich"
FT   misc_feature    complement(698081..698160)
FT                   /note="T-rich"
FT   misc_feature    698554..698574
FT                   /note="AT_rich"
FT   misc_feature    complement(698554..698574)
FT                   /note="AT_rich"
FT   misc_feature    699320..699354
FT                   /note="AT_rich"
FT   misc_feature    complement(699320..699354)
FT                   /note="AT_rich"
FT   repeat_region   699717..699741
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(699717..699741)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    700190..700259
FT                   /note="CT-rich"
FT   misc_feature    complement(700190..700259)
FT                   /note="GA-rich"
FT   gene            complement(<700738..>702864)
FT                   /note="synonym: Tb07.13M20.790; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658480"
FT                   /locus_tag="Tb927.7.2680"
FT   mRNA            complement(<700738..>702864)
FT                   /db_xref="GI:72391193"
FT                   /db_xref="GeneID:3658480"
FT                   /locus_tag="Tb927.7.2680"
FT                   /transcript_id="XM_840798.1"
FT   CDS_pept        complement(700738..702864)
FT                   /locus_tag="Tb927.7.2680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391194"
FT                   /db_xref="GeneID:3658480"
FT                   /translation="MFLPEQSNIPGSVTYVSRAAGIPSSSTTQQYQGGECMGVPSELDA
FT                   IDGGCAWRTASKGVCASQLPRGGSVAVSVSAPFIHLTDWGDATVSTREISDNAAEVPAA
FT                   RSIGNREGVDGSLTSSVFPSGDVNSTIDLPISLVNSALPNQEKNNMEFQDDCLAHVFSR
FT                   PESPFKDFSAESEDPFTIMQTRSVTCNPNIWEVEGKDVQSSLIHDAVKVGMSQITPSLF
FT                   SPITEAMESAIDKVKVAPDGLNDCRTVGPQQPTEEQRIPVVDPQRSKLHVPLSSIIPTK
FT                   ALGGRVSFPSLCLLFQSGRCLRGASCYQMHIDPQVVQRLRQINESLPYCCAFHGECNAN
FT                   KWDAEANAHRTILIKGAAVPLSRVAYTNGLERFVLKNNASRSLNTCAVCRLHGKPGGCR
FT                   YGADCWYVHICRDVLKELVATIKLDLEDPGSEDQCKVPTKTESTGNRVVSGDLLGALSQ
FT                   QQNRRKQQNYPTVAFHPSKSPTMSHLHKGRSIVSSERDGTHSGKLSSHGSASTNTFSAR
FT                   ASPTVGQITSDGTTCRNVLVQQRPPVYEDGPLGETRHGLATTMRLHGVAFPVTDPSEEK
FT                   SVPSPSQFSLNDRQSVTPISGREVSTPSVPCCAMYFPQKQSSVAPCPQPMQNGHTVWPS
FT                   TVLVPSTTVMYPMISATGLPVASAQQQMGTDGQTYGPFCFVSGREDGFRNLCLPMYGSG
FT                   KGNMPSQVPLHVPF"
FT                   /protein_id="XP_845891.1"
FT   gene            complement(<703788..>704150)
FT                   /note="synonym: Tb07.13M20.770; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658481"
FT                   /locus_tag="Tb927.7.2690"
FT   mRNA            complement(<703788..>704150)
FT                   /db_xref="GI:72391195"
FT                   /db_xref="GeneID:3658481"
FT                   /locus_tag="Tb927.7.2690"
FT                   /transcript_id="XM_840799.1"
FT   CDS_pept        complement(703788..704150)
FT                   /locus_tag="Tb927.7.2690"
FT                   /gene_family="HOG000257328" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391196"
FT                   /db_xref="GeneID:3658481"
FT                   /translation="MHRRTFFLFLFSKPLTQGYVAQLPQPAPTAQRTAWRRCFETNKEV
FT                   QDMYTPNAERYDEWYRETYGLEDISDGCAASGASSNRLLNDDKNLSETADVEDLRAAEE
FT                   EVEWCSRQFNHNTLVR"
FT                   /protein_id="XP_845892.1"
FT   gene            complement(<705594..>706457)
FT                   /note="synonym: Tb07.13M20.760; NADH-cytochrome b5
FT                   reductase, putative"
FT                   /db_xref="GeneID:3658486"
FT                   /locus_tag="Tb927.7.2700"
FT   mRNA            complement(<705594..>706457)
FT                   /db_xref="GI:72391197"
FT                   /db_xref="GeneID:3658486"
FT                   /locus_tag="Tb927.7.2700"
FT                   /transcript_id="XM_840800.1"
FT   CDS_pept        complement(705594..706457)
FT                   /locus_tag="Tb927.7.2700"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH-cytochrome b5 reductase, putative"
FT                   /EC_number="1.6.2.2"
FT                   /note="similar to NADH-cytochrome b5 reductase precursor
FT                   (EC 1.6.2.2) (P34/P32). (Swiss-Prot:P36060) [Saccharomyces
FT                   cerevisiae]; go_function: cytochrome-b5 reductase activity
FT                   [goid 0004128]; go_process: electron transport [goid
FT                   0006118]"
FT                   /db_xref="GI:72391198"
FT                   /db_xref="GeneID:3658486"
FT                   /translation="MKVFAAAAVTGMVASGYFKVDRAVEAKAAAKSPFSQSVYHSYKLV
FT                   CVQDESHDTKIFTFALPEKDMELNFEAPSCITLRYVDDKGKEVVRPYTPLNLESDKGSF
FT                   ELLVKSYPNSRMGSHLHNMKVGDSIEVQGPWKTMDIKSGQYEHIGMLAGGTGVTPMYQI
FT                   ARNFLGRPSNTTKFSLVCSNHSKAEMLLADRFGQLANDNPGKLFVFHSLTSPPWYWRGY
FT                   RGHITKKVIEETMPSPNCVDKAILLVSGPPGFMKTISGEKQGRSQGPLSGYLKELGYPE
FT                   AMVYKF"
FT                   /protein_id="XP_845893.1"
FT   gene            complement(<706914..>707777)
FT                   /note="synonym: Tb07.13M20.750; NADH-cytochrome b5
FT                   reductase, putative"
FT                   /db_xref="GeneID:3658483"
FT                   /locus_tag="Tb927.7.2710"
FT   mRNA            complement(<706914..>707777)
FT                   /db_xref="GI:72391199"
FT                   /db_xref="GeneID:3658483"
FT                   /locus_tag="Tb927.7.2710"
FT                   /transcript_id="XM_840801.1"
FT   CDS_pept        complement(706914..707777)
FT                   /locus_tag="Tb927.7.2710"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH-cytochrome b5 reductase, putative"
FT                   /EC_number="1.6.2.2"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: oxidoreductase activity [goid 0016491];
FT                   go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:72391200"
FT                   /db_xref="GeneID:3658483"
FT                   /translation="MKALFASAVGAFASSWYNFSSVNCAASKSPFSHVDFRQYTLMNFY
FT                   DESHDTRVFRFALPEADMSLNLEVLSFVELRHVGKDGSVLVRPFAPINSSNQRGYFEIL
FT                   VKNYQNSKVGNYLFSLKKGDAAEFKGPFVRVPIKSNRYKKIGILASDTGIAPVYQVARN
FT                   VLRAPNNKTEISLIYENTRKEDVLLGNELNELMQTYPLFSPYFVLSKAPSDWMGGVGHI
FT                   TKEMVKALMPAPNRVGDSIILVSGPPPFLDSISGNKENGTSPAEQGDLKGVLSELGYIQ
FT                   KMVFKI"
FT                   /protein_id="XP_845894.1"
FT   gene            complement(<707998..>709989)
FT                   /note="synonym: Tb07.13M20.740; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658482"
FT                   /locus_tag="Tb927.7.2720"
FT   mRNA            complement(<707998..>709989)
FT                   /db_xref="GI:72391201"
FT                   /db_xref="GeneID:3658482"
FT                   /locus_tag="Tb927.7.2720"
FT                   /transcript_id="XM_840802.1"
FT   CDS_pept        complement(707998..709989)
FT                   /locus_tag="Tb927.7.2720"
FT                   /gene_family="HOG000257326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Ligatin (Hepatocellular
FT                   carcinoma-associated antigen 56). (Swiss-Prot:P41214) [Homo
FT                   sapiens]; go_function: translation initiation factor
FT                   activity [goid 0003743]; go_process: translational
FT                   initiation [goid 0006413]"
FT                   /db_xref="GI:72391202"
FT                   /db_xref="GeneID:3658482"
FT                   /translation="MFHKKYVVKGQVSVSKKESKCLWDNIYGIVGEDNLSCLDSFWRRN
FT                   DSVVRTLWEFSGGGSAVLYSINKVPLVISVNRLSEDADSVCLENQFTIVPTLFMLSLMR
FT                   CYYKKEDTDFGSLFGARVFCHGPTSRFILSGAHLMLPGIIERRTQTDTPVRKGDLVFIY
FT                   SLGNLFPYAVGLATDGLAGSNQRGKGVYVIHSYKDGLWNLCFDAFHEYCSSSISVVPST
FT                   FRDSEVVEIVSSQMHPVCERTRGETSLNGEADLTDDAAGASCEDERVMKAALSLLEDED
FT                   NVLDFALCEAIRELNVSALPLPVGEFVPLLLSNYPRFPNVQMRFDFKGTKYRKALSYLT
FT                   VRDETLIISEEKKGEHFIVSVNKKSDLYRTHRRSYADFLKLFHIPLKEEERLVLEQQAL
FT                   RGGVKKGLQRRIKSVEALYSPRGRSLLNIQLFLCTGILLEQGGVVSGTVNGSSDKFDNH
FT                   KGSGDDDEYLDDLYSKKQLCDMLRSYISSKNILNISGDRSGIPCVLLDEFLGPLVRGSV
FT                   KEIPITELEELILQKLFVPVHKITLETSAVITGGSSSAPTVTQLTKRGTLPKVLIYTEK
FT                   RSGNKIVTAVKHLDDFGFDLFSLSNKWKHQFSTSCSIFDPSKGMQNLKPGTKIALEVHL
FT                   GGNWLVKLKKLLEVELGFPHHLIAERCA"
FT                   /protein_id="XP_845895.1"
FT   gene            complement(<710233..>711156)
FT                   /note="synonym: Tb07.13M20.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658485"
FT                   /locus_tag="Tb927.7.2730"
FT   mRNA            complement(<710233..>711156)
FT                   /db_xref="GI:72391203"
FT                   /db_xref="GeneID:3658485"
FT                   /locus_tag="Tb927.7.2730"
FT                   /transcript_id="XM_840803.1"
FT   CDS_pept        complement(710233..711156)
FT                   /locus_tag="Tb927.7.2730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391204"
FT                   /db_xref="GeneID:3658485"
FT                   /translation="MIEEVESVYKRAIETIEGSTAPPDPDAPNSFKWRLRPSEEAAIAC
FT                   NRYLNPPEPWGIKLCCSSTFWGPEKCVNIGRMLILNHTVTSLDLSMCDMQEEGAVRFFS
FT                   CIKRNRCLKHLNVNGNYIGDRGAVAASKCIGNLESLHASCNGIHDAGAVALASSLPSSS
FT                   KIKTLNLRGNRLTFLGAYKLVSALEHVVDLLSPELRDAVSAGTTLYTGSEKGLESSLKE
FT                   FTSAKSESSEKERQSSFGHIMEGLQESESDVKEFNTSLHTLWLRQNDDIPEELFRVLDK
FT                   ILEKRVPQPPKGVMKKGRNSRKKNAS"
FT                   /protein_id="XP_845896.1"
FT   gene            <716953..>717495
FT                   /note="synonym: Tb07.13M20.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658484"
FT                   /locus_tag="Tb927.7.2740"
FT   mRNA            <716953..>717495
FT                   /db_xref="GI:72391205"
FT                   /db_xref="GeneID:3658484"
FT                   /locus_tag="Tb927.7.2740"
FT                   /transcript_id="XM_840804.1"
FT   CDS_pept        716953..717495
FT                   /locus_tag="Tb927.7.2740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391206"
FT                   /db_xref="GeneID:3658484"
FT                   /translation="MEYQGSPQQEEGDAALAKRLHEELNRSEASGHQEPSDQTGGRRQV
FT                   ECPMCSSVSVVVGAADGVQQVCERCKATTHGGFASGEDNENYSMQKLLLCNICQSYNRV
FT                   PKGTFDAILCGACGNQLKAGGSVTENLSPEDTRVRTQEIRVRCPKCSSINTVEANTDAL
FT                   SVRFECGSCRYANEVFF"
FT                   /protein_id="XP_845897.1"
FT   gene            <717763..>718683
FT                   /note="synonym: Tb07.13M20.690; protein kinase, putative"
FT                   /db_xref="GeneID:3658487"
FT                   /locus_tag="Tb927.7.2750"
FT   mRNA            <717763..>718683
FT                   /db_xref="GI:72391207"
FT                   /db_xref="GeneID:3658487"
FT                   /locus_tag="Tb927.7.2750"
FT                   /transcript_id="XM_840805.1"
FT   CDS_pept        717763..718683
FT                   /locus_tag="Tb927.7.2750"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72391208"
FT                   /db_xref="GeneID:3658487"
FT                   /translation="MGIVGEYEILETLGTGAFSKVKLVRHLPTNVYFVAKIIQKSNQQV
FT                   ETDVRLEISILRRLRHRNIVQLIEILESSNNYYIILEPVLGGDVCSLVLSQEGGLAEDF
FT                   VANLFFQLVAGLRACHQNGVAHRDLKPENLLLTGEKVLKISDFGLSRLHKQSNFHAEAE
FT                   EYAHTLTGTLAYVAPEVLDGNYDAFKADIWSIGCILYVMLTGQFPFGPTTDACELGERI
FT                   KDGRVCEMPKSVSENARELTMWLLSRDPASRPSLDEVATHAFLRQHVPAKNIMALTRSR
FT                   QAKILAPDPSEFSSAIPEEKQVANS"
FT                   /protein_id="XP_845898.1"
FT   gene            <719444..>720280
FT                   /note="synonym: Tb07.13M20.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658488"
FT                   /locus_tag="Tb927.7.2760"
FT   mRNA            <719444..>720280
FT                   /db_xref="GI:72391209"
FT                   /db_xref="GeneID:3658488"
FT                   /locus_tag="Tb927.7.2760"
FT                   /transcript_id="XM_840806.1"
FT   CDS_pept        719444..720280
FT                   /locus_tag="Tb927.7.2760"
FT                   /gene_family="HOG000257332" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391210"
FT                   /db_xref="GeneID:3658488"
FT                   /translation="MPRPAPRFAMGHMLPHRSNVGSQFLHTQRHGSRSTWYKKHYFSLR
FT                   PFAIQRHHGTTPRILLDRSLWKSLWITKLQLPDINRWERVVNSQRVTEDRYAFVEEEGV
FT                   MHKVNWGLYCERLETELTVTQERLPQHTLLMKAAPSSWKKLDIDISVIRGLSLREAMAQ
FT                   CKLSLRKGHQIVFRALEMAQQGAEAKGLDKEHLRVAHISCYPGPTDKQIDIRSKGYYAW
FT                   KTKKSSHLVLTLAEDPEMVLPDRTCLPYSSLMSMKRAGLSAQPTVIDVPAITAEGI"
FT                   /protein_id="XP_845899.1"
FT   gene            <720553..>721779
FT                   /note="synonym: Tb07.13M20.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658489"
FT                   /locus_tag="Tb927.7.2770"
FT   mRNA            <720553..>721779
FT                   /db_xref="GI:72391211"
FT                   /db_xref="GeneID:3658489"
FT                   /locus_tag="Tb927.7.2770"
FT                   /transcript_id="XM_840807.1"
FT   CDS_pept        720553..721779
FT                   /locus_tag="Tb927.7.2770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391212"
FT                   /db_xref="GeneID:3658489"
FT                   /translation="MFRKRYRPLDPAEERSVGVEQALHVGFLRDEQSYCFRWPDAPLTA
FT                   MLRRSDDSLVLGMQSGSGSGTQNAVVLPPVPRLSAVLAEHDKAELFSSLSTNNTAISFS
FT                   ADSSSASGIVLNRGKRQFSAPASTCVDDSVFSFSSFQMKELESSGALKAFYEAHAFSTV
FT                   SATGDGCDKVLKVLARRRMEEEIVRLEWRAYYETEKVSPAIQRILLLTVAVPFLDNFES
FT                   SVLASTEGEAKWQRIIYELWVKWRIGSVKAGEVATASDGTPWGAPLLPGSFVSSLSREY
FT                   FTTVGPDRSGALRGVRANDAKGADGEGCQVLSSAAVGRRGAYGYLRWRIDLYEPRLRAV
FT                   PKEGDDEYGLSSSTKLVGAAEVNNIVEEKVPSVLCDVRLGGRVDPLDALALTDIRSDVG
FT                   TWRQWLAHV"
FT                   /protein_id="XP_845900.1"
FT   gene            <722307..>722660
FT                   /note="synonym: Tb07.13M20.666; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658491"
FT                   /locus_tag="Tb927.7.2780"
FT   mRNA            <722307..>722660
FT                   /db_xref="GI:72391213"
FT                   /db_xref="GeneID:3658491"
FT                   /locus_tag="Tb927.7.2780"
FT                   /transcript_id="XM_840808.1"
FT   CDS_pept        722307..722660
FT                   /locus_tag="Tb927.7.2780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391214"
FT                   /db_xref="GeneID:3658491"
FT                   /translation="MSKAPSQPAKKWMSARTLAKSEDATNRKSNTAAPASQPSQQPASV
FT                   MHERPTPPPPAPVQLPQSVFFERQEAVDTLSNLYRNAQSVKKIETGPAAFEARDISKVH
FT                   EELMDCLRPAAAA"
FT                   /protein_id="XP_845901.1"
FT   gene            <723558..>725663
FT                   /note="synonym: Tb07.13M20.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658490"
FT                   /locus_tag="Tb927.7.2790"
FT   mRNA            <723558..>725663
FT                   /db_xref="GI:72391215"
FT                   /db_xref="GeneID:3658490"
FT                   /locus_tag="Tb927.7.2790"
FT                   /transcript_id="XM_840809.1"
FT   CDS_pept        723558..725663
FT                   /locus_tag="Tb927.7.2790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391216"
FT                   /db_xref="GeneID:3658490"
FT                   /translation="MDGDDGMPPSEHSGTPFSQFEEDQEQEDLLREEIPEEAGESELPE
FT                   GDDQTDIALLPNDSEYAANTSELEGFGTEVRTTDMELEDSVDPELDMVGAEVAPVTKPS
FT                   ESVEELPLTAQAVDSELADVMPEREQPSYGVQTQLDVEDITEESSQQPTAESSEVEAHQ
FT                   LSPNEYIVSADIEVSVFVTVQPMGFQVTVKAPGGSRGDVYSGFLYECIASRFGVHPESL
FT                   RLRWRGERLRFGVTVPYEAGPGPREGRLWIDAFFNEGMIPEHLMSIEKDNHYVRCVTVR
FT                   ARLEQIGPSDLISARRRGLTFDEAINEVRESTKPQNYMTISIVHDPMGIRLPFLGGYRL
FT                   KKDHSRIFRHAATQLSSPGDTTLADLQYGPIVRNRVSRKTQTYGVSRSTQTLREGRTQT
FT                   ARPDYEVDEKFDEAITAKPYFSSQELLALQSTMIVVIQKMYRKWKARRVFREVAALRQD
FT                   FLNKAAQQAAEEEAEKRRREEFELRRRAVPRTADDFKTLRKELEAWRAAEAERILADTS
FT                   LSEAQKRTALTHLTNKEVKLLRELETLRGTVLNNRRMHRFETILQAMTCAKDCGPVSVT
FT                   TQAAERACELRQLYASFTEPPKTVEGRLDILLHVKWTVKEFDVPLTRQIVELIDREADL
FT                   LQRGRTMCSLKGLHTRLENLLKRFIATPEYNPAVEEVVRGPKFGVADGLDAPKISSSRR
FT                   LKPSNVL"
FT                   /protein_id="XP_845902.1"
FT   gene            <726181..>727473
FT                   /note="synonym: Tb07.13M20.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658497"
FT                   /locus_tag="Tb927.7.2800"
FT   mRNA            <726181..>727473
FT                   /db_xref="GI:72391217"
FT                   /db_xref="GeneID:3658497"
FT                   /locus_tag="Tb927.7.2800"
FT                   /transcript_id="XM_840810.1"
FT   CDS_pept        726181..727473
FT                   /locus_tag="Tb927.7.2800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391218"
FT                   /db_xref="GeneID:3658497"
FT                   /translation="MSFDGLRGRLKKKTSAPTTDGLGVSGNSIDLSDSVYAAAVQEACT
FT                   NHRSRKRQRSPISDVLTEQLVGEGNAGGTTSTPAVAEVSITPVARPRHLTEEEFLERCV
FT                   VSEKALGRCVERMSRALVEPAVFGSLEIRDQDIAGDDVVLLGSRVSALPLPLCRFLVQR
FT                   LQCVSTSSVVSDAAYQEEEYNLLFALGEVEACQRQACVSIPEQLEGLIAVLQTYWLALC
FT                   LYWRAALCGSVSGNPSHQGGWSYDVYLLQHHALPDTVRHTHGRQVALGLEAWRKATRVR
FT                   QDAFDFLALVLHDMLVLTRRLLRGGVSGVSDEESCAIPVDMAKNLFLLQKLLRSRDFPG
FT                   CRQLYVDLTLGTANWKLGLFSGGEVHMRRSMERIERRRIAHLLHNENALRLLHAVRELM
FT                   DFVQQHEAVLQDCFFFTFNSDENGPNKETAG"
FT                   /protein_id="XP_845903.1"
FT   gene            <727684..>728724
FT                   /note="synonym: Tb07.13M20.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658498"
FT                   /locus_tag="Tb927.7.2810"
FT   mRNA            <727684..>728724
FT                   /db_xref="GI:72391219"
FT                   /db_xref="GeneID:3658498"
FT                   /locus_tag="Tb927.7.2810"
FT                   /transcript_id="XM_840811.1"
FT   CDS_pept        727684..728724
FT                   /locus_tag="Tb927.7.2810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391220"
FT                   /db_xref="GeneID:3658498"
FT                   /translation="MRDSGVATATTYVAPVGGHVHPSLQRYMPGQLPKRMKRLCTGETN
FT                   LKVHNRMHMDSIRTEIAPILPSSEHLRQTLLPSITVQRAAGRSNVTPRAGPKEKQPSGV
FT                   NESSEANNKKNEAVMGVWCRLPHEDEVVVRSLVESNNKGKHNAFSNEAFYFGSHHTGGA
FT                   GQLEYAHHNMTHNNNHSVSAWKQRQHYHPDIWHTRAQQHPPPKKEANTTEEMQKHSIHG
FT                   TQNDEIRGESTHSVHPKEKCGNVEKEMTKKAMDYNAAKNKKYENLSWIQKSTTFDTSKM
FT                   TAPKLRFELTDYHNTMPITQTAPSTSQYIEESRRFETINGKPLTTDNDKKNIKYARRRY
FT                   DTTTKH"
FT                   /protein_id="XP_845904.1"
FT   misc_feature    728982..740297
FT                   /note="Histone H2 array, number of copies uncertain."
FT   misc_feature    complement(728982..740297)
FT                   /note="Histone H2 array, number of copies uncertain."
FT   gene            <728982..>729386
FT                   /note="synonym: Tb07.13M20.630; histone H2A, putative"
FT                   /db_xref="GeneID:3658496"
FT                   /locus_tag="Tb927.7.2820"
FT   mRNA            <728982..>729386
FT                   /db_xref="GI:72391221"
FT                   /db_xref="GeneID:3658496"
FT                   /locus_tag="Tb927.7.2820"
FT                   /transcript_id="XM_840812.1"
FT   CDS_pept        728982..729386
FT                   /locus_tag="Tb927.7.2820"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391222"
FT                   /db_xref="GeneID:3658496"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845905.1"
FT   gene            <729892..>730296
FT                   /note="synonym: Tb07.13M20.620; histone H2A, putative"
FT                   /db_xref="GeneID:3658495"
FT                   /locus_tag="Tb927.7.2830"
FT   mRNA            <729892..>730296
FT                   /db_xref="GI:72391223"
FT                   /db_xref="GeneID:3658495"
FT                   /locus_tag="Tb927.7.2830"
FT                   /transcript_id="XM_840813.1"
FT   CDS_pept        729892..730296
FT                   /locus_tag="Tb927.7.2830"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391224"
FT                   /db_xref="GeneID:3658495"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845906.1"
FT   gene            <730801..>731205
FT                   /note="synonym: Tb07.13M20.610; histone H2A, putative"
FT                   /db_xref="GeneID:3658492"
FT                   /locus_tag="Tb927.7.2840"
FT   mRNA            <730801..>731205
FT                   /db_xref="GI:72391225"
FT                   /db_xref="GeneID:3658492"
FT                   /locus_tag="Tb927.7.2840"
FT                   /transcript_id="XM_840814.1"
FT   CDS_pept        730801..731205
FT                   /locus_tag="Tb927.7.2840"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391226"
FT                   /db_xref="GeneID:3658492"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845907.1"
FT   gene            <731711..>732115
FT                   /note="synonym: Tb07.13M20.600; histone H2A, putative"
FT                   /db_xref="GeneID:3658493"
FT                   /locus_tag="Tb927.7.2850"
FT   mRNA            <731711..>732115
FT                   /db_xref="GI:72391227"
FT                   /db_xref="GeneID:3658493"
FT                   /locus_tag="Tb927.7.2850"
FT                   /transcript_id="XM_840815.1"
FT   CDS_pept        731711..732115
FT                   /locus_tag="Tb927.7.2850"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391228"
FT                   /db_xref="GeneID:3658493"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845908.1"
FT   gene            <732620..>733024
FT                   /note="synonym: Tb07.13M20.590; histone H2A, putative"
FT                   /db_xref="GeneID:3658494"
FT                   /locus_tag="Tb927.7.2860"
FT   mRNA            <732620..>733024
FT                   /db_xref="GI:72391229"
FT                   /db_xref="GeneID:3658494"
FT                   /locus_tag="Tb927.7.2860"
FT                   /transcript_id="XM_840816.1"
FT   CDS_pept        732620..733024
FT                   /locus_tag="Tb927.7.2860"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391230"
FT                   /db_xref="GeneID:3658494"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845909.1"
FT   gene            <733530..>733934
FT                   /note="synonym: Tb07.13M20.580; histone H2A, putative"
FT                   /db_xref="GeneID:3658499"
FT                   /locus_tag="Tb927.7.2870"
FT   mRNA            <733530..>733934
FT                   /db_xref="GI:72391231"
FT                   /db_xref="GeneID:3658499"
FT                   /locus_tag="Tb927.7.2870"
FT                   /transcript_id="XM_840817.1"
FT   CDS_pept        733530..733934
FT                   /locus_tag="Tb927.7.2870"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391232"
FT                   /db_xref="GeneID:3658499"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845910.1"
FT   gene            <734439..>734843
FT                   /note="synonym: Tb07.13M20.570; histone H2A, putative"
FT                   /db_xref="GeneID:3658500"
FT                   /locus_tag="Tb927.7.2880"
FT   mRNA            <734439..>734843
FT                   /db_xref="GI:72391233"
FT                   /db_xref="GeneID:3658500"
FT                   /locus_tag="Tb927.7.2880"
FT                   /transcript_id="XM_840818.1"
FT   CDS_pept        734439..734843
FT                   /locus_tag="Tb927.7.2880"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391234"
FT                   /db_xref="GeneID:3658500"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845911.1"
FT   gene            <735348..>735752
FT                   /note="synonym: Tb07.13M20.560; histone H2A, putative"
FT                   /db_xref="GeneID:3658506"
FT                   /locus_tag="Tb927.7.2890"
FT   mRNA            <735348..>735752
FT                   /db_xref="GI:72391235"
FT                   /db_xref="GeneID:3658506"
FT                   /locus_tag="Tb927.7.2890"
FT                   /transcript_id="XM_840819.1"
FT   CDS_pept        735348..735752
FT                   /locus_tag="Tb927.7.2890"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391236"
FT                   /db_xref="GeneID:3658506"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845912.1"
FT   gene            <736258..>736662
FT                   /note="synonym: Tb07.13M20.550; histone H2A, putative"
FT                   /db_xref="GeneID:3658505"
FT                   /locus_tag="Tb927.7.2900"
FT   mRNA            <736258..>736662
FT                   /db_xref="GI:72391237"
FT                   /db_xref="GeneID:3658505"
FT                   /locus_tag="Tb927.7.2900"
FT                   /transcript_id="XM_840820.1"
FT   CDS_pept        736258..736662
FT                   /locus_tag="Tb927.7.2900"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391238"
FT                   /db_xref="GeneID:3658505"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845913.1"
FT   gene            <737167..>737571
FT                   /note="synonym: Tb07.13M20.540; histone H2A, putative"
FT                   /db_xref="GeneID:3658503"
FT                   /locus_tag="Tb927.7.2910"
FT   mRNA            <737167..>737571
FT                   /db_xref="GI:72391239"
FT                   /db_xref="GeneID:3658503"
FT                   /locus_tag="Tb927.7.2910"
FT                   /transcript_id="XM_840821.1"
FT   CDS_pept        737167..737571
FT                   /locus_tag="Tb927.7.2910"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391240"
FT                   /db_xref="GeneID:3658503"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845914.1"
FT   gene            <738076..>738480
FT                   /note="synonym: Tb07.13M20.530; histone H2A, putative"
FT                   /db_xref="GeneID:3658510"
FT                   /locus_tag="Tb927.7.2920"
FT   mRNA            <738076..>738480
FT                   /db_xref="GI:72391241"
FT                   /db_xref="GeneID:3658510"
FT                   /locus_tag="Tb927.7.2920"
FT                   /transcript_id="XM_840822.1"
FT   CDS_pept        738076..738480
FT                   /locus_tag="Tb927.7.2920"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391242"
FT                   /db_xref="GeneID:3658510"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845915.1"
FT   gene            <738984..>739388
FT                   /note="synonym: Tb07.13M20.520; histone H2A, putative"
FT                   /db_xref="GeneID:3658508"
FT                   /locus_tag="Tb927.7.2930"
FT   mRNA            <738984..>739388
FT                   /db_xref="GI:72391243"
FT                   /db_xref="GeneID:3658508"
FT                   /locus_tag="Tb927.7.2930"
FT                   /transcript_id="XM_840823.1"
FT   CDS_pept        738984..739388
FT                   /locus_tag="Tb927.7.2930"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391244"
FT                   /db_xref="GeneID:3658508"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845916.1"
FT   gene            <739893..>740297
FT                   /note="synonym: Tb07.13M20.510; histone H2A, putative"
FT                   /db_xref="GeneID:3658507"
FT                   /locus_tag="Tb927.7.2940"
FT   mRNA            <739893..>740297
FT                   /db_xref="GI:72391245"
FT                   /db_xref="GeneID:3658507"
FT                   /locus_tag="Tb927.7.2940"
FT                   /transcript_id="XM_840824.1"
FT   CDS_pept        739893..740297
FT                   /locus_tag="Tb927.7.2940"
FT                   /gene_family="HOG000234652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H2A, putative"
FT                   /note="Part of an H2 histone array. Number of copies in the
FT                   array is uncertain; go_component: nucleus [goid 0005634];
FT                   go_function: DNA binding [goid 0003677]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:72391246"
FT                   /db_xref="GeneID:3658507"
FT                   /translation="MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIG
FT                   ASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVT
FT                   MSRGGVMPSLNKALAKKQKSGKHAKATPSV"
FT                   /protein_id="XP_845917.1"
FT   gene            <740636..>742648
FT                   /note="synonym: Tb07.13M20.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658504"
FT                   /locus_tag="Tb927.7.2950"
FT   mRNA            <740636..>742648
FT                   /db_xref="GI:72391247"
FT                   /db_xref="GeneID:3658504"
FT                   /locus_tag="Tb927.7.2950"
FT                   /transcript_id="XM_840825.1"
FT   CDS_pept        740636..742648
FT                   /locus_tag="Tb927.7.2950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: ATP binding [goid 0005524]"
FT                   /db_xref="GI:72391248"
FT                   /db_xref="GeneID:3658504"
FT                   /translation="MFTSFLIVLNFFSNFSMLLYNAFQYFGALSFHNEILLIFVLVFFS
FT                   AAGVVLSEVCRVVNFYFSSGGSVFVERRISVYLSTHVVIAVCDRNALLQNAIFYYMYEK
FT                   FLVSPVGSSCWRNMSSVILLIDPMRSAYEESYDSPFRVDDDDSDDAGRWESVNWRCQKQ
FT                   LRRFFIIRVPTDGCWLPVGNDGVELTYERKRETVDGSEGVVRTIVLRAKGATDAATRID
FT                   KFVETALDYYIMNLPDVMNEGKVFLELQAPSSCRDEGGLLFKRYPLGCGKTFDTLFFPE
FT                   KSRVLKLLDDFMGKGGRFSTEGFPQKLGFLLYGPPGTGKTSFVGALAEYTRRHVISIHL
FT                   PFLKSNHSLYDVFLNPTFRCIGESDPTSLAVEDVIFLLDDVDASSPLVRARVRSGRTIC
FT                   RRHHATLVSDGSVADDFVGVESPVLDSEVDEEEGEHGGLAPEPENPVDLVNQLLKATFG
FT                   KRYTGKVGTTRGGAENETSLLKWLRPSDELNLSGLLNVLDGAVDTPGRIVVMITNFPER
FT                   LDPALVRPGRFGTKLRMDYLQLPALLDMLGLHFGAVLRESGESGTDESSDGNDNAGGGV
FT                   SQPLRAIRTFERGEADSVNTSAPPKLSAYDVARVRDVVAALNDSRKGREGEDVSGLMIS
FT                   PAEVESMCAVSTTLDEFLLRFSSRFGAPQASANVQ"
FT                   /protein_id="XP_845918.1"
FT   gene            <742882..>744252
FT                   /note="synonym: Tb07.13M20.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658509"
FT                   /locus_tag="Tb927.7.2960"
FT   mRNA            <742882..>744252
FT                   /db_xref="GI:72391249"
FT                   /db_xref="GeneID:3658509"
FT                   /locus_tag="Tb927.7.2960"
FT                   /transcript_id="XM_840826.1"
FT   CDS_pept        742882..744252
FT                   /locus_tag="Tb927.7.2960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72391250"
FT                   /db_xref="GeneID:3658509"
FT                   /translation="MAGIRFAATGAFFAAVGYFSVDRFINSASWWALLRSSGEASAEDG
FT                   GSGGCIRRRLGSAGSVWQRFNQYSTPGAAGVQVLRFLDFVACVCLLDEEDRQRLHSRLC
FT                   GAPTEGREDLCSLFKLVDTNASGTITYDEFCVLITLLSACQRHLKIAFGAFDVTEEDSL
FT                   SRDGFRRIINTLMVDPTVQIVERTGHESDVHSHGGGRRDGGLTSSEFLSSNLVKLFFGV
FT                   DEDARISFDDFWTVVRRIQWMVRRVEFQLYDTQNTGRIKLHQLQKILFPDRYCSTQCEE
FT                   GHSDEESRYVSSRLNCLKDKFVSWDLYMKVFDVLCETESIVRGMNLALNARDPEGRNDH
FT                   TSCLCHRDDSMTPIVSVLADTAAGLTTSHSGRDRELDYVEFHRVLQSCDHLKHLTKSDA
FT                   EEIVEIFDIDGSGKLSPDEFGKMSRMCTSFFMRSTPLFLEPRRNTIQRFVYCMQQLR"
FT                   /protein_id="XP_845919.1"
FT   gene            <744793..>747267
FT                   /note="synonym: Tb07.13M20.480; hypothetical protein"
FT                   /db_xref="GeneID:3658501"
FT                   /locus_tag="Tb927.7.2970"
FT   mRNA            <744793..>747267
FT                   /db_xref="GI:72391251"
FT                   /db_xref="GeneID:3658501"
FT                   /locus_tag="Tb927.7.2970"
FT                   /transcript_id="XM_840827.1"
FT   CDS_pept        744793..747267
FT                   /locus_tag="Tb927.7.2970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72391252"
FT                   /db_xref="GeneID:3658501"
FT                   /translation="MPVSLTSVTTDGRTNTVPKLRPYQQELFEKAIRGDSIIYLPTGGG
FT                   KTVVAAAIAHYMRRKHEKRIVFVVNRVPLVAQQAKVLESVLGKGSRVATVRGGKKSVKS
FT                   WSVLVDEGCDGVVITDSIFHEWIIGSPKAITEDTCLVVIDEVHNATGGCLKKIFEYIHR
FT                   ICPREPQRCASNDGVSEPTLPLLLGLTASPVLSFTRSDSLNKLIDVTRCRIVNVTEKMD
FT                   NLLQEVPLPLTVGVEYYLSPPEEAFLFYLQRAAVALQDNLKVKKNAHLRAGFACPVASD
FT                   GYINRCNEIKVKACSGTSGEVDRFAYSIATFLLCVSQAFVKLNEVSLGSAYKTVMDDKL
FT                   FKSLQESPESAELVVPILEGLMKLLRESRHKYPERDPGQDDSSVGFDPFEVSSRVQFLL
FT                   QLLSWIGKHVEANHVEVAGIIFCDTRASVFRITEAIEKIPTLSSLYKPRALVGKGKTLV
FT                   DGEEKGMTDAQQRDVIDEFRKGNTRLLVATSLAEEGLDIAQCNLVIRYDSCVSLRSFVQ
FT                   SRGRARRRNALFIVFEHARREIKVAAVAMKAVRLQDFLVNAVRDAIEVGTRRAPRVWEE
FT                   SPKFWLRRFERRHNAPIERKETDCRTDFGSHTHPFIVELTVTIPNNSSPEKIVIPKPYE
FT                   GKTISVKASGGRVKARQYAEYQLCEELDKRGILIGEDGERARSISTMKMLSNGILVCEE
FT                   GSLSTSELRKLFSRNPTAIETYDRKDWGPHTPSSVLRDSLRRRRLPAPEIHINRSGDET
FT                   RAEIYVYMRRDEKIEQRRFAASGVCALEEAAMKALKHMKIQLFTGTGHVETTDDIGSRD
FT                   LAWESETSESEN"
FT                   /protein_id="XP_845920.1"
FT   gene            <748550..>749122
FT                   /note="synonym: Tb07.13M20.460; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658502"
FT                   /locus_tag="Tb927.7.2980"
FT   mRNA            <748550..>749122
FT                   /db_xref="GI:72391253"
FT                   /db_xref="GeneID:3658502"
FT                   /locus_tag="Tb927.7.2980"
FT                   /transcript_id="XM_840828.1"
FT   CDS_pept        748550..749122
FT                   /locus_tag="Tb927.7.2980"
FT                   /gene_family="HOG000089187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391254"
FT                   /db_xref="GeneID:3658502"
FT                   /translation="MRRSVYQLSKELPISEDEVACLVKKVMRECPSAFNSQSSRAVILF
FT                   GEQHTKLWNLTKDKLKATVKPDSYNEAAKKIDGCFAPAAGTILFFEDKSVVEGLVKSYP
FT                   AYAEGFPVWSTESSGMAQFAVWTALAEKGIGASLQHYTSLIGEAVTAEWKLPATWEMHA
FT                   QMPFGKPLEKCGEKTYMPDEERFKVFK"
FT                   /protein_id="XP_845921.1"
FT   repeat_region   750470..750497
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(750470..750497)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            <750792..>751721
FT                   /note="synonym: Tb07.13M20.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658512"
FT                   /locus_tag="Tb927.7.2990"
FT   mRNA            <750792..>751721
FT                   /db_xref="GI:72391255"
FT                   /db_xref="GeneID:3658512"
FT                   /locus_tag="Tb927.7.2990"
FT                   /transcript_id="XM_840829.1"
FT   CDS_pept        750792..751721
FT                   /locus_tag="Tb927.7.2990"
FT                   /gene_family="HOG000137448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391256"
FT                   /db_xref="GeneID:3658512"
FT                   /translation="MSNPPKHYSVESLRTVGLLPAQLALSRKPRLRPHVGNLKGLVYPL
FT                   PYYAMWRGNHNKYTYNKSTVCLWGEGDTRSMYHQHYAHAKCPTDYGRGGREFEYLTVKR
FT                   GKMLQKPLPRVQYVAEGSKPVWLFKSWHTPLSSPSMWEREVQYAEHTPEHIGAKRPLAV
FT                   VAPRTMHRYLFLMHMEKVTITVSPLLFGYGHTIQKAVLDFYRRAISARSPFPKDKVFLF
FT                   YAIDHITPRIEVTWLDGTSYVPPVLEGASSQDLIQMVMEEAWLAADRMAAEGRVLNPLA
FT                   IDDYKWDQLVVFKKVRDKEASKGGGRKK"
FT                   /protein_id="XP_845922.1"
FT   gene            <753395..>757423
FT                   /note="synonym: Tb07.13M20.410; kinesin, putative"
FT                   /db_xref="GeneID:3658515"
FT                   /locus_tag="Tb927.7.3000"
FT   mRNA            <753395..>757423
FT                   /db_xref="GI:72391257"
FT                   /db_xref="GeneID:3658515"
FT                   /locus_tag="Tb927.7.3000"
FT                   /transcript_id="XM_840830.1"
FT   CDS_pept        753395..757423
FT                   /locus_tag="Tb927.7.3000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin, putative"
FT                   /note="go_component: microtubule associated complex [goid
FT                   0005875]; go_function: motor activity [goid 0003774];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   microtubule-based process [goid 0007017]"
FT                   /db_xref="GI:72391258"
FT                   /db_xref="GeneID:3658515"
FT                   /translation="MTSQTSAVLVAVRVRPFNSREAPHECTVTVTDPRTITLTDVGQVN
FT                   RFSTSVSGSMQRHVFTFDKIFWSVPGCVLPLPTTPSGHSQQMPSASSIRLSVADSSSTH
FT                   SPSPTESPTVRRSSNSSDASVPCAAPTAEVSVSAITCVRPSFHRLPCFAQTPSCDNQTS
FT                   VYSFIGPLMYDSVMTGYNSCLFAYGQTGSGKTYSMIGPHDSFSEKGDQRGIIQRLCEDL
FT                   FDMMRREREEDEGISYNVECSFLEIYCERVRDLLTHTTFHSTNDDYSAPNVTTMGPPSN
FT                   LRSKTSPSQSLVLTPRQGSSNPSPQLRIRQHPTHGPYVEGLSHVKVRDVEGVMHQLTCG
FT                   MRERATAETRMNEHSSRSHALLQLNITRVSAVREEEAVVTRTRVCKVSLVDLAGSERIS
FT                   QSGATGDRFEEARNINLSLTTLTRVIMQLTDKQAGKNVVPSYRDSALTWLLSDSLGGNS
FT                   KTIMLATVAPSAYCYQQTLNTLRFAGVAKTVINVATVNEDQRFQKLITSLREQIVKLTM
FT                   QVEEGRILDPQNSEIRKLRRDKGELETQLEAMRIKVSKMVPATDLEILRRRVAETEEEN
FT                   TRLHAEKCNLQRQLMTTTTNLREELIRRRSEIVKLQEMLSKKDVEVQEWKRRHHSEVLR
FT                   GGKATPQSTVQLSRGRAASGGRAASPSGAFKSNNSSKCGMLKTDVASISSDSIVEGDAD
FT                   SGCAAVGELQFRNQQLERRVEKLTESVKEEQKRREDVEKVNHNLRFELRELQKLRDATR
FT                   GQLEEAQRRLTEKSHALEAAESDLASTRTLLSTERNGSCASEREALLTTQLEDLRVEYL
FT                   GEKQSNVGLLMRVSHMEQQLFLSQQEAEIKSRDVGELEQMLLEETETSERYYIFQLYYS
FT                   GKANICHAFHQKILLVKSLEPTNSVGVVTGVTRRSSFSDGPSVCVRALRDCECNEGCRR
FT                   LLLVEEWFNTVLDLAAQRHAMWRWSASALSDEILSLRINFAEGEEKQQRLLRKLETAEI
FT                   SLEEAIAVRNSVQATLSTTVEQCEELKRQVEDLKEELQAQQQRNEMLITRIAEVQAVRD
FT                   VFGEPSLSVDDPVSGLTLDGRGEEYQRFSRGSGERSLEDLSSEMTLYKERVDMLSAQLE
FT                   SERNRSHDLQVEMERELEIRQQEVQRVKSSCKASLFESTQIVREYEARLQELQDVIETL
FT                   RTALAEESNNVDIAQEEVRQAKVRHCTLTTELHRVVEVKESLERRLEDTELQFSTIQQE
FT                   QQKLKREFCEVERRLLDLSQMHEADVYLNVRCGGEDSEWLEKAAREKEAIEQQKRLVQK
FT                   LNKELLEAITEQKASLLDMDRQIALMQRGATSHNGEANLTQESNGGVSQFQGCIDGEG"
FT                   /protein_id="XP_845923.1"
FT   gene            <758725..>760965
FT                   /note="synonym: Tb07.13M20.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658511"
FT                   /locus_tag="Tb927.7.3010"
FT   mRNA            <758725..>760965
FT                   /db_xref="GI:72391259"
FT                   /db_xref="GeneID:3658511"
FT                   /locus_tag="Tb927.7.3010"
FT                   /transcript_id="XM_840831.1"
FT   CDS_pept        758725..760965
FT                   /locus_tag="Tb927.7.3010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391260"
FT                   /db_xref="GeneID:3658511"
FT                   /translation="MKFHLQSVLLMALDVVKGPYLSCFAPVNPVEQGGDDQPRDVQGDV
FT                   NKDSSRNKDMLHLPTNAGRFKAFSDVFVPKSEFCRRVMCLVEAESGILYLFYPEEISGV
FT                   HYERKTLRYTLCFAFAVDTNLVTATAATVERLLRPYSFVLTRIVEGLREAEQRSGYMSR
FT                   GLSHRLSTHCPSRGDCQQQQSKNDLIGQPSRSDFHEYGGGVSAEIHSVVGTTSFASPPT
FT                   GDEALFRYAKGTSRVNVFLTPPQDSSGMQWTSLEALMGELFTFLGTDPKEGETKCPRPW
FT                   ATENTVSLRLCETFFIPVGHRAPPHLPQQHALDEVPVPVAAYEPEVFEHVDLVMHDVFR
FT                   IVDGRRTIRQIVQVLAAECERYEDSDELLQRQGRIFSPASSQCAIHSVFAHSLHPVNFP
FT                   GSRSAPEVGGLASSTASTNAHPRDALNTQRATPGLLSPPSAADICLTSPFPNTVCSGTC
FT                   FSAPTVCTWSRTLQTSRYLPERQNAEEAANNSISDKLSVWCELELLVVEALQHLEVHNY
FT                   VKIIRPIKMKYTYFATNALYSIMSDRSSPARQLLGKRMLLVEYMFHKEKGQRTSLQGSS
FT                   GNQKRLQELAPEYRKNLEGLNSATRLTPPLAPLSAHDKGVAVDDEISREQQYHIKRERS
FT                   SDTALPCSTSLRHSSTECLQDGDSSHDDVDVTPAAETNPDRHEATYTEVLINMAAAAAL
FT                   CALGKFSGSTIFSVQRDMQGHPQWSNAFANWEESCCKSLVEIAIINGWLVAQ"
FT                   /protein_id="XP_845924.1"
FT   gene            <761227..>761799
FT                   /note="synonym: Tb07.13M20.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658514"
FT                   /locus_tag="Tb927.7.3020"
FT   mRNA            <761227..>761799
FT                   /db_xref="GI:72391261"
FT                   /db_xref="GeneID:3658514"
FT                   /locus_tag="Tb927.7.3020"
FT                   /transcript_id="XM_840832.1"
FT   CDS_pept        761227..761799
FT                   /locus_tag="Tb927.7.3020"
FT                   /gene_family="HOG000089187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391262"
FT                   /db_xref="GeneID:3658514"
FT                   /translation="MRRSVYQLSKELPISEDEVACLVKKVMRECPSAFNSQSSRAVILF
FT                   GEQHTKLWNLTKDKLKATVKPDSYNEAAKKIDGCFAPAAGTILFLEDKSVVEGLVKSYP
FT                   AYAEGFPVWSTESSGMAQFAVWTALAEKGIGASLQHYTSLIGEAVTAEWKLPATWEMHA
FT                   QMPFGKPLEKCGEKTYMPDEERFKVFK"
FT                   /protein_id="XP_845925.1"
FT   gene            <763458..>764387
FT                   /note="synonym: Tb07.13M20.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658519"
FT                   /locus_tag="Tb927.7.3030"
FT   mRNA            <763458..>764387
FT                   /db_xref="GI:72391263"
FT                   /db_xref="GeneID:3658519"
FT                   /locus_tag="Tb927.7.3030"
FT                   /transcript_id="XM_840833.1"
FT   CDS_pept        763458..764387
FT                   /locus_tag="Tb927.7.3030"
FT                   /gene_family="HOG000137448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391264"
FT                   /db_xref="GeneID:3658519"
FT                   /translation="MSNPPKHYSVESLRTVGLLPAQLALSRKPRLRPHVGNLKGLVYPL
FT                   PYYAMWRGNHNKYTYNKSTVCLWGEGDTRSMYHQHYAHAKCPTDYGRGGREFEYLTVKR
FT                   GKMLQKPLPRVQYVAEGSKPVWLFKSWHTPLSSPSMWEREVQYAEHTPEHIGAKRPLAV
FT                   VAPRTMHRYLFLMHMEKVTITVSPLLFGYGHTIQKAVLDFYRRAISARSPFPKDKVFLF
FT                   YAIDHITPRIEVTWLDGTSYVPPVLEGASSQDLIQMVMEEAWLAADRMAAEGRVLNPLA
FT                   IDDYKWDQLVVFKKVRDKEASKGGGRKK"
FT                   /protein_id="XP_845926.1"
FT   gene            <765163..>767070
FT                   /note="synonym: Tb07.13M20.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658518"
FT                   /locus_tag="Tb927.7.3040"
FT   mRNA            <765163..>767070
FT                   /db_xref="GI:72391265"
FT                   /db_xref="GeneID:3658518"
FT                   /locus_tag="Tb927.7.3040"
FT                   /transcript_id="XM_840834.1"
FT   CDS_pept        765163..767070
FT                   /locus_tag="Tb927.7.3040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391266"
FT                   /db_xref="GeneID:3658518"
FT                   /translation="MIDPFRSSFSGSTPFNGGAIDQLQHMQQPVFSLHSEPLPPLVSNV
FT                   GASHNGGVEENTTLHMTVTEEVDAFDEGQLEKLRRTLQLLEGISQGRHAVDWKGLINPS
FT                   KPVESAKNVSSMLARPTTLPSAIECVAKCITTPEHLSIVAKLDQPFRSQVRDAVLQELL
FT                   NTLTTERDPPPMPVCSEMLAEMVQLNLVVLRGVSRTLETLLSDTNTRRAAIAVLGKLAD
FT                   RSRGDAVFARAVQNLEPLVRAINDTEYEYDRVAIARLLRWGGSEREASLVLERIIASQP
FT                   QQYQVTSMAYIGQRDELASATCDGSVVIWGSPNAVSKEVRPATSIDLPQNYVPVALEAP
FT                   PNGSYMVVAGMPISLASQQAMMKASGSGISGHNWEKRRQASPSRVRAPLLRFLTCNEGT
FT                   GVWMSGDTTMRKENTALTAAVALPNMVVCTAESYPSERSSEAGIQHNLVLLNGCAPQPL
FT                   GVFEGAHEDYITVLRVGDESGHTLFTGSRDCVVKMWDIRSNSTRSVFSLGSATAPHAEI
FT                   PLHRLENAHTDTVTSIFPHRKVLLTASLDGNLLMWDIRQLCAPVHEMQLHSPILDVAPA
FT                   SGGFMVVSTARSLNLLSLETLKFHDIVPNVSYTQLRTNFDGRVMFGAGGTGVSVYSVRD
FT                   "
FT                   /protein_id="XP_845927.1"
FT   misc_feature    767356..767409
FT                   /note="AT_rich"
FT   misc_feature    complement(767356..767409)
FT                   /note="AT_rich"
FT   repeat_region   767700..767720
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(767700..767720)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   768156..768195
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(768156..768195)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   768411..768436
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(768411..768436)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   768552..768583
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(768552..768583)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   768583..768630
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(768583..768630)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   768886..768907
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="aaatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(768886..768907)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cattt"
FT                   /rpt_type="tandem"
FT   misc_feature    768985..769027
FT                   /note="T-rich"
FT   misc_feature    complement(768985..769027)
FT                   /note="A-rich"
FT   repeat_region   769465..769489
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(769465..769489)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    769652..769689
FT                   /note="GA-rich"
FT   misc_feature    complement(769652..769689)
FT                   /note="CT-rich"
FT   gene            <770088..>773585
FT                   /note="synonym: Tb07.13M20.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658516"
FT                   /locus_tag="Tb927.7.3050"
FT   mRNA            <770088..>773585
FT                   /db_xref="GI:72391267"
FT                   /db_xref="GeneID:3658516"
FT                   /locus_tag="Tb927.7.3050"
FT                   /transcript_id="XM_840835.1"
FT   CDS_pept        770088..773585
FT                   /locus_tag="Tb927.7.3050"
FT                   /gene_family="HOG000257347" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391268"
FT                   /db_xref="GeneID:3658516"
FT                   /translation="MFRVRRLAGFIQCSPCGKMGPLKQQTRRYTPIWKSDPAVDNVAPL
FT                   RDEDERRTLWAEVGPISDVGSAVTAWIRFGNDPVLHTAVPTMLGGKFRNQQREKESLLP
FT                   NSSSPFAYVEDYMGTNLVFGSPVHAKESAAVWATYFERRYASRLRLSRRTVANYVGLIN
FT                   SPEVFDDESDRPETRWSQDTFFRECAYLSEKFLKEKVSNMQQFEAALKRASPEAYLAFF
FT                   DAFQQQTQTQIPLPSPSVWHYEGERRKQWAEKFISISHKAQAFFKDVLSEDVKKYQEVP
FT                   GKLLQKVKPVLADVGKILVKRHERWLKGRVWTSLTEEEREAYCMKEVKRQQMQVEDGEF
FT                   DPMMEDDVDDTELEEWQREHDAIMELMNSPIDGLHFTTLELWLHAMRCEELETEHIYTS
FT                   ARVRAVQVAARKKLYDTTSYEEVIQAVVESIARGTLDLGAGVLRPHFNEVWCQLNYAKF
FT                   GSSTITQHTTTSRRQLLFFHAGSLKDIAATATLYYATKPLSNSLDYASPYKYRRSLITL
FT                   CSNYGVETAYTTQRPLLRSAANLARAEDLIHAVVTAAAQPFGERRRAATRDLHMEFQRL
FT                   AVPVERVIVANPVSALLESGADPDEKPVEGEKVNMWPLGAKRVVLYKWSAPNVEKLKAM
FT                   ESDAAPAVSGSSLTAERLREIQELKRRGFLEVSLWRRVTAQERKQRNEIVEAKKKQVEE
FT                   VVRTVPSLAHLHQYATSLYSRIEERVAFPTETSTVTDTTNMKEETNKPLEDSEWEFAVL
FT                   LDDRVLLNKEESVELYLPYRDANGELLAQGEYRALVRAFDLEANPNLHPAYCSVGYSES
FT                   FHVFDALPQLIAQFFRVKDATAEAAGVTHIPAADFTPFCAFLRDAGLDVPLRCEFEAGQ
FT                   AVTTDGDVYMDYFLQLLRGEAFHQSHAQAGLTEAQRAIEPLCRAHWVVHHPGADESEWA
FT                   TARRSVLDHAMQHEREWWFPNEMLDVKDVVTGSTNGLTPQMYPAAVRYGVELCTVLTAE
FT                   GKFVDERGSGLSARCVVNGTGAAESVVFDTANCNGTNTTSVEDALRVAHGALRSAQDRH
FT                   NTLAAFRLGPLSKQSQVLLFCGVNAYEFGGKYARTYAYAFEKAKKELEVTAASGFMAPS
FT                   LSHEDIERLSDQPTTSPSVDRFASTTHPEQRKAQFVPRVGPGSTPLEDPAADQKSEWS"
FT                   /protein_id="XP_845928.1"
FT   gene            <774730..>775893
FT                   /note="synonym: Tb07.13M20.280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658520"
FT                   /locus_tag="Tb927.7.3060"
FT   mRNA            <774730..>775893
FT                   /db_xref="GI:72391269"
FT                   /db_xref="GeneID:3658520"
FT                   /locus_tag="Tb927.7.3060"
FT                   /transcript_id="XM_840836.1"
FT   CDS_pept        774730..775893
FT                   /locus_tag="Tb927.7.3060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391270"
FT                   /db_xref="GeneID:3658520"
FT                   /translation="MFCFFQNRWESGLGAHLTEELISSAFSDFAPYAGAEQQQTRFVRR
FT                   QSDGTTTRVAYGEDGGWSVSMGNPYAGGISFATTPDLLCDMQLRIPLKLARDVVEQNSE
FT                   RGIIGSADNCEVLPVSRISLTPITTPYDSRSPFQYSVPPPLGPTGCFGMVELLYSYVTH
FT                   VYGAGLRVGPLSLRATASPGGMPSIDNSYVSALGQTACLVDGSWCAPLSAFPSCNLTVA
FT                   LQHPFMAVEGDTLAAICLESSAPKTPEGQGCNNFRLLVVQTLATSNRQNKQNPSDSHSH
FT                   SFSSVLRGDKNWRELGTLVAVQKSFRNQRFRLSAAAMIHDRELDYETAALADVTAIFSR
FT                   PTVLRLGFNRARRVAMGIATEILNGLTLTLGVHYTAGDLRFGLEAAL"
FT                   /protein_id="XP_845929.1"
FT   gene            <776417..>777913
FT                   /note="synonym: Tb07.13M20.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658517"
FT                   /locus_tag="Tb927.7.3070"
FT   mRNA            <776417..>777913
FT                   /db_xref="GI:72391271"
FT                   /db_xref="GeneID:3658517"
FT                   /locus_tag="Tb927.7.3070"
FT                   /transcript_id="XM_840837.1"
FT   CDS_pept        776417..777913
FT                   /locus_tag="Tb927.7.3070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391272"
FT                   /db_xref="GeneID:3658517"
FT                   /translation="MLRTNGKILNGKTPSNVVAKSSGVKKKIVKIKSSSAPKPVESALT
FT                   GNYGRVLFQMAICIAGIYVCFGFWSIKQERIMTKPYDAVVVVGGNTTVVSTKLSTVFVL
FT                   GLVQVVMAVVVSCVLLLAERLYAGKSQKAEKEETQKPKLEKKKKGTVKPKNGEMVNRRE
FT                   DKKVVVGRTASNKPKRKTEEDNTALSTGADKELEANKAFRNAVLIGFTNGFASMLGFAA
FT                   MRRLPYPVVLATKMSKMVPVILVGFFWHGTRYSLSKCLACALITGGSFCFYMLGEAGDE
FT                   SQALKSKTRNRSEVVSLFGFVLLFVNLLADGFTNSTQDKLVKVHGWTSNKLMFVTNLST
FT                   ALWIGAVLLLMECLQPFATAYLSISEPVTFSPSFAAFHPLLHRLDESFRWFLRDVAPFN
FT                   DFSKTMDFFNRHPEALYDVTVMSVLNAVGQMFIFRTISLFGSLTLTALTLLRKSSSVVL
FT                   SIIVHGHSVTLEQWFSLAVVFAGAVWEGLIHARKEPVSSK"
FT                   /protein_id="XP_845930.1"
FT   repeat_region   777998..778070
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(777998..778070)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            <779167..>780456
FT                   /note="synonym: Tb07.13M20.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658521"
FT                   /locus_tag="Tb927.7.3080"
FT   mRNA            <779167..>780456
FT                   /db_xref="GI:72391273"
FT                   /db_xref="GeneID:3658521"
FT                   /locus_tag="Tb927.7.3080"
FT                   /transcript_id="XM_840838.1"
FT   CDS_pept        779167..780456
FT                   /locus_tag="Tb927.7.3080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391274"
FT                   /db_xref="GeneID:3658521"
FT                   /translation="MAEGVPAPSSSFAQKMHQLLQIRAERQPLAEGYMRCPLNPTHQVP
FT                   IAAIVTHLSKAHQQDSLDIAPDAMYGVNTRSRRSEFLKEQLQRMQPVDESDLSESGYSN
FT                   HRRKRYRRSSSQSYSSDMGSSSSCCSNGRSNVSRQSNSSRSSGKHRHYEERPYNNRRRE
FT                   EQPTQRSFHGNNTTNWHDPSNVFKRLLGRYPFGASINKQRLTEFLICFGPLQSFNFLAN
FT                   GTEFVVEFESSVAASKCLQAATPNLLIDDVCVRMYPVPLPSPGVAPEFSYGGAEIMRTP
FT                   PPWPDDAAPPTVVSSLPAAQQNQPWPPTDITPSVAVGVGAGSKSVGVPVLSNVDDLVDA
FT                   FTSVSSARITSNTAILSCAVRTTCGKNVTTEDIWKELWHFGEMRNILLVGPRVVVEFSD
FT                   GRGVRRATQAMELEPGKFKFCSLLGEGEGR"
FT                   /protein_id="XP_845931.1"
FT   gene            <781168..>784254
FT                   /note="synonym: Tb07.13M20.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658513"
FT                   /locus_tag="Tb927.7.3090"
FT   mRNA            <781168..>784254
FT                   /db_xref="GI:72391275"
FT                   /db_xref="GeneID:3658513"
FT                   /locus_tag="Tb927.7.3090"
FT                   /transcript_id="XM_840839.1"
FT   CDS_pept        781168..784254
FT                   /locus_tag="Tb927.7.3090"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391276"
FT                   /db_xref="GeneID:3658513"
FT                   /translation="MWNEVSASEVEALLGELRDIVSDPVVMSVTKSGEDKQLISEEKTK
FT                   PKAVGRVGFSTYASVTESRRTVVPLYERLPPITPPVVCSIRDELTMSGADTLRKGFLLL
FT                   PNLTGDGEGMPQRPMSPNEVRRLLCCAESSARGGAANNSATSPTAGEGGDVKDSYREPN
FT                   FLPIMCARHICPGGIVPRARWGHTLTAVQGHKLVLFGGMDLKEGDTSDLFEYDAHHVVW
FT                   DPVFVADGVGPAPRTNHAACAAEDRWLYVSGGTTARGTIILGDIYRFDTWTHEWKCLWE
FT                   YRGIGTSASNSTSKNEPTPRFGHSMLHRDGRLYIFGGRALKRNQSGSRGDAVTCMASTD
FT                   VYVFSLTSGKWKKRIQAGKENTVSDEAKAPGSAGPCASERQESENAVELPPTRPTVRFH
FT                   HAACIMDSTMFINGGVDGDSVTLADTWALNLKEGRWIRLHDGSTADAHPREKHHLFACG
FT                   GCLLAVGGCSASDRRSLVSRRCRNFVAVLALESENKLGSVSWFPLAMGNAAAVVPNRKS
FT                   FGAAFSGGFVHVFGGICGCEPPSNTMVRFLAADGYFATDSTMVPSSSAGNKEGAISMMR
FT                   SVRESGDFVTYDAYILPRSWDGDVEVDTVANKPFGVHRALVQQRAPKFWEDVLRCRTSV
FT                   AKSIISPIADASSQLVNFACNPGLAESGNADNPTVGSCNRAGCDEEPNQAHVTAYYTEG
FT                   NSRVQGLSVSLTANQLQCLLDYIYWGDMHLSMLAELDDDNVSNRGREDLQKTAAQEEVR
FT                   TVQSLMRAAEVYELPLLHALCNALSSGNIKELREARERCGEQLQEDLLHLLETSRGATA
FT                   TVLFVDPHTKQQVSCSLHPFILTASNSFFKDLLRPLLTGEKMAFQMGSVSAKLCAAGRY
FT                   AASKSRRGIVVGPVPMPYLAVQPVLCFLYTRQLQIPRESVFATMLGSRLLDVAPLQAYC
FT                   ETILAREEVNYDTALHFFSLAGRYQAPLLQEIALLTAVMGYGVIRPTMRTVDLSEEEVK
FT                   EIAAVAEELGTDTWVPPPQTSTVAKTREEYQARWDASLP"
FT                   /protein_id="XP_845932.1"
FT   repeat_region   784847..784877
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(784847..784877)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <786190..>788016
FT                   /note="synonym: Tb07.13M20.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658524"
FT                   /locus_tag="Tb927.7.3100"
FT   mRNA            <786190..>788016
FT                   /db_xref="GI:72391277"
FT                   /db_xref="GeneID:3658524"
FT                   /locus_tag="Tb927.7.3100"
FT                   /transcript_id="XM_840840.1"
FT   CDS_pept        786190..788016
FT                   /locus_tag="Tb927.7.3100"
FT                   /gene_family="HOG000257351" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391278"
FT                   /db_xref="GeneID:3658524"
FT                   /translation="MTGPTRALFLSSGINLGRLRLAEQFSSMNGWQSKEDPAFDAYVKE
FT                   RRRKENYEAFDQRVERGYAAAAKLHKAEIQNAVKRRLKSSGAKFTAETLREMSSAVTER
FT                   LAWLRDVWAQIDSDYRSGDSARQETAAQEISAALRGEPNDHMRWVYETKRELRFAGPVG
FT                   RRAIQEELQAAELPEVLDEEVNRYHDLKLNMMEIEREVKAKYGVAGQQHWAELQAAKDE
FT                   EYIQKLDEAAEVYKQLLDQSARLDESRRSELQRSYVERVHQAQVRFKAAMELEGQREQL
FT                   IEAHQAMKEERMRTEREKRRQLLREAAELRAQGKESADVLTALKERQLDANAKRQAEYE
FT                   LKECEDILKRKSEMLDMIAHFKHDVEEREGREMLQRQKSDEERQVNVFGFYEEVGVEDG
FT                   LSISSEGTTSQGVSSGLGTVSTSTSCAKSADSNSSAQPSQKLRKEELWKAINADTYEDP
FT                   FRTVHQARLDAVKTYDPAYARTFPLNLVLGRKYSRQGAGEMAAGNETDKQILQKGNNIL
FT                   YSFQWGLNNGTVHDLDADGSTDYFMDGAFHVRDKETGDIDWRYEKKRGGPVFRGPKFYR
FT                   LGAQREAADPGERAMDPTPYTSTPREHKWRSS"
FT                   /protein_id="XP_845933.1"
FT   gene            <788738..>790342
FT                   /note="synonym: Tb07.13M20.210; transporter protein,
FT                   putative"
FT                   /db_xref="GeneID:3658525"
FT                   /locus_tag="Tb927.7.3110"
FT   mRNA            <788738..>790342
FT                   /db_xref="GI:72391279"
FT                   /db_xref="GeneID:3658525"
FT                   /locus_tag="Tb927.7.3110"
FT                   /transcript_id="XM_840841.1"
FT   CDS_pept        788738..790342
FT                   /locus_tag="Tb927.7.3110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter protein, putative"
FT                   /note="similar to Cis,cis-muconate transport protein.
FT                   (Swiss-Prot:P94131) [Acinetobacter calcoaceticus];
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_function: transporter activity [goid 0005215];
FT                   go_process: transport [goid 0006810]"
FT                   /db_xref="GI:72391280"
FT                   /db_xref="GeneID:3658525"
FT                   /translation="MAKRREVADDSDVYVLEFQKNYSDTTRQSLIVSDEVPDSTLLWRN
FT                   MVMFTLLKIIGSYDSGAFSAAVGAENGIADEWGLTNLEQGALSASVFLGCMVGCPLAGH
FT                   LFSQYSAKIVLIRVLVLHIFFTFCFATVTVYVISMVSRFLIGVTLSFIFVYVPVWVDDF
FT                   APRDRQSVWMALHNAGVPVGVLGGYLCGAILPSYTRISWEWAFYSKCIFTVPVIVYFLR
FT                   VDHRSVDRNSSRKSNVQGSLGIGHGGNGLPTNGTESAVRRGNENVFDRSSGARNLVSSA
FT                   CDAVLHIWKTAAVLLGNIEYTCSVLAMCSLYFVVSGLQNFMTQYLHAEPFNASMKTIMV
FT                   GFGTAIVASPIGGVITGGVLLDRLGGYQQNTRRVMIFTTAWGAGAAFFSVLCIFAGSTS
FT                   ALLVLMSLMLFCGGAVVPSGSGRVMASLPDTQRPAGAALAQMVYNLVGNFSGPLVCGSI
FT                   AQWMGDLKYGIRAVFCCSVIGLVPMVILLFAADRHPSGVCAMSSCGPVSTVVEERLEVK
FT                   SSGVVVENGNDDTVDAK"
FT                   /protein_id="XP_845934.1"
FT   gene            <792434..>792754
FT                   /note="synonym: Tb07.13M20.190; small nuclear
FT                   ribonucleoprotein SmD1"
FT                   /db_xref="GeneID:3658526"
FT                   /locus_tag="Tb927.7.3120"
FT   mRNA            <792434..>792754
FT                   /db_xref="GI:72391281"
FT                   /db_xref="GeneID:3658526"
FT                   /locus_tag="Tb927.7.3120"
FT                   /transcript_id="XM_840842.1"
FT   CDS_pept        792434..792754
FT                   /locus_tag="Tb927.7.3120"
FT                   /gene_family="HOG000182713" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small nuclear ribonucleoprotein SmD1"
FT                   /note="identical to: GB:AAG00461.1: Sm-D1 {Trypanosoma
FT                   brucei} (PMID:10900267); 100% identical to: GB:AAG00461.1:
FT                   Sm-D1 {Trypanosoma brucei} (PMID:10900267); go_component:
FT                   nucleus [goid 0005634]; go_component: small nuclear
FT                   ribonucleoprotein complex [goid 0030532]; go_function:
FT                   snRNA binding [goid 0017069]; go_process: nuclear mRNA
FT                   trans splicing, splice leader addition [goid 0045291]"
FT                   /db_xref="GI:72391282"
FT                   /db_xref="GeneID:3658526"
FT                   /translation="MPAAESSTLIGFLQQLRGTQVEIEMMNSTIVTGEITFVEANMNTY
FT                   MRHVKITAKGKNPEMAETYMVCGSKIRYVILPEAMNTDDVLVKAAAAKARPGSKRTERS
FT                   NE"
FT                   /protein_id="XP_845935.1"
FT   gene            <793614..>796484
FT                   /note="synonym: Tb07.13M20.180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658523"
FT                   /locus_tag="Tb927.7.3130"
FT   mRNA            <793614..>796484
FT                   /db_xref="GI:72391283"
FT                   /db_xref="GeneID:3658523"
FT                   /locus_tag="Tb927.7.3130"
FT                   /transcript_id="XM_840843.1"
FT   CDS_pept        793614..796484
FT                   /locus_tag="Tb927.7.3130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391284"
FT                   /db_xref="GeneID:3658523"
FT                   /translation="MDVAALRRLQHRMEARGRAAQSCVVNCDYSRPHCTCVPRHQHDEG
FT                   GGRDDTEVATASNHINKQGNNGNSSIVTLSGAARSWLVQRLEDIEVDITGGAAQHSRAV
FT                   PCCCSCCQGYHHSYHEPKEGSNVYAGCLNGKGSEKGQAATPSVSEVRADCIQQQADGSP
FT                   TVADGRINSSSPAPRTYDVPTLRGTQNVLKPAKSSKLLHALLRNAQMVAVPAKAREWEN
FT                   DPESEPDTPSRSAGSTLESAKRVFRERKRAATVPKTHSATESTRTSAMRTRSSSLLPTD
FT                   RQHRTATETATEGYSQPPSVTVYPHVNREVSQRPVGVSPRDAATDTSPLKSVVERSVQC
FT                   TPLVTSASTQRALALSVAIQTEDVADPSRSFPKGSSGSLAGKQLQQSSSTSTNGPATLS
FT                   AEVTSPTSRSGASESHEQGSAGRYVSNTKATTATMEPSPTEVINALREKLLLEKADAYV
FT                   RLLEQQVSGELHTKGRVEEEEAHARSHNQERILSLLSRLHQEDREIMEALYDAVNEKET
FT                   LEQARSLVASSLPVSSPSVSASASVPPPGQSFGDVSQESMQTSARPVYGKNSFPEEVLA
FT                   AYEQCSAEPSPHPKPPAGMTPLTTAGSPQTEVSQGSMRAWVDRYFSDSLDPQHRALLHH
FT                   VLLSREAEVRRAEAAESQCRKLKSRLCTADAPSLMLTEGSGKHESQKLSVPAVSGGNEE
FT                   ESKVPDLRRDGSGIKSSELSCSMPPPAPPRTENLPSRGNDRAVNACGANPSATSSSPSR
FT                   AVNEEELQRWKSRCDAIEQQHRASVHRLAELQTYIEQLRRDAHQAVVKVATAGTVTVPT
FT                   APNLPTTTLPQPNESTVQMSSVRDMWSPGSGPTRGVSDTLSFTQPPSSTCQPHSTVAPL
FT                   STFERPSKPATEMGPLSGVTPPTSLYPTSVPTTTTVQTSTGNREAALQMLREELDAECS
FT                   RFADESRRWQQFVETQRISLQKGKGG"
FT                   /protein_id="XP_845936.1"
FT   gene            <797426..>797986
FT                   /note="synonym: Tb07.13M20.170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658527"
FT                   /locus_tag="Tb927.7.3140"
FT   mRNA            <797426..>797986
FT                   /db_xref="GI:72391285"
FT                   /db_xref="GeneID:3658527"
FT                   /locus_tag="Tb927.7.3140"
FT                   /transcript_id="XM_840844.1"
FT   CDS_pept        797426..797986
FT                   /locus_tag="Tb927.7.3140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391286"
FT                   /db_xref="GeneID:3658527"
FT                   /translation="MSTLSSWLTGGKTGGGKESEKEDAAAIAARNELLNVIEGAPPSLV
FT                   SQQADQFAFLRSNARHKIADVVLALTAYTFSGFIHMYGQSTALTTLSMWAAGTTFFLNM
FT                   QVRKVFELEDETRRKQAVIDMGLQEKNVFQLEAVASWVWMLSSLQQFKIHKRLKYCGYS
FT                   SWTALCCCTYFTFRHMYQMLLEA"
FT                   /protein_id="XP_845937.1"
FT   gene            <798592..>800280
FT                   /note="synonym: Tb07.13M20.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658528"
FT                   /locus_tag="Tb927.7.3150"
FT   mRNA            <798592..>800280
FT                   /db_xref="GI:72391287"
FT                   /db_xref="GeneID:3658528"
FT                   /locus_tag="Tb927.7.3150"
FT                   /transcript_id="XM_840845.1"
FT   CDS_pept        798592..800280
FT                   /locus_tag="Tb927.7.3150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391288"
FT                   /db_xref="GeneID:3658528"
FT                   /translation="MVKTVSSLNSVDKLSHGTVSESSSRAQGQCPQRVLRELRDYLSIT
FT                   PHNEADGLTEAYLLRCLEATEHSIPKTVQLLRQRRVFEQTFPTIRLTPQVLTALRSGAI
FT                   STIGRDLQGRLVLYIHPKCFKQDPLDEQETQRLFVIVMEYALGCCTANQAPQQVLTTES
FT                   PRVVHTDRRTSASEVQKQQIVVLVNEEGSSWHSSNMALSRAKSLLALLTKYYPRLVVQI
FT                   LLYQPSCDVKLLVKHVLPSGPAASGALTAVEVVTPNHIQKYISPTTLPEELGGTSNFVS
FT                   SSSSSAFADAVLRHWFLETSYLLTEDASSRPIWKLPPCTVAAAGWSNLLARASAAAVAK
FT                   CGTTNYVAITDGNEGADYHVDPLSGEVNREQLHARVDNWVQESHVMYSRCRGQIRCSSA
FT                   EAENDDGGGSILSDVHFLSCREAELSTSDVWLGVDGFNSAAEREALLRELQNERNRRFA
FT                   MEKQLLNSRTSLGTTTQLDAQVTEKIEEALKTARVSLNMLVMNVVACAQESEACGNPPT
FT                   LRQLLDLTLTTIEGGTSEVQKVSNMKSPKLVKKKKEDKSSCCTVM"
FT                   /protein_id="XP_845938.1"
FT   repeat_region   800312..800332
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(800312..800332)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            <801917..>817789
FT                   /note="synonym: Tb07.13M20.140; dynein heavy chain,
FT                   cytosolic, putative"
FT                   /db_xref="GeneID:3658530"
FT                   /locus_tag="Tb927.7.3160"
FT   mRNA            <801917..>817789
FT                   /db_xref="GI:72391289"
FT                   /db_xref="GeneID:3658530"
FT                   /locus_tag="Tb927.7.3160"
FT                   /transcript_id="XM_840846.1"
FT   CDS_pept        801917..817789
FT                   /locus_tag="Tb927.7.3160"
FT                   /gene_family="HOG000257356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, cytosolic, putative"
FT                   /note="go_component: cytosol [goid 0005829]; go_function:
FT                   microtubule motor activity [goid 0003777]; go_process:
FT                   microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:72391290"
FT                   /db_xref="GeneID:3658530"
FT                   /translation="MMRQEKDKQLCLTADELLASDVVDCISSMMRSATKPQVREALQGV
FT                   EHEKNGTALHLVVCEYTPTQNLNNEEAATTTCVVAAEDLTTVFFRLMATVSRGVTSPKY
FT                   MGTGPMTEGSKNVDGGSSMETEGAAALPRVTRCVFITSASGGNSAEDIRNAPSSPRPAP
FT                   LTLSQLNVHAMEMDQPLGDLQSLLQRVYEPVLRQRREDALRYNLQEFVNSMQCRYHFLT
FT                   RVNLMQFVHPKLLTVCSVNPTADLHELVGLLHEEGDDVDLDDVFAIWSPCRNLLNVAFE
FT                   ADTADDGNAARPQVINLSEVVGGAPHHGSCIGDNTSRNHGNNNNGGVLEEVSYWQEVRQ
FT                   WINHIRRQLRSREWRLAHYLLRHRVPTSYEREYELHSKLAHSYEQHAKGVLQLLPHIND
FT                   VNDITTFLVNALRIIEAAARPGAYPRKRCTHFVNCVVHNIMEQFVALADGLDVLHIQPA
FT                   EKQLQKIGEMMKAIVELQRCLVDGVLSARIDQRDVEGTTVTETRNSSVAGQWCTEVKNL
FT                   SGFGRCSLLLERMKQLKDFLNEHFHYYRTLAQTFAEGGGSGSTTTSFCRHLAEAYSRFT
FT                   ADVVERGCLWDVSPTGAGKYQRIRDSYSSRVSRIDDRLALHVGISLSNEQERDTYNVTT
FT                   STVKANTSTEAKTSDPRRPARGRVDAPTAGGSPLYRAYSCFCVFRREKVLAVLASFRTA
FT                   LREQIDREINDICEEYFGKESCPHIVRATVARLGVTEDVGRMLWERSLQRQLETHMERR
FT                   EEISEHGWRQLLLLRTLEHRWCLNESLARFFGARLQDLVVEGFAAGSEVHGTAYALAFL
FT                   SLVHSKNELRWSRDPHIQSARQYLDENSPQSLEKARLRLVLLRKGSSWGSKQSEPWDVL
FT                   NFRDSIAQKLNEHVERWCNIVQSKFLHVDMVEETMAMKGPFLRLSYVERGVGTAGGNSD
FT                   KNNNFHRNNEGNIDGVSRGEQVLVPNIPQEMYAFLRDFYTLESVQLQEKHKQLFGNIRC
FT                   FFLKNEARFRIANSFRDLTRVFEEAVGDEEELMAHLITDEYAQVYGCLVDGAKLTWLEE
FT                   DKLLEFIQRLSCRVYNFCSAASSVRTAVDDVERILQQLHSQTFAAQSIVEKVEKLCGIV
FT                   KQLGSEGSSREWYVQRIQPRLDAALLLQLQAHLHRWTVEFLSMGRDPRFLDPASCTEEY
FT                   KLRPLRIRMRVLFKGITLATPEAACRYHWLNILNNSFAWLHAIPALHSSFRRSNHQHPT
FT                   ATPLFGGGSVVEVTAETVYGRLVDCLSSEVLAEPMTAIDKSIQEAFDVEKQWRRGQQLL
FT                   NLEVGVLQQKLGDDLVKWEEALRHIREFADTLMNHTQPSTLLGGILIVASDAQKELGRK
FT                   LDNMTQYINSRYREVVSKHLELCHRRITEERTDVEKCDVINSIDDACMFICELPTIYTK
FT                   LEETGRRIAPLVAAEEYLKNQGLSLPDSGVCVKKVKEEHQAYKDLIARKVKAVELRRPF
FT                   LRENAKQKGKGLQDDVAELEKSLAELDKQIQLRERQDKQHLEELADSMQERFYDIQKQI
FT                   LVLEKQHDRLTLLCKVLGIQPVDEVRLQSVASRTENLRWVFGHLLEVCRKLNRLSQTPF
FT                   SEVDPQRLHEDIISLQAEVQEFPPGVRGHPAHNELVQLIEERLAARWIIHELSSRAMMP
FT                   VVRAERHWSLLRSKLGTQWKLEELTVGDIWRSDPMTRAKIYYEVLDVARGEHRLETKLE
FT                   QITAFWNNFEFNTTIYKKKHVLIRGWDAVFAQLSDDIDTLQGFHLSPFYSASHIAASVT
FT                   EWESRLNLLLKVLEVLMGVQRRWVHLDGLFSSNEDIYQQLSSEGMQFDRVTWELWNLMP
FT                   YRSSPFGSTETAADLENVVVRTQDFLEEKRLLSSLERVDGQLTRVQRALNRYLDRQRRL
FT                   FPRFFYVGDDDLLETLGNSNNATLIAKHLPKMFTALARLIVKDMGANGQGSAGSAAADL
FT                   HIVGFACEEGEEVATNRSIRLEGRALHLTLNEVEIVMTQTLRQLTVSAAASLADAGCVT
FT                   TEWIEAFPLQVVCLAFQVWWAQLQEQALATWKAQQKREPSLAVSRMVSLLDQLALEVTA
FT                   VGVTPSVRRASEELITLAVYQRDVSRLIELKNVTAAEDFEWMRILRLYVVAPDTYSKKG
FT                   DAATDVGRPRKSGVVLANEVDYPEVHCRMADASLIHGFEYIGWYRRLVQTPLTDRCYLA
FT                   MTQALHTRLGGSPVGPAGTGKTETVKSLGAQLGRHVVVFNCTDTFDFSAIGRILMGLCQ
FT                   VGAWGCFDEFNRLEECVLSAVAQQIRSIQEALRGDLHSVNLSRQQVPLKTNVALFITMN
FT                   PDFADRSQLPGNLKQLFRTVTMVAPDREAIAEVMLFAQGFRTAESLSRKVVPLFDLCRE
FT                   QLSRQSHYDFGLRALKSVLVIAGEAKHADCKRNAVHVPETASSATAVEDDSNVNSRECE
FT                   LMLGSLINNIVPRLISEDVILFYPLLRDFFPGRPVPDVFESLLRSTIEEVCQDTHYTPT
FT                   PAWVEKIYQLYRTRKTRHGLMLVGPSGTGKTSCWKTLLRVMARLSTQEGHNDFDEGDLA
FT                   SPSRRSRGRPLEAHAYVIDPKAMTKAELFGVFEATTREWKDGIFTDILRRIVNNSLDTN
FT                   STQQQHWIIFDGDVDPLWVENLNSLLDDSKIYTLPNGERLSLPPSVRIVFEVQDLRYAT
FT                   PATVSRCGMVWFSHGTVPVSCLLNRHLTTFLRAPMIDKRGGKRIVEVCDDHEEMQSRLC
FT                   GGHFTLHRAAASSGTTTLASTQRELTTSDGDVRTSRENNKAHDSLTEDALNRSARNSEN
FT                   VPESPPPRTPHSFVSAERDILELQVFMVGVWTTAFAKGGLLERAFEIIHTERYRGQGIM
FT                   EHNDLQILRSVQSLLLDGIWSMWQVREKWGALPTERVVRSYAEKLLNYAVFWGFGAALN
FT                   NELRRQLLDDIGFQLLGQPRDLTLMDVEPDPVHGTWRTTRERVQPVDVDPEDVGFSDVI
FT                   IPTVDACRNRTLLEAWITGGDAVILCGPPGSGKTILVTSLLRDSFTHESVFLNFSSGTR
FT                   PENIIRALEQYCSVHNHAVHGPIMTPTSGKRLLLFCDEVNLPALDQYGTQPVVQFLRQL
FT                   VERKGYYRSRDNVWVTVEGVQVIGACNPPTDKGRVSLSHRFLRWAPVLFVDFPTEESLH
FT                   VIYSSYCRAMLSFSSRLQRYHPKCLAAAMVDVYTASQSRFNTWQQPHYVYSPRELTRWI
FT                   RALRGAILSWSDQQRCELTVEELVQLAIHEGLRIFQDRLVQNEEREWAHRKVVECFARH
FT                   FTDVTSSPAQPPLLFSSIVNGVYMKQTKSELVQYVEEKVRTFCEGEGDTELVVLDTMVD
FT                   HVVRIDRVLRQPSGHMVLVGASGVGKTIITRLVAWMNGMSVFRIDVNRGYQLADYERDL
FT                   REVLRRAGCGLERICFIFDDSNAMETGFLEYINALLPSGEIPGLFDGDKWAKLMDDIRA
FT                   SVEEQQSLKATSGTTQHLPRVLQHHQHEREGNELHNSARTSLFDRSSTMNRRDFGAPMT
FT                   GGGYDFDRHPLLLNETAGPMLTSDYIDITSEQVLYRWFVNNVRRNLHVVFVTDPSTKEF
FT                   ADRVVTSPALFNRCTINWLGEWDRTTRAQLAQKLTQNMDVMFSCRESFSGSEDTSRKAL
FT                   TEALSAIHEATEEVNSTARQRNANSGTFITPRHFSDLLQQLKLLYEEKKGRSMEQLTHL
FT                   RSGLAKLATTSEEVGQQQTQLREHEVLLDERSAKAQAMLERIVSETERTKQEKQEAEQL
FT                   RQQLKEEEDLILADRARVEQQLSEAAPALREAEEGLNSIKQEYLREMRAYTTPPTMVKR
FT                   VLETVLVVMGERRAGEWDVIKHYVRRDDFIASVKAFQARDVTEEAVQTVRGMLQEDGFT
FT                   YEAAMRASKAAGPLLQWVTAQINYAIVYAAVQPLRSRIDQITITQGAKQAQLERTETEI
FT                   STLEMSLQQLKEDYQSMAEEIATCKSTMGVIASRCDRATKLLQQLLEERDRWGAESLGF
FT                   DSEVSVLLGNCILAAASLTYFGYFDEYTRQSLLLPVWVQQLKNFKIRCTEEHSSGFVDY
FT                   LVTPSQRLEWEQQGLPKDNLCAENAMILHRSRRYPLLIDPSGVATAFLQKKHKDGTMRT
FT                   TSFTKSDYLKQLDMAIRFGYALIIEDAEFMDPIIGPLLKNEMRRVGGRTMTRLGGREVE
FT                   TTSSFSLILITRDSHYQPPPGIAGRVCLVNFAVTLSSLESQCRHRLLLHERADVDEQRA
FT                   RVLKVREEYSVRVRVLEQELLKLIAGSEGSILENNTLTVALERLKGETKALKEGIVESD
FT                   ELMRSITAVEEHYKPLATAVSKVYFVLRCFSQLHGLYQYSVKFIFRVLNDALDQLPPPS
FT                   NSNGAQQEEAPAEKKEEDAARLQVLTRHVFYLLYHRARRGMFAQDHLVLATALGKARSG
FT                   IADPIGQQLTIEEWNLFESALGGPVASTGVSIPAESIKGADRLDQLPKILSGCRVCSPS
FT                   SAAVLAELLKLPLFEQVRVSLNNPEHGEAWRAYFAAVEPYAETIPPFSRKVKNFSADDA
FT                   NCSSVGGSHAVGPTRRAFITALLLLHTRRDAFVPAASEFLRLFFDGADVAVGDGRGNCG
FT                   ESGYRAIAGHDGAKGGMGDFDSFFSAEVLDLVAIQKELTNTTPLILVANAGSDPTVSLE
FT                   AVASAMNVQLHTAVMGSADSTEAAERFLTTATVDGAWVLLKNIHIDRAFADVVVRHLHR
FT                   VFAGDQVHEGFRLILSMEAKAQHVVGNLGERGCGGDVINARSPLDLPVSLVESSIVVVY
FT                   EPPPGMKASLLQTIGSLRAPTQQAPYSADMVRIYLTAAWFHAVVMERLLYVPLGWSTRY
FT                   EINDTEFWHTLQAVNRWVMTTESTSGGNTVGDIEGNQVCSANREHFPWLALQTIIGTAL
FT                   YGGKLSNDFDQFLLNSFCTQLFSPIIFEDDKFFALLEGLCVNQKLRLPSMDTLNDVLAW
FT                   VKSLPDPQPLRWARLPASASRLMLEKQAVAMLERLAILRFVGEKEHSGRSIVDGCAAYS
FT                   EESTIPRCLTEMQWAQKVRLFCSSWRSSLERLVPAGQVVSAQSAETPSGGRSSGAERCK
FT                   EEPVSVMVDREYAFAMERLHEVLDDLQVVENICCGTGKPTADQRALIDWLLKDQIPPMW
FT                   ARSYSSHTAVAEQWMIDFARRVSHALYLRGAIQRESGGAVCLNLGLLFWPEAFVTTTKQ
FT                   QTARRQSQPLEQLQIQLDLMPEEDVRARAAKVVKEDDVWHIVGLTLFSASLKKCDTASG
FT                   GAGYTCVLLPDSSTAPSTPVGAVMRWRPVVLSRTTTAPDAGCCMAPAAKSSVLTRLASR
FT                   DKNSNCLIVPLYASDLRRALLQVVELRVDIKNTPMHAWYERGTCLVAWSMEAY"
FT                   /protein_id="XP_845939.1"
FT   gene            <818368..>819543
FT                   /note="synonym: Tb07.13M20.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658522"
FT                   /locus_tag="Tb927.7.3170"
FT   mRNA            <818368..>819543
FT                   /db_xref="GI:72391291"
FT                   /db_xref="GeneID:3658522"
FT                   /locus_tag="Tb927.7.3170"
FT                   /transcript_id="XM_840847.1"
FT   CDS_pept        818368..819543
FT                   /locus_tag="Tb927.7.3170"
FT                   /gene_family="HOG000257357" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391292"
FT                   /db_xref="GeneID:3658522"
FT                   /translation="MMSSGNQHEKVQLQQGGNTRGRFCSVTIVGSGVSTGVPVIGHLSS
FT                   DCACAEAFRDPQGPDRRNNVSLLITVRDAECTGSDSEDDRNAKHVLIDCGKTFRDAYFR
FT                   VLAKHKVRYLDGLLLTHDHADAAGGVDDLRDLQRVTVDDVSKCCTIEQYISTYASEKTI
FT                   ESLRQQFGYIVRNSWLMGPAPSTAEEHELVVKRMREDREREGQTDNIGYRRSAALHLYT
FT                   LPDTYPSSFYIPGFGENFPMYALPVEHGKGYMSLGFVFGRGVALRSTGASSCNGYSCVV
FT                   YLSDVSEIPPNAMSFLRDLVKIDVLFVDMLYGPEVSHPSHYCMDDTLQLVCELQPARTY
FT                   AIGMYCDIKHAAGNRLLKERLEELRGAGKCGDGVITVELGYDGMTMALPLS"
FT                   /protein_id="XP_845940.1"
FT   gene            <820174..>821472
FT                   /note="synonym: Tb07.13M20.120; mu-adaptin 1, putative"
FT                   /db_xref="GeneID:3658529"
FT                   /locus_tag="Tb927.7.3180"
FT   mRNA            <820174..>821472
FT                   /db_xref="GI:72391293"
FT                   /db_xref="GeneID:3658529"
FT                   /locus_tag="Tb927.7.3180"
FT                   /transcript_id="XM_840848.1"
FT   CDS_pept        820174..821472
FT                   /locus_tag="Tb927.7.3180"
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mu-adaptin 1, putative"
FT                   /note="identical to GB:AAL85340.1: adaptor medium chain 1
FT                   {Trypanosoma brucei}; similar to Adaptor-related protein
FT                   complex 1, mu 1 subunit (Mu-adaptin 1)(Adaptor protein
FT                   complex AP-1 mu-1 subunit) (Golgi adaptor HA1/AP1adaptin
FT                   mu-1 subunit) (Clathrin assembly protein assembly
FT                   proteincomplex 1 medium chain 1) (Clathrin coat assembly
FT                   protein AP47)(Clathrin coat associated protein AP47) (AP-mu
FT                   chain family membermu1A). (Swiss-Prot:P35585) {Mus
FT                   musculus}; 100% similar to GB:AAL85340.1: adaptor medium
FT                   chain 1 {Trypanosoma brucei}; go_component: AP-1 adaptor
FT                   complex [goid 0030121]; go_component: clathrin vesicle coat
FT                   [goid 0030125]; go_function: clathrin binding [goid
FT                   0030276]; go_process: protein targeting [goid 0006605];
FT                   go_process: intracellular protein transport [goid 0006886];
FT                   go_process: vesicle targeting [goid 0006903]"
FT                   /db_xref="GI:72391294"
FT                   /db_xref="GeneID:3658529"
FT                   /translation="MASVFYILDSKGSPLICRSYRGDVTHNPPSVFQRRVLDEEEFRIT
FT                   PIFEEQGYIYCYIRVNNVFFLMVSKLNILPLQQFAFMRQCVTVFESYFKHVLEETIMDN
FT                   FVIVYELLDEMCDFGFPQYTEEKSLKKYITQESLISYLLPEDKLHVKELPAEASGRGGL
FT                   TPWRQPGKYKYRKNEVFLDVIESVNILLSPGGETLSSEICGQIKMRVRLSGMPVLKLGL
FT                   NDKATFEMLASRGRAVEMEGVKLHQCVKLSQFESHRVISFVPPDGEFELMSYRTSKKVA
FT                   PMVTVECTTVSKSATQVEMALVARTTFRRTLTASFLDILVPVPSDAFKPEGRCSAGKVR
FT                   HAPESNLLMWSLREVSGGKQFTCSFKFSLPSVRSSDPSVFAKAPVQVKFEVPYLTASGI
FT                   QVRYLKVEEEPNYQALSWVRYVTQSGDYQIRTA"
FT                   /protein_id="XP_845941.1"
FT   misc_feature    821471..821566
FT                   /note="GA-rich"
FT   misc_feature    complement(821471..821566)
FT                   /note="CT-rich"
FT   gene            <822237..>824003
FT                   /note="synonym: Tb07.13M20.110; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658532"
FT                   /locus_tag="Tb927.7.3190"
FT   mRNA            <822237..>824003
FT                   /db_xref="GI:72391295"
FT                   /db_xref="GeneID:3658532"
FT                   /locus_tag="Tb927.7.3190"
FT                   /transcript_id="XM_840849.1"
FT   CDS_pept        822237..824003
FT                   /locus_tag="Tb927.7.3190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391296"
FT                   /db_xref="GeneID:3658532"
FT                   /translation="MQWKEVLDSEDSIDSPEAPLLSVTSALLAFSTGELQRGEERTRHL
FT                   DASDDSNGGTPRFDHEVAEGVCFLFTKEAGEDNKLTCGGGDRVGCFHDMENQRLLTDLC
FT                   PGNDAVASECQMVWNAGNWVSPSGEVVDQSERYRALLPLQWGVCKDSFITLSRDTVTDS
FT                   LVVIHRHRYPRSGHGSNGEESLGQLHIPFSQPWRRRVRSLLSLSHTNLMPVTDIIMNEA
FT                   KQELLLVHPYMDGVQPIASALRSYPHLIYRPITSPMMCSIVRGLVDALLFLHKHGIVHG
FT                   ALSPWTVLLTTDNRALVAGPSLQNTTWPLADLESVGGNSLHPSFHAPLEEKDSMGGHCL
FT                   PTEADDTFALGVLMLAMTWEMCDPLCVELHERAVKLTHRCVAHRMTLMELKASLGPLVD
FT                   PRNQQERKDRQEEEGEKCSKSCGEHNPLSTVELVPKPQPPVVTGILRRTDSPVLYRTTG
FT                   LDKWMTSRASNIQRVQRDVVVTLKPYNEDKFDALLRWRVVSITVLFIVSIRRSLQRGCV
FT                   PLKKIFYHSKETPPRPVPRRLQQHRMTVRRSPVSTSHADRTHLLLPARVPLTQNPPRGG
FT                   ARERDGNSLEDD"
FT                   /protein_id="XP_845942.1"
FT   gene            <824977..>826041
FT                   /note="synonym: Tb07.13M20.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658533"
FT                   /locus_tag="Tb927.7.3200"
FT   mRNA            <824977..>826041
FT                   /db_xref="GI:72391297"
FT                   /db_xref="GeneID:3658533"
FT                   /locus_tag="Tb927.7.3200"
FT                   /transcript_id="XM_840850.1"
FT   CDS_pept        824977..826041
FT                   /locus_tag="Tb927.7.3200"
FT                   /gene_family="HOG000257359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391298"
FT                   /db_xref="GeneID:3658533"
FT                   /translation="MKSTVTMAASVRCTHRIRAPLDHLIMRPSDMDQVVTSIGTTDAAI
FT                   VTWYMPLANLQHILHRRYEAEQFGEIIIPPVTTQDPTTSADEQNNNPLGFVTLVAGRNY
FT                   PQKQTWLERVFDPAPHSTLSLRVAVMDRVHWQRTSWMANSICRSICWGRLPQKMFSINL
FT                   DWKNAVHIDADFDVDADRYNAPYSVHVPGLGFQLTLRDTGRTVLDRETPTVDGFLDNES
FT                   ALHRLALAREVNMQGLGGCVYRQTLWSAPSLPNTAKVMQFQPGELFKRCFGVDPPAHVE
FT                   PVAAWLVHEVEQTLVYKMEGEVEDENEPNSATTYGDRSLTERVQKKAMNRYNGFRDEVR
FT                   GKVYSELDGKELPR"
FT                   /protein_id="XP_845943.1"
FT   gene            <826374..>828248
FT                   /note="synonym: Tb07.13M20.90; protein kinase, putative"
FT                   /db_xref="GeneID:3658531"
FT                   /locus_tag="Tb927.7.3210"
FT   mRNA            <826374..>828248
FT                   /db_xref="GI:72391299"
FT                   /db_xref="GeneID:3658531"
FT                   /locus_tag="Tb927.7.3210"
FT                   /transcript_id="XM_840851.1"
FT   CDS_pept        826374..828248
FT                   /locus_tag="Tb927.7.3210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72391300"
FT                   /db_xref="GeneID:3658531"
FT                   /translation="MLLHYRTLAMATSRKQVVGKYELGKVLASGYFDCRTRICTHIVTG
FT                   AQYVVRIYSKSTLAEAQWMWDRTRDAIHVMRTLPKHENIIEISELFETESSLYILMQLF
FT                   APMHLTKMYTTVGESGQRERVPIQRTKALFLQVVRGLRHMHDCSVVHLGLAPDHVMVND
FT                   RDHVKIGNLVSCKYVPKGTKLCRDIRGTMHTVAPEVLRNGEYDPYLADSWSMGVLLYFM
FT                   LHNGRYPHDGANTTKNILYNRIRPPDPKLPAEALNLLQQLLSHNPGSRMRVEQIADHPF
FT                   FATEHKDVDTGRTEQQAARYTGVVPNLWASRTAHIPVVLRAPLKERVQYSGNREDAAAY
FT                   LIQMCYKAFRGRKRRFSDRFLSTQPRGSINRSRSQVVEVVCPSSRSRRRKNYQTPHGDT
FT                   EAAFGQERTHLSSQHYQQRWSAVTNTEMQQGELGSRTSSINSGFAKCGEGPADPAEGSS
FT                   FFGFSGSESEGSPMNATQGSHFNFSLKSGNLPLTLPPLRRQGGPCKLGCDPTLDAPVGT
FT                   PPNSTFDGPDNASPTTASVCNEVVRAASFRLRVPSMLHLKAAEAFSRDLDLRGPGFTHF
FT                   NTRVDPGRRCPVCDRPPAQRMNRKQPYLNTPYEYKEGKFTIKTVADSD"
FT                   /protein_id="XP_845944.1"
FT   gene            <830241..>830861
FT                   /note="synonym: Tb07.13M20.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658535"
FT                   /locus_tag="Tb927.7.3220"
FT   mRNA            <830241..>830861
FT                   /db_xref="GI:72391301"
FT                   /db_xref="GeneID:3658535"
FT                   /locus_tag="Tb927.7.3220"
FT                   /transcript_id="XM_840852.1"
FT   CDS_pept        830241..830861
FT                   /locus_tag="Tb927.7.3220"
FT                   /gene_family="HOG000264264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391302"
FT                   /db_xref="GeneID:3658535"
FT                   /translation="MRAEKVTVSPAGEGAAPLFVFGYGSILWKQQFEYLRALPCCVHGY
FT                   KRVFYQGSTDHRGVPARPGRVVTLLTCGDPEAWVGGVAFELPVEEEKREKILAQLDDRE
FT                   SGGYEREEVTLYDIKTHERLHLPPGAVCLCYRATEDNPEYLGEAKDEAIAEQILSCEGL
FT                   SGPNSEYLFKLAEALRKLESADQHVFAVETAALHIMKAQNVPE"
FT                   /protein_id="XP_845945.1"
FT   gene            <831326..>834019
FT                   /note="synonym: Tb07.13M20.60; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658534"
FT                   /locus_tag="Tb927.7.3230"
FT   mRNA            <831326..>834019
FT                   /db_xref="GI:72391303"
FT                   /db_xref="GeneID:3658534"
FT                   /locus_tag="Tb927.7.3230"
FT                   /transcript_id="XM_840853.1"
FT   CDS_pept        831326..834019
FT                   /locus_tag="Tb927.7.3230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391304"
FT                   /db_xref="GeneID:3658534"
FT                   /translation="MDGQRATKGVGHASDWAELRRALFNVHLLLALQEGSVTQPPGEEK
FT                   VVASREASQPLLERGCGMNRVQSVSLMTLELEDSTDALHSQCLEKHEEKRGVCRALPLP
FT                   PLRWAVPSHQQRLAALEKERRRRQRKNAAAEGKLNMLGNTLGSGDTRQPSSITGSSATA
FT                   KVMELDKNVMKEDLQDGTASPAHSTRSSLTRTGDHSECESSQDTYTAAFASVDDHCPRE
FT                   MPSFRLSSGSDNSDCQTLSRTISTLSVRKTLAPVHEGHRCASVYRLLGAGSSLSEDTTA
FT                   HMAQTEVEQICSGEAEPYTSYLFSPVVRVVDLSEGRSSPTPPGGNEDRMAPDGDLEMKD
FT                   GCTRVSFSPNGECYVVGTRRGFLWLFTTGSPPGQNNIYGYGDEKGDGVCLDEEPPVEPL
FT                   KLQAHGGPVTDVTFNDVGTLFASAGGDACVILWNQRTRLKVRRINTGGGVPTLVRFVPE
FT                   NNNYLLVSLMQHRLLRLYNTSTGRPVTRRGAEMRIEASTVAVHFCADPFLFIGDTSGTV
FT                   SMWRYYLGCEHTCAMCPLEPRRSGEWREGRASSPAVTGLLPHGVASGASSTRGSIKERC
FT                   CQVPAVVVENQPCFEKAGSLLLEKGTPVGALAVSTMTQEQLRYLKRAQRIGWKIPKRGL
FT                   FGKLIEGILSEALNRNNSSESPGEMDASDCSKLMCAVMLLASLPCDRMAVLCIQAKAED
FT                   TREYTLVPMLVVDRACRIRHMSTGAAFCTDNVRSPTFTSTCEEGFVQIIACTAARMLPV
FT                   AKEETAATGSSAVVTPWAVMATLPVPCGGSPSSLAWSPDMRILTAVTEEGMVYQWRRVQ
FT                   LHQGTTVNEDINRDADDGLRASTTRDEVDEWRRHFEREKKRQLHRYRARKNAANQLEDT
FT                   SRPYGGLNAGSGSRTSVVQSLCHASN"
FT                   /protein_id="XP_845946.1"
FT   gene            <834318..>834809
FT                   /note="synonym: Tb07.13M20.50; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658536"
FT                   /locus_tag="Tb927.7.3240"
FT   mRNA            <834318..>834809
FT                   /db_xref="GI:72391305"
FT                   /db_xref="GeneID:3658536"
FT                   /locus_tag="Tb927.7.3240"
FT                   /transcript_id="XM_840854.1"
FT   CDS_pept        834318..834809
FT                   /locus_tag="Tb927.7.3240"
FT                   /gene_family="HOG000257363" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391306"
FT                   /db_xref="GeneID:3658536"
FT                   /translation="MLRSTLTSLNTFLTSSVATPPISVIRTGPKWWADPERMVRQKLMY
FT                   FTLGVDQLPLRRTAVIQRDLQRFHMCKPPPRVGDSTGYKRSRAAQLNTWYRRIQYQEYH
FT                   MQHLFTRHVWGLLRVYPGNTTKIQGKADDGYVGYDSVPFHRYNRAPLPFPARELYERRK
FT                   "
FT                   /protein_id="XP_845947.1"
FT   gene            complement(<836329..>837522)
FT                   /note="synonym: Tb07.13M20.30; expression site-associated
FT                   gene (ESAG) protein, putative"
FT                   /db_xref="GeneID:3658537"
FT                   /locus_tag="Tb927.7.3250"
FT   mRNA            complement(<836329..>837522)
FT                   /db_xref="GI:72391307"
FT                   /db_xref="GeneID:3658537"
FT                   /locus_tag="Tb927.7.3250"
FT                   /transcript_id="XM_840855.1"
FT   CDS_pept        complement(836329..837522)
FT                   /locus_tag="Tb927.7.3250"
FT                   /gene_family="HOG000137449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene (ESAG) protein,
FT                   putative"
FT                   /note="go_component: plasma membrane [goid 0005886];
FT                   go_function: transferrin receptor activity [goid 0004998];
FT                   go_process: nutrient import [goid 0009935]"
FT                   /db_xref="GI:72391308"
FT                   /db_xref="GeneID:3658537"
FT                   /translation="MRFWFVLLALLGKETRANYYERNALNATAANKVCELSTYLKGVAH
FT                   RVNSGSAAVMKKLSDLKIKSAQLQLSVMRNSVPSSEKDCKDIRTLLKTVLKNEFTFQQE
FT                   LEEMRNASALAAAAAGLAAGRLEEWIFAFAQAARTTSQFCISVGGSRPAVHDKLQECFR
FT                   GTIGPETLYKIEDSHVTKSAEKNLQLHEALSSISFSSLGAESIIERNEDRGCNLMRTAT
FT                   DGLLKGGSLSHSFTWGGGVMNFASSVEGKLNVKGGEYGDVTSYGAVRWTEDPNKVSIFG
FT                   DVIRLFARFEEAKNAVMEKIKTTADELTKCIGHKEAELTNDQLHEELIGEILNSLELSR
FT                   RVNEESTSRGQEEVRLKSNYSAEPARRPVMRAESNPAAHSGVRAAALCSAVLLLRML"
FT                   /protein_id="XP_845948.1"
FT   gene            complement(<838888..>839907)
FT                   /note="synonym: Tb07.13M20.20; expression site-associated
FT                   gene (ESAG) protein, putative"
FT                   /db_xref="GeneID:3658538"
FT                   /locus_tag="Tb927.7.3260"
FT   mRNA            complement(<838888..>839907)
FT                   /db_xref="GI:72391309"
FT                   /db_xref="GeneID:3658538"
FT                   /locus_tag="Tb927.7.3260"
FT                   /transcript_id="XM_840856.1"
FT   CDS_pept        complement(838888..839907)
FT                   /locus_tag="Tb927.7.3260"
FT                   /gene_family="HOG000137449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene (ESAG) protein,
FT                   putative"
FT                   /note="go_component: plasma membrane [goid 0005886];
FT                   go_function: transferrin receptor activity [goid 0004998];
FT                   go_process: nutrient import [goid 0009935]"
FT                   /db_xref="GI:72391310"
FT                   /db_xref="GeneID:3658538"
FT                   /translation="MRFWFVLLALLGKETRANYYERNALNATAANKVCELSTYLKGVAH
FT                   RVNSGSAAVMKKLSDLKIKSAQLQLSVMRNSVPSSEKDCKDIRTLLKTVLKNEFTFQQE
FT                   LEEMRNASALAAAAAGLAAGRLEEWIFAFAQAARTTSQFCISVGGSRPAVHDKLQECFR
FT                   GTIGPETLYKIEDSHVTKSAEKNLQLHEALSSISFSSLGAESIIERNEDRGCNLMRTAT
FT                   DGLLKGGSLSHSFTWGGGVMNFASSVEGKLNVKGGEYGDVTSYGAVRWTEDPNKVSIFG
FT                   DVIRLFARFEEAKNAVMEKIKTTADELTKCIGHKEAELTNDQLHERQFKAIQNYLELL"
FT                   /protein_id="XP_845949.1"
FT   misc_feature    840837..991076
FT                   /note="sequence corresponds to BAC RPCI93-28B13"
FT   gene            complement(<841229..>843652)
FT                   /note="synonym: Tb07.28B13.860; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658541"
FT                   /locus_tag="Tb927.7.3270"
FT   mRNA            complement(<841229..>843652)
FT                   /db_xref="GI:72391311"
FT                   /db_xref="GeneID:3658541"
FT                   /locus_tag="Tb927.7.3270"
FT                   /transcript_id="XM_840857.1"
FT   CDS_pept        complement(841229..843652)
FT                   /locus_tag="Tb927.7.3270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391312"
FT                   /db_xref="GeneID:3658541"
FT                   /translation="MHRRLRIQFLFSTTPLPWGSSLLGQQFILQNRVHYHQLIHERKRK
FT                   PRGDIPAASPFASLRFRSSGPDSPEGCDEPFALSFSEPGFKAIPPDEFTAIFNTRPVAE
FT                   RAAAMVVARQHASGRVGLKVFVEQLPKVSRDNIFGSGMGVEEWLQKCLLLRLVEDAHGL
FT                   RHVELTAEPKSYLADVDKDESETVNEAGERIGSHASEGTHRGLVGAAEKLLDVLRDDVL
FT                   GRRERDEPNYKPLSEAYSLLLREGSRVCELSGTVHTVKYGDFLSLLRTPRAAGEFWVLH
FT                   DRYICTRLAGESKPPRFVSPQPQTRGANSMNAYGGWAAASNVPTREDVYEILKYVPVNW
FT                   GNFGNLNLPPAVKKKHIRISSTLQWFRRQPFYFELRSIAGTTEIRRSIVLHPEAHGLTP
FT                   EEAHEQLQLKIAKGEANSLIPLNAEGEVTNMAGESQQLATILKFVSRVCPGYFVPSSLL
FT                   MQRYTKKNLTHNELIGCVKNHPAQFEVVQLRYTDTPLVRRRIGANSDRWKGHFIEDFEQ
FT                   FPEDVRGLIILMGRVCTTWDRSHYVYVRLTEEEKVMVGGFEGMMHILNRHPRIFRVGEN
FT                   FIARVDLSDPLSSQEPEPAPGDMATRVIIREENPYQTPRDLAVVFHYVAPDDEPCTAAF
FT                   FLQCASPAMRAVLPPRIVTVLQLFPDLFVCKETSPGVFLMRKVKKVSGGRSGNIFGEAP
FT                   ITPRTSGDARSPSISTLSSQANVSAECSGESLDLEAEFAENDFLSREEAVQAVRSLIPA
FT                   RGVEASQLLLWASLSVQQAANRHYGGVLKLVEANRAHFRIQDTPEAKMVFLVES"
FT                   /protein_id="XP_845950.1"
FT   gene            complement(<844383..>846746)
FT                   /note="synonym: Tb07.28B13.850; translation initiation
FT                   factor IF-2, putative"
FT                   /db_xref="GeneID:3658539"
FT                   /locus_tag="Tb927.7.3280"
FT   mRNA            complement(<844383..>846746)
FT                   /db_xref="GI:72391313"
FT                   /db_xref="GeneID:3658539"
FT                   /locus_tag="Tb927.7.3280"
FT                   /transcript_id="XM_840858.1"
FT   CDS_pept        complement(844383..846746)
FT                   /locus_tag="Tb927.7.3280"
FT                   /gene_family="HOG000257365" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor IF-2, putative"
FT                   /note="go_function: GTPase activity [goid 0003924];
FT                   go_function: GTP binding [goid 0005525]; go_function:
FT                   translation factor activity, nucleic acid binding [goid
FT                   0008135]; go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72391314"
FT                   /db_xref="GeneID:3658539"
FT                   /translation="MQSGLCHCVRRVAALGSVANLHHFTNLPSGFSVWTSRRWQSQSSR
FT                   GQPGLQWQEGVVDPRYSSSGNMRRFNPDTVAHYVKATIQNDRREMGLGEVYDWHEFAKD
FT                   AVYIPTRSGPLWVGSDDPRCAKFMRRRSKMQKTPQQKARPKPGPDPAKALEDHPLREYF
FT                   TTATNLRDPLSTANNLHRAGLIREYDIKYTAAKVRYVPRPPVVSIMGHVDHGKTTLLDY
FT                   LRKTNVASQEAGGITQNVGAFQVKTLGDTLVTFIDTPGHAAFTTMREVGATANDLIVLV
FT                   VSAVDGVQPQTKEVIELAHKSGIPFVVACTKIDRQPRVENVKQQLRDCNVELEEDGGDT
FT                   QFVPVCARDGRGVPELLEAIALQAELCEISTPEPSRCEVTVIETNGVNTTTEVAGIVRC
FT                   GKVRAGQVLVAGMTYAVVRKVLDEHGQIIQEAGPSQPVVLHGFRVHPKPGSVLLQVSSE
FT                   SHAQKFYHFMKEVYQAEGRREDYLQLLNQEQHGMLYARKPDNNLVRTYSTQAFVLSCKA
FT                   ATFGMLQALMKSIYEIPRLEGISTEIKVTEVGGLRDYDVALIGSSGQPGCILLYGGCKD
FT                   TNTLDVPSHVTVIRFNVLYHGLEALKETLVGALPKITKIRVTAEAECLQVFRASQAGKS
FT                   GNAGGMRVTKGTIIAAHLTFRVCRKAPLVKGTAETDGVSDNEGVGDEDMLGHRVVVYEG
FT                   QIKELRRFKELVPSVELGLECGVIMQDEFQFRTGDILQQYETYEEPRDVAEEYQKAELR
FT                   EKIMRDTAAAEALLAESTGGEDKPTEESEVKTTI"
FT                   /protein_id="XP_845951.1"
FT   gene            complement(<847493..>848614)
FT                   /note="synonym: Tb07.28B13.840; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658540"
FT                   /locus_tag="Tb927.7.3290"
FT   mRNA            complement(<847493..>848614)
FT                   /db_xref="GI:72391315"
FT                   /db_xref="GeneID:3658540"
FT                   /locus_tag="Tb927.7.3290"
FT                   /transcript_id="XM_840859.1"
FT   CDS_pept        complement(847493..848614)
FT                   /locus_tag="Tb927.7.3290"
FT                   /gene_family="HOG000258254" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391316"
FT                   /db_xref="GeneID:3658540"
FT                   /translation="MLLSVPEAHTEVITSLQFSPHHASVLCSTSGDDTAALWDLRNPSD
FT                   SCNIARLTHHREPVNHALFIEESEPCLLTASDDRTIAYWDVREISQPVAVIRGFGDGIN
FT                   KMLRLPVSRRSGNACVNGGACCLIVSACDDGAVYIHDVALCGDTRRQSGMPVEGAGDTF
FT                   SSTGNLVDRFMASTSTVNDLVLSPNPNLLLTASEDCAIRLWDIGPIFGGQRTQDERLVT
FT                   SFDEFENPVNHIAVINSPRVTQFVQDEGQGGHSGCWLYAACSEFIFAVDLDPVSGALGE
FT                   GARTLTGHQDYVRGLEFVGDDTLLTVSDDSTVIEWSLRTSNPVRQVKLHEGLVMASAVS
FT                   AARDVLATGTDGGEMRVWRLPFLTETCCGGDGC"
FT                   /protein_id="XP_845952.1"
FT   gene            complement(<850271..>852793)
FT                   /note="synonym: Tb07.28B13.820; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658543"
FT                   /locus_tag="Tb927.7.3300"
FT   mRNA            complement(<850271..>852793)
FT                   /db_xref="GI:72391317"
FT                   /db_xref="GeneID:3658543"
FT                   /locus_tag="Tb927.7.3300"
FT                   /transcript_id="XM_840860.1"
FT   CDS_pept        complement(850271..852793)
FT                   /locus_tag="Tb927.7.3300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391318"
FT                   /db_xref="GeneID:3658543"
FT                   /translation="MECVSQSLTSYSLLRCIVSAAQFAGGELSFGAHCAELIAMDVEGE
FT                   TTTPLRIHYDDLIHFRVVREQQLMRIELPRVTVQKWAESNGFALELGAGDDGHAVADGG
FT                   RYEGTCALVQQLSVDDMAHFLQCIAPVVAASRRTRSLSRVSITEVLPLSYCPQNPDGTE
FT                   VVSATESSSRGVDCGSDGEGSCDNSKDEDCNRPNSVLRDGAAASDKDNSHCPSVSLLSA
FT                   PKPGRPSSASASLSQRASCSAETGSTQREPMRHARSDRGLSTTTSALSERKGATVEVNE
FT                   KLLCRLESVDLSSDASGAKFSRASTVQRSQLLACEPSRLGGGGDKEKEETEAIPGAASV
FT                   CGESEAAASDMAILVRKSRSKKGRSSTEGHLFNTEKCVKDDPTALDEDPQTPLKRGKRV
FT                   RGRPAPQTRRGQLVVPLSLQEATVSVPPPAAERPPRGKECPTNNTVPFKGTPASALLEV
FT                   SKSSGNADNNSATEAAAAYNFADVITAPSAADHLPVTSDTHKLLADLHAVLPGRRRPTA
FT                   KRAGTRQQPSRRPTAKGRTKAISTAEATKVATPPPKATALTTQEKHIISPKAPARTASR
FT                   NPSFDPIKSPVPYQATTGSAASEYETPLINPRAFYLSREAHREPSPLAQDVQNTDVSND
FT                   PHDNQPQLPGESLLNGCTDSAYATQKAGRLPSGQYSFCTLSPLSEYHVDASLLPPTDNI
FT                   RTDVGATLGNASPSTACTETDETSGLFRERGKFVSPKGVKGQKRLKTKMKRGGVHMRPP
FT                   TPGTSSVASKLHRHHLYRTKRRGGSASPPLASAAAIVTATTCAHSRKNRWRQVVRQLNN
FT                   LSLCLTKARACGEELRGLFLLMLEDAEI"
FT                   /protein_id="XP_845953.1"
FT   gene            complement(<853860..>854930)
FT                   /note="synonym: Tb07.28B13.810; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658542"
FT                   /locus_tag="Tb927.7.3310"
FT   mRNA            complement(<853860..>854930)
FT                   /db_xref="GI:72391319"
FT                   /db_xref="GeneID:3658542"
FT                   /locus_tag="Tb927.7.3310"
FT                   /transcript_id="XM_840861.1"
FT   CDS_pept        complement(853860..854930)
FT                   /locus_tag="Tb927.7.3310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391320"
FT                   /db_xref="GeneID:3658542"
FT                   /translation="MCICMYACIRVCTYKEGTKKKASAQPAVMFYTGCSYRGERTSDDR
FT                   RFDGQGIFTFANGDTYVGAHRDGCMHGHGTLFFAKERGGGHYVGVWENGRNVSGAFVFS
FT                   DGLVYGSGEQTKIPDPSAGGPLTPEVSETGTILAAQQSGNTGESDKQITNASVSGEGEE
FT                   VEAPPVDTSSNSTLARNWLYCRKGDRRLWAEHLREVMPVLPLQALLGGERAPQSRKWAK
FT                   SLVVAPCVAAEAKTPATFAQGQPRCLSDVPEEFWSDEEQRKSVVSRMELQASPFIGAQG
FT                   GAGREETMIDGERLATNLTLRIIKPLESEAMRRAIEAAALASTAARVKSDTFMSPRSRS
FT                   SSEKSSHCLNIVEDSL"
FT                   /protein_id="XP_845954.1"
FT   gene            complement(<855890..>856294)
FT                   /note="synonym: Tb07.28B13.800; microtubule-associated
FT                   protein 1A/1B, light chain 3, putative"
FT                   /db_xref="GeneID:3658545"
FT                   /locus_tag="Tb927.7.3320"
FT   mRNA            complement(<855890..>856294)
FT                   /db_xref="GI:72391321"
FT                   /db_xref="GeneID:3658545"
FT                   /locus_tag="Tb927.7.3320"
FT                   /transcript_id="XM_840862.1"
FT   CDS_pept        complement(855890..856294)
FT                   /locus_tag="Tb927.7.3320"
FT                   /gene_family="HOG000232034" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="microtubule-associated protein 1A/1B, light chain
FT                   3, putative"
FT                   /note="go_component: microtubule associated complex [goid
FT                   0005875]; go_function: microtubule binding [goid 0008017];
FT                   go_process: protein-vacuolar targeting [goid 0006623]"
FT                   /db_xref="GI:72391322"
FT                   /db_xref="GeneID:3658545"
FT                   /translation="MPSHYRYQYTRSFAERAKETESARLRYPKHIPILCEPTSAASAST
FT                   PRDVRLFSTRQQVQRELDCNKFLLPETATVMEFMMALRQRLLLEEGQAVFVFIGNELPP
FT                   NSACLGDIYARAKDPDGFLYVSYGVENTFG"
FT                   /protein_id="XP_845955.1"
FT   repeat_region   857112..857131
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(858083..858102)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<858888..>871892)
FT                   /note="synonym: Tb07.28B13.760; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658546"
FT                   /locus_tag="Tb927.7.3330"
FT   mRNA            complement(<858888..>871892)
FT                   /db_xref="GI:72391323"
FT                   /db_xref="GeneID:3658546"
FT                   /locus_tag="Tb927.7.3330"
FT                   /transcript_id="XM_840863.1"
FT   CDS_pept        complement(858888..871892)
FT                   /locus_tag="Tb927.7.3330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Region still in closure. Gene sequence is repetitive
FT                   and contains two streches of Ns."
FT                   /db_xref="GI:72391324"
FT                   /db_xref="GeneID:3658546"
FT                   /translation="MATAEGHFDEEWSQTADSLHALDKGASPTHSRVKSLLNSVKDPLC
FT                   VGSLVAYELLGKASKRRWFLGRVLQLDSRSATVRVLLPQNSHDPAVLNTLRIDKERKME
FT                   EMRHRHMSVMALREEMAAVRRNNEAAMGRAKESSDAVRRAIAAVEEVRLHEVFNTRVPS
FT                   VQLRLALEATVALLNEDLVVDSSWSWEDLRAAVRDPTYIQRLLEFDPMTDMSVELYNDI
FT                   NDAYMSDVHLYCNQLSGKTTGGSRSGTDTLLPLLFDWIIAQMGMFHVICEIVNSQRSTD
FT                   ELHANITSHIAHIKELNTQIKRIETKLHCSAEEGSSVDDGACEDESEQYLTFVASADRP
FT                   STNVSRSCILTVLSISDDNGDVVSITDKDVQFIDWCATIHRPLLHVALHHALEGGFSCG
FT                   GLQPKDEAVDSQPRQNSTDIAHEENSDLLQQIEEAQRVNNELQQLLNEQRELAEKTRQE
FT                   GIIKISELKQRHDEDLRQLEHYRKEIEELQRESSGDQIRGYDATDQGVSEHESPLHAST
FT                   RGGSREGYIIEGHKDQHGERVTSTLKKNIDLREWRTHIINNREDINKAVLVDAARACQV
FT                   DISDIDDICFNEYYTSVVFTVSHPPSVSQYDLAQRVRRAEFLSVLQLMQTIGKQGESDP
FT                   HQHSNRGRREGDHQDSPSYSHSLHETLDDGDLFMSTREEIAQIEELRGHIKALEERLRI
FT                   LNDENTLLRRTKENKEEVIQTKTEDAKDDGYLLEKETSEEETTRTNTSVESSEECQTRE
FT                   TYRKETPTEHSKLHEQDESLRDHDKDNICNIRAHRQRQQKTEEPLSEESPEERKAVRIK
FT                   EDKQGQHSPMRPHQQIIGQLIEKEELHCIREAASGDVELQGYVHEMEEQLAELRAENEE
FT                   LHRIREAASGDVELQGYVHEMEEQLAELRAENEELHRIREAASGDVELQGYVHEMEEQL
FT                   AELRAENEELHRIREAASGDVQLQGYVHEMEEQLAELRAENEELRNTDGDKARELDVQN
FT                   EKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTE
FT                   GDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAEL
FT                   RAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEK
FT                   LHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGD
FT                   KARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRA
FT                   ENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLH
FT                   EMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRTENEELRNTEGDKA
FT                   RELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAEN
FT                   EELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEM
FT                   EEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARE
FT                   LDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE
FT                   LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEE
FT                   QLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELD
FT                   VQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQLAELRAENEELR
FT                   NTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQNEKLHEMEEQL
FT                   AELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQ
FT                   NEKLHEMERHLQQLKEENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNT
FT                   DGDKARELDVQNEKLHEMERHLQQLKEENEQLRLTDFDNAKEIESLNELIVNVESKISL
FT                   LQESLKAIRAENDELRKHDSRWMASMEGDCMVSSQCVQLQGERLDELLKNKPEELRCAV
FT                   VVDAANACRVYRDCVSNVTFTPSGRVVEFDVTHPSSIHPSEIAQRLQHYPFRETQRLLL
FT                   KLNEPKDGLDLLKEQIDEGRQQLNTLEQELCELGAKLHDVSSERDDLLRLQEEKTNELA
FT                   AQQARLTAVENQLDALVEENCDLKRTLECKSNDLVVQEGLLGDLDGKLQEFLVQNEQLR
FT                   GSDEAKARELDVQNEKLNEMEEQLAELRTENGGLRDSEAEKARELDLRSRHLEEMEEKV
FT                   KKMQEEVDALRECVREKVIELDAQNELCSAKDQHIKKLSKESEELHRAEEEKARELDLL
FT                   KKHVCEVERHLQQLKEENEQLRLAESDNAKEIESLNELIANVESKISLLQESLKAIRAE
FT                   NDELRKHDSRWMASMEGDCMVSSQCVQLQGERLDELLKNKPEELRCAVVVDAANACRVY
FT                   RDCVSNVTFTPSGRVVEFDVTHPSSIHPSEIAQRLQHYPFRETQRLLLKLNEPKDGLDL
FT                   LKEQIDEGRQQLNTLEQELCELGAKLHDVSSERDDLLRLQEEKTNELAAQQARLTAVEN
FT                   QLNTLARENEELCKNNEIISVDAKKQSEYIQDVHRQMRTLSESHSNLQQICNSKTNQIE
FT                   ELNSQLRQLQQDANELQKENEQLREHEVEKSLDLCVQSGRVQELVEQLREVRTENTGIR
FT                   EEQHAKLRELEVRNQQLLYLQKELEQKINGLRTENEELRNTEGDKARELDVQNEKLHEM
FT                   EEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARE
FT                   LDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEE
FT                   LRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEE
FT                   QLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELD
FT                   VQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELR
FT                   NTEGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQL
FT                   AELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTEGDKARELDVQ
FT                   NEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNT
FT                   DGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAE
FT                   LRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNE
FT                   KLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELRAENEELRNTDG
FT                   DKARELDVQNEKLHEMEEQLAELRAENEELRNTDGDKARELDVQNEKLHEMEEQLAELR
FT                   AENEELRNTEGDKARELDVQNEKLHEMEEQLAELRTENEELRRSNELFSLRNDDRDVSR
FT                   DAKDGAMKIDSDGEYLLKEKSADVDVSGDGDGIGVIKNELILVKRENIDLRSVDDENSK
FT                   EIECLLSDVKELRLKLSEISSENDELRKELDIKSHELVVQGELLQELGDRLKEFLTQNE
FT                   QLRGTDELRVDELDKQQRRLRDMEEQVMELQAVNERKTNELVSQSDGLRKAVDALKKLR
FT                   SGVDVVDASSHNDRPSVLMSNALDDLEEALNEPSRGGEEERKHDSRWMASMEGDCMVSS
FT                   QCVQLQGERLDELLKNKPEELRCAVVVDAANACRVYRDCVSNVTFTPSGRVVEFDVTHP
FT                   SSIHPSEIAQRLQHYPFRETQRLLLGSSIGTNDAGGGNLTMSSFLRRACGVMVDEQGVF
FT                   VDEVLSRLVIERSSLSSLQCLLVVGFLNRDRIRAKREGDLLDELEERATEHTEMLENME
FT                   EMVVLLDEARQAECTVRSELFAREEELLELRCTQDRDKKFRDEMLLSLFNMLEKARSSH
FT                   VEVARGKVEELMSGVYLVGELEQEVKKLSEENAALREELEQREITHKEDLDALNRKIAA
FT                   LLLELDEKGFEYTDTIGKLDEFVNVLEGARAAEKAALMALEAREQELFDLQDAKDDEMR
FT                   EVEAVMQQLEARIEELQGGMPVPLPWTSSEHLGETGNSTTSAVTVPSASNLAVGGTDII
FT                   SSMRHQLERLKREKEALMVELQSKGRQHDDVVDELNRNIGGLMTDLDSRIRGCQVSATS
FT                   AKELLREISLLRSVEEGEDDEDEGDATGCPTTHLGGPWAHH"
FT                   /protein_id="XP_845956.1"
FT   gene            complement(<873066..>874598)
FT                   /note="synonym: Tb07.28B13.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658547"
FT                   /locus_tag="Tb927.7.3340"
FT   mRNA            complement(<873066..>874598)
FT                   /db_xref="GI:72391325"
FT                   /db_xref="GeneID:3658547"
FT                   /locus_tag="Tb927.7.3340"
FT                   /transcript_id="XM_840864.1"
FT   CDS_pept        complement(873066..874598)
FT                   /locus_tag="Tb927.7.3340"
FT                   /gene_family="HOG000260659" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391326"
FT                   /db_xref="GeneID:3658547"
FT                   /translation="MTTASGAVVGPHAAAMSSTPVLPSVGSGMPYILSSCNEAVSESRL
FT                   HELAAEEEERRVTRQKKLFEDLLVFEGGAVADHESLGTELIMRDFIHFALYHKKWGYYP
FT                   KLYRKYRQLMTTGYFDPIPFGSLRNQQDYERYVGKIHDSTPSCVTPTQLFQPHYGWVIA
FT                   EYLVTMMRAKFDPRDPLVVYDIGAGSGALAVSVLDYLSEHFPSVYEQCEYHVVEINPQL
FT                   VQVLRNRLIMHYHHVKIHNISILNWREVERRRCVVFGVELLSGMPHDCVVLSADGVCNE
FT                   QWFHFQQHDNLSTAHERYFSVKDPVILRYLRYARWMQEESFHSLKVLCLTGGRDNIDPP
FT                   PFTSIEPNMYDPLRVVITKMMWMHSPFRTLWLPTVSMLFLETCATYFPRHHLFLVDWGS
FT                   VRQGLPGVNGPVLQSKTRIAKDIYLRRPADSLHGNAGMIDICFPTDFDLLKAVYRNICG
FT                   AYKEVSSMSHPQFWKTFGGDKTSIFTTRSGFNPLLEDFDPLHVFVTHHPSEM"
FT                   /protein_id="XP_845957.1"
FT   gene            complement(<875281..>876354)
FT                   /note="synonym: Tb07.28B13.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658544"
FT                   /locus_tag="Tb927.7.3350"
FT   mRNA            complement(<875281..>876354)
FT                   /db_xref="GI:72391327"
FT                   /db_xref="GeneID:3658544"
FT                   /locus_tag="Tb927.7.3350"
FT                   /transcript_id="XM_840865.1"
FT   CDS_pept        complement(875281..876354)
FT                   /locus_tag="Tb927.7.3350"
FT                   /gene_family="HOG000260658" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: metal ion binding [goid 0046872]"
FT                   /db_xref="GI:72391328"
FT                   /db_xref="GeneID:3658544"
FT                   /translation="MCSCCCEPPVGQWIDIYGGPVRPRRSGFECPLDALQVIAWSVIVT
FT                   LATLHFTLHVPMLDSLLVCIISPISGFLTFTTAALKLALSCSRIEDPIVFATDVPRYAQ
FT                   EELVQEAAPPGTEPCVFCRRFVILGSKHCSVCDKCVPGFDHHCRWLNTCVGEGNYVMFC
FT                   CFMGTAWCSIALVFGVGIYVISNAFIHKQDFSDRLKERFGVSSYVTYMVFLFLTLALSA
FT                   AGLAALGNLIVFHINLCLTRRTTYEHVLSKRAKRREKLSKQSKPLVATDRSKGPCGCLA
FT                   IQKRRDFRRYKKNPAGSSGAVPDIGVHNLGDNATDGAYPSRDTSQPGETCEIRETTSDH
FT                   KGGVRLERETHDNEPIA"
FT                   /protein_id="XP_845958.1"
FT   repeat_region   877007..877032
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(877007..877032)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<878019..>879122)
FT                   /note="synonym: Tb07.28B13.710; farnesyl pyrophosphate
FT                   synthase"
FT                   /db_xref="GeneID:3658548"
FT                   /locus_tag="Tb927.7.3360"
FT   mRNA            complement(<878019..>879122)
FT                   /db_xref="GI:72391329"
FT                   /db_xref="GeneID:3658548"
FT                   /locus_tag="Tb927.7.3360"
FT                   /transcript_id="XM_840866.1"
FT   CDS_pept        complement(878019..879122)
FT                   /locus_tag="Tb927.7.3360"
FT                   /gene_family="HOG000160912" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="farnesyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="similar to GB:AAO17735.1: farnesyl pyrophosphate
FT                   synthase {Trypanosoma brucei} (PMID:12618430); 99% similar
FT                   to GB:AAO17735.1: farnesyl pyrophosphate synthase
FT                   {Trypanosoma brucei} (PMID:12618430); go_function:
FT                   geranyltranstransferase activity [goid 0004337];
FT                   go_process: isoprenoid biosynthesis [goid 0008299];
FT                   go_process: farnesyl diphosphate biosynthesis [goid
FT                   0045337]"
FT                   /db_xref="GI:72391330"
FT                   /db_xref="GeneID:3658548"
FT                   /translation="MVMQMFMQVYDEIQMFLLEELKLKFDMDPNRVRYLRKMMDTTCLG
FT                   GKYNRGLTVIDVAESLLSLSPNNNGEKDDGARRKRVLHDACVCGWMIEFLQAHYLVEDD
FT                   IMDNSVTRRGKPCWYRHPGVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNR
FT                   VDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPL
FT                   VMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSW
FT                   LAVTFLAKASSAQIAEFKANYGSGDSEKVATVRRLYEEADLQEDYVAYEAAVAEQVKEL
FT                   IEKLRLCSPGFAASVETLWGKTYKRQK"
FT                   /protein_id="XP_845959.1"
FT   gene            complement(<879960..>881750)
FT                   /note="synonym: Tb07.28B13.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658551"
FT                   /locus_tag="Tb927.7.3370"
FT   mRNA            complement(<879960..>881750)
FT                   /db_xref="GI:72391331"
FT                   /db_xref="GeneID:3658551"
FT                   /locus_tag="Tb927.7.3370"
FT                   /transcript_id="XM_840867.1"
FT   CDS_pept        complement(879960..881750)
FT                   /locus_tag="Tb927.7.3370"
FT                   /gene_family="HOG000260657" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391332"
FT                   /db_xref="GeneID:3658551"
FT                   /translation="MQGGFGRTNFNQTSGLRPGSQMRPGSQMRPGSQMRGARVAGMGES
FT                   LQQAVSVSAQAPVTLEGMRAATRSGNAGPGRQVGDRSYYIGLLRPKITELTTEIERLNE
FT                   QEELIVKGGSVLTQLQQRNKALTDEAAKLKGTLADINLALEKSTTQDPSSVKDQATKLN
FT                   QVNGEKRKQVDQLFLNAKEMEALTKKNTQTLEEEMQNLDRRILAENQDFGLYKATRDEA
FT                   FNVSDAVLSHQHQIRMLTAKQELLMTKLSTDPDKKRAAEVLRGILSKRQLKEELTKQCA
FT                   LSVEEERQLLIKQVKTARGDIEVLERQVNETRDALSESKNRCASLDEELKSYSGDNIKA
FT                   FQELQEKDRELQSFMDSFPAKLKEEMDKITEVQRNIATLLERISQALELKKQMPQEGSP
FT                   NALQALESEVDAKRNQIEHDTMTHQRLERELMDRKVELEKVENLDTKIKAELQAHALKM
FT                   EEQSQEMIKYGDMDGLRRNVDARRTELLNERTFLIKLRDSSKQQLNVLSGTVDTLRKQL
FT                   NEDTSYRSMSTLEGRLRQLRQSSFTLEEFVRLKGRESYFVGLKTECLRLVDEINILLKE
FT                   TEQARGTSVGGGAVLMVGDR"
FT                   /protein_id="XP_845960.1"
FT   gene            complement(<882631..>883461)
FT                   /note="synonym: Tb07.28B13.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658549"
FT                   /locus_tag="Tb927.7.3380"
FT   mRNA            complement(<882631..>883461)
FT                   /db_xref="GI:72391333"
FT                   /db_xref="GeneID:3658549"
FT                   /locus_tag="Tb927.7.3380"
FT                   /transcript_id="XM_840868.1"
FT   CDS_pept        complement(882631..883461)
FT                   /locus_tag="Tb927.7.3380"
FT                   /gene_family="HOG000201538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391334"
FT                   /db_xref="GeneID:3658549"
FT                   /translation="MNHDDAMWNVMGQTFCSFKVKTHDDKARFCRNPYNVTGLCQRGVC
FT                   PLSNAQYATVVEHDDELYLYVKTAERAHLPRRQWEKVRLDANFPRALAQIDEELQWWDQ
FT                   KLVNKVKARLLRLKQYLMRRRKMLLEPKVEYVSVNKRQEDKLIRREAKAEAAARLELEV
FT                   EKELLERLRSGTYDSVINCSLEAFERVLDREEDRTEFEALEDEEDEEFPEFVMDDELDE
FT                   EEEMEESNRKIGKRGDSSVVHRSGRGTRRQRLVIEEEVEQEPVSKRVRTADLDW"
FT                   /protein_id="XP_845961.1"
FT   gene            complement(<883775..>884821)
FT                   /note="synonym: Tb07.28B13.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658557"
FT                   /locus_tag="Tb927.7.3390"
FT   mRNA            complement(<883775..>884821)
FT                   /db_xref="GI:72391335"
FT                   /db_xref="GeneID:3658557"
FT                   /locus_tag="Tb927.7.3390"
FT                   /transcript_id="XM_840869.1"
FT   CDS_pept        complement(883775..884821)
FT                   /locus_tag="Tb927.7.3390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391336"
FT                   /db_xref="GeneID:3658557"
FT                   /translation="MASLGEFCVSVVDSVDSFQSIFTSSSFDHLLLCYEADVDAVTAAD
FT                   LIAFERVVKAAATEFGTRLGLHLWNCSDDAFGAARTQLGKEKGTPLLLIVYRGEIADML
FT                   HQPLANLVSEVALVCQRLASYQRGDSIAVVSSLPLSPQQPVQDDAVDTASVVGQRMTVD
FT                   IARLIEMGKRLMTTGRAEYAEKIFGRALGTLDAMSSNCGSDTRLRGSTAMCLAWVSLAI
FT                   LVQGRCADDHLQRLRGDYEEFCVEFESDAARVCATQRMMHSLTIKWKGDVCSEKRLRSI
FT                   LADDPHKHDHRCALVVTLFLSGDLERCLTEALKLHAFGVPFGAVALSSVRDYVGPEHPL
FT                   FQLTDVPS"
FT                   /protein_id="XP_845962.1"
FT   gene            complement(<885081..>886394)
FT                   /note="synonym: Tb07.28B13.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658550"
FT                   /locus_tag="Tb927.7.3400"
FT   mRNA            complement(<885081..>886394)
FT                   /db_xref="GI:72391337"
FT                   /db_xref="GeneID:3658550"
FT                   /locus_tag="Tb927.7.3400"
FT                   /transcript_id="XM_840870.1"
FT   CDS_pept        complement(885081..886394)
FT                   /locus_tag="Tb927.7.3400"
FT                   /gene_family="HOG000136160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391338"
FT                   /db_xref="GeneID:3658550"
FT                   /translation="MALGSGIGLVPMWSSCPSVNPPTFPKGGIEILRQSLEAQEEVERT
FT                   FREREAGHIECLNFKKSLRHLLRKQNERREELQLVEQRASERTQALLDELLIVVRERLK
FT                   AMSPEGYQSITFDNGDMYEGNWKSCRMHGTGVMRRVADNDIYEGEWFFGVRNGNGMCCS
FT                   PNFGTLYSGKWLAGKWHGRGELAEPEGLYIGDFVDGQIRGYGEYLYREGYAYKGDWVNG
FT                   VYEGSGTFFYTNGARYEGQWRNGYEHGRGTMTYYNGDVYTGDWCNGRKHGTGTYTSKLL
FT                   QYEGGWSSGAVHGIGKCTYADGSMYKGSWCRGLYDGDGEFVSQDKKCSYKGEFRGGKRC
FT                   GRGVYQCGEVEYSGDWLDDRRHGVGEIKTRDGRVFRGTWSHDEPHCEVVPGCNLEGTSL
FT                   SYCGGRGAPIAPEEPDPVLNMRLGLPDEVIDCMADAPT"
FT                   /protein_id="XP_845963.1"
FT   gene            complement(<886750..>887199)
FT                   /note="synonym: Tb07.28B13.660; centrin, putative"
FT                   /db_xref="GeneID:3658552"
FT                   /locus_tag="Tb927.7.3410"
FT   mRNA            complement(<886750..>887199)
FT                   /db_xref="GI:72391339"
FT                   /db_xref="GeneID:3658552"
FT                   /locus_tag="Tb927.7.3410"
FT                   /transcript_id="XM_840871.1"
FT   CDS_pept        complement(886750..887199)
FT                   /locus_tag="Tb927.7.3410"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centrin, putative"
FT                   /note="similar to GB:AAL01153.1: centrin {Leishmania
FT                   donovani}(PMID:11544261); 97% similar to GB:AAL01153.1:
FT                   centrin {Leishmania donovani}(PMID:11544261); go_component:
FT                   basal body [goid 0005932]; go_function: calcium ion binding
FT                   [goid 0005509]"
FT                   /db_xref="GI:72391340"
FT                   /db_xref="GeneID:3658552"
FT                   /translation="MAALTDEQIREAFNLFDADGSGAIDAEEMALAMKGLGFGDLPRDE
FT                   VERTVRSMNTNANGLIEYGEFERMVKSRMAQKDSPEEVLKAFQLFDLDKKGKISFANLK
FT                   EVAKLLGENPGDDVLQEMIAEADEDGDGEVSFEEFKSVMMQMRGK"
FT                   /protein_id="XP_845964.1"
FT   gene            complement(<888761..>889099)
FT                   /note="synonym: Tb07.28B13.650; peptidyl-prolyl cis-trans
FT                   isomerase, putative"
FT                   /db_xref="GeneID:3658555"
FT                   /locus_tag="Tb927.7.3420"
FT   mRNA            complement(<888761..>889099)
FT                   /db_xref="GI:72391341"
FT                   /db_xref="GeneID:3658555"
FT                   /locus_tag="Tb927.7.3420"
FT                   /transcript_id="XM_840872.1"
FT   CDS_pept        complement(888761..889099)
FT                   /locus_tag="Tb927.7.3420"
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidyl-prolyl cis-trans isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="similar to FK506-binding protein 1 (FKBP)
FT                   (Peptidyl-prolyl cis-trans isomerase)(PPIase) (EC 5.2.1.8)
FT                   (Rapamycin-binding protein). (Swiss-Prot:P20081)
FT                   [Saccharomyces cerevisiae]; go_function: peptidyl-prolyl
FT                   cis-trans isomerase activity [goid 0003755]; go_function:
FT                   FK506 binding [goid 0005528]; go_process: protein folding
FT                   [goid 0006457]"
FT                   /db_xref="GI:72391342"
FT                   /db_xref="GeneID:3658555"
FT                   /translation="MSRNDCVMMDKIIEGDGKTIPRQGSIVTLDYVGYLPDGRKFDSTI
FT                   ERGKPFVFRVGCGEVIKGWDEGIVQMSKGERSRLTMPPSLAFGSTGFPGIIPPNTVIVF
FT                   EVTLLDVV"
FT                   /protein_id="XP_845965.1"
FT   misc_feature    890247..890275
FT                   /note="AT_rich"
FT   misc_feature    complement(890247..890275)
FT                   /note="AT_rich"
FT   gene            complement(<890292..>890987)
FT                   /note="synonym: Tb07.28B13.640; cyclophilin-type
FT                   peptidyl-prolyl cis-trans isomerase, putative"
FT                   /db_xref="GeneID:3658556"
FT                   /locus_tag="Tb927.7.3430"
FT   mRNA            complement(<890292..>890987)
FT                   /db_xref="GI:72391343"
FT                   /db_xref="GeneID:3658556"
FT                   /locus_tag="Tb927.7.3430"
FT                   /transcript_id="XM_840873.1"
FT   CDS_pept        complement(890292..890987)
FT                   /locus_tag="Tb927.7.3430"
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclophilin-type peptidyl-prolyl cis-trans
FT                   isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="similar to GB:AAF89277.1: cyclophilin {Trypanosoma
FT                   cruzi}  (PMID:1141034); 88% similar to GB:AAF89277.1:
FT                   cyclophilin {Trypanosoma cruzi}  (PMID:1141034);
FT                   go_function: peptidyl-prolyl cis-trans isomerase activity
FT                   [goid 0003755]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72391344"
FT                   /db_xref="GeneID:3658556"
FT                   /translation="MLHRTRLAQLINGRILQYFVPYERDEVNPVVFMDVTVEGDALGRV
FT                   SVELFHDIVPKTTENFRSLCTGERGYSQCPLFYKGIPFHRVIPGFIVQGGDILLKDGRG
FT                   NVSVFGFPFPDESFEGKAGKHLRGTVAMAHSAPNQNGSQFFFNLARNDHLDGKFVVCGQ
FT                   VIDGWEVVDRVAVLSGSSCGTPVSRAWITECGQSSGDKLEDTERALSGERALHTMPGKE
FT                   VLDILSPRY"
FT                   /protein_id="XP_845966.1"
FT   gene            complement(<891472..>892212)
FT                   /note="synonym: Tb07.28B13.630; I/6 autoantigen"
FT                   /db_xref="GeneID:3658558"
FT                   /locus_tag="Tb927.7.3440"
FT   mRNA            complement(<891472..>892212)
FT                   /db_xref="GI:72391345"
FT                   /db_xref="GeneID:3658558"
FT                   /locus_tag="Tb927.7.3440"
FT                   /transcript_id="XM_840874.1"
FT   CDS_pept        complement(891472..892212)
FT                   /locus_tag="Tb927.7.3440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="I/6 autoantigen"
FT                   /note="similar to SP:Q26768: I/6 autoantigen. {Trypanosoma
FT                   brucei brucei} (PMID=9127738); 98% similar to SP:Q26768:
FT                   I/6 autoantigen. {Trypanosoma brucei brucei}
FT                   (PMID=9127738); go_component: microtubule cytoskeleton
FT                   [goid 0015630]; go_function: structural constituent of
FT                   cytoskeleton [goid 0005200]; go_function: calcium ion
FT                   binding [goid 0005509]"
FT                   /db_xref="GI:72391346"
FT                   /db_xref="GeneID:3658558"
FT                   /translation="MLCPPDVAFEKRHFKRRDGNKVVPPSIALVAGLESGFLFKLSAVE
FT                   DVARRGQFPGLLTEDEFLLMCEESEHIRDAYAMAKHLVALAPDGIFTRATLQETAGKVG
FT                   STQDTLSVEEVDALFNALDSDNRGYVSVDEFMDALYGEEGREAMREIRREYMRRKIEVE
FT                   GEPIVEDEANPEADAEAEAEAEARARAEAEAEARAEAEARARAEAEARARAEAEARARA
FT                   EAEARARAEAQRPPPPKQKAGCGC"
FT                   /protein_id="XP_845967.1"
FT   gene            complement(<892522..>893109)
FT                   /note="synonym: Tb07.28B13.620; I/6 autoantigen"
FT                   /db_xref="GeneID:3658562"
FT                   /locus_tag="Tb927.7.3450"
FT   mRNA            complement(<892522..>893109)
FT                   /db_xref="GI:72391347"
FT                   /db_xref="GeneID:3658562"
FT                   /locus_tag="Tb927.7.3450"
FT                   /transcript_id="XM_840875.1"
FT   CDS_pept        complement(892522..893109)
FT                   /locus_tag="Tb927.7.3450"
FT                   /gene_family="HOG000257368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="I/6 autoantigen"
FT                   /note="similar to SP:Q26768: I/6 autoantigen. {Trypanosoma
FT                   brucei brucei} (PMID=9127738); 90% similar to SP:Q26768:
FT                   I/6 autoantigen. {Trypanosoma brucei brucei}
FT                   (PMID=9127738); go_component: microtubule cytoskeleton
FT                   [goid 0015630]; go_function: structural constituent of
FT                   cytoskeleton [goid 0005200]; go_function: calcium ion
FT                   binding [goid 0005509]"
FT                   /db_xref="GI:72391348"
FT                   /db_xref="GeneID:3658562"
FT                   /translation="MLCPPDVAFEKRCFKRSGNKVTPPSIALGTGLESGFLFKLSAVED
FT                   VARRGQFPGLLTKDEFLLMCEESEHIRDAYAMAKHLVALAPDGIFTRATLQETAGKVGS
FT                   TQDTLSVEEVDALFNALDLGNRGYVSVDEFMDALYGEEGREAMREIRREYMRRKIEAET
FT                   EPVVEDEANPEADAEVDAEADEEAEADEEAEL"
FT                   /protein_id="XP_845968.1"
FT   gene            complement(<893320..>894669)
FT                   /note="synonym: Tb07.28B13.610; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658561"
FT                   /locus_tag="Tb927.7.3460"
FT   mRNA            complement(<893320..>894669)
FT                   /db_xref="GI:72391349"
FT                   /db_xref="GeneID:3658561"
FT                   /locus_tag="Tb927.7.3460"
FT                   /transcript_id="XM_840876.1"
FT   CDS_pept        complement(893320..894669)
FT                   /locus_tag="Tb927.7.3460"
FT                   /gene_family="HOG000257369" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391350"
FT                   /db_xref="GeneID:3658561"
FT                   /translation="MLFRSVSCKNYQRGGWSPGSKHQKHMTLNPTLYLYRFPGPHGPGP
FT                   YTMKYWWTLGCFPTGMEVPFRLHEFLSTYQQEHVPVEVEEWLRCYIKDPLSELVNASND
FT                   FFKAVEVYPEVESARGYKTLQPSIAPLLVPMKKFEEQLGVKISPVGLRSVLSNPVLKDR
FT                   FLDDLFDYKSYVEKGGSTPHRRLARSRFEGSLSVLGECEKCLPEQHQVEISESLGTFIG
FT                   ATVSPAETTADDERSLILLLTTISEGCINAGNYSDAASVLADALMFCHDPDSQATTHAN
FT                   ISFASLLNADFKGAEYNGREAALLQPQVKPTSTACARGYVGWAAAAAYQDDFEKAEAIV
FT                   KDGLTLYVGNEHLEKLANKLQALREEQPSVYKQVPRSLRESRSHLPSQQSRGLLSGSGK
FT                   GFSNEFDWVEFKNKLYPSKMDPRNNEMGSVFRRVGDLGSFISTSRSMERL"
FT                   /protein_id="XP_845969.1"
FT   gene            complement(<894923..>895705)
FT                   /note="synonym: Tb07.28B13.600; p22 protein precursor,
FT                   putative"
FT                   /db_xref="GeneID:3658563"
FT                   /locus_tag="Tb927.7.3470"
FT   mRNA            complement(<894923..>895705)
FT                   /db_xref="GI:72391351"
FT                   /db_xref="GeneID:3658563"
FT                   /locus_tag="Tb927.7.3470"
FT                   /transcript_id="XM_840877.1"
FT   CDS_pept        complement(894923..895705)
FT                   /locus_tag="Tb927.7.3470"
FT                   /gene_family="HOG000257370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="p22 protein precursor, putative"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: transcription regulator activity [goid
FT                   0030528]; go_process: RNA editing [goid 0016547]"
FT                   /db_xref="GI:72391352"
FT                   /db_xref="GeneID:3658563"
FT                   /translation="MRRVVASRKAICEYRLYSQVSPQGYPVTAVTPQQIRRVPFYRHRK
FT                   LYDLTTRELSEEAIRDFLPPKPAVPAGWSMEHKIGSCRFDLTKTMGADDSAREDLHVVA
FT                   LMEPKKYEQTYRMDNGERNGEEYLVFNLFIKKHQHSGGVEFGLTSIDMELVMDSLVVHS
FT                   TDREMDYSIGALGPGKTTSVGTSFGQKLNIECRRCRDYRYRGPMLNELDDDLTDEILDY
FT                   LDERGVNNGFAEYMMAQAHFLEQEEYLNWLRLLKQFAT"
FT                   /protein_id="XP_845970.1"
FT   gene            complement(<899464..>900114)
FT                   /note="synonym: Tb07.28B13.580; hypothetical protein"
FT                   /db_xref="GeneID:3658554"
FT                   /locus_tag="Tb927.7.3480"
FT   mRNA            complement(<899464..>900114)
FT                   /db_xref="GI:72391353"
FT                   /db_xref="GeneID:3658554"
FT                   /locus_tag="Tb927.7.3480"
FT                   /transcript_id="XM_840878.1"
FT   CDS_pept        complement(899464..900114)
FT                   /locus_tag="Tb927.7.3480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72391354"
FT                   /db_xref="GeneID:3658554"
FT                   /translation="MLTDTLTIPPSTLLVKPPGLVAPIFEIFFSLAGLILRNGTDDRFF
FT                   FLQSPRCKFTGMIAGHARHVRYHATQSVTGRHTLIRCTRTYVHECLHGRAGAESAMIAF
FT                   PGHYRSIQIYLHFLLPHFFAGIPTMSRYPSSKRLRCKRARVGAHFDILFLQFEVEVPDF
FT                   ARRCLSLQWPPSIFFAVIFSPPLSYALTFSSLIRLCYRKFGGQLLIYILFIFF"
FT                   /protein_id="XP_845971.1"
FT   gene            complement(<902880..>905342)
FT                   /note="synonym: Tb07.28B13.570; synaptojanin (N-terminal
FT                   domain), putative"
FT                   /db_xref="GeneID:3658553"
FT                   /locus_tag="Tb927.7.3490"
FT   mRNA            complement(<902880..>905342)
FT                   /db_xref="GI:72391355"
FT                   /db_xref="GeneID:3658553"
FT                   /locus_tag="Tb927.7.3490"
FT                   /transcript_id="XM_840879.1"
FT   CDS_pept        complement(902880..905342)
FT                   /locus_tag="Tb927.7.3490"
FT                   /gene_family="HOG000256263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="synaptojanin (N-terminal domain), putative"
FT                   /note="go_function: inositol or phosphatidylinositol
FT                   phosphatase activity [goid 0004437]; go_process:
FT                   endocytosis [goid 0006897]"
FT                   /db_xref="GI:72391356"
FT                   /db_xref="GeneID:3658553"
FT                   /translation="MYVEKSPRKRCAVAVKDGTSILFVVLARPLPPPPPKEPELLMFFE
FT                   KPSSPVAKQPETATGNEVEWQKWSAGSYCVPLVVDERGEIQRYDKLCHREFPNLRDAYR
FT                   QCGPFESFVEFAALFGCLRLDRMYFLVATKVEEAAVLPFGGAILRVGGTEWISFGIPGS
FT                   EPLYLTSGDRNRLKEFETYSHEGGYYYSDDCDLRRPFPFVSSKDGNGPQFHSDWSRQLR
FT                   KPFITAGVESCCSVLLRGFAAEKEVLLKDGSILHVLLCGRQNNLNPGPRYFGRGLNAVN
FT                   AVGNDHVYEYVMWRQGGGNGPIQFAKHTILRGTVPVHWSTRISKTISEPAMMFSQNKEE
FT                   VLRGCDSYFSFVFTQLVAIMRYDSGEQLTGRGPRLRCVNMLRQSHHSSEEALTKHFTEA
FT                   VTKSQAALQQAFPGSQLDLVHVDWLNMLKEQGIDRTTTTFWTTLLATFSTDELVTAGTI
FT                   GVDGGVTRNSCQTSFVRVNCADSLDRTNIGCFYTCFQSTLNMLAYLRLEPDSFVDQNRL
FT                   PPLEEQEGERPLETTLAMLQLSGSPRRDSVATWQEACNPSLYPAAIGRALSELYVYNGD
FT                   TIARLYTNSAAMHSNILRGICGLKAAASNMVIATQRRYENAFEDKSKFRNIELLLGRNI
FT                   DIHFPSMSQAFLKRPVPVENWGCALIAKGIPVGVPCSEIEQAVRKAWDSLVVPRLREDG
FT                   IPVTSSDALTFIISAEDNEGEYHDEFICAVKQLTFEQDTSGEEDTNAEQNSEHLAVIEF
FT                   DKDFCRALDAPFLLQENAILKFQTTGVALEPYTYPVLSENGNSRGIVRKAAKSLRSGVK
FT                   NFVRGLYK"
FT                   /protein_id="XP_845972.1"
FT   gene            complement(<905992..>906930)
FT                   /note="synonym: Tb07.28B13.560;
FT                   glutathione-S-transferase/glutaredoxin, putative"
FT                   /db_xref="GeneID:3658566"
FT                   /locus_tag="Tb927.7.3500"
FT   mRNA            complement(<905992..>906930)
FT                   /db_xref="GI:72391357"
FT                   /db_xref="GeneID:3658566"
FT                   /locus_tag="Tb927.7.3500"
FT                   /transcript_id="XM_840880.1"
FT   CDS_pept        complement(905992..906930)
FT                   /locus_tag="Tb927.7.3500"
FT                   /gene_family="HOG000256262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione-S-transferase/glutaredoxin, putative"
FT                   /note="85% similar to GB:AAF40169.2: putative
FT                   glutathione-s-transferase/glutaredoxin {Trypanosoma cruzi};
FT                   go_component: mitochondrion [goid 0005739]; go_function:
FT                   electron transporter activity [goid 0005489]; go_process:
FT                   electron transport [goid 0006118]"
FT                   /db_xref="GI:72391358"
FT                   /db_xref="GeneID:3658566"
FT                   /translation="MFTKGSMSRKLLCATGALAGLGFAGGYVTYQRRLEENRSCTAEDF
FT                   NAAQDQTELQFALSHITDPKKCPPILLYRYSTCPFCATTKSFLDYNKIRYECVEVEPMF
FT                   KKEISMSAYKKVPQLKFCVRGDDGPFLVDSEVIVSTVAKHVGMGKQLEDPEVKKWREWA
FT                   RGPMVRLLTLEFNSSLLNSWGSYSYIDNIETIPYKNKIFLKLVGAPVMYLVAQYVTKPR
FT                   LLKSGDLLPTDDPKVKLHNEIDRFVKEGLLDGKKKFHGGSKPDLADLDTHGVLQSVRGH
FT                   RLYNEIIEATTIKPWLERMDEAVGNEKYIPK"
FT                   /protein_id="XP_845973.1"
FT   gene            complement(<907346..>908794)
FT                   /note="synonym: Tb07.28B13.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658559"
FT                   /locus_tag="Tb927.7.3510"
FT   mRNA            complement(<907346..>908794)
FT                   /db_xref="GI:72391359"
FT                   /db_xref="GeneID:3658559"
FT                   /locus_tag="Tb927.7.3510"
FT                   /transcript_id="XM_840881.1"
FT   CDS_pept        complement(907346..908794)
FT                   /locus_tag="Tb927.7.3510"
FT                   /gene_family="HOG000256261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391360"
FT                   /db_xref="GeneID:3658559"
FT                   /translation="MWHSSLRYVSFKRLPFGRRSTSGGVNFNKGLLTDRERGDPFTEPH
FT                   AYRNKKSIAAISKVAKKQDILLREEKQRKELDKIQSGYVTERELHIGCDKPLGGNANEI
FT                   ARVIDEQALISPTPGEKCSTALRELMENEVDRRNHMMDKFGQPVGAREFHRLFKELRHA
FT                   DNEAETIERHQTRLVEEYGVYPSLRLDAYMLDDDTYFPEWVNALPYSIRDRVKFGSLGL
FT                   TEKDEALRVTLGRMPLDRRRREWERLKKAKEYKAAKEETLTLAELRDARQGKRRFHWLQ
FT                   RKRQKRASILRRLALRKPDAFELWPSRVVDYSQRIAFIAQHVENGLDTKGQWPLDPEEL
FT                   ARARVRRSKEEAERTFLMSAEEKRAHKKLSGRSGDGSIAEMLQSLEVPDKPFKRLSRKV
FT                   YANRVNAIVHGDQDEYGRRYRKMETRSKRRMRPYASLGEIGLENELRKEPRINAKGLNN
FT                   TDDEDWPRHTKSWGDGMPSMRYGS"
FT                   /protein_id="XP_845974.1"
FT   gene            complement(<909322..>909726)
FT                   /note="synonym: Tb07.28B13.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658564"
FT                   /locus_tag="Tb927.7.3520"
FT   mRNA            complement(<909322..>909726)
FT                   /db_xref="GI:72391361"
FT                   /db_xref="GeneID:3658564"
FT                   /locus_tag="Tb927.7.3520"
FT                   /transcript_id="XM_840882.1"
FT   CDS_pept        complement(909322..909726)
FT                   /locus_tag="Tb927.7.3520"
FT                   /gene_family="HOG000256260" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391362"
FT                   /db_xref="GeneID:3658564"
FT                   /translation="MSATTKQAIPKLFPKPLHKYVGNGRVFQCLKSYEKYGVVAYLNSV
FT                   YNLAPSFKWMLSIVPLYGIFVGNPPVEKIDVNSSAALCTTGLLWFVYALLIQPQNSGSR
FT                   SLAAVNVCLAAVHGYNIYRAMSYKRSKALH"
FT                   /protein_id="XP_845975.1"
FT   repeat_region   910002..910066
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(910002..910066)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<910069..>912144)
FT                   /note="synonym: Tb07.28B13.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658568"
FT                   /locus_tag="Tb927.7.3530"
FT   mRNA            complement(<910069..>912144)
FT                   /db_xref="GI:72391363"
FT                   /db_xref="GeneID:3658568"
FT                   /locus_tag="Tb927.7.3530"
FT                   /transcript_id="XM_840883.1"
FT   CDS_pept        complement(910069..912144)
FT                   /locus_tag="Tb927.7.3530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391364"
FT                   /db_xref="GeneID:3658568"
FT                   /translation="MGESFVPARSFKLLVDAKVELRQKGAKEVSQKVSTVFRSSSITEA
FT                   YEITTKELHEIERSLLRTTSPTYRRGGMIAIRAIIASLPPRNHEQRLVEDLATIVFDSV
FT                   ADVDVSVRMAAFEAAHALVRNLQQQLLNFCFLRTFRGVACGISEGDKRVVLLAREVSSA
FT                   IRELVTGNDNFSFKTELFVTFINETLVPFCCATGDEGSTHSAVVEWCLEWIYHVLNLPG
FT                   DDFIIQLWQLLKPLLLLSGTCNGSEALSLLQKCLGKTKDAFTRHVDVRVAKLVSIACEC
FT                   VQDANAALAKKSALEWISELHTVGALELLDLTDGVVKACLSQLGSKDLETRLAAQKVNQ
FT                   KITQFIAAPRDDTKAIPYEAVLKGVLEQLADRSVEEVRVAALEWIVLVLHAAPDVLECC
FT                   FDASFDTTVALLCDRSLHVVHKCIEVLCLISGEVHFDHFIARLVDLIHTKADVLLPKVP
FT                   TIIKQLQLRYQEEDLGQCEKLCLKLADVVSSHKDKRFVEKFVITLNTMLLTSRELLPLR
FT                   EVLHRGVDDARAREAFLGLYNCFCYNTVSALSLCFLSRAYEHAYQLVRFMGSCEMSANT
FT                   LVQLERLVRLIETPALSYVRIALMEPSKCLPLVRTLFAMQLILPQCSPQYMILYRRIKT
FT                   IPSLARLEREDSANAVQGSNNAIWEQLLNQSKEAQRCTAEFERRFFLQQMGDADIL"
FT                   /protein_id="XP_845976.1"
FT   repeat_region   912196..912216
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(912196..912216)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   912246..912274
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(912246..912274)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<913363..>914178)
FT                   /note="synonym: Tb07.28B13.510; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658560"
FT                   /locus_tag="Tb927.7.3540"
FT   mRNA            complement(<913363..>914178)
FT                   /db_xref="GI:72391365"
FT                   /db_xref="GeneID:3658560"
FT                   /locus_tag="Tb927.7.3540"
FT                   /transcript_id="XM_840884.1"
FT   CDS_pept        complement(913363..914178)
FT                   /locus_tag="Tb927.7.3540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391366"
FT                   /db_xref="GeneID:3658560"
FT                   /translation="MACGDFGKMEFLVHSSLHDQAPQRVQLRVRNPLSAEDMLQQIRNQ
FT                   FVQLKQQSAGAGPSALLGSHLFFFSSEEGCYVPLDGQSASVLHNYGRLLVHAPVTPSSE
FT                   EPDRPTSSQHTPRLAQRGPSNVGSGSTAAVEKREVCGNKCAISHDSNNQRNENSQPSKL
FT                   PPLETDIAGNEGREGEIEMKPTMIKAGPMLTMELMLKVTGVILSEYAARLNESVIEPTE
FT                   ESLWGLIEEVLYGDGNTIPYSLDPHTVDAFTRTIVRSLSNKGKSDEESV"
FT                   /protein_id="XP_845977.1"
FT   repeat_region   914974..915008
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(914974..915008)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    915600..915632
FT                   /note="AT_rich"
FT   misc_feature    complement(915600..915632)
FT                   /note="AT_rich"
FT   misc_feature    915881..915924
FT                   /note="A-rich"
FT   misc_feature    complement(915881..915924)
FT                   /note="T-rich"
FT   misc_feature    916170..916256
FT                   /note="CT-rich"
FT   misc_feature    complement(916170..916256)
FT                   /note="GA-rich"
FT   repeat_region   916673..916701
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(916673..916701)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<916851..>920576)
FT                   /note="synonym: Tb07.28B13.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658567"
FT                   /locus_tag="Tb927.7.3550"
FT   mRNA            complement(<916851..>920576)
FT                   /db_xref="GI:72391367"
FT                   /db_xref="GeneID:3658567"
FT                   /locus_tag="Tb927.7.3550"
FT                   /transcript_id="XM_840885.1"
FT   CDS_pept        complement(916851..920576)
FT                   /locus_tag="Tb927.7.3550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar to Neurofilament triplet H protein (200 kDa
FT                   neurofilament protein)(Neurofilament heavy polypeptide)
FT                   (NF-H). (Swiss-Prot:P12036) {Homo sapiens}"
FT                   /db_xref="GI:72391368"
FT                   /db_xref="GeneID:3658567"
FT                   /translation="MSIFGEPLPHEDDTATSLIRREGFPPFSTYDQMPVHYACSCCAEI
FT                   NPSRGRNHLLRTAKQEKELEREKLMQINIIEERAKNPHPSIPRPRTSNLQRVMEDEELN
FT                   QPAIPLPPTTLDELRKSRRQTNTTRLIVTVHHGKSINVDPRDPVSVLVRCGAFEGQTAK
FT                   VPRGRSAICTWEELFEFPYPNEEEGLEVLVVDDTLPAENDHMFGGIVVPPHALRNRARG
FT                   DEETLPVCAAGEMHRSYGRMKETPMGSIVVSWYVKRDGEDDADGAALKQNLEGGPINCN
FT                   FVVHRLFQYTDNGALPYNGGVLCLLRDTDDNCSESGLYTFNSEGAMSSSPYYGKGGCTY
FT                   LPQDRSQMLQLITPKKLGHVLICVTKDEVENEEDEELIVVGAVPLDFEKLYHKGSAVLL
FT                   VESKVKEDVLWGEIAVEWGIISYATIQKSNEEDRQGTQMSNDRTGQRDGSGPRESLFLT
FT                   VVRGLNLTDREGEPLAQGQVSVFACDMEGSTYSAPAVVEADGLAHVITWNQEVRFIEMD
FT                   GGQAFIDVQVLDDKRIVSSGRFELLNDSDALTVKMHDPQNETVKRGEILVSYKLIRSTE
FT                   EDDGESKRELSNEKEEEGSSPRRGASGRSGRGGSKRQSEMRSDQLSSRRNEDGSEYASD
FT                   SREKSAEKGRSAREKSPSKQRSQKRSPRSSRKSNSKGSTARQTSRSPKSTSPKRNEEEG
FT                   GRYLDELDEQQVKSAEDGRSPKERPLSKRSEEERGSDRFNESAAKSAEDDRSAQDKPLS
FT                   KRNEENEDLEELDEQQVKSAEDDRSAQERPLSKRSEEERGSDRFNESAAKSAEDDRSAQ
FT                   DKPLSKRNEEDEDLEELDDPQGHAAEDEQHPSGGERKKKRSPKESEKSRKSPKEGKEKR
FT                   SPRETTGKSKEESEKSRKSPKEGKEKRSPRETTGKSKEGSEKSRKSPKKSKEKRTPTEA
FT                   AGKSADEEGYGDDGPLSKRTAEEESLEELDEPQGLAGADERYPVKEDEYTRSPKELAEE
FT                   DLEELDEPKAEEPTEEQPLSKRNEEGGERLSSKGSEGRFEKEGGKEQRTVKLDVPPTPS
FT                   PDRKPPIGKGDERSAKKKAASQGGSEKRSGSGKKPVSPEAATKKGRLSGQRDSAENVRG
FT                   RGDSAGRTRAAEGKPSTSEAESSDVGAAANTRNRSPRSSVRRPSERLDEHNFSISPGAS
FT                   LTSGNWQPWHPTKNASNEDHIPLEKRTTFRNRTETIKQLEMRSRDSRLSSGHPSGNRDS
FT                   SRRASTNRESSVGRGF"
FT                   /protein_id="XP_845978.1"
FT   repeat_region   921128..921173
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(921128..921173)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<921562..>926844)
FT                   /note="synonym: Tb07.28B13.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658565"
FT                   /locus_tag="Tb927.7.3560"
FT   mRNA            complement(<921562..>926844)
FT                   /db_xref="GI:72391369"
FT                   /db_xref="GeneID:3658565"
FT                   /locus_tag="Tb927.7.3560"
FT                   /transcript_id="XM_840886.1"
FT   CDS_pept        complement(921562..926844)
FT                   /locus_tag="Tb927.7.3560"
FT                   /gene_family="HOG000256257" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391370"
FT                   /db_xref="GeneID:3658565"
FT                   /translation="MAAPAQAVVKEKPPIHVYPQAKIGTKIFTHHGIHSMRYNGVCALT
FT                   GSTVLMASGRFVMFVDVHKGTIESMQGPENGGVGAVAVHPSRQYYVVCERKPSDPAIRA
FT                   YSWPSRTEVGEFVKGATKGFSACAFNKDGSMMATVGMYPDFFLTVWDWESRGMVLRSKC
FT                   HNTDVYTVLFSPFDSGLLVSGGAGHIKFWTMANTFTGLKLQGLLGKFGRLEISNVSGFV
FT                   VLSDGKVISGSESGLIILWEGDLIRCCFAREVDREDDDGTAATFMARSYDYTPCHEGAI
FT                   NVVELMEGGRVLMTAGDDGYFRFWRVSELEVAEGEGAPPLYVPECLGEILVHAGAFIRS
FT                   VTYCKDVDEWVVLDSAGVLWRVPYVHPDDILNNAVTKPKEQAVPALEFNGGSITSAALS
FT                   PIDHTVVTGGEDGTIRLVDYVTPRELYKMCLPQPNVVIGLRFFQKDPEKKKFLACCKSG
FT                   AVLLVKRGSTAFTLLGQWRPHNDGLALFAVDAAEHRLCTIAHGTVFFFTILDDFSSLEP
FT                   IGFCKIPLPGATCVAWDDASSCCLIGFECGKLLAIRAPTRDMVDQSVSYEFTCNYALVG
FT                   IRQRKKVEKKQANVSAGEREGFVEEEEEEEYLGPWPVRLICPMADGDFAIGAGGVELLY
FT                   KYGLHVRYEGQKELPPLPPTGIEPPDYVEEPLMNLCYRDYTPEASSMSYSGRYLVVICE
FT                   GSQMLLRQLDEMGRVRLEPILVASAHDRLDGPIAAACTSFDDKMLVSVGSDGLVVAQLL
FT                   DGCIAPQPPSPVAQLQPLRAEEIVEPQLAPFSITEQKDLDDRRRAEDEKRRELNLFLDK
FT                   LKDVHQKYARLLRENQSLALTHRLSKEEITIHPQIYRELQEEMRQRVEESRKPTALELA
FT                   RENIRTRKMRNRFVDNLAHDRFLVRSFSKEFSVASFRTPYVDGSIKLFQQQIDELLGSE
FT                   RCSSLACDGDRGIVSVASGEASQQSPRNLSLSTAAGVVRWLNSEERKRNEGEQQKMNAA
FT                   HREAEILTTTMRQYLNKMDERREERHWRKKGYEMLLAHKPDPAVEEASLNEELRRETRR
FT                   RGECILRTDPSYHSAPSAVIKLQQLIRLEEIIFNMRNNFSNELLKLRDEKERLCGTLNV
FT                   SLQRIRAINEKLKDKSFHADDVKLTPEEMPGKRFEISRDGLVAFMKQRQEEKLREQTAK
FT                   KAQRGFGADLATGEPATNTDTSGADTPATRRSEGEDSRKVTISANRDSFGTAAARTRSV
FT                   RTGTLAASKGGRPFSGGGFAAGAARERMNHELRVKHENIKLTEMEEEELQIERNRLLAE
FT                   RQRLHTQVQAMMDEFDVRLWSMYEERSRVDANLCLAHTHSLLLFREYNILLVFRQKDFE
FT                   LQSSYDEARNSRDRCLREMEELQRLVQDQTASIEKLQEANKVFRREVEIFISNSFPAEH
FT                   VPYITKVFLRQIKRRKHHSDMSGNDDDITSDDDDDDDMGEDEAWEEICPPNCSEERWCE
FT                   VIEKREVRLDYVDAITEERRQLEATEQRIEEHKALADKNNAAVSTCLKAIEDFQGEKRK
FT                   QLNMLETLVAMRCGQVRCLDEEGRCPDTFRRNDLVVVSDKVITGLHDRIRALAEEKHDR
FT                   RGKLKSMVAEQQALQRERSEKQALHTQWEEKIYEAMLLKFGQIVNLEVLESSCGSREVE
FT                   QLKERLRLEELSWEKELRKRDKKIAVLREKLHESLEYNTSLLQTIGDQESDRQSVERSL
FT                   AQSTQKVVSKMYDSINVATEEDRSNLRLLIAAQQEEIDALRTEVALLRTKGGHVYAAAM
FT                   AAGR"
FT                   /protein_id="XP_845979.1"
FT   gene            complement(<927142..>929346)
FT                   /note="synonym: Tb07.28B13.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658569"
FT                   /locus_tag="Tb927.7.3570"
FT   mRNA            complement(<927142..>929346)
FT                   /db_xref="GI:72391371"
FT                   /db_xref="GeneID:3658569"
FT                   /locus_tag="Tb927.7.3570"
FT                   /transcript_id="XM_840887.1"
FT   CDS_pept        complement(927142..929346)
FT                   /locus_tag="Tb927.7.3570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391372"
FT                   /db_xref="GeneID:3658569"
FT                   /translation="MEDEWNTDGGLVSLTLEVPSAIQLPGSIRFRSFTETSYEDNESGD
FT                   SATITAWKATRWNDLGIHKRRRLDDAPGYECGDVVQPLLHVVKDSFDVAQRRMETLHWF
FT                   QKPRSAEEISARFALDRRLGVTPSLAATHQALTRLQQLNRTEAIIDLAEDLVMDSPTIS
FT                   LWTLLRIVDGLKGQPQCAARIVFSLSPLVTNGAVPPSAWTSLCDGLDKVARQLPAPLER
FT                   PLVELFGEVLYRARDDGPVDGKFVVYYGQALLKSRAPIGSIMGFVRAELLSGRNAPSAD
FT                   GTSAIRLGAFLSDLIQVMCSASGGAEEREERVPLSAADRLMHCGDLVKHAYAGRLQLTQ
FT                   GAFDAFLRFCDESQDYHRLCIVFLAMCTLSTPTLSSVARVAEVLCDVKQMSDYLADVLH
FT                   QSTPSLMLYLLLRHGSVSLFPQINNNNIRTRGGNVSNNERDKLEMHFCTCLARLCVRDG
FT                   DEFVCMALFSAIIDIGRPVGASAFISEVANSLRCPVKLFGGRATPAGVAASVEPFNVEA
FT                   LYYALRPAVASSGSGGIGDGTSLDALRTIPQSRPLASLLGGRDLAEKTCGTTVEQALAG
FT                   LLTSPHVYCTVVCESAISSLVKSPPLAEAFAKMMDGYATKMGAIAFVPFDVCTAEQLTD
FT                   DGRKFLFEWISRYAWFVVLPLSLTMQLAMNPAAVTVGKWKTEERLNESRCIRLFHAIQA
FT                   AKHTKVAFITAEPNVAEDAKASGVHPVITLTDLAKRLGIN"
FT                   /protein_id="XP_845980.1"
FT   misc_feature    929513..929536
FT                   /note="AT_rich"
FT   misc_feature    complement(929513..929536)
FT                   /note="AT_rich"
FT   repeat_region   929901..929946
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(929901..929946)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    930170..930231
FT                   /note="A-rich"
FT   misc_feature    complement(930170..930231)
FT                   /note="T-rich"
FT   misc_feature    931772..931805
FT                   /note="AT_rich"
FT   misc_feature    complement(931772..931805)
FT                   /note="AT_rich"
FT   repeat_region   932152..932198
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(932152..932198)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   932309..932328
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(932309..932328)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    932615..932659
FT                   /note="A-rich"
FT   misc_feature    complement(932615..932659)
FT                   /note="T-rich"
FT   repeat_region   932944..932985
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(932944..932985)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<933093..>934883)
FT                   /note="synonym: Tb07.28B13.440; protein kinase, putative"
FT                   /db_xref="GeneID:3658570"
FT                   /locus_tag="Tb927.7.3580"
FT   mRNA            complement(<933093..>934883)
FT                   /db_xref="GI:72391373"
FT                   /db_xref="GeneID:3658570"
FT                   /locus_tag="Tb927.7.3580"
FT                   /transcript_id="XM_840888.1"
FT   CDS_pept        complement(933093..934883)
FT                   /locus_tag="Tb927.7.3580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72391374"
FT                   /db_xref="GeneID:3658570"
FT                   /translation="MDRFTKVRNIGKGNMGACVLVRNNEDGKLYVIKQVDLTKMNRKER
FT                   QQSLNEAHLLKSLQHPNVINYVDSFLTNKSDYICIVMEYADGGDLSSRIKKSYGVNFRE
FT                   TQVIDWIIQLALSLSYVHKRKVLHRDVKSQNVFLTSQNILKLGDFGIARTLSGTYDQAK
FT                   TFVGTPYYLSPELIMERPYDHRSDVWALGVIVYELLTLKHPFNATSMKGLMQRILKLQY
FT                   EPIPPLYTTELRNIVPRLLTRDPAHRIRLSDLLDLPVIHRRLREWMLSDVMPKDYIETL
FT                   LRNGLLPSQVAALRKSAVVPPAAPTTLPARDRTQCLTPLSPEVITKPSKLPSPIPAGGS
FT                   SPPLVTDISEGLSPKLPQLDQRQKQQTPQQNDHFQQQQQQQQQQQQQQTPSLQPSQQLN
FT                   GARLPSQDRDAGAKKQQLQPKHLYINYKKFNGGYNSSSVSGNGVVKQNSSAPNPMCVPS
FT                   GPRNAGVSPSNAPSIVPNSARHFTAILGPGRQNGQNVVAAPPQSSEYGPTGHNINAIGC
FT                   RGTAQPSVVPNSIILQRLAEHRAHKRSQQETGNTALRLNPFLHQPNAPAPLPYLAGVQQ
FT                   LDIRAMLQRATLERARRNAT"
FT                   /protein_id="XP_845981.1"
FT   repeat_region   933692..933803
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(933721..933761)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   934998..935019
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(934998..935019)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   935484..935533
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(935484..935533)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   935578..935602
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(935578..935602)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   935666..935700
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(935666..935700)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   gene            complement(<936438..>936893)
FT                   /note="synonym: Tb07.28B13.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658576"
FT                   /locus_tag="Tb927.7.3590"
FT   mRNA            complement(<936438..>936893)
FT                   /db_xref="GI:72391375"
FT                   /db_xref="GeneID:3658576"
FT                   /locus_tag="Tb927.7.3590"
FT                   /transcript_id="XM_840889.1"
FT   CDS_pept        complement(936438..936893)
FT                   /locus_tag="Tb927.7.3590"
FT                   /gene_family="HOG000256254" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391376"
FT                   /db_xref="GeneID:3658576"
FT                   /translation="MLRRAAPAGGIIARWGLSNCNVSIRHGRHGLTRHDFSNVFSRSLT
FT                   EEEMKALQQQQEYRPVSAVVPGKLFMRHWIAGEQATESVVDRVISGFVFVCFMLWGCGF
FT                   ATLGFNGNSCAHTAVLVFIAYWLYLQTHCRLLISALATLAVLHLIVN"
FT                   /protein_id="XP_845982.1"
FT   gene            complement(<937611..>938288)
FT                   /note="synonym: Tb07.28B13.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658573"
FT                   /locus_tag="Tb927.7.3600"
FT   mRNA            complement(<937611..>938288)
FT                   /db_xref="GI:72391377"
FT                   /db_xref="GeneID:3658573"
FT                   /locus_tag="Tb927.7.3600"
FT                   /transcript_id="XM_840890.1"
FT   CDS_pept        complement(937611..938288)
FT                   /locus_tag="Tb927.7.3600"
FT                   /gene_family="HOG000256253" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391378"
FT                   /db_xref="GeneID:3658573"
FT                   /translation="MYRSGTTNSHRDSLQISSLVMVCFYFATYTGGVDAVRVRPTEQQL
FT                   SIDINNEEVCMYSHGVHRREGVMFHYHSLRGGNDFDFYIRDPDNRTVYVSYAGEHADEE
FT                   RVYFTKRVLGEYSYCVDNRPYTGSIKTVKMSVGMTSLKRWKDRIDPLMRMMDGSDRFML
FT                   AMHDDQMIFRLREEHLRKKVQESKKLVLFRGVAETAVILFVCTLQVLLIKRMFNRKGTR
FT                   AVA"
FT                   /protein_id="XP_845983.1"
FT   gene            complement(<938793..>940058)
FT                   /note="synonym: Tb07.28B13.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658572"
FT                   /locus_tag="Tb927.7.3610"
FT   mRNA            complement(<938793..>940058)
FT                   /db_xref="GI:72391379"
FT                   /db_xref="GeneID:3658572"
FT                   /locus_tag="Tb927.7.3610"
FT                   /transcript_id="XM_840891.1"
FT   CDS_pept        complement(938793..940058)
FT                   /locus_tag="Tb927.7.3610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391380"
FT                   /db_xref="GeneID:3658572"
FT                   /translation="MSSRSGGRPFGKSHESLKLPVIRTVGTVMHEPPRPVCRVISPAEP
FT                   IQWRKRSRINKSPQNIPDASVSVPPTKDSTGRDFEITISQYPGSNDAASGVINNLDLFE
FT                   ARLHGEPNLCRLLTSQHESSPSSRASVMPEHLFPFMDDSSSPRLLRGTMITLLPCLSSD
FT                   LFLKNNTIAARLREMERGEVLQKLRAEGRRLGMREVTVDEFSHLVGCLFGEELLDKDEV
FT                   EYLFRFLYWNTQDCISFEDLIASVSLIFEEVDVLILVRCKYIMEERTLNNSVISLVDVD
FT                   IMLGAFKSVFGEYVPEVCELCADVRRAMEDIMPTYTVPASTFREEIKRHELLMNCLDVV
FT                   HTDGSIGWLPLLQLLDRLPDDDCKSFGTTHVELQRALVDTAIAKWREEPDESVSDDGKD
FT                   CVMDLCHPKFIADKYMISTNVP"
FT                   /protein_id="XP_845984.1"
FT   gene            complement(<940744..>942837)
FT                   /note="synonym: Tb07.28B13.380; tyrosyl-tRNA synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3658574"
FT                   /locus_tag="Tb927.7.3620"
FT   mRNA            complement(<940744..>942837)
FT                   /db_xref="GI:72391381"
FT                   /db_xref="GeneID:3658574"
FT                   /locus_tag="Tb927.7.3620"
FT                   /transcript_id="XM_840892.1"
FT   CDS_pept        complement(940744..942837)
FT                   /locus_tag="Tb927.7.3620"
FT                   /gene_family="HOG000256251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tyrosyl-tRNA synthetase, putative"
FT                   /note="go_component: cytosol [goid 0005829]; go_function:
FT                   tyrosine-tRNA ligase activity [goid 0004831]; go_process:
FT                   tyrosyl-tRNA aminoacylation [goid 0006437]"
FT                   /db_xref="GI:72391382"
FT                   /db_xref="GeneID:3658574"
FT                   /translation="MTTNTADVGSVEERFKLIRSVGEECIQENELRAMLEKKPDIRCYD
FT                   GFEPSGRMHVAQGVFKSINVNKCTQSGCEFVFWVADWFALMNDKVGGELQRIRIVGEYL
FT                   TEVWKAANMNMERVRFLWSSDEITNNANTYWKLVLDISRRNTIARIKKCCTIMGKQEGT
FT                   LTAAQVLYPLMQCADIFFLKADICQLGLDQRKVNMLAREYCDLIGRKNKPVILSHHMLA
FT                   GLKQGHAKMSKSDPDSAIFMEDSEEDVARKIRAAYCPRVAQKSTEVTDDGAPVASEDKN
FT                   PVLDYFECLVFSKPGATAVVDGAEYNTYADLEKAFVDGNISEEALKEGLIELLNGILEP
FT                   VRKHFVEDPHAASLLQQVLSFRAGGAAPPLSAVPLPEQSATPLAVAWLPACIKFPVDLA
FT                   VALSDAIKQFLRENTDGEAVLLLPEWTAMACNNVGGEEKYISAALELNAAILKSHWLPS
FT                   ERVRIVRQSEMILANPNDYWLTAINVGRKNKLQRVEEVCGDLKNAGAVVAALMYVADAA
FT                   MLKATHAICTSHDRGCHEIATDFYEGKLRVIPALGGVVPPLSNAEPPVSETLASGPVNK
FT                   DDILFIDDTDMDMRRKIKRAYCAPNEDANPVLSIATWLMREQGALLIERTEANGGDVAY
FT                   KGEGQLRADALSGALHPADLKQAVSKMLLDKCAAAKAVLSTAEGKKYAQTLKNAEKSLS
FT                   KSK"
FT                   /protein_id="XP_845985.1"
FT   repeat_region   944204..944247
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(944204..944247)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<944569..>946155)
FT                   /note="synonym: Tb07.28B13.340; TPR-repeat-containing
FT                   chaperone protein DNAJ, putative"
FT                   /db_xref="GeneID:3658575"
FT                   /locus_tag="Tb927.7.3630"
FT   mRNA            complement(<944569..>946155)
FT                   /db_xref="GI:72391383"
FT                   /db_xref="GeneID:3658575"
FT                   /locus_tag="Tb927.7.3630"
FT                   /transcript_id="XM_840893.1"
FT   CDS_pept        complement(944569..946155)
FT                   /locus_tag="Tb927.7.3630"
FT                   /gene_family="HOG000256247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR-repeat-containing chaperone protein DNAJ,
FT                   putative"
FT                   /note="similar to DnaJ homolog subfamily C member 7
FT                   (Tetratricopeptide repeat protein 2)(TPR repeat protein 2).
FT                   (Swiss-Prot:Q99615) [Homo sapiens]; go_function: protein
FT                   binding [goid 0005515]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:72391384"
FT                   /db_xref="GeneID:3658575"
FT                   /translation="MYITGENSAIKCRYNMILKILLLVGAAVGAECSGVADDDTTKKLL
FT                   LEGDSALRQGRSYYQEALAKYTEALTHNPNSIRGLYSRAELLSMLRRRDACMSDLDQLL
FT                   KLDSKHQRGLVLRSALYSQAGQLKEAVRDVEKLVEVMSEGGKAAKVQEYKAKLQQLRRY
FT                   AEVWIPLQLKLQAAKQGAVTLSRDEQCACVGFLHDMIREFAKDNAGLRLQRAECALACG
FT                   DNQAASEELKYVVQREPQNLDAVALGARALRALGALEQARRELRRCLSLDPEFALCAQL
FT                   HKLVREQIRVTQGVEKALEEKDYGKVLKLIEGAMRFEENPPYKDQLLRWRCDAAVGMQD
FT                   TKDGLPACDEAIQLYSPEDPTVVSILLQKLELYLMDGNVERAEEMLQRAQQLQPNDGKV
FT                   NEYKRKMERIKRVGLRKNYYKILGVKKTADSSEIRRAYRHLAKTFHPDKLASQELSKEE
FT                   RAEADKRFRDINEAKEILLDDEKRARYDNGEDPTKPPGQDEHAFHGQPFNFPNEMFGQG
FT                   GRFQQFYFHFD"
FT                   /protein_id="XP_845986.1"
FT   repeat_region   946665..946746
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(946665..946746)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   gene            complement(<948081..>949136)
FT                   /note="synonym: Tb07.28B13.320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658579"
FT                   /locus_tag="Tb927.7.3640"
FT   mRNA            complement(<948081..>949136)
FT                   /db_xref="GI:72391385"
FT                   /db_xref="GeneID:3658579"
FT                   /locus_tag="Tb927.7.3640"
FT                   /transcript_id="XM_840894.1"
FT   CDS_pept        complement(948081..949136)
FT                   /locus_tag="Tb927.7.3640"
FT                   /gene_family="HOG000256246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391386"
FT                   /db_xref="GeneID:3658579"
FT                   /translation="MYDPAVPNNYRDVKIVQWKRAREVEENEKLSRTSMESILATPSPF
FT                   DFPGMVQPPSPTPTDTSFPGSSEVLPLHLSVEELHQRRVRQSAALGITTAIRLERDELE
FT                   AAHKVKVATGMDRKGRIGSKLEKFMKMATSSSSSGDAASGSNGDADVSSGMSSMGLPPS
FT                   SLAGSSAPLVFQRSTLAAGGYMVKEDTNAQDGRKAPSGKPSSTILIRFIRDGPPPDLFE
FT                   EDATAGGDNEGGAVGSLRAAGLAFLENVQGQCARYGIVRSVRPALLTEEQRTAVRARLE
FT                   QCASTPVEVELRFARELVRVLVRFDTVAGAFKAIDALQQNCVNWSVCFFPTILFDAGTL
FT                   GPSDGEPLCGT"
FT                   /protein_id="XP_845987.1"
FT   repeat_region   949151..949177
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(949151..949177)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    949631..949658
FT                   /note="AT_rich"
FT   misc_feature    complement(949631..949658)
FT                   /note="AT_rich"
FT   misc_feature    949958..950001
FT                   /note="GA-rich"
FT   misc_feature    complement(949958..950001)
FT                   /note="CT-rich"
FT   misc_feature    950098..950118
FT                   /note="A-rich"
FT   misc_feature    complement(950099..950214)
FT                   /note="T-rich"
FT   misc_feature    950119..950174
FT                   /note="A-rich"
FT   misc_feature    950403..950454
FT                   /note="A-rich"
FT   misc_feature    complement(950403..950454)
FT                   /note="T-rich"
FT   repeat_region   950597..950633
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(950597..950633)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   950757..950792
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(950757..950792)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<951054..>952373)
FT                   /note="synonym: Tb07.28B13.300; protein kinase, putative"
FT                   /db_xref="GeneID:3658577"
FT                   /locus_tag="Tb927.7.3650"
FT   mRNA            complement(<951054..>952373)
FT                   /db_xref="GI:72391387"
FT                   /db_xref="GeneID:3658577"
FT                   /locus_tag="Tb927.7.3650"
FT                   /transcript_id="XM_840895.1"
FT   CDS_pept        complement(951054..952373)
FT                   /locus_tag="Tb927.7.3650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72391388"
FT                   /db_xref="GeneID:3658577"
FT                   /translation="MGSGRKCSSNESSKVGTQSIGNISPSCVTLPNDVGDGTPLRVSLA
FT                   HKALIGKGSFGVVFQAMNRDTNQIIAVKEIAFTSNADSQLLDTVRRELTTLKLLDHPHI
FT                   VKFLGGEWADNCLRIYLEYVSGGSISSVLRTFGPFQEKQASRFTRQMLEGLAYLHSKNI
FT                   IHRDLKGDNLLVDPNGTLKISDFGTAKSLVENQPPQHNGVPPTPAGTAYFMAPEAIVGD
FT                   PVGLSSDIWSVGCCVIEMLTGSAPFSHMKNQYSTMLCVAEHKGELVSSMIPKGNNFSSK
FT                   TLDFLMRCLQRDPEKRSTALELLEDPWIQNPPEDTELSCSIALPPCAPSLQRDRSSGGG
FT                   VFEPPFGAFNDIVRTPKFSHFSFCTEETSSLSESKGGNSTRKSSTKSNRTPREWRGEKR
FT                   HSESHGGLSNSCQKERDRDSAREERRSAGGSVLGVSFPNI"
FT                   /protein_id="XP_845988.1"
FT   misc_feature    953265..953285
FT                   /note="AT_rich"
FT   misc_feature    complement(953265..953285)
FT                   /note="AT_rich"
FT   repeat_region   954251..954301
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(954251..954301)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    954442..954556
FT                   /note="A-rich"
FT   misc_feature    complement(954442..954556)
FT                   /note="T-rich"
FT   repeat_region   954714..954744
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gagaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(954714..954744)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttctc"
FT                   /rpt_type="tandem"
FT   repeat_region   955032..955060
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(955032..955060)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<955510..>957459)
FT                   /note="synonym: Tb07.28B13.290; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658571"
FT                   /locus_tag="Tb927.7.3660"
FT   mRNA            complement(<955510..>957459)
FT                   /db_xref="GI:72391389"
FT                   /db_xref="GeneID:3658571"
FT                   /locus_tag="Tb927.7.3660"
FT                   /transcript_id="XM_840896.1"
FT   CDS_pept        complement(955510..957459)
FT                   /locus_tag="Tb927.7.3660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391390"
FT                   /db_xref="GeneID:3658571"
FT                   /translation="MSTLEGCADALLQQKVVQASNYERLEARLMEMERTKRSLFFGLKE
FT                   VITDVERRTQDLSELKQENSRLRQQLQQGNVKFGALAVFIKDEQKKTARLRETLEGCEI
FT                   AWAGYPARVALVLHALQERQVFREQLGDVVKNLERVNQLVIVLRRVGEVHSRVAQRLVE
FT                   HSAETVRLDDAYKQERQLTAGLREEYEQHSVATLAESDRLRGVAQRLELQQLVRESELA
FT                   AARVESSEAEARNDICRMALQGALTAADTQAVKHQRAEVYFRFVSWRCGLLHTVVSAAE
FT                   AQTEVVSEMMNTWVGGLRCQRDRLKEETAQTESGRALSAEELEVARTSEAIFQRRNASL
FT                   RLLCGALRLLYCRQRSRAADIHKEWSQLEGEVSRARKAHEARLFARRLLLLQKEAREGL
FT                   CAEELLTRRALAEGEEAARQEAVTQRQLDLEAVKKQKLQRDVSPLRREEKADATRSWFQ
FT                   LTNPAKLVVPRARGAAQTEKKRPRLPPDVATPARRTYPLGAKPKSAESDKHWEGGNETP
FT                   SLSHPQSPPSSPPRNHHSVALIRPSSQVKATRCSRSPSLSGMPVSTVHNSNSSKKRGQP
FT                   RKNFVTKLGPVGHLVTSPLPRRPSAAKPIDDVVAGAGVQKGVSHHGPRPSLLSEKEPWN
FT                   GAKFEDVFSDIFPY"
FT                   /protein_id="XP_845989.1"
FT   gene            complement(<958559..>960520)
FT                   /note="synonym: Tb07.28B13.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658580"
FT                   /locus_tag="Tb927.7.3670"
FT   mRNA            complement(<958559..>960520)
FT                   /db_xref="GI:72391391"
FT                   /db_xref="GeneID:3658580"
FT                   /locus_tag="Tb927.7.3670"
FT                   /transcript_id="XM_840897.1"
FT   CDS_pept        complement(958559..960520)
FT                   /locus_tag="Tb927.7.3670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391392"
FT                   /db_xref="GeneID:3658580"
FT                   /translation="MQEDVKHLLCGVVDGSCVDPTMNPLITGAPLAVSALAQQCLYTCY
FT                   AVSSNHAVIGDKSSNFWRVLRYVERVRDKYVESETLPPPPPLRLRNSCTYETTGGDNSA
FT                   AAGACGSEIGGIGGVVFKVAPSCSDLETSDQSFHYSPLAPFKQGRVRKQLLPPLEFRVV
FT                   VVGGGRVGRAIVELLLRVRELVHPSRVTIVTQRPEAVACFAAQGVQCVAKDAGRQALMQ
FT                   CHVLIIACQQSQFHDFAKIYCPRCSLTPAAVGLVDNEAAGGSRTDEVDEVGGAVKDRRR
FT                   PRKRTLRDVVEKWRTMETSERGSSRKNVKDSPGESSRKDEPLTRLLRPDAIVFSCCVAL
FT                   PAHKIASDLGHLYPLVVRARINLKSVRGLAQDIQTVKAVLHDDYVKRLQSEGNTFLTRL
FT                   TLIQQSAKGGGKQAELLRLVKAAHERHGDLTSSNLSGGMGNTLESLPCLGLGDSFARMD
FT                   STNPLQSRQSKGGGVLDLKNMLPTTNNENPMFVVHMWRALRSLSVVQALNFTRTDQRSF
FT                   IYLGSMGPLLACTLVALPTNTQRAIVSGIETYLDDSFRYYQNRVATDGVNDDDIAPFIL
FT                   LRVNQRHVPAFDSDDDEDEGCGSSSPTEETLTPAQPFLERELRRLVARFPTVFKSTKIV
FT                   LQQLLSVYKMVACSANSP"
FT                   /protein_id="XP_845990.1"
FT   repeat_region   960547..960586
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tataa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(960547..960586)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttata"
FT                   /rpt_type="tandem"
FT   repeat_region   960589..960627
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(960589..960627)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    961229..961249
FT                   /note="AT_rich"
FT   misc_feature    complement(961229..961249)
FT                   /note="AT_rich"
FT   gene            complement(<961287..>961748)
FT                   /note="synonym: Tb07.28B13.250; ubiquitin/ribosomal protein
FT                   S27a, putative"
FT                   /db_xref="GeneID:3658581"
FT                   /locus_tag="Tb927.7.3680"
FT   mRNA            complement(<961287..>961748)
FT                   /db_xref="GI:72391393"
FT                   /db_xref="GeneID:3658581"
FT                   /locus_tag="Tb927.7.3680"
FT                   /transcript_id="XM_840898.1"
FT   CDS_pept        complement(961287..961748)
FT                   /locus_tag="Tb927.7.3680"
FT                   /gene_family="HOG000233943" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin/ribosomal protein S27a, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_function: heme binding [goid 0020037]; go_process:
FT                   protein biosynthesis [goid 0006412]; go_process: ribosome
FT                   biogenesis [goid 0007046]"
FT                   /db_xref="GI:72391394"
FT                   /db_xref="GeneID:3658581"
FT                   /translation="MQLFLRSATGATSVVEASAADTVGTLRAKAGFDDTSSIFFFGGFC
FT                   LREESATLAECGLQQGSTVQVMIPVEGGKGKKKKKKVFTKPKKPIHRHKLEKMRALKYF
FT                   KVTENDDGSFKVERTRDECPNPNCGAGVFMAQHKGRKYCGKCHLTYTMK"
FT                   /protein_id="XP_845991.1"
FT   repeat_region   961818..961862
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(961818..961862)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    961943..961963
FT                   /note="AT_rich"
FT   misc_feature    complement(961943..961963)
FT                   /note="AT_rich"
FT   misc_feature    962732..962789
FT                   /note="A-rich"
FT   misc_feature    complement(962732..962789)
FT                   /note="T-rich"
FT   gene            complement(<962765..>963241)
FT                   /note="synonym: Tb07.28B13.220; hypothetical protein"
FT                   /db_xref="GeneID:3658582"
FT                   /locus_tag="Tb927.7.3690"
FT   mRNA            complement(<962765..>963241)
FT                   /db_xref="GI:72391395"
FT                   /db_xref="GeneID:3658582"
FT                   /locus_tag="Tb927.7.3690"
FT                   /transcript_id="XM_840899.1"
FT   CDS_pept        complement(962765..963241)
FT                   /locus_tag="Tb927.7.3690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72391396"
FT                   /db_xref="GeneID:3658582"
FT                   /translation="MQKRRECLERFVLKSFLLFLFRFFLSFFLVFFPLIIVSTGDSFFI
FT                   SQLPSGIGITTTPFTIIIIIIIITIIVIIMLPLSSPSIFVQKIIYLFIFLSFFLSFFLS
FT                   FSFLFLFVCVCVCMCFFFLKLRATYHYWTVDCARVTLQEIQRSTVISFFFFPFL"
FT                   /protein_id="XP_845992.1"
FT   misc_feature    962874..962979
FT                   /note="A-rich"
FT   misc_feature    complement(962874..962979)
FT                   /note="T-rich"
FT                   /locus_tag="Tb927.7.3690"
FT   repeat_region   963018..963066
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(963018..963066)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    963155..963196
FT                   /note="GA-rich"
FT   misc_feature    complement(963155..963196)
FT                   /note="CT-rich"
FT                   /locus_tag="Tb927.7.3690"
FT   repeat_region   963597..963631
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(963597..963631)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   963719..963764
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(963719..963764)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   963838..963877
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(963838..963877)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   repeat_region   963934..963956
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(963934..963956)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    964324..964361
FT                   /note="AT_rich"
FT   misc_feature    complement(964324..964361)
FT                   /note="AT_rich"
FT   misc_feature    964446..964513
FT                   /note="A-rich"
FT   misc_feature    complement(964446..964513)
FT                   /note="T-rich"
FT   gene            complement(<964705..>965622)
FT                   /note="synonym: Tb07.28B13.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658578"
FT                   /locus_tag="Tb927.7.3700"
FT   mRNA            complement(<964705..>965622)
FT                   /db_xref="GI:72391397"
FT                   /db_xref="GeneID:3658578"
FT                   /locus_tag="Tb927.7.3700"
FT                   /transcript_id="XM_840900.1"
FT   CDS_pept        complement(964705..965622)
FT                   /locus_tag="Tb927.7.3700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391398"
FT                   /db_xref="GeneID:3658578"
FT                   /translation="MTEQTEAEVQKRETSTSESSAGGPTFNFAEGAGTPLKELPSLKKI
FT                   RARSIAMRQLETSIEPLHRLVYGRPGRMGERWGALEEFCGFPEYKREEVVDRLGRIAKR
FT                   RLRDFVMATGMRINVSQKLPKLAQDVTAFLMSPQSEGVIDPELEAAKPKKGSSRKSTQR
FT                   GRKTAKRPASTRSRRANGSERKTPTKRLARNSTLRAASLESPSDDTLRVAIFRRVLFTP
FT                   QTERSYLTTKVLRLELQEKFGDLEHRKAIIKEAAAECVSALISAESAAIAFTNSNMSST
FT                   TDTTIKTNDFTQPGTVSSENGSPA"
FT                   /protein_id="XP_845993.1"
FT   repeat_region   965735..965759
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(965735..965759)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    965768..965804
FT                   /note="CT-rich"
FT   misc_feature    complement(965768..965804)
FT                   /note="GA-rich"
FT   repeat_region   965838..965857
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(965838..965857)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    965948..966007
FT                   /note="A-rich"
FT   misc_feature    complement(965948..966007)
FT                   /note="T-rich"
FT   gene            complement(<966383..>967801)
FT                   /note="synonym: Tb07.28B13.170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658583"
FT                   /locus_tag="Tb927.7.3710"
FT   mRNA            complement(<966383..>967801)
FT                   /db_xref="GI:72391399"
FT                   /db_xref="GeneID:3658583"
FT                   /locus_tag="Tb927.7.3710"
FT                   /transcript_id="XM_840901.1"
FT   CDS_pept        complement(966383..967801)
FT                   /locus_tag="Tb927.7.3710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391400"
FT                   /db_xref="GeneID:3658583"
FT                   /translation="MHDGAGATAIMSNTNHCGLIDQVLKRLEGKLLVTSCSNKLPEDCG
FT                   PFLRKLTEAADESRISDILDDVFDRVSTIFATYLKAVLAAAAATTTTTTEDGGEVHSME
FT                   DTTPLVEGTALTAFNLITAEALPFLTSSHECRDLPSWVEGVSWCRLGSLLVCLIREATD
FT                   GFQSPTVRLRWHHIEGEELQPMLSVVVLVWEVVVRLLSFVVNCIEFGEEGDAHHSSKPH
FT                   PLLHIISDCFVAMVENNNKLQVQASTLPNSVDVLCVFINNYMWIKQQCRRLPMFSATEV
FT                   LALVDGYTAGALQDLLNCCTTELQHIISKTTSPAVDGECQSEILFHRIISLCRCIRGVA
FT                   PPIPRQEVTSLLLERTLRPLVERLLDGEKKRDVPSLSVVTRALRAFGDVQRVAGGSFFL
FT                   QDLAGKVTGSRSGSSGDIRGNVGIDGDVSESLMARRLSEVLQFLEEEPVFGTRCCQQSP
FT                   SFCTLRRLFLDVPS"
FT                   /protein_id="XP_845994.1"
FT   repeat_region   967521..967551
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(967521..967551)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   968056..968080
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(968056..968080)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   968900..968922
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(968900..968922)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   969110..969160
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(969110..969160)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   969204..969254
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(969204..969254)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tgag"
FT                   /rpt_type="tandem"
FT   misc_feature    969283..969317
FT                   /note="AT_rich"
FT   misc_feature    complement(969283..969317)
FT                   /note="AT_rich"
FT   misc_feature    969408..969438
FT                   /note="AT_rich"
FT   misc_feature    complement(969408..969438)
FT                   /note="AT_rich"
FT   repeat_region   969552..969593
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(969552..969593)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   969658..969796
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(969658..969796)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   969939..970014
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(969939..970014)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   970027..970082
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(970027..970082)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    970177..970235
FT                   /note="T-rich"
FT   misc_feature    complement(970177..970235)
FT                   /note="A-rich"
FT   misc_feature    970445..970481
FT                   /note="T-rich"
FT   misc_feature    complement(970445..970481)
FT                   /note="A-rich"
FT   repeat_region   970506..970536
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(970506..970536)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   970596..970638
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(970596..970638)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    970747..970773
FT                   /note="AT_rich"
FT   misc_feature    complement(970747..970773)
FT                   /note="AT_rich"
FT   repeat_region   970774..970801
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(970774..970801)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   970976..971021
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(970976..971021)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   misc_feature    971292..971356
FT                   /note="T-rich"
FT   misc_feature    complement(971292..971356)
FT                   /note="A-rich"
FT   repeat_region   971608..971631
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(971608..971631)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   971926..971992
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(971926..971992)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   972003..972090
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(972003..972090)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    972813..972891
FT                   /note="GA-rich"
FT   misc_feature    complement(972813..972891)
FT                   /note="CT-rich"
FT   misc_feature    973316..973336
FT                   /note="AT_rich"
FT   misc_feature    complement(973316..973336)
FT                   /note="AT_rich"
FT   misc_feature    973659..973721
FT                   /note="GA-rich"
FT   misc_feature    complement(973659..973721)
FT                   /note="CT-rich"
FT   misc_feature    973824..973862
FT                   /note="AT_rich"
FT   misc_feature    complement(973824..973862)
FT                   /note="AT_rich"
FT   gene            <973881..>974456
FT                   /note="synonym: Tb07.28B13.130; hypothetical protein"
FT                   /db_xref="GeneID:3658587"
FT                   /locus_tag="Tb927.7.3720"
FT   mRNA            <973881..>974456
FT                   /db_xref="GI:72391401"
FT                   /db_xref="GeneID:3658587"
FT                   /locus_tag="Tb927.7.3720"
FT                   /transcript_id="XM_840902.1"
FT   CDS_pept        973881..974456
FT                   /locus_tag="Tb927.7.3720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72391402"
FT                   /db_xref="GeneID:3658587"
FT                   /translation="MRLTATHLLLFIHATFLFHYCAVVYSSCISPHIFYLSYVFLFFFF
FT                   VLASPPFSLASSLFFKKKLLLLLLFPLTLFSPLFSTNATAKKTTIITRATTIIIIIITP
FT                   QIHEVFKYQNAINIVGKVQNPLTKENKKSPLRINLNMQMYTYIIAFLFFLILFIHSSSS
FT                   PPFFPSVVQHIKQKQKKQKKQKTKIKQK"
FT                   /protein_id="XP_845995.1"
FT   misc_feature    973966..974060
FT                   /note="T-rich"
FT   misc_feature    complement(973966..974060)
FT                   /note="A-rich"
FT   misc_feature    974061..974090
FT                   /note="AT_rich"
FT   misc_feature    complement(974061..974090)
FT                   /note="AT_rich"
FT   repeat_region   974162..974187
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(974162..974187)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    974403..974458
FT                   /note="A-rich"
FT   misc_feature    complement(974403..974458)
FT                   /note="T-rich"
FT   repeat_region   974564..974586
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(974564..974586)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    974735..974847
FT                   /note="A-rich"
FT   misc_feature    complement(974735..974847)
FT                   /note="T-rich"
FT   misc_feature    975005..975035
FT                   /note="AT_rich"
FT   misc_feature    complement(975005..975035)
FT                   /note="AT_rich"
FT   misc_feature    975304..975357
FT                   /note="A-rich"
FT   misc_feature    complement(975304..975357)
FT                   /note="T-rich"
FT   gene            complement(<976289..>977311)
FT                   /note="synonym: Tb07.28B13.110; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3658586"
FT                   /locus_tag="Tb927.7.3730"
FT   mRNA            complement(<976289..>977311)
FT                   /db_xref="GI:72391403"
FT                   /db_xref="GeneID:3658586"
FT                   /locus_tag="Tb927.7.3730"
FT                   /transcript_id="XM_840903.1"
FT   CDS_pept        complement(976289..977311)
FT                   /locus_tag="Tb927.7.3730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="similar to GB:AAP42139.1: RNA-binding protein UBP-1
FT                   {Trypanosoma cruzi} (PMID:12637517); similar to Cleavage
FT                   stimulation factor, 64 kDa subunit (CSTF 64 kDa
FT                   subunit)(CF-1 64 kDa subunit). (Swiss-Prot:P33240) [Homo
FT                   sapiens;]; 59% similar to GB:AAP42139.1: RNA-binding
FT                   protein UBP-1 {Trypanosoma cruzi} (PMID:12637517);
FT                   go_function: RNA binding [goid 0003723]; go_process: RNA
FT                   processing [goid 0006396]"
FT                   /db_xref="GI:72391404"
FT                   /db_xref="GeneID:3658586"
FT                   /translation="METHQDPRNLIVNYIPTPVTEEDLEELFRPFGPLVSVRIICDREN
FT                   GNHPKGYGFVRYKFVESAMNAMSRMNGYSINNKRLRVTQATGPRKYSQAAGSTSVRQPG
FT                   PRAPPGSAPPKVSGPCFGDGAVEQISLTTSSLVPCPIVHPFDSRNSVLTAMARPQETTV
FT                   HHPATFALVDRGRMHMIQAAPGIMAAPVGNQQFVQTVPASWAPALSTIQPPVVLSEGDT
FT                   GGIVTGNIKTCGSSSPMELSVLSMTTQPVPAMTIPRVQQSNSATQPEQYHPSSKTMEPL
FT                   CFQSYMPLNPVRDGILQGSVSSFFTPLGASDPTTGSLCGAALSSPTTRMIGTTNFMSPN
FT                   "
FT                   /protein_id="XP_845996.1"
FT   gene            complement(<978815..>981364)
FT                   /note="synonym: Tb07.28B13.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658588"
FT                   /locus_tag="Tb927.7.3740"
FT   mRNA            complement(<978815..>981364)
FT                   /db_xref="GI:72391405"
FT                   /db_xref="GeneID:3658588"
FT                   /locus_tag="Tb927.7.3740"
FT                   /transcript_id="XM_840904.1"
FT   CDS_pept        complement(978815..981364)
FT                   /locus_tag="Tb927.7.3740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391406"
FT                   /db_xref="GeneID:3658588"
FT                   /translation="MSYVVGDEGCEIDLSKLISYTMSFQPLQLLFEDIIKRLKQSETAN
FT                   ERQDNELTLLRMEMDELRRRDADREAQLQNILSRAPGAHRQQPQKPEGATVETVETEAE
FT                   DSKLEQAPAEWLPPYEDRGQSDNLQPLWDEIEYLKRMVGNFCEPMNNASIEQLYHARRK
FT                   VSTTQQSPLSGTDGDFVTKEKQKGGDTEGVAVGEVILQRANEELQLDGISPKEEDPTGE
FT                   SMQPDNRAEDVVPDQLGQQGESSLAQPSGRVTRPVSGRRMSQGRSSISGVSFTRGMSPE
FT                   DSNNPESLFVRVRQDEESIGRLNRVVAEILSELKGLQKDVDLMRTVGPGDGLDAVQSAR
FT                   LEGVEEELEELKRRLSALEGGGMPYLGDTTDDVARTTPHEGTESSFRNSGDGDVGGVAE
FT                   GDTAPEAAVEARPTGIVTGSGGDVVSSSSTQNRPANTEVRDLRARLNNLEAAFRRMNDK
FT                   LLKITPTDSQPKAKETSPIPPQSVGEPASGVEKELAESKEFESGVDKGDLEQVWGAIRK
FT                   LQGEAKGLGRLCATLERKKQDKGAAQESSPETGGGVSDEGQMKADKELGSKQGQESGDG
FT                   SPVLADLKGDEEVKERVKDLSKRLNQLQNRLVSVEGNVLNLDDRKADYSGLQRLADDVR
FT                   GLRQLLEMESSKGGSEGAAATAQKQEEQIQNVQKDLVEQMQMLQAVRDGTSGELDTLRK
FT                   YVEHIDRCKADAQLVANKAERDYVENALERLMREVEQVLNTTNASLIDTLDKSLNILRD
FT                   MLDGKAGKEDLVNMQRILSEEHDGGGVADVLMGFRGFRCLGCNRPVDKMRPRSLGSRLQ
FT                   PFVNRLPQNLPPDQIMGHVQDVPLIYNTNKDVKPSSA"
FT                   /protein_id="XP_845997.1"
FT   gene            complement(<982009..>982605)
FT                   /note="synonym: Tb07.28B13.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658585"
FT                   /locus_tag="Tb927.7.3750"
FT   mRNA            complement(<982009..>982605)
FT                   /db_xref="GI:72391407"
FT                   /db_xref="GeneID:3658585"
FT                   /locus_tag="Tb927.7.3750"
FT                   /transcript_id="XM_840905.1"
FT   CDS_pept        complement(982009..982605)
FT                   /locus_tag="Tb927.7.3750"
FT                   /gene_family="HOG000256237" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391408"
FT                   /db_xref="GeneID:3658585"
FT                   /translation="MRPLLVFGLRGTLLERIHASRVPSGMPGGAITVGMSRVWLRPSAM
FT                   ETLLALQQHCTLAVWSSTTARNTTPLMEAVFSQHAQKVNFAFVWSREHTTADEFRRVSA
FT                   TSRDDQHATVKDLREVYRRFPEIATPQNTVLIDDTPSKGKLNASNFLWLETCEELKIEN
FT                   PNVMPALRRFVEEHLLAEREDVRRLLPARVPWGQQ"
FT                   /protein_id="XP_845998.1"
FT   gene            complement(<984322..>985629)
FT                   /note="synonym: Tb07.28B13.50; phosphatidyl serine
FT                   synthase, putative"
FT                   /db_xref="GeneID:3658590"
FT                   /locus_tag="Tb927.7.3760"
FT   mRNA            complement(<984322..>985629)
FT                   /db_xref="GI:72391409"
FT                   /db_xref="GeneID:3658590"
FT                   /locus_tag="Tb927.7.3760"
FT                   /transcript_id="XM_840906.1"
FT   CDS_pept        complement(984322..985629)
FT                   /locus_tag="Tb927.7.3760"
FT                   /gene_family="HOG000256236" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidyl serine synthase, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase activity [goid 0003882];
FT                   go_process: phosphatidylserine biosynthesis [goid 0006659]"
FT                   /db_xref="GI:72391410"
FT                   /db_xref="GeneID:3658590"
FT                   /translation="MYTPRTLSVLIVLLAVFLFMVRYCHYLDMDVVSSVKLGLAASGVS
FT                   FIAFGATHLPDSMLLRPHPSFWRAVLAVGVLYLALLSFLLFQSLDTIRAILLLHDPSLK
FT                   SLPEERQYAEDCRIFTSDDPFLFVRTTFDIFIVAHTLGYFAKTIIVRDWRASTCISVVF
FT                   EIVEVTFQHALPNFKECWWDHLLLDVLICNGGGTLLGILALRIFHARRYNWVLSDNVKS
FT                   KCGKARRFISQLVPQSLVPYEWNVFLSPKRFVQFLLLLSLMTLQELNTFTVKHILHIPP
FT                   KHHLVVLRLVMWLFLAIPAVCEYYFYISGLDPTNKLGPSVWVSVVNLLFEVVLAGKLAV
FT                   EGNYFQEPMPGYIAIPWIISLISLCIWFAIFFGVLTLKQRMEKRCLLYAISSVFFYFGC
FT                   GCVLAMFAMGMPDLQIGREAFQRYVYPYERYIIFWR"
FT                   /protein_id="XP_845999.1"
FT   gene            complement(<986160..>987887)
FT                   /note="synonym: Tb07.28B13.40; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658584"
FT                   /locus_tag="Tb927.7.3770"
FT   mRNA            complement(<986160..>987887)
FT                   /db_xref="GI:72391411"
FT                   /db_xref="GeneID:3658584"
FT                   /locus_tag="Tb927.7.3770"
FT                   /transcript_id="XM_840907.1"
FT   CDS_pept        complement(986160..987887)
FT                   /locus_tag="Tb927.7.3770"
FT                   /gene_family="HOG000228406" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391412"
FT                   /db_xref="GeneID:3658584"
FT                   /translation="MRRNSFIRTISTYTRYPDEQQKLLYLAWSAAWLRKAEVEAARVQG
FT                   ITLYDLMQRAAAAFFKVVCTEVPNAKKWLVLCGSGNNGGDGFEVARRASSRGGGTCVTV
FT                   ITVAGSKPLPPEAAAAYAALQEERQKPGVEIVMKDARTWLEEGASLSGVDVVVDGLLGT
FT                   GMGGAPRGDYAAIIDRVNESGKPCFAIDIPSGLDAETGDVKGSCIRAVHTVTFIAVKPG
FT                   LLTGSARNHVGKLHYDSLDLADWLLLPDQQRDVFCRRLESSHLFPLLSRSEPRRCINKA
FT                   MNGKLLVVGGDSGFGGAIAMAAEAALRSGCGLVRVLTRAEHAAPIMCRCPEVMTQTLTE
FT                   ESLRMGLQWASCVAIGPGLGQGAWGIEALRVVEIHLRENINVPSVWDADALNILAAFSR
FT                   KRNDGEQQPPSVRLNNRVITPHSAEASRLLGCTVSEVEQNRYRAAEELVARYGGVVLLK
FT                   GPGTVLRIAEDARVPVPTGTAAELLFPACAVADVGNSGMASGGMGDVLTGIIAGLLAQQ
FT                   FPLWQATCAGCLVHGTAADLAASSQGGERGLTATTLFKYLPVCLNPTPEGFQASQCYL"
FT                   /protein_id="XP_846000.1"
FT   gene            complement(<988310..>990373)
FT                   /note="synonym: Tb07.28B13.30; poly(A) polymerase,
FT                   putative"
FT                   /db_xref="GeneID:3658593"
FT                   /locus_tag="Tb927.7.3780"
FT   mRNA            complement(<988310..>990373)
FT                   /db_xref="GI:72391413"
FT                   /db_xref="GeneID:3658593"
FT                   /locus_tag="Tb927.7.3780"
FT                   /transcript_id="XM_840908.1"
FT   CDS_pept        complement(988310..990373)
FT                   /locus_tag="Tb927.7.3780"
FT                   /gene_family="HOG000256235" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="poly(A) polymerase, putative"
FT                   /EC_number="2.7.7.19"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   polynucleotide adenylyltransferase activity [goid 0004652];
FT                   go_process: transcription [goid 0006350]"
FT                   /db_xref="GI:72391414"
FT                   /db_xref="GeneID:3658593"
FT                   /translation="MSRTDKSFLAKKIISSDGPSPAEEDHNVPLVEWCAAGIEPEEEAN
FT                   RRRSVLEHINCIVRAWIRSTMIAEFRMPAEAAAQVEGRIFATGSYRYNVHGSGSDIDIV
FT                   LIAPNRITREHFFNTLAPRLSHESRITELHCIRDARVPLIAMVADGIDIDLSFGSIRQD
FT                   RVPEVITDDLLQGLDDQSVLSCNAVRVAHNIMDLVPHKASFRQALRFIKAWGKARGIYS
FT                   NTFGFPSGIGWAILVAFVCQCHPNQNAAGMVVRFFRIYHTWFSPNPHGSGRENRAIYLT
FT                   ETMRVKTNLGRGWDPRESKSDALALFPVLTPAVPYGNACYNVTMTNLRQLCDEFARGHE
FT                   ICSSYIGMGVEETKMKLGPHGIWSKILEPVKFFGEYKYYLHVQVTCTDAEAYQGYVDAV
FT                   ESKIRFLWAGTAESRAQSLESFPHVRLRLNPKGYEAPEEVEARSRLLKKAPRGGGIPES
FT                   GAQGRAGASSNGNSSSVSSAVGGGSAGTAVKSFSRHYYFGMSVDSKAASMKVDLAPSIR
FT                   SFHNIVRQLRQYRDGVTRLPVITVEDMTKIPAFVKAAAGYKDPVSTTESDAGSGRACTP
FT                   SEADTATSSNGAAAATAGASEAADKSEGAPSAETAGVKRHRGEDDENDAAAMKVVAKDS
FT                   VNSAIADHAGPKLGKGSAEGGGARRDNSTGHSKVSQDDDEELGLEQALGLGF"
FT                   /protein_id="XP_846001.1"
FT   misc_feature    991077..1017490
FT                   /note="sequence corresponds to BAC RPCI93-6C8"
FT   gene            complement(<991146..>992879)
FT                   /note="synonym: Tb07.6C8.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658589"
FT                   /locus_tag="Tb927.7.3790"
FT   mRNA            complement(<991146..>992879)
FT                   /db_xref="GI:72391415"
FT                   /db_xref="GeneID:3658589"
FT                   /locus_tag="Tb927.7.3790"
FT                   /transcript_id="XM_840909.1"
FT   CDS_pept        complement(991146..992879)
FT                   /locus_tag="Tb927.7.3790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391416"
FT                   /db_xref="GeneID:3658589"
FT                   /translation="MDHIDLAEEREMGNGDPIMVLNVSVPYSANSSDRKSNVSSPLLSK
FT                   CASKQTSGVMWLTKPTLDPSCIRLCPLRRWVPDTQVSTCMAHGCNVAFSMFNRRHHCRV
FT                   CGRVFCSACCSETVNALVQSALEVQSNPIEACGGVDKTSLPSGRVSGTDIANGEDNISQ
FT                   QQQQGQVQFMNPTTVAAYRVCFACHYEVQLVVSRRDRNGEVRRKCRGELKMLQWSLLVR
FT                   VLSYLTMEELLGVSLVSSDFYFMSRDNVIWYRYNMTRCLREEELQRMLSTTLGSRNSTR
FT                   RQRLPQKQLGELTFGTDFDSITSAGAAKPTISLNARYNFTQFLDFTRRREATRCKGLSC
FT                   FSVGMRDLLSSPIKIALIGPCGVGKTSLMREWGRQRRPGDNSARFAVTPPTVTFNQFDK
FT                   TVFLTGGLTARAQLRVFDISGHPRFRELTRFVCASCHAVVICYDPQRKSSLMEAKAIIA
FT                   DVETKLGVQPVIVCGLIPPADAGRGGSAVEVSAEEATEISSRERGSLLCAWHEGKILFE
FT                   HVVQCLLDCIALGTSAISFTAPVSPLGVPVDSEEFSVNRSTAQELLRITMCPSAIDVLL
FT                   D"
FT                   /protein_id="XP_846002.1"
FT   gene            complement(<993303..>994043)
FT                   /note="synonym: Tb07.6C8.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658591"
FT                   /locus_tag="Tb927.7.3800"
FT   mRNA            complement(<993303..>994043)
FT                   /db_xref="GI:72391417"
FT                   /db_xref="GeneID:3658591"
FT                   /locus_tag="Tb927.7.3800"
FT                   /transcript_id="XM_840910.1"
FT   CDS_pept        complement(993303..994043)
FT                   /locus_tag="Tb927.7.3800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391418"
FT                   /db_xref="GeneID:3658591"
FT                   /translation="MKATEEEAKNGMFYGTAALGGSGTQYSERAQRIRRQEMFFRHLRR
FT                   LVVPAFAGYGLYVTRPHEGHFIRYLVDRSRHEAFFNEIHSVVAADDGDKPVVANAAAGD
FT                   GSVASVWVRWLPLNSGASGRNGASDANEEDAIRIANRRKLFSSTGASASRGAEGTSPCG
FT                   WKSLPQRHELSEKLWELRNNTKRHDASVTSDTSGSGEKLLPVRLEFDDWLFFATGALIF
FT                   TDPLGAVVRRHRFFGICGSLWWEL"
FT                   /protein_id="XP_846003.1"
FT   gene            complement(<994663..>995808)
FT                   /note="synonym: Tb07.6C8.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658592"
FT                   /locus_tag="Tb927.7.3810"
FT   mRNA            complement(<994663..>995808)
FT                   /db_xref="GI:72391419"
FT                   /db_xref="GeneID:3658592"
FT                   /locus_tag="Tb927.7.3810"
FT                   /transcript_id="XM_840911.1"
FT   CDS_pept        complement(994663..995808)
FT                   /locus_tag="Tb927.7.3810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391420"
FT                   /db_xref="GeneID:3658592"
FT                   /translation="MFRLAGSRLAVSITATLLEKKRGNAAEPIPTNIAASASMEVAPRR
FT                   VGTVTSFMHRRGYGFITALQLSSSDSPDTQCLASAELEAAVRENAENFFFPRSSLDGGF
FT                   YVSQGQTVTFDVLPSPQVNEQVEKEHREATEDIEASGDPPKSLPVARHIRLCDLDTGKE
FT                   RPVTPVMLHGCVQSWDTITGSGCIAELDLAGNLHDDAPCFNFSLEDLDVVNISDLHQGC
FT                   FVRFCIERGDRNAARRVIIDRSTGKRHAPLQQWRSSQGASRALGFAADSKPAAARYYGT
FT                   VRELVDGRFGFIVLEETGESIFFHMSNVDQDDQNASIKVGDTVSFILRGVSQGKHAGKR
FT                   TCLKIRRCSPQPSLASRNHNSGKGTNHLSDDDDDDEFNLLE"
FT                   /protein_id="XP_846004.1"
FT   gene            complement(<996424..>998514)
FT                   /note="synonym: Tb07.6C8.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658599"
FT                   /locus_tag="Tb927.7.3820"
FT   mRNA            complement(<996424..>998514)
FT                   /db_xref="GI:72391421"
FT                   /db_xref="GeneID:3658599"
FT                   /locus_tag="Tb927.7.3820"
FT                   /transcript_id="XM_840912.1"
FT   CDS_pept        complement(996424..998514)
FT                   /locus_tag="Tb927.7.3820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391422"
FT                   /db_xref="GeneID:3658599"
FT                   /translation="MDLSEKRRQLEEIREARKAKERSVLQQRQNVVPPKRESITGSEGL
FT                   VVGGSISGSTGCARTRCSVSVSKCPGDGDRAVDTKECKPACGNLSSASLSACSISRSVA
FT                   EDGVGCSAARRQKTLTTSAPSVSAKTLCSASHSSVKSVENTGSDPAKGGCGVGKASVTS
FT                   VDRDIVGSVFTSFGGSKSPCVGSAGAAFMTLEHSIFLGSVCGSGSRCVLDVRVLNCPSS
FT                   EDGDACSKGLLFVAASLSEACNVENLSDMMMQGATGGSTFRGFDSVGLVLLICIQQGTD
FT                   GGGPVVVPLCFSSEVRTLTYTKRCPHLLFGGAANGCIVAWRIDQALQQCGRAASPPVLT
FT                   TFGKSSSLSYGCLPSSSALSASAPVYPCVQSFPSPHSHQTQVLAMAVHGDLGSHHLFSI
FT                   SEHGQVCMWEPSKLCLPSSTRESLVQGMAPGCVGSCAAFVSTTADAMNKVFFGCLNGHI
FT                   LEGGAKGPGVVDMQPISGSTVGVDKSTHENPSCRVRHPKEKCYDTPAHCAAVVAVAPHP
FT                   FHGDPHVSATLLSAAADGSCYLWLGSRCAAIEGLTSQVNCLQWSPTHSAVFAAGESSGR
FT                   VAIWDLGRSNFPVASVYPQTGARLGSGGSFSSKPSTTTSARKSGTFVRNYAPISSLSFS
FT                   EDGSRVVCGSSDGEVHVFHLQGDLVKEQRAQSRERATEGGGNSYASTAVDCVAEELPPA
FT                   SV"
FT                   /protein_id="XP_846005.1"
FT   misc_feature    998560..998624
FT                   /note="A-rich"
FT   misc_feature    complement(998560..998624)
FT                   /note="T-rich"
FT   misc_feature    998638..998672
FT                   /note="AT_rich"
FT   misc_feature    complement(998638..998672)
FT                   /note="AT_rich"
FT   misc_feature    complement(998727..1004928)
FT                   /note="Repetitive protein. Number of repetitive motif
FT                   uncertain."
FT   gene            complement(<998727..>1004138)
FT                   /note="synonym: Tb07.6C8.180; kinesin K39, putative"
FT                   /db_xref="GeneID:3658598"
FT                   /locus_tag="Tb927.7.3830"
FT   mRNA            complement(<998727..>1004138)
FT                   /db_xref="GI:72391423"
FT                   /db_xref="GeneID:3658598"
FT                   /locus_tag="Tb927.7.3830"
FT                   /transcript_id="XM_840913.1"
FT   CDS_pept        complement(998727..1004138)
FT                   /locus_tag="Tb927.7.3830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin K39, putative"
FT                   /note="Repetitive protein. Number of repetitive motif
FT                   uncertain. This gene is within a region of repeats and
FT                   might be misassembled; go_component: microtubule associated
FT                   complex [goid 0005875]; go_function: motor activity [goid
FT                   0003774]; go_function: ATP binding [goid 0005524];
FT                   go_process: microtubule-based process [goid 0007017]"
FT                   /db_xref="GI:72391424"
FT                   /db_xref="GeneID:3658598"
FT                   /translation="MISNIRRAGEQNSGKNNSTMTDESRNSLTTTEMTTNACDESIKVA
FT                   VRVRPQNTSEMSGTHKLALRANTSYSTITLIDHHSKSSQCPRAQTFQFDNIFCSCGCTD
FT                   EGGLPPAGQLEVYEAIGRPLVMHAFNGYNSCLFAYGQTGSGKTYTMMGGDPGSVSGVDA
FT                   GVIPRLCLEIFEKRARIEGKGHSRWKVTVGYVEVYNERVSDLLARRRKGSREDVFVDVR
FT                   EHPTMGVFIEGQRLQEVSSVEEVVELIELGNRVRHTASTKMNDRSSRSHAIFMLILHEE
FT                   RSTQTASGQVITTAGMSSRMNLVDLAGSERVAQSEVVGQQFNEARYINLSLTTLGRVID
FT                   MLADMAKNKSSQWSTPPYRESKLTYILKDSLGGNSKTFMIATVSPSALNYEETLSTLRY
FT                   ASRARDIVNMTRVNEDPRARRIRELEEQMEQMRQDIKGKDPTYVRELEEKLVLLEAEAQ
FT                   KRAADLHALEKEREKNIIREKMLYATEVEREELLIKATELERQVEESKRRAEYHEEMSQ
FT                   RLKDEYAQREQELLEKVRQHRAEIEGIRERKDAEMLSSQQQLSRVMSELEQERHSREEA
FT                   LHILRERQEQLSAALCNSQQSSEKHTELQQQNEELSHRMQKLLEECEAQQRILSDLEVF
FT                   RLERNELEEIAQFLDLKLEETEHRHIKTINHLLTTIGMHNLWQAELLTAVGTEVETQLT
FT                   KCNQHHFDQRAAMEKNHKLFQMEQHQMTKKLEQKILMLEKEIEEAKKQLDTTKQSEAAI
FT                   TNKARQAEDARAAVERNLETVEAERDELQQRLDATSNDLKSQLRNSEDARAAVERNLET
FT                   VEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLK
FT                   SQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETV
FT                   EAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKS
FT                   QLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVE
FT                   AERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQ
FT                   LRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEA
FT                   ERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQL
FT                   RNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAE
FT                   RNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLR
FT                   NSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAER
FT                   NELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRN
FT                   SEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERN
FT                   ELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNS
FT                   EDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNE
FT                   LQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSE
FT                   DARAAVERNLETVEAERNELQQRLDATSNDLKSQLRNSEDARAAVERNLETVEAERNEL
FT                   QQRLDVFERECAVLNIRLSYLRRKLLSGFVVGEEPYKLTRKIINIGK"
FT                   /protein_id="XP_846006.1"
FT   gene            complement(<1004538..>1004699)
FT                   /note="synonym: Tb07.6C8.170; kinesin-like protein,
FT                   fragment, putative"
FT                   /db_xref="GeneID:3658597"
FT                   /locus_tag="Tb927.7.3840"
FT   mRNA            complement(<1004538..>1004699)
FT                   /db_xref="GI:72391425"
FT                   /db_xref="GeneID:3658597"
FT                   /locus_tag="Tb927.7.3840"
FT                   /transcript_id="XM_840914.1"
FT   CDS_pept        complement(1004538..1004699)
FT                   /locus_tag="Tb927.7.3840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin-like protein, fragment, putative"
FT                   /note="This gene is within a region of repeats and might be
FT                   misassembled; go_component: microtubule associated complex
FT                   [goid 0005875]; go_function: motor activity [goid 0003774];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   vacuolar transport [goid 0007034]"
FT                   /db_xref="GI:72391426"
FT                   /db_xref="GeneID:3658597"
FT                   /translation="MHAFNGYNSCLFAYGQTGSGKTYTMMGGDPGSVSGVDAGVIPLPG
FT                   SWRNSGHG"
FT                   /protein_id="XP_846007.1"
FT   gene            complement(<1004929..>1007913)
FT                   /note="synonym: Tb07.6C8.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658600"
FT                   /locus_tag="Tb927.7.3850"
FT   mRNA            complement(<1004929..>1007913)
FT                   /db_xref="GI:72391427"
FT                   /db_xref="GeneID:3658600"
FT                   /locus_tag="Tb927.7.3850"
FT                   /transcript_id="XM_840915.1"
FT   CDS_pept        complement(1004929..1007913)
FT                   /locus_tag="Tb927.7.3850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391428"
FT                   /db_xref="GeneID:3658600"
FT                   /translation="MPFPQTPLHGILKLMLHGRGLPKVGTSRPHWTLSTTELICARMHC
FT                   WRSALTCYDFLHKRRLPVAAEAIFFLYLQLRSVSSGDSCDSVSCDSVRHCSIPFLPPRG
FT                   DAVLDGAPPKPASMKESNSIHCIANDVSDLELPFATLFLLRCAEHQSTLRPLYHRLQFA
FT                   VRKLRNSSQARADGKTSADASGGRFLDHEEDKDRCVFLKGLLSVLSAPCVIINLSLEHN
FT                   GQRGRWPDVLRTVHNLHHYNLLNSYLIELHKMYTRCEVKYVLTKMGHDVHYRKCIEPPS
FT                   LAPLMGMLLTEWETYWSMLKGKAEPRCALARMLSPASSDYPLPPECAVGGTDTVERDER
FT                   IPWLTMAADGNSGGEYGNCASDLTPLRMKLMLEESSLEVLQFVGLTAFAVEGRGDVQAE
FT                   EEEVFHRLVEVATRGADFAFCARLAQTWANPYLIRPLAGRQSPHIASKLLLLTRLIAKG
FT                   SASEDVLKMLDDWSSLLSAGCSDSAACLSCASFAALLCPEVVAALAARLTPSLFREEVV
FT                   EKRLLPCNFALGLHVQEVVVDTLRRGGFHRVAEEFSVRQACIEVAALCKENERCRPEEA
FT                   VGVMRKYFSQKLYSGDRKHLLFELLEFVGEPRYPQVVDLLLSMCKEPLLEGDVPELVVE
FT                   MPVLLFDVICYMITERQRPGDAAVLFRLTIDAIRGGGSTPLRGKCEEVPEALHQHSRTY
FT                   LAIEGAVDSFTMAVASLGLVKGCDKAPRSGCHDDALQWLKLLSEIPSTLFDEPVLVVWL
FT                   FWTMKAMTQHEEARTEWGHTATSESVTKAGVLKASGNLSRSLKKCGARAVFPPMLLHWL
FT                   SSNANISWAVATKWLSDHAGEEISKNCRFAFLRLPLGPAALEGLPCRESKEQLFLAVEE
FT                   ELKTDVLHYTNCNLCSIKPPKLNLKSSIEELFERIRYTLLRAWYYELRDPRDTVAGTPV
FT                   HCGSSESHDPLSLVSGLQPQGGLQRKASYILTMCSVQRALRFLWDGGAATPLEAVDGSS
FT                   APRRV"
FT                   /protein_id="XP_846008.1"
FT   gene            complement(<1008426..>1009145)
FT                   /note="synonym: Tb07.6C8.150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658601"
FT                   /locus_tag="Tb927.7.3860"
FT   mRNA            complement(<1008426..>1009145)
FT                   /db_xref="GI:72391429"
FT                   /db_xref="GeneID:3658601"
FT                   /locus_tag="Tb927.7.3860"
FT                   /transcript_id="XM_840916.1"
FT   CDS_pept        complement(1008426..1009145)
FT                   /locus_tag="Tb927.7.3860"
FT                   /gene_family="HOG000256228" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391430"
FT                   /db_xref="GeneID:3658601"
FT                   /translation="MQQKYLGRDEVGGVEVIMRQMLATILPYGIVFGSVLLKLPQIVKI
FT                   LRNHSADGISIISLVVELMSCVISSSWGIARSLMFKDYGESTLIMIEMFLLLLIVGCMQ
FT                   RKLLITVLVFIVAVFLLVFMSAGYAPRNIHEGMLRLQIFFALGSRIPQIVINYQNKSTG
FT                   QLSALTFFLAMSGGISRLLTTFHNIPSDKGRDIMLTQFGVVVFLNFVIVMQCILYKAAD
FT                   RRQVGTTEAKAVVKKNN"
FT                   /protein_id="XP_846009.1"
FT   repeat_region   1009390..1009409
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1009390..1009409)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<1009516..>1010349)
FT                   /note="synonym: Tb07.6C8.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658594"
FT                   /locus_tag="Tb927.7.3870"
FT   mRNA            complement(<1009516..>1010349)
FT                   /db_xref="GI:72391431"
FT                   /db_xref="GeneID:3658594"
FT                   /locus_tag="Tb927.7.3870"
FT                   /transcript_id="XM_840917.1"
FT   CDS_pept        complement(1009516..1010349)
FT                   /locus_tag="Tb927.7.3870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391432"
FT                   /db_xref="GeneID:3658594"
FT                   /translation="MRQYNTCILGFLPPFTDTLKNMLINFLVILMLWGSSIFGEMLEPN
FT                   YRGHGTQNTRSGTSSTSSTLVRHTGHIPWVNWPQLVHRVSVARCTVLSNGFSGDVNAND
FT                   TYDGQRDLHLLATSRSQSPIALCHLPVFIFFHKENCPACRMLIEELGVSPEFELLSEYM
FT                   TMVSAETVDEILRSSPYPRPAFGEIHPRLRGNKRRTKQNGKGEDEMIKAMSPQGEYYPR
FT                   VLFLFPHNGSVMPVFNNGLDHDSAHIHFYGRAKSLLRGMMSAIRIMDAKVDFDEL"
FT                   /protein_id="XP_846010.1"
FT   misc_feature    1010523..1010543
FT                   /note="AT_rich"
FT   misc_feature    complement(1010523..1010543)
FT                   /note="AT_rich"
FT   gene            complement(<1011321..>1013651)
FT                   /note="synonym: Tb07.6C8.130; protein kinase, putative"
FT                   /db_xref="GeneID:3658595"
FT                   /locus_tag="Tb927.7.3880"
FT   mRNA            complement(<1011321..>1013651)
FT                   /db_xref="GI:72391433"
FT                   /db_xref="GeneID:3658595"
FT                   /locus_tag="Tb927.7.3880"
FT                   /transcript_id="XM_840918.1"
FT   CDS_pept        complement(1011321..1013651)
FT                   /locus_tag="Tb927.7.3880"
FT                   /gene_family="HOG000256225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72391434"
FT                   /db_xref="GeneID:3658595"
FT                   /translation="MEPADGLKRCGASTDTIIEEIKALAKSMLESTEAIRRRSRNVESC
FT                   KSYDALLSVLESTAPLTKHPARQQRTQGHNDVICEFPVTRGGGISGGATANNAKPGNCY
FT                   AKKVSGDAAEFCESELDDTEAEVTSCSPEACGEDGHDLGGFYPNSKAQLFSACTMGADF
FT                   SADSDDNVYDGVKTQVVFKAVDPALYQDISGCTWQPEPLLLHSETGEAVEDSSEDKDED
FT                   KESDYMDDAAVVGTKKVYRVPSFPFGGGITEGQARFLSKTFSETIRRGGLSSSKRPAHV
FT                   TVKDFVGYKYDECATTDAERSRFKPVSPFEFVVELERGVMFDAVRAREERRQEFRRLAK
FT                   EGKAPVTMGSFNLRVIMDPIKTGFEEEKTFPIERGTIVADRYQIVEMLGKATFSRAVRC
FT                   YDLSQPIYEDDVKVEDKDRTATTDAQNRCVDTENGGVSNDAKKRKVVGYVEVCLKIINN
FT                   SKDFFDQSLDEIRLLTLINKYKDPDKAHVIRLIDSFYYKEHTMLVTELLSDNLYEYSKY
FT                   NREEEETFYFTIPRLRRIARQITEALTYVHSLSLIHADLKPENILFVSHRRCLIKVIDF
FT                   GSSCFLSDHLSSYIQSRSYRAPEVILGCDYDGRIDVWSLGAILAELVTGEVLFTSETVP
FT                   EMLARIVYVCGRPFPRRMLWEGRHTSKFINKFGCIYEQGNKDGDDPGEDSSYYYLYTPV
FT                   PQSSGIKNPDAEGTDAENNGTRDTESLISEERPYRVLREKLAAHNVTDSAFISFVEACL
FT                   TLDHKARPRSKDLLSHPFLAQVD"
FT                   /protein_id="XP_846011.1"
FT   misc_feature    1017491..1164122
FT                   /note="sequence corresponds to BAC RPCI93-5F10"
FT   gene            <1019311..>1020231
FT                   /note="synonym: Tb07.5F10.890; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3658596"
FT                   /locus_tag="Tb927.7.3890"
FT   mRNA            <1019311..>1020231
FT                   /db_xref="GI:72391435"
FT                   /db_xref="GeneID:3658596"
FT                   /locus_tag="Tb927.7.3890"
FT                   /transcript_id="XM_840919.1"
FT   CDS_pept        1019311..1020231
FT                   /locus_tag="Tb927.7.3890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72391436"
FT                   /db_xref="GeneID:3658596"
FT                   /translation="MAFLLSAWLPTFRTYFSLFSTIVWQVMEGMLLDAVSKSMVAEGAK
FT                   LVPKYGVRNSALMSLSVNALKGNPTYDKARTLGNRELSRLFPRGFSIAVVEHIVASSNQ
FT                   TAHLRLEECFSKYAILSTVAKNSDTYQLGCYKPPGVREVVSEAMDSKFSALLPYCEHWA
FT                   EAVALECLPSNTPFAAKLALEFIDTTCYYAERMRSLGSVVEAGNILLQSRISDPFAAEP
FT                   HSIGVSGGVKKGEKNDAFWQKFATTVPLSSGPHASHGMLGYEWYILRMKVGAILSLGML
FT                   SFMGEKSRSRLETKSMVRSIICGIL"
FT                   /protein_id="XP_846012.1"
FT   gene            <1021359..>1021901
FT                   /note="synonym: Tb07.5F10.880; vacuolar transporter
FT                   chaperone, putative"
FT                   /db_xref="GeneID:3658604"
FT                   /locus_tag="Tb927.7.3900"
FT   mRNA            <1021359..>1021901
FT                   /db_xref="GI:72391437"
FT                   /db_xref="GeneID:3658604"
FT                   /locus_tag="Tb927.7.3900"
FT                   /transcript_id="XM_840920.1"
FT   CDS_pept        1021359..1021901
FT                   /locus_tag="Tb927.7.3900"
FT                   /gene_family="HOG000256223" [ FAMILY / ALN /