(data stored in ACNUC8465 zone)

HOGENOMDNA: TRBRU1_7

ID   TRBRU1_7; SV 1; empty ; DNA; empty ; INV; 2481190 BP.
XX
AC   NC_007281;
XX
DE   Trypanosoma brucei TREU927 chromosome 8, complete sequence.
XX
OS   Trypanosoma brucei TREU927
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
XX
RN   [1]
RP   1-2481190
RX   PUBMED; 16020726.
RA   Berriman,M., Ghedin,E., Hertz-Fowler,C., Blandin,G., Renauld,H.,
RA   Bartholomeu,D.C., Lennard,N.J., Caler,E., Hamlin,N.E., Haas,B., Bohme,U.,
RA   Hannick,L., Aslett,M.A., Shallom,J., Marcello,L., Hou,L., Wickstead,B.,
RA   Alsmark,U.C.M., Arrowsmith,C., Atkin,R.J., Barron,A.J., Bringaud,F.,
RA   Brooks,K., Carrington,M., Cherevach,I., Chillingworth,T.-J., Churcher,C.,
RA   Clark,L.N., Corton,C.H., Cronin,A., Davies,R.M., Doggett,J., Djikeng,A.,
RA   Feldblyum,T., Field,M.C., Fraser,A., Goodhead,I., Hance,Z., Harper,D.,
RA   Harris,B.R., Hauser,H., Hostetler,J., Ivens,A., Jagels,K., Johnson,D.,
RA   Johnson,J., Jones,K., Kerhornou,A.X., Koo,H., Larke,N., Landfear,S.,
RA   Larkin,C., Leech,V., Line,A., Lord,A., MacLeod,A., Mooney,P.J., Moule,S.,
RA   Martin,D.M.A., Morgan,G.W., Mungall,K., Norbertczak,H., Ormond,D., Pai,G.,
RA   Peacock,C.S., Peterson,J., Quail,M.A., Rabbinowitsch,E., Rajandream,M.-A.,
RA   Reitter,C., Salzberg,S.L., Sanders,M., Schobel,S., Sharp,S., Simmonds,M.,
RA   Simpson,A.J., Tallon,L., Turner,C.M.R., Tait,A., Tivey,A.R., Van Aken,S.,
RA   Walker,D., Wanless,D., Wang,S., White,B., White,O., Whitehead,S.,
RA   Woodward,J., Wortman,J., Adams,M.D., Embley,T.M., Gull,K., Ullu,E.,
RA   Barry,J.D., Fairlamb,A.H., Opperdoes,F., Barrell,B.G., Donelson,J.E.,
RA   Hall,N., Fraser,C.M., Melville,S.E. and El-Sayed,N.M.;
RT   "The Genome of the African Trypanosome Trypanosoma brucei";
RL   Science 309 (5733), 416-422 (2005)
XX
RN   [2]
RP   1-2481190
RX   PUBMED; 16020724.
RA   El-Sayed,N.M.A., Myler,P.J., Blandin,G., Berriman,M., Crabtree,J.,
RA   Aggarwal,G., Caler,E., Renauld,H., Worthey,E.A., Hertz-Fowler,C.,
RA   Ghedin,E., Peacock,C., Bartholomeu,D.C., Haas,B.J., Tran,A.-N.,
RA   Wortman,J.R., Alsmark,U.C.M., Angiuoli,S., Anupama,A., Badger,J.,
RA   Bringaud,F., Cadag,E., Carlton,J.M., Cerqueira,G.C., Creasy,T.,
RA   Delcher,A.L., Djikeng,A., Embley,T.M., Hauser,C., Ivens,A.C.,
RA   Kummerfeld,S.K., Pereira-Leal,J.B., Nilsson,D., Peterson,J.,
RA   Salzberg,S.L., Shallom,J., Silva,J.C., Sundaram,J., Westenberger,S.,
RA   White,O., Melville,S.E., Donelson,J.E., Andersson,B., Stuart,K.D. and
RA   Hall,N.;
RT   "Comparative genomics of trypanosomatid parasitic protozoa";
RL   Science 309 (5733), 404-409 (2005)
XX
RN   [3]
RP   1-2481190
RA   Ghedin,E., Blandin,G., Bartholomeu,D., Caler,E., Haas,B., Hannick,L.,
RA   Shallom,J., Hou,L., Djikeng,A., Feldblyum,T., Hostetler,J., Johnson,J.,
RA   Jones,K., Koo,H.L., Larkin,C., Pai,G., Peterson,J., Khalak,H.G.,
RA   Salzberg,S., Simpson,A.J., Tallon,L., Van Aken,S., Wanless,D., White,O.,
RA   Wortman,J., Fraser,C.M. and El-Sayed,N.M.A.;
RT   "Sequencing, closure, and annotation of Trypanosoma brucei chromosomes 2
RT   through 8";
RL   Unpublished
XX
RN   [4]
RP   1-2481190
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (24-OCT-2006) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [5]
RP   1-2481190
RA   Haas,B., Blandin,G. and El-Sayed,N.;
RT   "Direct Submission";
RL   Submitted (12-APR-2005) The Institute for Genomic Research, 9712 Medical
RL   Center Dr, Rockville, MD 20850, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000071.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2481190
FT                   /mol_type="genomic DNA"
FT                   /isolate="927/4 GUTat10.1"
FT                   /note="single VAT derivative of TREU (Trypanosomiasis
FT                   Research Edinburgh University) 927/4 (GPAL/KE/70/EATRO
FT                   1534)"
FT                   /db_xref="taxon:185431"
FT                   /organism="Trypanosoma brucei TREU927"
FT                   /chromosome="8"
FT   misc_feature    1..150600
FT                   /note="sequence corresponds to BAC RPCI93-25E9"
FT   gene            2..1327
FT                   /note="synonym: Tb08.25E9.10; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658986"
FT                   /locus_tag="Tb927.8.100"
FT                   /pseudo
FT   misc_feature    1649..1670
FT                   /note="AT_rich"
FT   gene            3247..4698
FT                   /note="synonym: Tb08.25E9.20; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658988"
FT                   /locus_tag="Tb927.8.110"
FT                   /pseudo
FT   repeat_region   4975..5002
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            5498..6343
FT                   /note="synonym: Tb08.25E9.30; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3658989"
FT                   /locus_tag="Tb927.8.120"
FT                   /pseudo
FT   gene            <7309..>8886
FT                   /note="synonym: Tb08.25E9.50; variant surface glycoprotein
FT                   (VSG, atypical), putative"
FT                   /db_xref="GeneID:3658990"
FT                   /locus_tag="Tb927.8.130"
FT   mRNA            <7309..>8886
FT                   /db_xref="GI:72392164"
FT                   /db_xref="GeneID:3658990"
FT                   /locus_tag="Tb927.8.130"
FT                   /transcript_id="XM_841790.1"
FT   CDS_pept        7309..8886
FT                   /locus_tag="Tb927.8.130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="variant surface glycoprotein (VSG, atypical),
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_process: antigenic variation [goid 0020033]"
FT                   /db_xref="GI:72392165"
FT                   /db_xref="GeneID:3658990"
FT                   /translation="MSTKKHLVSLIHVYAAASIKESNAAAGEGKNIREFHILCSLVELC
FT                   KKTPINLPGSSLLDDDVRAIELVNMSGSTDEWQSQFPTTDKVSGEKSIDCEKQPKQISC
FT                   HEKYDKWRATRKALEAEPNKEIKQTPAKGIQNTAYGRRIHIQINDIAKEAQVIYNNYKA
FT                   ETAPVLNGINDKLRIHFGDALYGKQDRPLAGAPADKWQASGTRNNDCKGAKAGISPRGD
FT                   LFCLCAQDTTIAEHMCGDTVTAAGSNWLLATVAPLIDGMASKCAGKAKPTITASYIRHA
FT                   LETFDSALKSHTQGTKDAVVLGTPHSSGVCGGQASVACVDYTAAVMPKEQGKHNDIKWY
FT                   NELTDASKALDNYAAAMAEEKAAQTKIQKLKQEANRLFQTLKVQEPAAIPPISQLPRID
FT                   PLELKKKCEQFHNKSKECTENGCKWKGTDETTGTCDVDETKVTSQTNAAGTGEASNEET
FT                   ATSGCAKHKDKTECDADKKDDKQNCAFRKGKDVEDDKDTEKCRSSGFLVNNKLVQSIAA
FT                   VFVSLVPS"
FT                   /protein_id="XP_846883.1"
FT   misc_feature    8934..8996
FT                   /note="AT_rich"
FT   misc_feature    9072..9117
FT                   /note="AT_rich"
FT   gene            10953..11472
FT                   /note="synonym: Tb08.25E9.79; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658998"
FT                   /locus_tag="Tb927.8.140"
FT                   /pseudo
FT   repeat_region   complement(12007..17270)
FT                   /transposon="ingi"
FT   repeat_region   complement(12007..12260)
FT                   /transposon="RIME-B"
FT   repeat_region   complement(17023..17270)
FT                   /transposon="RIME-A"
FT   gene            18907..20445
FT                   /note="synonym: Tb08.25E9.110; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658999"
FT                   /locus_tag="Tb927.8.150"
FT                   /pseudo
FT   misc_feature    20706..20730
FT                   /note="AT_rich"
FT   misc_feature    20858..20890
FT                   /note="AT_rich"
FT   misc_feature    21420..21539
FT                   /note="T-rich"
FT   gene            21627..22031
FT                   /note="synonym: Tb08.25E9.120; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659000"
FT                   /locus_tag="Tb927.8.160"
FT                   /pseudo
FT   misc_feature    22114..22151
FT                   /note="AT_rich"
FT   repeat_region   22262..22311
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            <24041..>25522
FT                   /note="synonym: Tb08.25E9.140; variant surface glycoprotein
FT                   (VSG, atypical), putative"
FT                   /db_xref="GeneID:3659001"
FT                   /locus_tag="Tb927.8.170"
FT   mRNA            <24041..>25522
FT                   /db_xref="GI:72392166"
FT                   /db_xref="GeneID:3659001"
FT                   /locus_tag="Tb927.8.170"
FT                   /transcript_id="XM_841791.1"
FT   CDS_pept        24041..25522
FT                   /locus_tag="Tb927.8.170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="variant surface glycoprotein (VSG, atypical),
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_process: antigenic variation [goid 0020033]"
FT                   /db_xref="GI:72392167"
FT                   /db_xref="GeneID:3659001"
FT                   /translation="MRESQKKQQQTLILLAATTLLNVTAVALAQPNKVCTTPCGCKSRV
FT                   IKRLEVYTTQFERALGQHQANLLDFSKLILAAVAADNQLKRKAAAALAPAAAILARCTD
FT                   QLNAAAPPLTAAAYQAGYTAATYAAQHALTTMAGTLKIEPTGGKTLKAETITTKTLGSI
FT                   PPAMCPTEDQTETGVKITTESEKDEPKLATIKLHSNAQAKCTATGANSCHDNALADSGN
FT                   LEIQLTYAMGQKKTPWTWNSNTNADFQTTHSAEINLLRGNESDLDSKLTTLRTAHALDS
FT                   CRKAIAEYSALSSDPNWALFNAKALLDNFESEKPSDISSDRLEQATNKAYGPDGTNYKN
FT                   NVWHKIEQTQVPTVQHEQLKLQPIKSLSSTDEIGAALARVFINQQKKETQTHQKQGQKD
FT                   DDTKENECSNKNGDKCKGDCVLDGDICKPKKKGEDENKEKDGKTASTCAGKDEKTCGTT
FT                   QGCSWENNACKDFSILLTKQFALSMVSAAFVAFLF"
FT                   /protein_id="XP_846884.1"
FT   misc_feature    25810..25987
FT                   /note="T-rich"
FT   repeat_region   26233..26804
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttaggg"
FT                   /rpt_type="tandem"
FT   gene            27357..27734
FT                   /note="synonym: Tb08.25E9.150; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659002"
FT                   /locus_tag="Tb927.8.180"
FT                   /pseudo
FT   gene            29452..31046
FT                   /note="synonym: Tb08.25E9.180; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658987"
FT                   /locus_tag="Tb927.8.190"
FT                   /pseudo
FT   misc_feature    31317..31341
FT                   /note="AT_rich"
FT   repeat_region   31388..31425
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            32272..33285
FT                   /note="synonym: Tb08.25E9.190; UDP-Gal or
FT                   UDP-GlcNAc-dependent glycosyltransferase (pseudogene),
FT                   putative"
FT                   /db_xref="GeneID:3659003"
FT                   /locus_tag="Tb927.8.200"
FT                   /pseudo
FT   gene            33526..35078
FT                   /note="synonym: Tb08.25E9.200; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659004"
FT                   /locus_tag="Tb927.8.210"
FT                   /pseudo
FT   gene            36916..38437
FT                   /note="synonym: Tb08.25E9.210; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659005"
FT                   /locus_tag="Tb927.8.220"
FT                   /pseudo
FT   misc_feature    38500..38538
FT                   /note="AT_rich"
FT   gene            39787..40888
FT                   /note="synonym: Tb08.25E9.220; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3658991"
FT                   /locus_tag="Tb927.8.230"
FT                   /pseudo
FT   gene            41073..42557
FT                   /note="synonym: Tb08.25E9.230; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658992"
FT                   /locus_tag="Tb927.8.240"
FT                   /pseudo
FT   misc_feature    42676..42715
FT                   /note="AT_rich"
FT   gene            43850..45373
FT                   /note="synonym: Tb08.25E9.250; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658993"
FT                   /locus_tag="Tb927.8.250"
FT                   /pseudo
FT   misc_feature    45436..45463
FT                   /note="AT_rich"
FT   repeat_region   45690..45722
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            46608..48055
FT                   /note="synonym: Tb08.25E9.260; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658994"
FT                   /locus_tag="Tb927.8.260"
FT                   /pseudo
FT   misc_feature    48099..48128
FT                   /note="AT_rich"
FT   repeat_region   48284..48326
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(48777..53503)
FT                   /transposon="DIRE"
FT   repeat_region   53504..58236
FT                   /transposon="ingi"
FT   repeat_region   53504..53751
FT                   /transposon="RIME-A"
FT   misc_feature    60283..60311
FT                   /note="AT_rich"
FT   gene            62486..64023
FT                   /note="synonym: Tb08.25E9.340; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658995"
FT                   /locus_tag="Tb927.8.270"
FT                   /pseudo
FT   repeat_region   64220..64261
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   64297..64329
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   64381..64409
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    65465..65495
FT                   /note="AT_rich"
FT   gene            65838..67268
FT                   /note="synonym: Tb08.25E9.360; variant surface glycoprotein
FT                   (VSG, atypical), putative"
FT                   /db_xref="GeneID:3658996"
FT                   /locus_tag="Tb927.8.280"
FT                   /pseudo
FT   misc_feature    67301..67321
FT                   /note="AT_rich"
FT   gene            69197..70716
FT                   /note="synonym: Tb08.25E9.370; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3658997"
FT                   /locus_tag="Tb927.8.290"
FT                   /pseudo
FT   gene            72810..74211
FT                   /note="synonym: Tb08.25E9.380; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659006"
FT                   /locus_tag="Tb927.8.300"
FT                   /pseudo
FT   gene            75869..77280
FT                   /note="synonym: Tb08.25E9.390; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659007"
FT                   /locus_tag="Tb927.8.310"
FT                   /pseudo
FT   repeat_region   complement(79400..83213)
FT                   /transposon="DIRE"
FT   repeat_region   complement(83134..83213)
FT                   /transposon="RIME-A"
FT   repeat_region   83970..83992
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    84273..84307
FT                   /note="AT_rich"
FT   misc_feature    84500..84531
FT                   /note="AT_rich"
FT   gene            84581..86013
FT                   /note="synonym: Tb08.25E9.410; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659008"
FT                   /locus_tag="Tb927.8.320"
FT                   /pseudo
FT   repeat_region   86293..86371
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   86405..86445
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            87463..88974
FT                   /note="synonym: Tb08.25E9.420; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659009"
FT                   /locus_tag="Tb927.8.330"
FT                   /pseudo
FT   repeat_region   89330..89358
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            90925..92417
FT                   /note="synonym: Tb08.25E9.440; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659010"
FT                   /locus_tag="Tb927.8.340"
FT                   /pseudo
FT   misc_feature    92202..92249
FT                   /note="GA-rich"
FT   misc_feature    92468..92512
FT                   /note="AT_rich"
FT   gene            94593..96173
FT                   /note="synonym: Tb08.25E9.460; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659011"
FT                   /locus_tag="Tb927.8.350"
FT                   /pseudo
FT   misc_feature    96507..96529
FT                   /note="AT_rich"
FT   repeat_region   96563..96601
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   96652..96705
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            98581..100054
FT                   /note="synonym: Tb08.25E9.470; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659012"
FT                   /locus_tag="Tb927.8.360"
FT                   /pseudo
FT   repeat_region   100350..100399
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            101223..102323
FT                   /note="synonym: Tb08.25E9.490; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3659013"
FT                   /locus_tag="Tb927.8.370"
FT                   /pseudo
FT   gene            102529..104019
FT                   /note="synonym: Tb08.25E9.500; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659014"
FT                   /locus_tag="Tb927.8.380"
FT                   /pseudo
FT   gene            105019..106006
FT                   /note="synonym: Tb08.25E9.510; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3659015"
FT                   /locus_tag="Tb927.8.390"
FT                   /pseudo
FT   gene            106153..107750
FT                   /note="synonym: Tb08.25E9.520; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659016"
FT                   /locus_tag="Tb927.8.400"
FT                   /pseudo
FT   misc_feature    107944..107972
FT                   /note="AT_rich"
FT   gene            108919..110449
FT                   /note="synonym: Tb08.25E9.540; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659017"
FT                   /locus_tag="Tb927.8.410"
FT                   /pseudo
FT   gene            112157..113708
FT                   /note="synonym: Tb08.25E9.550; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659018"
FT                   /locus_tag="Tb927.8.420"
FT                   /pseudo
FT   misc_feature    113926..113954
FT                   /note="AT_rich"
FT   gene            115234..116694
FT                   /note="synonym: Tb08.25E9.560; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659019"
FT                   /locus_tag="Tb927.8.430"
FT                   /pseudo
FT   repeat_region   117038..117079
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            118408..119911
FT                   /note="synonym: Tb08.25E9.580; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659020"
FT                   /locus_tag="Tb927.8.440"
FT                   /pseudo
FT   repeat_region   120638..120696
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   gene            complement(122247..122382)
FT                   /db_xref="GeneID:4443204"
FT                   /locus_tag="Tb927.8.443"
FT   rRNA            complement(122247..122382)
FT                   /db_xref="GeneID:4443204"
FT                   /locus_tag="Tb927.8.443"
FT                   /product="rRNA large subunit epsilon (M4)"
FT   gene            complement(122700..122777)
FT                   /db_xref="GeneID:4443205"
FT                   /locus_tag="Tb927.8.446"
FT   rRNA            complement(122700..122777)
FT                   /db_xref="GeneID:4443205"
FT                   /locus_tag="Tb927.8.446"
FT                   /product="rRNA large subunit zeta (M6)"
FT   repeat_region   122854..122874
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   123019..123044
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(123108..123290)
FT                   /db_xref="GeneID:4443206"
FT                   /locus_tag="Tb927.8.449"
FT   rRNA            complement(123108..123290)
FT                   /db_xref="GeneID:4443206"
FT                   /locus_tag="Tb927.8.449"
FT                   /product="rRNA large subunit delta (M2)"
FT   misc_feature    123317..123343
FT                   /note="AT_rich"
FT   gene            124234..125246
FT                   /note="synonym: Tb08.25E9.590; expression site-associated
FT                   gene (ESAG, pseudogene), putative"
FT                   /db_xref="GeneID:3659021"
FT                   /locus_tag="Tb927.8.450"
FT                   /pseudo
FT   gene            <125412..>126989
FT                   /note="synonym: Tb08.25E9.600; variant surface glycoprotein
FT                   (VSG, atypical), putative"
FT                   /db_xref="GeneID:3659022"
FT                   /locus_tag="Tb927.8.460"
FT   mRNA            <125412..>126989
FT                   /db_xref="GI:72392168"
FT                   /db_xref="GeneID:3659022"
FT                   /locus_tag="Tb927.8.460"
FT                   /transcript_id="XM_841792.1"
FT   CDS_pept        125412..126989
FT                   /locus_tag="Tb927.8.460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="variant surface glycoprotein (VSG, atypical),
FT                   putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_process: antigenic variation [goid 0020033]"
FT                   /db_xref="GI:72392169"
FT                   /db_xref="GeneID:3659022"
FT                   /translation="MHTTTVLQVIALLLSQRKAAAVAAGDNEHHFLDLCALIALTQRPI
FT                   PELPETQQATTDYQEIQKLNISLSGTDWRKQFDKTGTPPKRAAYKPSGATEDSLRKERR
FT                   PYWINAEDEIETDKGPEKILRSAGADGATQADRQRLLALLQPIAEAAASTFTEIENLKQ
FT                   ASKALTAAAIHKKIQTATYGEQATAAADLTAAVFKAANGNPTNRKELCGDTTSASAKAR
FT                   TLTAFLYCICAGEQSQNAGGFKACSNAQPANADAQAALTNVHTAIQGLINVCPEPGNDK
FT                   VTPDDITKLIAAVAGKTTSKAQQAFYGTFAATDCGGLSGSGLCVYYKTTTKADSKAYHN
FT                   IQWKKQLSDAANDLRDQQLATQRLQGLLLQLKSLKKQAYNLRPQLEIYKKLQVTAGKSG
FT                   TTQEAQAKKGDDCKQHTKNATCTENNCKWKATTEEAGTCEAKAEEQKSQGTGEGASGTS
FT                   ATTGCTRHGTDKTACENDKTGDKQNCAWRKGKDDEPDKETEKCRNGCFLVNNKFALMTA
FT                   SFASLVAF"
FT                   /protein_id="XP_846885.1"
FT   misc_feature    127047..127075
FT                   /note="AT_rich"
FT   repeat_region   complement(127660..132811)
FT                   /transposon="ingi"
FT   repeat_region   complement(127660..127913)
FT                   /transposon="RIME-B"
FT   repeat_region   complement(132564..132811)
FT                   /transposon="RIME-A"
FT   gene            132810..134249
FT                   /note="synonym: Tb08.25E9.645; variant surface glycoprotein
FT                   (VSG, pseudogene), putative"
FT                   /db_xref="GeneID:3659023"
FT                   /locus_tag="Tb927.8.470"
FT                   /pseudo
FT   repeat_region   134457..134483
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   135345..135379
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<135693..>136691)
FT                   /note="synonym: Tb08.25E9.660; phosphatidic acid
FT                   phosphatase protein, putative"
FT                   /db_xref="GeneID:3659024"
FT                   /locus_tag="Tb927.8.480"
FT   mRNA            complement(<135693..>136691)
FT                   /db_xref="GI:72392170"
FT                   /db_xref="GeneID:3659024"
FT                   /locus_tag="Tb927.8.480"
FT                   /transcript_id="XM_841793.1"
FT   CDS_pept        complement(135693..136691)
FT                   /locus_tag="Tb927.8.480"
FT                   /gene_family="HOG000130897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidic acid phosphatase protein, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: phosphatidate phosphatase activity [goid
FT                   0008195]; go_process: phospholipid metabolism [goid
FT                   0006644]"
FT                   /db_xref="GI:72392171"
FT                   /db_xref="GeneID:3659024"
FT                   /translation="MADDGKTGFAKFVYYIKVFHALDYILLVTFALAVVYGMRTVRPPC
FT                   RTFSWNDTDISHKKGKSTFPSGTLFSMEFIPIGLYLLFEALRARLARKGEWYLDVKETD
FT                   QLIDGATTRVEMLEPEGKRSEGANAAKAGRYPDESPEGNKENDPKRLMTCLEATNYWVL
FT                   AHGFSIILAVCLVEILKVYAGRLRPDFLDRLKKANVTEGTDPKDLCDIAKARDGRLSFP
FT                   SGHSSCAFSVCTPMALYFLSVLHAFSGASVWRTLVGLSPIYLACACAISRTRDNRHHFA
FT                   DIVAGSLIGMGTGLLAVAVFFRFGKEIAVLVPRRMEFVRSRGGRVLADVAE"
FT                   /protein_id="XP_846886.1"
FT   misc_feature    138660..138692
FT                   /note="AT_rich"
FT   gene            complement(<138767..>139618)
FT                   /note="synonym: Tb08.25E9.690; hypothetical protein"
FT                   /db_xref="GeneID:3659033"
FT                   /locus_tag="Tb927.8.490"
FT   mRNA            complement(<138767..>139618)
FT                   /db_xref="GI:72392172"
FT                   /db_xref="GeneID:3659033"
FT                   /locus_tag="Tb927.8.490"
FT                   /transcript_id="XM_841794.1"
FT   CDS_pept        complement(138767..139618)
FT                   /locus_tag="Tb927.8.490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392173"
FT                   /db_xref="GeneID:3659033"
FT                   /translation="MKTIVLALILGFLGSSAEASFWELLKMYALYRNSLSLDEVCAAFE
FT                   KGGHMRFYCERGGQRIRWGKMHCGGGEEGGIALAYSKKGWNHTSFESVGRTMKGWNFLG
FT                   INPVCQLNGTFPLTRSKAAKCTKDMLKFEKKWAKNVGDYDHWGTVHGKCIVTYLTPEKI
FT                   QRVRGVEIVGPYGGLWTEDDDEDDEDDEDDEDEEEDEEEDEGEDEDEDEEDSSKGGKGK
FT                   YRGRMQRRKSIGEGNESNSGEDDEENYDDEVVRSPLKRNNGKLHENKGNIFFFLLSILC
FT                   YF"
FT                   /protein_id="XP_846887.1"
FT   misc_feature    138926..139079
FT                   /note="CT-rich"
FT   gene            complement(<139718..>140662)
FT                   /note="synonym: Tb08.25E9.700; hypothetical protein"
FT                   /db_xref="GeneID:3659027"
FT                   /locus_tag="Tb927.8.500"
FT   mRNA            complement(<139718..>140662)
FT                   /db_xref="GI:72392174"
FT                   /db_xref="GeneID:3659027"
FT                   /locus_tag="Tb927.8.500"
FT                   /transcript_id="XM_841795.1"
FT   CDS_pept        complement(139718..140662)
FT                   /locus_tag="Tb927.8.500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392175"
FT                   /db_xref="GeneID:3659027"
FT                   /translation="MCKQIGAILIILLFSSLCNGEEYNRVRNCHAFWFIDGESVIVACN
FT                   FDSKIRKSEQGWNITLCSRGEDGRMYLLPTQWTLEDWKRHLSDPGAKFVNDTFRGRGYN
FT                   PCCRVSRRRTIIVEPINDCAPAHFAATPRTEATGPMRVWRLRNQNHCIIALNHVYSPPQ
FT                   GVSVGTQIVSTIFAALAGSAMESTCKRIGGNCSKESTQIKSVIMESQMPNTSENVPFAR
FT                   YDATEEDEDLNQCEEKNRVKEFGYQKEKRKKEEVIVETKVSKVKGEKSKSKICRRKGEN
FT                   SDEADDEDYECREGVTNKRALYNLLIIVIFLFF"
FT                   /protein_id="XP_846888.1"
FT   misc_feature    141706..141738
FT                   /note="AT_rich"
FT   gene            complement(<141813..>142628)
FT                   /note="synonym: Tb08.25E9.710; hypothetical protein"
FT                   /db_xref="GeneID:3659026"
FT                   /locus_tag="Tb927.8.510"
FT   mRNA            complement(<141813..>142628)
FT                   /db_xref="GI:72392176"
FT                   /db_xref="GeneID:3659026"
FT                   /locus_tag="Tb927.8.510"
FT                   /transcript_id="XM_841796.1"
FT   CDS_pept        complement(141813..142628)
FT                   /locus_tag="Tb927.8.510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392177"
FT                   /db_xref="GeneID:3659026"
FT                   /translation="MKTIVLALILGFLGSSADKEEWDKIKHLFYDDLGTPKRLCSAFAD
FT                   DRGMQMFCHRGNELPIWKVMSCGVDEKGNVFASYSNEWKSYEKHILLEQDMDDWIYLGV
FT                   NPECTIDDEVELPKVPVTQCTNESLKKMERRVKNGNRYKSWDPAKGKCIITTRPLDILS
FT                   TEGEAVEVNEDDEPEESRNEEENMTRELEVEKKRRHKKRKRTAKKRKTILSSENAHEEG
FT                   IDDKHGADADDEYANDNEDFQNLVKQGTASPQKNKGNIFFFLLSILCYF"
FT                   /protein_id="XP_846889.1"
FT   gene            complement(<142728..>143255)
FT                   /note="synonym: Tb08.25E9.720; hypothetical protein"
FT                   /db_xref="GeneID:3659028"
FT                   /locus_tag="Tb927.8.520"
FT   mRNA            complement(<142728..>143255)
FT                   /db_xref="GI:72392178"
FT                   /db_xref="GeneID:3659028"
FT                   /locus_tag="Tb927.8.520"
FT                   /transcript_id="XM_841797.1"
FT   CDS_pept        complement(142728..143255)
FT                   /locus_tag="Tb927.8.520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392179"
FT                   /db_xref="GeneID:3659028"
FT                   /translation="MRVWRLRNQNHCIIALNHVYSPPQGVSVGTQIVSTIFAALAGSAM
FT                   ESTCKRIGGNCSKESTQIKSVIMESQMPNTSENVPFARYDATEEDEDLNQCEEKNRVKE
FT                   FGYQKEKRKKEEVIVETKVSKVKGEKSKSKICRRKGENSDEADDEYYECREGVTNKRAL
FT                   YNLLIIVIFLFF"
FT                   /protein_id="XP_846890.1"
FT   repeat_region   148160..148184
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(148507..149241)
FT                   /note="synonym: Tb08.25E9.790; leucine-rich repeat protein
FT                   (LRRP, pseudogene), putative"
FT                   /db_xref="GeneID:3659025"
FT                   /locus_tag="Tb927.8.530"
FT                   /pseudo
FT   misc_feature    150601..296882
FT                   /note="sequence corresponds to BAC RPCI93-12O16"
FT   repeat_region   151121..151146
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttaggg"
FT                   /rpt_type="tandem"
FT   gene            complement(<151635..>158966)
FT                   /note="synonym: Tb08.12O16.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659029"
FT                   /locus_tag="Tb927.8.540"
FT   mRNA            complement(<151635..>158966)
FT                   /db_xref="GI:72392180"
FT                   /db_xref="GeneID:3659029"
FT                   /locus_tag="Tb927.8.540"
FT                   /transcript_id="XM_841798.1"
FT   CDS_pept        complement(151635..158966)
FT                   /locus_tag="Tb927.8.540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392181"
FT                   /db_xref="GeneID:3659029"
FT                   /translation="MQHIISFLLARVAKVADVNPFDVESSLTKRSLRIRNVKLKKDALR
FT                   DITQLPVESGHVTEIHFDIPWPSSKDALVVHAKEARLHLNTCSHLATSDTETELSSDII
FT                   RSGITEQSILGNRNCATSPCNSSRSHSRVSSSTASPKPIDHAKEHADAHDDEDECMSCC
FT                   SEVSSSSTYVDPGGNEAVEGEEGIISYLYGVVKSTMSGLVDRKILVNVDVLTLMLSVGP
FT                   NSNTRLEIVFRDLAVHVEPCACNGTEEIKVVKATVSDVTAKAFAGELCATFVTTDVAAV
FT                   CVTSVFLRGVLCRQNVTISLEQQVSLLVNHDVLLALHAYLAASRSFLELPVYCHPHIHL
FT                   RGSASLWNYAHCCVMELLRDRRRRYNFTLSHIRSFAEARRAYIQLLNYCHQVGDISAKL
FT                   DAMVEIEQKVRYRDVILFLRRTVMETYARTSVTSDIASDGGKGRQLVDAIMLSIHVDIG
FT                   EVYIYFPTGTVMLLGEITLVSRVDETNVHIGDVSLKDDSMWETLRLPGASDVPFFSFQK
FT                   RKTKGACSLKVNVEPTRIALSTPRLLETIKPVASILPLLFVEMVATSRTAPAPSSRGTM
FT                   EKMSFVLPFLRLIIDDINVECEKLSLIIIKGDAPRGSQIGVSLHALSAHFGEGAHELVA
FT                   PINVRMGDEGNIIVSELKFNICPAFWEYLKHICSEWSEVAWVGYESYKGATKRTQRSSN
FT                   ANVSISSWEEIFTAADIHQVSRRKKKSQCICIKCIQCWFVPTESVITIGETRIFSSKNV
FT                   SDEDVLCIHLRSFMLTTEDASKPFFIIDFPRGAKCRVASLSKGRLFCALASSSVVEVTL
FT                   GVFSTQKLLSASNLQLGLSHPMSHFSVETVQVLDAVEVAPLRVSFCSRLHSALTHNFLP
FT                   PVACVLISVGSVCVRVDRLTAGEFKQITSTMESCGALFVSPHAWREWCCAFPHNSCEIA
FT                   IALCNTTCVLSFGESGVLQCRCRIPNAGSESALSFFNRFSEFFHELRDSPPALLINSCG
FT                   AYTKELYIPAVDADVLHPLLPSSCLKVEVRDLSASFLFRKEAMCVLGVHAEGGLTPLKL
FT                   NVQSITMYGGDVISLKLEALKFVLASTASTQDARKYGAEATSVLSTFEKQALVELECIE
FT                   LKTNLCDTPYPVRQLFDALLDIRRMATSLSRKHVITADYLHDVSYNLDMIGSCFFNCPG
FT                   KVVNVVECEFLAVRGSARLVVCRGTHVLFQRCRISTLIRSSIAVEDESGSFLLLDCDDT
FT                   IKKLETHEATQLDAPNVRDILRCIVPHGLHLMIHHSRGELLFPTGCQLTFAFTLVGDCL
FT                   CSTSYGLGLQLCLQNSWVDYIDGSVCSRVFSSTTSAVNVATRCKEHIGTVNATLQVDRV
FT                   GVPMGLVETMQQLIGGTSCRKGFNGRSRTSPLLCYKRLKYLFGEGKWSIAVSAFPIDIL
FT                   LRGGASVAHMAVNKSLLRSKVEADGGEAHVDFRFGVQELTLWDFCSQSYKRALQRPLSV
FT                   AAVARLLDSKHVACETLLSSLDLSVSIEQMKFIASSFLPGNFGRGLTVPPTVEVINQLG
FT                   VSLVLDVDDGERVVVKERQTFYGNHLVFPRCIHSVDNCRISHFESYRDPNPEKELTDVL
FT                   RRACVVTLTSGEKVRIVRQVLDHTLSQRVSFRTSFQISNRLPCGVVLGAIDSSVGKLEV
FT                   PPGETLPVPIHLISRDDISLCLMSSNSACTSEQQLLSEGSLRILFKLAEERGDDSIGRL
FT                   RKFVLGDVPVYIDVTYLLSGGVLTMFLSPARLGIHNGTRFNMKVLLLISDLVVEECIIE
FT                   PSGTFFTLQHDPFGPRVDYVFESIVYSDIYFSTDRVEACFNEGSLRQRVLMRHREFPYK
FT                   RFFELDIGQQDVGSCTAPSVCTVRPYGVFGLKNNSGTDVRFTTEVGKPTGLIRDGALSH
FT                   ATGRNFAYLPLHTRLVLHAGELSSVSFEVTEDFEERPLFCAPMSVKGTHLGQPHLFLMR
FT                   SRVDRFGYFMELIPPLLFTNMDDLRDLQVRHVTRRGGLFTDELPHCFTVPAGGTVSYTA
FT                   LANDEVVNFAFAWSAKGSDTTVNIEFSAPVAVSLLPQTCSSAFIECGDTHHEIRVFKED
FT                   RFEPTVVSVSEPRPPYVTVVNLTSHNYEKVPRMSVSSYTPHSLTSGEVVLVLREGVNSS
FT                   RRFRVLLSHGTEVEIGNDVAAFIHQRKDTVGWVITLVTTYAISSLRSGLGTLVGSAVIV
FT                   ETPVEEMMLRAGVKACGIGLLVEDGDNIPINCVVGRCESWLVYEHKRVTVQCTVSNMRS
FT                   NGTYNGKMSHEIKPFSIDLTVRDARIVGNAILASSVYSHVTTLELELSDTFVYQMRRLG
FT                   RRYKSSETNKDLENVVRVQRGMLSCWKLLKFMSVQLHFIKISDIFVLFTYDRSDRPPED
FT                   IIFKGSHVGNIFPSIHRAEITLPGTHRKDFHGASLANVWSACCEAVMMELLRQVPQLVS
FT                   GAVVFPSFSSIRSVLNRIGAVIFSSNSKNIDASDTLLL"
FT                   /protein_id="XP_846891.1"
FT   misc_feature    159213..159235
FT                   /note="AT_rich"
FT   gene            complement(<159730..>160263)
FT                   /note="synonym: Tb08.12O16.110; peptide methionine
FT                   sulfoxide reductase, putative"
FT                   /db_xref="GeneID:3659032"
FT                   /locus_tag="Tb927.8.550"
FT   mRNA            complement(<159730..>160263)
FT                   /db_xref="GI:72392182"
FT                   /db_xref="GeneID:3659032"
FT                   /locus_tag="Tb927.8.550"
FT                   /transcript_id="XM_841799.1"
FT   CDS_pept        complement(159730..160263)
FT                   /locus_tag="Tb927.8.550"
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide methionine sulfoxide reductase, putative"
FT                   /EC_number="1.8.4.6"
FT                   /note="go_function: protein-methionine-S-oxide reductase
FT                   activity [goid 0008113]; go_process: protein modification
FT                   [goid 0006464]"
FT                   /db_xref="GI:72392183"
FT                   /db_xref="GeneID:3659032"
FT                   /translation="MNPNAVATFAAGCFWGTEHFFVRQFGAALISHKVGFMGGKELPEM
FT                   NYQLVKKGDTGHAEVLQVTYNTNELTYDALLNFFFRMHNPTTLNRQEGDVGTQYRSTIF
FT                   YHNEEQRNEAESFIEKLNGGDEKLRENIVKAFGSSAKVVTTLERASRFYPAEDYHQNYL
FT                   EENPNGYCAHRLYW"
FT                   /protein_id="XP_846892.1"
FT   gene            complement(<160844..>162577)
FT                   /note="synonym: Tb08.12O16.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659030"
FT                   /locus_tag="Tb927.8.560"
FT   mRNA            complement(<160844..>162577)
FT                   /db_xref="GI:72392184"
FT                   /db_xref="GeneID:3659030"
FT                   /locus_tag="Tb927.8.560"
FT                   /transcript_id="XM_841800.1"
FT   CDS_pept        complement(160844..162577)
FT                   /locus_tag="Tb927.8.560"
FT                   /gene_family="HOG000255427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72392185"
FT                   /db_xref="GeneID:3659030"
FT                   /translation="MVLASIRVLVCGTDFSSVEAALGGMVENKHHAWNRRYEVTCTSVS
FT                   GVERADSRLLSTCHLVVLTHGAITPSSKASYDNKPTISIPGTSSDALTLLQGCDFYYGQ
FT                   YNLNDLRVAVVDIGLSPLHIIWNSSTRCITETGELSLRRAFWLFDKDGDGVLNEEEILA
FT                   WQRSAASVSFSKGDIADMLAEVSIPNASIPMNFDLFKAVQVSYLLKNDARKVWATLHIT
FT                   GLHPTGLPYSWRDINAVRVSKECNTYLSHHAIQFFRNLYKLKRFHDIDDMWSVTPGCPW
FT                   AHISGFIKSRIPLDKFIEYWKYMALVKREVVIQYALYWGYKGDTSILFQLRRARPYREP
FT                   GETVPNIITVLVLGAPGCGRRSLIFTLTANDDELYDDQTIQQVTYVRTTTFFVRKGMEE
FT                   APQTVAYVTLPIDSAGELLENVVQEKQVDVVLLCYDGSRVAKTTPPIMDAYVRATGSQQ
FT                   KCHNLPFIVVATKAEVSHEIEENVAEAQLAMESFCRENQLLWPPVATSVENPEETEIAT
FT                   LNEYVYAVAKQPEIAVASPPITTIRILRRVAIVSFAAFVVGGITRFLIRKVLGTSRKKG
FT                   R"
FT                   /protein_id="XP_846893.1"
FT   gene            complement(<163209..>164204)
FT                   /note="synonym: Tb08.12O16.130; proteasome regulatory
FT                   non-ATP-ase subunit 10"
FT                   /db_xref="GeneID:3659036"
FT                   /locus_tag="Tb927.8.570"
FT   mRNA            complement(<163209..>164204)
FT                   /db_xref="GI:72392186"
FT                   /db_xref="GeneID:3659036"
FT                   /locus_tag="Tb927.8.570"
FT                   /transcript_id="XM_841801.1"
FT   CDS_pept        complement(163209..164204)
FT                   /locus_tag="Tb927.8.570"
FT                   /gene_family="HOG000165630" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome regulatory non-ATP-ase subunit 10"
FT                   /note="identical to GB:AAL72633.1: proteasome regulatory
FT                   non-ATP-ase subunit 10 {Trypanosoma brucei}
FT                   (PMID:11854272); 99.7% identical to GB:AAL72633.1:
FT                   proteasome regulatory non-ATP-ase subunit 10 {Trypanosoma
FT                   brucei}  (PMID:11854272); go_component: proteasome complex
FT                   (sensu Eukaryota) [goid 0000502]; go_function: protein
FT                   binding [goid 0005515]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]; go_process: cell growth
FT                   [goid 0016049]"
FT                   /db_xref="GI:72392187"
FT                   /db_xref="GeneID:3659036"
FT                   /translation="MPEACFLCLDSSEFMRNGDQHPNRFFVVQEAATLLANAKTSANAE
FT                   NTVGFLTLGGNACTVFETLTSDVDRVMSTMSKISISGKQCHFSKGLQIACLALSHRTNP
FT                   RAEKRIVAFIGTPLGETDGELEKLAKKLRKESVAVDVVSVGVPSNVPRLTAFVERLSNN
FT                   GNSRFLSVPAKVPLIDSLMSSAIFMGEDSSVSGGGFNGSSAGFSVDPTMDPEMVLAIQM
FT                   SLEEEERRQAAAAALNSNAAESETVERTDINMDEEALSLENMTEEEMLRRALLLSLQEA
FT                   NKGQAAAGSNATNTADDEAFANELEKELERQSKEETLQGKHDDQNEEKED"
FT                   /protein_id="XP_846894.1"
FT   gene            complement(<164621..>165688)
FT                   /note="synonym: Tb08.12O16.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659031"
FT                   /locus_tag="Tb927.8.580"
FT   mRNA            complement(<164621..>165688)
FT                   /db_xref="GI:72392188"
FT                   /db_xref="GeneID:3659031"
FT                   /locus_tag="Tb927.8.580"
FT                   /transcript_id="XM_841802.1"
FT   CDS_pept        complement(164621..165688)
FT                   /locus_tag="Tb927.8.580"
FT                   /gene_family="HOG000255426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392189"
FT                   /db_xref="GeneID:3659031"
FT                   /translation="MSSHSSLGVAVVTGGVSLAGALVWGARWGKLRSRRADLDRQYADS
FT                   LAETSALDEARLAGAELLRQKRKESVLLHEAMDSIWKDRFERYKQTNKETHSYLRALPE
FT                   ALGVLKGVTNHYQYMAREMRKFIGFDVACSKVHNFALLLNHGEKVGIQRVSETIRQLLV
FT                   AEPLVRVVCDSLLDEATNFSCPTSISESSDSFVFCMEGLDRAVDAAAARYIELQKPSMG
FT                   ESPPNVFCRVLRKITTALEANMLSRCDIIMKEERQALRNHLLRDRRQLHTMHDLVGAMR
FT                   YVEELSRHFQDSAKNPASVNMSVLSDPEVLLAREQLLLWRRAAAIFLVRQQAKEALNSY
FT                   HLLLAETLTKTRHPS"
FT                   /protein_id="XP_846895.1"
FT   gene            complement(<166539..>168575)
FT                   /note="synonym: Tb08.12O16.150; carnitine
FT                   O-palmitoyltransferase, putative"
FT                   /db_xref="GeneID:3659034"
FT                   /locus_tag="Tb927.8.590"
FT   mRNA            complement(<166539..>168575)
FT                   /db_xref="GI:72392190"
FT                   /db_xref="GeneID:3659034"
FT                   /locus_tag="Tb927.8.590"
FT                   /transcript_id="XM_841803.1"
FT   CDS_pept        complement(166539..168575)
FT                   /locus_tag="Tb927.8.590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carnitine O-palmitoyltransferase, putative"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: carnitine O-acetyltransferase activity [goid
FT                   0004092]; go_process: generation of precursor metabolites
FT                   and energy [goid 0006091]"
FT                   /db_xref="GI:72392191"
FT                   /db_xref="GeneID:3659034"
FT                   /translation="MTRVSTSKRRVAKESPLPLPSLREILECYVRFLEPLGNVENKEES
FT                   LSFIRGVLLSLQASKGCAPDQLRDAVAYFRLLESIAKAYKQFCNESLHTSHMTPLWNAM
FT                   YLSTRDPLPFGWNYTLQLDSPPLDNLAKGVGVSMQALRASIIGTASLHFRSLLGNPKFF
FT                   TPEFQGRVPKMCRLDLSLCGDQFTRLFRTVRIPHEGVDGLRWSLTNKVLVLHRGNAFVV
FT                   DWIRFGGINGNGSLERICVEEIIANAHLIEALKSKALSLPRNRSTPLVLANGCRKKWAR
FT                   AFGKLWLEQSSREALDEITSCSFGIALDENTDLSRCLHGGACPENRYPDMNVTYAIGPN
FT                   GESSCNMEHSWGDGSTLAAVCAFVNYYNVSFSRCFTGAIDPPKTCLTVMEAHMHMVHWG
FT                   NAICTHVLQDIQKFHRDHNLRVKQMTLALRRVNDFGTNEIKQRCGSSPDAFMHAAFHIA
FT                   QKRLFGDQRSTYCALLMKKYHHGRTETLRTVTHSTQTLAKLVESAKGERSFSPNIRTAL
FT                   HNVSEEHRERIILCRSGKGFHRAVTLLSRFHKEVQERLHHNPSTDVPWDVNKGVTHVEK
FT                   MFFASQALRELCSDYLSTSNMSAPGILSFSFAATHPDGVGIGYSLSPKQLSFTVSAFTE
FT                   CKRPLAGDQACEETNVAIAFANAIEDAVKDLYDRTALPLQSKL"
FT                   /protein_id="XP_846896.1"
FT   gene            complement(<169984..>170895)
FT                   /note="synonym: Tb08.12O16.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659035"
FT                   /locus_tag="Tb927.8.600"
FT   mRNA            complement(<169984..>170895)
FT                   /db_xref="GI:72392192"
FT                   /db_xref="GeneID:3659035"
FT                   /locus_tag="Tb927.8.600"
FT                   /transcript_id="XM_841804.1"
FT   CDS_pept        complement(169984..170895)
FT                   /locus_tag="Tb927.8.600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392193"
FT                   /db_xref="GeneID:3659035"
FT                   /translation="MSSSSSSTSTDVANSSGSDNGDDSVSTQSNRSSSSDSVSLISSTC
FT                   SITDRIRETGGGCGDAVATERLEREQRLRRLLSQRKVGNTVPLHDGKIAEPFSMRKGTL
FT                   DPDDGVILSTFSNALLFQRLLSVLSSSDALARSQSFDEVLAVANPIFFRKLKAPLGEGS
FT                   TEASQPQHFRPVVHSECAQLDRSGIVVHRRKRERHGHWVAAGEKKSAMGDSSGVRTMST
FT                   SSGLIQKSHAQWERYLTKELQEEGVSLQSFRQQRQDDSYLEKQRFLERSQWAEYQHELQ
FT                   VDARRRELKASRAIRRGESEMN"
FT                   /protein_id="XP_846897.1"
FT   repeat_region   171216..171244
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<172338..>174983)
FT                   /note="synonym: Tb08.12O16.170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659040"
FT                   /locus_tag="Tb927.8.610"
FT   mRNA            complement(<172338..>174983)
FT                   /db_xref="GI:72392194"
FT                   /db_xref="GeneID:3659040"
FT                   /locus_tag="Tb927.8.610"
FT                   /transcript_id="XM_841805.1"
FT   CDS_pept        complement(172338..174983)
FT                   /locus_tag="Tb927.8.610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392195"
FT                   /db_xref="GeneID:3659040"
FT                   /translation="MGPKKAGGGDSTATFPLAPVGTFECNARCCCVVGKVVWVAELKGG
FT                   VAVHNAQDGQLLERIAVAEGNNRVHFKCMVLVNHELWAGSSEGVVHIFEATRRRWKRQI
FT                   AIMGTGTAAPITALIFDGHSVIGASETGRIVQWNPSSKAQMMAYTSSSPAADVTVFAGL
FT                   IISGHGDGSLRVWDPYSGEMVVEHLKDNSDVTRLLVEPTTSTLWVGRRSGCISVYSLDA
FT                   ESEERRSLEPVLFTLKSRVLIGKEAVTSLQAITGKVLVTTHCRVVAVVNAHTYEVLIRV
FT                   NGAHDAFIYGAARVYVAETVRAWTIGNDSVAHIWDVAGYYVPSQSTPAMGPHEQEKIVE
FT                   DAKCLLSFENSKLATRVAAAGVTVTKLQEELQAARNEAQELRLRLVSVDDLEKEKEVEI
FT                   VSSSTRIKELESEVKRLNKELADANARADGAERQFNMTRNDLNNAATEASKARADVSEK
FT                   IKEKADVEQQLAARNTEKLHLERQLRDKSLELEHVRGEYDRLHRATAQGLQTKGVTDAY
FT                   KFCSSRDGGVALSNELEELRKKNELLGTLLSSMEYTLRRKEEEERDMAVLLNGFRRKLA
FT                   DKVVDPHLIALLNATMLNNPDKFYISDDEGTKSALLERNGPLSRYLQSLRDCDPDVYEQ
FT                   LLAYLQHPLAGSTNDPIYDKLMLLARDEGETAENFSFLKKTLPILLSSVNFMNAASGVE
FT                   TGDFHPTPSGTITAKQMDETPGNALNTVVGSIVDATTRNSSENKPSVEDPLFGVLKNLQ
FT                   LFGDINILTGQTNPSANDEAYLKQVRNTFEFILQTRSSLVKQLALLSKRVAKGLQVVTA
FT                   LASKNTRDGITQGGRPVSFNASGGTSSRGNSLGAVAVGILEELNSVVTVIVSSFLTLNE
FT                   KQRVGVGTQF"
FT                   /protein_id="XP_846898.1"
FT   gene            complement(<175388..>176569)
FT                   /note="synonym: Tb08.12O16.180; RNA-editing complex protein
FT                   MP42"
FT                   /db_xref="GeneID:3659041"
FT                   /locus_tag="Tb927.8.620"
FT   mRNA            complement(<175388..>176569)
FT                   /db_xref="GI:72392196"
FT                   /db_xref="GeneID:3659041"
FT                   /locus_tag="Tb927.8.620"
FT                   /transcript_id="XM_841806.1"
FT   CDS_pept        complement(175388..176569)
FT                   /locus_tag="Tb927.8.620"
FT                   /gene_family="HOG000255422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-editing complex protein MP42"
FT                   /note="identical to GB:AAK64280.1: RNA-editing complex
FT                   protein MP42 {Trypanosoma brucei}(PMID:11564867); 100%
FT                   identical to GB:AAK64280.1: RNA-editing complex protein
FT                   MP42 {Trypanosoma brucei;} (PMID:11564867); go_component:
FT                   mitochondrion [goid 0005739]; go_component: mRNA editing
FT                   complex [goid 0045293]; go_function: RNA editase activity
FT                   [goid 0003969]; go_process: mRNA editing [goid 0006381]"
FT                   /db_xref="GI:72392197"
FT                   /db_xref="GeneID:3659041"
FT                   /translation="MKRVTSHISRFLPLVLSQRGLSTYASPHVSSMRYYGATKCLLAST
FT                   PDTPSFQCGECGKAFRLINALNHHIMTKHAGKAKAMMNKGGKLEEVNPEEIKNKPQGAM
FT                   SQPTSPPPSSSTSGTEAASTSPTHSSFPGIPFSPVGGIGLVGTPVGAASHVVNTTTTAA
FT                   NSASGNALSDENADKKTFVCTICQKTFRLEAALQHHYQAKHNMEMPTSSSSSGGASAQP
FT                   VLQGGATTAGVGSVGFSHTEEETGRSAMGTQYVHSQETILPQAPQYHLDVAPNAPEEGE
FT                   VAAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDS
FT                   DYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKV"
FT                   /protein_id="XP_846899.1"
FT   gene            complement(<176866..>178404)
FT                   /note="synonym: Tb08.12O16.190; lipoate-protein ligase,
FT                   putative"
FT                   /db_xref="GeneID:3659039"
FT                   /locus_tag="Tb927.8.630"
FT   mRNA            complement(<176866..>178404)
FT                   /db_xref="GI:72392198"
FT                   /db_xref="GeneID:3659039"
FT                   /locus_tag="Tb927.8.630"
FT                   /transcript_id="XM_841807.1"
FT   CDS_pept        complement(176866..178404)
FT                   /locus_tag="Tb927.8.630"
FT                   /gene_family="HOG000136271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipoate-protein ligase, putative"
FT                   /EC_number="6.-.-.-"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: catalytic activity [goid 0003824]; go_process:
FT                   protein modification [goid 0006464]"
FT                   /db_xref="GI:72392199"
FT                   /db_xref="GeneID:3659039"
FT                   /translation="MRAARLSLRPTISLLDFVNRHGASIRSDRLLSDKQRSVALISNSD
FT                   VIYDNLATEEALLRGVVLRRQEALLLMYVNKPCVVVGRNQNIFSEVALRAAHHDGVSIA
FT                   RRNSGGGAVYHDLGNVSFSVFTHRDTYEPKRSIQLLRWHLCREFGIGPERITTTKRHDL
FT                   FLDEMKITGSAMRVQRDIACHHFTLLVSSSGSRLGKYLKREGDYISFTTAAVGSVCSRT
FT                   TTLKEAGVLTDSASADPVNFILRSMAGFFVEHSWDILAHKAPWETNPLNFGDNVDTVES
FT                   KRTRECRETAAVFTLDTTKAIADGTVMIDGENRRPCAGASKTVREECVRLQSLGWLFNM
FT                   PKFETRVAITLADILASEETFSKHAALPPSLIAWLLQSCTRVDIITLIENRRVTSITAY
FT                   WIKQGEPAPEQPWFSCLLRYLVEGRYVDNVFADMGGKCSVLAAAIDLECSQIISGLPAI
FT                   ISQLSAGGSRNGEAVGSVISLAEERERSHDVIQRFLQAVLDVWRRKNVFYPISY"
FT                   /protein_id="XP_846900.1"
FT   gene            complement(<178808..>179149)
FT                   /note="synonym: Tb08.12O16.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659038"
FT                   /locus_tag="Tb927.8.640"
FT   mRNA            complement(<178808..>179149)
FT                   /db_xref="GI:72392200"
FT                   /db_xref="GeneID:3659038"
FT                   /locus_tag="Tb927.8.640"
FT                   /transcript_id="XM_841808.1"
FT   CDS_pept        complement(178808..179149)
FT                   /locus_tag="Tb927.8.640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392201"
FT                   /db_xref="GeneID:3659038"
FT                   /translation="MEGKSEATVHASFGEPGSPATDVQNQTRGPTPNREGMCSGPSDDL
FT                   PKPLSVPEYLETHVMAVLTEGLEDLCRLRPANPIDHLALFLLRHSQSNTATEVDPRNVT
FT                   PVEAPKSDM"
FT                   /protein_id="XP_846901.1"
FT   misc_feature    179207..179234
FT                   /note="AT_rich"
FT   gene            complement(<179692..>183477)
FT                   /note="synonym: Tb08.12O16.210; cation-transporting ATPase,
FT                   putative"
FT                   /db_xref="GeneID:3659037"
FT                   /locus_tag="Tb927.8.650"
FT   mRNA            complement(<179692..>183477)
FT                   /db_xref="GI:72392202"
FT                   /db_xref="GeneID:3659037"
FT                   /locus_tag="Tb927.8.650"
FT                   /transcript_id="XM_841809.1"
FT   CDS_pept        complement(179692..183477)
FT                   /locus_tag="Tb927.8.650"
FT                   /gene_family="HOG000199432" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cation-transporting ATPase, putative"
FT                   /EC_number="3.6.3.-"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism [goid 0015662];
FT                   go_function: hydrolase activity [goid 0016787]; go_process:
FT                   cation transport [goid 0006812]"
FT                   /db_xref="GI:72392203"
FT                   /db_xref="GeneID:3659037"
FT                   /translation="MITKNSIIKEIKLLRHRHWSAWPIIWPFVPLYAVIFTLHLNPEIA
FT                   WDRTTYLVHGTYINFFHAVCIPIVIFFHGLLSLFTIWSVRFRSLVQFHCVPPKEVDTAT
FT                   HVYVCTKEFKGESEIVPLVHASSDHPCCFVFQQRKWKLDAVTEQFVKPRFPTKDNLSMY
FT                   FAWEGLATTADRSKQLDMFGRNETEVVIPDFQTLLVDHALAPFFVFQMFCVLLWCLDQY
FT                   WYYSLFTAVMLVAMECTIVMQRIRNMKTLRSMAEVPVRQVTVLRAGREVSVKTTELLPM
FT                   DLMVVDNNAPCPADVILVRGTCIVNEAMLTGESTPQLKEAIDAANLPLEMKKHARHLLY
FT                   SGTQLLLSNGPHGQSDTERGRALAVVLKTGFETKQGKLLRTILHSQERASENNGEAFGF
FT                   IGLLLVFALMASGYLLKRGLEDPNRDRWKLFLACIQIITAVVPPELPMELTLAVNTALL
FT                   GLVKQNVFCTEPFRIPYAGKVDTCCFDKTGTLTTDEMLFSGVDMADGKGLLNTLKTVPP
FT                   KAELVLVTCHSLLQLEGTDTVAGDAMEKASLGALGYRVNIDDTVVYDPPAQKEDVKGKS
FT                   TTGSSKNETSGSSKSQNRKNNSGFEKQYKILVRFPFLANLRRMPCIVSAPDGKYVVAKG
FT                   SPEAIAQLCESIPPDFHSVANAHAIKGYRVIALAYRPLKEEERSKEAIHNMDREDCEKN
FT                   LIFAGLAVFQCPLKKDAKDTIEMLQSGSHRCVIITGDSVQTAISVGRDVTILKCRQQLV
FT                   ASSMKKKGNGEDEVDDCIVWTDAATGKEVNLDRRSILAKTFVQTRRHKVPSDDEWDLCV
FT                   NAESIPTTTLATLIAQYSEHIAVWARCAPTHKEDIVTDLKQKEHMVLMAGDGTNDVGAL
FT                   KQAHAGIAVLNATSMDASQNVGGSGEHNSNEPHNEPDVPKDHKIPPGFKLTVVPPAPSA
FT                   DAPFMEQVRHKMAQARRRAEIVQIARWNKQLEESKKSRKTAEAGKVASQPEMNAPASDF
FT                   LMESIFNADDADMGGAPQVKLGDASIAAPFTCRSRALTSVCDIVRLGRSTLVTTLQMYK
FT                   ILALNCLTSAYSMSVLQMDGVKHGESQMILSGIILTVCFLCMSKSQPMPTLCPQRPITK
FT                   VFHPYMMCTIFMQFGLHLYSMVETVRLVEEADAEGVATMRQAGAEGEFKPTLLNSAMFL
FT                   LTTLIGGVTFAVNYRGEPFMQSIRKNRPMFYSLVVLALAVFYFASEMDPTLNQSFEIVA
FT                   FPSKEFRERFLQILLMDALGCFVIEGLSLKLLTEYD"
FT                   /protein_id="XP_846902.1"
FT   misc_feature    183945..183966
FT                   /note="AT_rich"
FT   gene            complement(<184411..>185391)
FT                   /note="synonym: Tb08.12O16.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659046"
FT                   /locus_tag="Tb927.8.660"
FT   mRNA            complement(<184411..>185391)
FT                   /db_xref="GI:72392204"
FT                   /db_xref="GeneID:3659046"
FT                   /locus_tag="Tb927.8.660"
FT                   /transcript_id="XM_841810.1"
FT   CDS_pept        complement(184411..185391)
FT                   /locus_tag="Tb927.8.660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392205"
FT                   /db_xref="GeneID:3659046"
FT                   /translation="MSGHRASMQTDIRSISTLQTRVLKPSPPTEGLRAPRPKDLYSSTT
FT                   TFSVPTQQHGSLEEQLRYLLHAKDQTDRSVIENDVQQVLAELQRRRRMRKAAAPPSRAS
FT                   SALSAAAAPRPHVLALVQACEASTEAAAASILKSFCMNNCTPTGKDSGLSLVTVPLAEF
FT                   LLKQKNAPGDIDDALKLLDSAIASRHAGAMLQVGLCLRDGVGVPIDLTAALTWVERAAD
FT                   SGYAPAMYELGVMYEDGVEIGGKCLPSDWGEALRLYRGAAELGHTMAQLNVGKLLWRAA
FT                   EAAASRAVGVCDDNTVAELRGKSREWLEAAAASGSEEATRLLRCK"
FT                   /protein_id="XP_846903.1"
FT   repeat_region   185682..185701
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   186979..187010
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<187367..>188239)
FT                   /note="synonym: Tb08.12O16.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659045"
FT                   /locus_tag="Tb927.8.670"
FT   mRNA            complement(<187367..>188239)
FT                   /db_xref="GI:72392206"
FT                   /db_xref="GeneID:3659045"
FT                   /locus_tag="Tb927.8.670"
FT                   /transcript_id="XM_841811.1"
FT   CDS_pept        complement(187367..188239)
FT                   /locus_tag="Tb927.8.670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392207"
FT                   /db_xref="GeneID:3659045"
FT                   /translation="MSLLVAGATGAIGRRVVFEALRREEFIRVAALTRSCPSEDVAALF
FT                   GFSLEGINGNKTEKEASSLLTREQIARLHTVTFDWEDFCRFWEEQRENADKTHRKTQSS
FT                   AEVRYRDIFSGHTYVAMCLGTTRRDAGSATKFKRCDYDYVVAFAEAVKRFSGSTLLNYA
FT                   QVSAQLANKNSCFLYPQTKGRADASVEELQLSRLSIYRPGLLDRAEKTRAVEKIAKWFV
FT                   RGLPVETCGKAIVIDFLHCSDVVATEAETSTSSVHCAGKKQELSQRSGVVCYFGNNEII
FT                   KEASALSTP"
FT                   /protein_id="XP_846904.1"
FT   gene            complement(<188554..>189009)
FT                   /note="synonym: Tb08.12O16.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659044"
FT                   /locus_tag="Tb927.8.680"
FT   mRNA            complement(<188554..>189009)
FT                   /db_xref="GI:72392208"
FT                   /db_xref="GeneID:3659044"
FT                   /locus_tag="Tb927.8.680"
FT                   /transcript_id="XM_841812.1"
FT   CDS_pept        complement(188554..189009)
FT                   /locus_tag="Tb927.8.680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392209"
FT                   /db_xref="GeneID:3659044"
FT                   /translation="MVGAMHDIQVGFLDRCSVFQFTLTCTVLDFQKVAEPQPKSPGSLP
FT                   SSTRTAPNPNGEEVEKHINKEQYTVRCLGSEAYTEALKNYLDDGCIVRVIGRLKTTEVV
FT                   DAGKKQPFPCIIVEQGRWSTVSLVHSLRKQRRDWQLQNILTSVATLE"
FT                   /protein_id="XP_846905.1"
FT   repeat_region   189791..189812
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    190321..190346
FT                   /note="AT_rich"
FT   gene            complement(<190379..>190726)
FT                   /note="synonym: Tb08.12O16.260; peptidyl-prolyl cis-trans
FT                   isomerase/rotamase, putative"
FT                   /db_xref="GeneID:3659042"
FT                   /locus_tag="Tb927.8.690"
FT   mRNA            complement(<190379..>190726)
FT                   /db_xref="GI:72392210"
FT                   /db_xref="GeneID:3659042"
FT                   /locus_tag="Tb927.8.690"
FT                   /transcript_id="XM_841813.1"
FT   CDS_pept        complement(190379..190726)
FT                   /locus_tag="Tb927.8.690"
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidyl-prolyl cis-trans isomerase/rotamase,
FT                   putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="go_function: peptidyl-prolyl cis-trans isomerase
FT                   activity [goid 0003755]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:72392211"
FT                   /db_xref="GeneID:3659042"
FT                   /translation="MSEKLRAAHLLVKFSGSRNPVSRRTGDSTADVTYEDAIKELQKWS
FT                   QRIASGEVSFEEAASQRSDCGSYASGGDLGFFSSGEMMKPFEDAVRALKIGDISPIVQT
FT                   DSGLHIIKRLA"
FT                   /protein_id="XP_846906.1"
FT   repeat_region   191052..191080
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<191287..>194265)
FT                   /note="synonym: Tb08.12O16.270; DNA repair and
FT                   recombination helicase protein PIF1, putative"
FT                   /db_xref="GeneID:3659043"
FT                   /locus_tag="Tb927.8.700"
FT   mRNA            complement(<191287..>194265)
FT                   /db_xref="GI:72392212"
FT                   /db_xref="GeneID:3659043"
FT                   /locus_tag="Tb927.8.700"
FT                   /transcript_id="XM_841814.1"
FT   CDS_pept        complement(191287..194265)
FT                   /locus_tag="Tb927.8.700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair and recombination helicase protein
FT                   PIF1, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_component:
FT                   mitochondrion [goid 0005739]; go_function: DNA helicase
FT                   activity [goid 0003678]; go_process: telomere maintenance
FT                   [goid 0000723]; go_process: DNA recombination [goid
FT                   0006310]; go_process: chromosome organization and
FT                   biogenesis (sensu Eukaryota) [goid 0007001]"
FT                   /db_xref="GI:72392213"
FT                   /db_xref="GeneID:3659043"
FT                   /translation="MWDGPLRSRQNLRTVAKLRSSGCPLTQSAIHPTTTSPSEGETASE
FT                   ILQGQASAGYIEEQQLPATSSQLEMSGDSNAASDNNVVIMTKRQRDDLSQASQAEVLSR
FT                   LRTEDAQGPAENNGAQSDLALHSCDMEERVDSSKLNLNHVTVNKHSPPASKSAGISQQN
FT                   DDGGCGASENVDNTTTAASKQRGKLLLDSSSSNCTPKQQAQQAVTQVPEWELSHEQERI
FT                   FDIVVNHRRSVFLTGGAGTGKSHLLRAIIAALPLSTTFVTATTGLAALNLGGTTLHSFS
FT                   GCGFVDQHTSTHQMVYRNVLGRKKARANWRKCRVLVVDEVSMLDAWFFDMLEYVARHIR
FT                   GCRKPFGGIQLVLSGDFLQLPPVNKHSPKQETRLCFEAKSWPRVNPLVCTLSHQFRQKD
FT                   KEFFSLLNEVRVGALTAPSLGLLSSLSVITTVSFVDEEKLKLKREVGAEAVDIITDSKG
FT                   RTRRQRQDGFTILRARRSEVDAINTEKFGELDTEIYSYKGAHRGEGHFPSDLPSTVSVR
FT                   AGCRVMLLANLDLSAGLANGSIGTVESFVSSKLHQTANPSTKDDLQHLADHMMLPVVRF
FT                   DHKGKQGPGDGGGAAAGRLVVIEPHRWTMRQGDSDVSCSIQIPLQLAYAITIHKSQGMS
FT                   LSHVNVDFAGIFEEGQAYVALSRCTDVANLVIENFDAQRVNPNIKALAYYRALEFVGTE
FT                   HREAEKKLIDNGNKMNPWGPYDVEDFEASDDDNGGAVKKEVVENLTYDAENISCMVEQF
FT                   RQRYMPQYIMFSTLRRRVLSNTEDAARVKGALLVMDTTSLLALTNMTGPTSLYQTIFTE
FT                   RGNMMRVPRVVKEELLFLASTDVKEVSSVTTPTLHSFCSTCSSTPCSTGFSYDFVEVVS
FT                   CALSIMENAKCDFLLDEQREGEANSLPPVIQEWRSLSPLLMLNSSPDTGEKDAPSVIGF
FT                   GERSREQHHSTLMFASFLVSRYSGNGAVYVCTETVELAARALAIGLRVCSIAYLCNRAR
FT                   RVN"
FT                   /protein_id="XP_846907.1"
FT   repeat_region   195479..195508
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   195970..196059
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<196484..>200617)
FT                   /note="synonym: Tb08.12O16.280; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3659047"
FT                   /locus_tag="Tb927.8.710"
FT   mRNA            complement(<196484..>200617)
FT                   /db_xref="GI:72392214"
FT                   /db_xref="GeneID:3659047"
FT                   /locus_tag="Tb927.8.710"
FT                   /transcript_id="XM_841815.1"
FT   CDS_pept        complement(196484..200617)
FT                   /locus_tag="Tb927.8.710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="go_function: RNA binding [goid 0003723]; go_process:
FT                   RNA processing [goid 0006396]"
FT                   /db_xref="GI:72392215"
FT                   /db_xref="GeneID:3659047"
FT                   /translation="MITPETAGTTSTVSQPQPTKRDSGSSIASVQLTSPASSEPPTQKG
FT                   FTVEAASLTTANDIQMEKVTGTSSQSSETTAAHCWPLVNDGAGAAASTKSTLNPEAKEF
FT                   HVPMGAVGFAVPAVPNPVDLHAMLQNPLLYCQPAPMTPMAMPWPPSRGGIANDGMIAPP
FT                   EKNVAARWPASTPSVRVMASHDSSSGNSGSTAANTQNSVSQSPQSLTSQIMLAFASECS
FT                   NYHIVAVFNLESRTTKEELLNIFFPMNAKKAEILPQHFSLRPNRRAGAVFFPSKAFAAV
FT                   AVEKFNDFVPNGQHQPLRVIYCDPEAPPAQSLPVSPDATRSVTSMSGKQKQQQTQRTQQ
FT                   QPTWGLSSSAKPWRLPPGTELYKTHMEMCRFIQSNSHMNRASGKHVVAIHGLDPEVAHS
FT                   VLSQNFIQKGAECFDMWPPKSCSFATTPMACSSVSALVYYNEEATAMEAVSLFQLKPPE
FT                   GQAQPIDVVHLNKLFDFHPGGVALAGNQSVADVAGGNDTSATYSALHDTSNMAVLDEID
FT                   DFFKRTYSGRDLFLVGVHNLLATMDKKSLFALFSRYGALSAEIFPDIVQLSGGPRRSGL
FT                   IFFDKEGTARDAAEKLNGSYAKGQLFPMVARYLSKPSGRDPVSGTAASEAAVESGTMLK
FT                   PFRRNVASDVNDLCARVGNNALLREVVEELHANVVDVNVLTDKMQQLLTNPEATEKTAE
FT                   QLATALTDTLIAFGHHAQALSTPLVNALLSLHEKMRIPRRGGRDNVGVENGEDPDLIMG
FT                   RNIIFISKIARSLVHLFISNDKPDESRKVAAVLSAYLFQYCYLKKSPYELAVKIIKEHE
FT                   VALRSAKEFERSRPLSTKPAVLFGAGKGEEDVHKPCLILLACLEEFTSLWRKNNKSRAK
FT                   KDPYRKEYDHCLEGLLPLDSAQGGGNSSLCASARPTPRRVIEKVTPVNANGTSNSSPGL
FT                   TYTSPSSHRVTTRGEPMDISSSHDVSVECASPHSATPVSLPHGDASTPSMFFRHCGSSA
FT                   AMSLIQKQVQQQQQHLQQQQQQQHRASQVRPQLSEAATGLDSAKTFSGPRGGGYAPSVY
FT                   TQAELMDRTVYITKLPSTLRRAQFRRLLTYFGELNKVRLCRDENQVPPKGDITGVGRNG
FT                   SELGAPAPTLWFSFVEFAEPSSSKAIVEYFRNATFTSKPFSFLLDTPKGMPEASYFTVQ
FT                   DIQSLLNVRTSPARNPIHDQLSLDAVLTYSFPPVSVVCTEPCRFGIEHGEKTIDSAIDA
FT                   SPFSAFGSSCNMGLTPAARMRVTTKPLTDVQRHQPPVGTCGEQTKDADASDDDSLIEDI
FT                   MDRGVKLAADRTYAKGSREMPHEASRHTTSFDSFVKEMCGKLGEADVREFAVFGDVSQQ
FT                   SMAPANALREKEPNNYSMIWGSHAFGEVLMDDGR"
FT                   /protein_id="XP_846908.1"
FT   repeat_region   197580..197624
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   misc_feature    200978..200999
FT                   /note="AT_rich"
FT   misc_feature    201118..201172
FT                   /note="A-rich"
FT   misc_feature    201269..201330
FT                   /note="A-rich"
FT   misc_feature    201371..201462
FT                   /note="T-rich"
FT   misc_feature    201613..201666
FT                   /note="T-rich"
FT   repeat_region   201711..201753
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   201767..201817
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    201994..202039
FT                   /note="T-rich"
FT   misc_feature    202070..202186
FT                   /note="T-rich"
FT   misc_feature    202673..202734
FT                   /note="T-rich"
FT   misc_feature    202902..202942
FT                   /note="GA-rich"
FT   misc_feature    203287..203309
FT                   /note="AT_rich"
FT   gene            complement(<203348..>203830)
FT                   /note="synonym: Tb08.12O16.290; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659050"
FT                   /locus_tag="Tb927.8.720"
FT   mRNA            complement(<203348..>203830)
FT                   /db_xref="GI:72392216"
FT                   /db_xref="GeneID:3659050"
FT                   /locus_tag="Tb927.8.720"
FT                   /transcript_id="XM_841816.1"
FT   CDS_pept        complement(203348..203830)
FT                   /locus_tag="Tb927.8.720"
FT                   /gene_family="HOG000157065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392217"
FT                   /db_xref="GeneID:3659050"
FT                   /translation="MEELVNPNPTVFRGNLGKRKRTVEQEKEELCEDVRDPIDGLEIYE
FT                   LIRTIRDPEHPNTLEELQVVDPKLISVDEERQTVRVQFTPTVPHCSLTTLIGLCIGLKL
FT                   KRCLPRNMKVDICVTPGSHEQEEQVNKQLGDKERVAAALENTNLLNVVESCVNAFE"
FT                   /protein_id="XP_846909.1"
FT   misc_feature    203853..203877
FT                   /note="AT_rich"
FT   repeat_region   203953..203976
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<204635..>205396)
FT                   /note="synonym: Tb08.12O16.300; nucleolar RNA-binding
FT                   protein, putative"
FT                   /db_xref="GeneID:3659048"
FT                   /locus_tag="Tb927.8.730"
FT   mRNA            complement(<204635..>205396)
FT                   /db_xref="GI:72392218"
FT                   /db_xref="GeneID:3659048"
FT                   /locus_tag="Tb927.8.730"
FT                   /transcript_id="XM_841817.1"
FT   CDS_pept        complement(204635..205396)
FT                   /locus_tag="Tb927.8.730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar RNA-binding protein, putative"
FT                   /note="This gene is within a region that contains some
FT                   repeats that are probably misassembled and where Ns were
FT                   inserted at two locations where misassembly is suspected.
FT                   See PMID:8663171 for experimental characterization;
FT                   go_component: nucleolus [goid 0005730]; go_function: RNA
FT                   binding [goid 0003723]; go_process: RNA metabolism [goid
FT                   0016070]"
FT                   /db_xref="GI:72392219"
FT                   /db_xref="GeneID:3659048"
FT                   /translation="MAPMFHGFEVVPGKEHKLVLEKHHSFHLSVVSVKHGVKGRSTLYV
FT                   TVDGESFSLLTLDVSQQLMQTPVDIVFGYEQEVVFRVKGNAVLHCCGYQQESEGMLSAA
FT                   LSGSGEYDNAEEEEEEEEGEDTGLDDGDDMAGVPLTDGKKNGNAATKRQQVVDRTDDSD
FT                   DDDDEDEEDDEDDEDDEDEDDEDEDEDDDDQEKEEDEDEEPPAKKQKVGKSEGHVAQQS
FT                   KQQQRGVQEPPRNKSKPNFNGNNNDRKRGRF"
FT                   /protein_id="XP_846910.1"
FT   repeat_region   204789..204919
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   misc_feature    205023..205054
FT                   /note="CT-rich"
FT   gene            complement(<206119..>206538)
FT                   /note="synonym: Tb08.12O16.310; nucleolar RNA-binding
FT                   protein, truncated"
FT                   /db_xref="GeneID:3659049"
FT                   /locus_tag="Tb927.8.740"
FT   mRNA            complement(<206119..>206538)
FT                   /db_xref="GI:72392220"
FT                   /db_xref="GeneID:3659049"
FT                   /locus_tag="Tb927.8.740"
FT                   /transcript_id="XM_841818.1"
FT   CDS_pept        complement(206119..206538)
FT                   /locus_tag="Tb927.8.740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar RNA-binding protein, truncated"
FT                   /note="This gene is within a region that contains some
FT                   repeats that are probably misassembled and where Ns were
FT                   inserted at two locations where misassembly is suspected.
FT                   See PMID:8663171 for experimental characterization;
FT                   go_component: nucleolus [goid 0005730]; go_function: RNA
FT                   binding [goid 0003723]; go_process: RNA metabolism [goid
FT                   0016070]"
FT                   /db_xref="GI:72392221"
FT                   /db_xref="GeneID:3659049"
FT                   /translation="MLSPLSPIHFVFSISKGVLHLTFVKGFYGVEVSAGQKVKPKIPED
FT                   HVLRLTQIAVPANASGAITLVISFQGKEFTIATLDPKRSLFQMGIDLVLTAEQGTTLSA
FT                   TGSGSVHLTXXXXXXXXXXXXXXXXXXXXLALFVI"
FT                   /protein_id="XP_846911.1"
FT   misc_feature    206140..211720
FT                   /note="This region contains some repeats that are probably
FT                   misassembled. Ns were inserted at two locations where
FT                   misassembly is suspected."
FT   gene            complement(<207159..>208259)
FT                   /note="synonym: Tb08.12O16.320; nucleolar RNA-binding
FT                   protein, putative"
FT                   /db_xref="GeneID:3659052"
FT                   /locus_tag="Tb927.8.750"
FT   mRNA            complement(<207159..>208259)
FT                   /db_xref="GI:72392222"
FT                   /db_xref="GeneID:3659052"
FT                   /locus_tag="Tb927.8.750"
FT                   /transcript_id="XM_841819.1"
FT   CDS_pept        complement(207159..208259)
FT                   /locus_tag="Tb927.8.750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar RNA-binding protein, putative"
FT                   /note="This gene is within a region that contains some
FT                   repeats that are probably misassembled and where Ns were
FT                   inserted at two locations where misassembly is suspected.
FT                   See PMID:8663171 for experimental characterization;
FT                   go_component: nucleolus [goid 0005730]; go_function: RNA
FT                   binding [goid 0003723]; go_process: RNA metabolism [goid
FT                   0016070]"
FT                   /db_xref="GI:72392223"
FT                   /db_xref="GeneID:3659052"
FT                   /translation="MEGFYGVEVSVGEKVIPEIPEGNVLRLTQIAVPANTSDAVSLVVS
FT                   LQGKEFTIASLDPVRNVSQMGIDLVIKAEQNIILSATGNGSVHVTGYIQPIENVTDGES
FT                   SCGGEICSGVPFEKMAPPPFRGVAPACKTSVQSSNNTSESDYDVEGIVSVDDGVEKIGK
FT                   RGDKGEERPSKIRHEGGVEFHNEQHVDEHRYRRGGYFRYNGEGGYGGVHQGFFRQRGRQ
FT                   RINSTSSQGGFGAIYNEPIHEADQLGMNRGYGRGGYSSRGRGYMGGGYRGQANGEMRRG
FT                   YTNEERYLYSGGEWQGMSSNLLGRGFAAINRGFHPYSSRNNYPFPPNHHLNDASRTLPP
FT                   YSGRGGTNAVWNRGGFRGGNSGRGRY"
FT                   /protein_id="XP_846912.1"
FT   gene            complement(<208921..>209907)
FT                   /note="synonym: Tb08.12O16.330; nucleolar RNA-binding
FT                   protein"
FT                   /db_xref="GeneID:3659054"
FT                   /locus_tag="Tb927.8.760"
FT   mRNA            complement(<208921..>209907)
FT                   /db_xref="GI:72392224"
FT                   /db_xref="GeneID:3659054"
FT                   /locus_tag="Tb927.8.760"
FT                   /transcript_id="XM_841820.1"
FT   CDS_pept        complement(208921..209907)
FT                   /locus_tag="Tb927.8.760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar RNA-binding protein"
FT                   /note="This gene is within a region that contains some
FT                   repeats that are probably misassembled and where Ns were
FT                   inserted at two locations where misassembly is suspected.
FT                   See PMID:8663171 for experimental characterization. similar
FT                   to GB:AAC47134.1: Nopp44/46 {Trypanosoma brucei}
FT                   (PMID:8663171); This gene is within a region that contains
FT                   some repeats that are probably misassembled and where Ns
FT                   were inserted at two locations where misassembly is
FT                   suspected. See PMID:8663171 for experimental
FT                   characterization. 99% similar to GB:AAC47134.1: Nopp44/46
FT                   {Trypanosoma brucei} (PMID:8663171); go_component:
FT                   nucleolus [goid 0005730]; go_function: RNA binding [goid
FT                   0003723]; go_process: RNA metabolism [goid 0016070]"
FT                   /db_xref="GI:72392225"
FT                   /db_xref="GeneID:3659054"
FT                   /translation="MEGFYGVEVSAGQKVKPKIPEDHVLRLTQIAVPANASGAITLVIS
FT                   FQGKEFTIATLDPKRSLFQMGIDLVLTAEQGTTLSATGSGSVHLTGYVQPVDDGSDFDE
FT                   EDDLDEVDAEDMESYGVPPKRGGKSAKFPVSEENSDEANGDGVDGDDESDDEEGIEKDN
FT                   EGIDAGDEDDNDDDDEAYDEDDSDDDDDDDDDEEDDNDNDNDDDDDDDDDDDDDDDDDD
FT                   EPASKVQRTEQQGFRGGNRGGFRGGDRNGNGGNRGGFRGGDRGGNRGNFRGGDRSGNGG
FT                   NRGNFRGGDRGGNRGNFRGGDRGGNRGNFRGGNRGNFRGGNSGRGRY"
FT                   /protein_id="XP_846913.1"
FT   repeat_region   209240..209410
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   gene            complement(<211318..>213237)
FT                   /note="synonym: Tb08.12O16.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659053"
FT                   /locus_tag="Tb927.8.770"
FT   mRNA            complement(<211318..>213237)
FT                   /db_xref="GI:72392226"
FT                   /db_xref="GeneID:3659053"
FT                   /locus_tag="Tb927.8.770"
FT                   /transcript_id="XM_841821.1"
FT   CDS_pept        complement(211318..213237)
FT                   /locus_tag="Tb927.8.770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392227"
FT                   /db_xref="GeneID:3659053"
FT                   /translation="MNEGKGTSHATSEMTKDTGGESVVELARGNSRRKLSPRPRQEVAD
FT                   ALREGVGGTVETPDEEEEVFLFDKMVRQTMKPTLTPLFAVSWCWPKVSEESVPQRDAET
FT                   DHCQWDIGPTTITELRGDPRLRRGNRLIALIITEGRRFLLPLIPERREDDDSPESGVYW
FT                   QVPTRPYEVQLSQSPRAQLVIGTLQHVEEVNDMVRRFAESGSQHDDNVSLTTGEPIAES
FT                   EGTLHSPLGTFSFSSIPCRCLWLYRIPNCVVVSLPCEERLVFINTGPGVECKSIAPRVL
FT                   ANVLSCVSSFSFPRHVVPLDVNEIFDRPFVVVGTLLHGVLVVHVEDCGICTGIVHHIPL
FT                   TGLVSSIFPVTRLASVFPARRNRGEEISETSGAYWLKSGLFSQCLDGVIICSSPYEDRA
FT                   VVVKCASATNGGCGYELAPPKRFFCGISSATYTYSSVGTVVGTLDGKVMSVLASTELTE
FT                   DGSGSKSYKEFRRCRHSAAYDATCPAFVCTVLARNMTSGALTFICEGGPVLQKTSHTKY
FT                   QRSFVRHWLCHSTTLNEVVLLDRNLQSYAVHSTVPLGPPESDHFDEEAPDDLRRETDQN
FT                   TDNNREREEGSDTANVHLENGNRPHQPLENIISGLSWLLVEDGFLQVIVAHHKNWLSTI
FT                   TWKT"
FT                   /protein_id="XP_846914.1"
FT   gene            complement(<213736..>216813)
FT                   /note="synonym: Tb08.12O16.350; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659051"
FT                   /locus_tag="Tb927.8.780"
FT   mRNA            complement(<213736..>216813)
FT                   /db_xref="GI:72392228"
FT                   /db_xref="GeneID:3659051"
FT                   /locus_tag="Tb927.8.780"
FT                   /transcript_id="XM_841822.1"
FT   CDS_pept        complement(213736..216813)
FT                   /locus_tag="Tb927.8.780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392229"
FT                   /db_xref="GeneID:3659051"
FT                   /translation="MGDCVASHPSGRFLQTYTSVMPPMLQSDVTASSILSSILNKPMPP
FT                   IGMQGENLPYRMASGSRLGFSKCVLFTLGTGTCAGYSNVGTPEALLLQREFQIRDEYNQ
FT                   LCRAEEARRRMEEERTRRYEREEEQQSLIETARQLEESRAKREEEQRQRLLAQERELEE
FT                   WKHERARELERERRRHIEEEERMRERQHERAMQRLREESEVRIQSQKEISECHNVVEQT
FT                   VKSATNVMVERICNEMREREREYRAEANQLHQSYKSEIAALRHDIESKRQMIARSEQQA
FT                   AEAREIFSQVVNQLNEVRQKQESCSKSRSSEEALADVHRKTVEVLQRTFEDDKLSMKRW
FT                   FEEELRRINNTHERMRTEDEERCNSQLRMLERTLEEQQQRQREAEADIQQWRTKAAAAT
FT                   AAASEEARLREELRTVRKQLQDALASQQRLERRATDSERTAGEARNALHTLQGELESLS
FT                   AKQSAELRVLREEKQELVDEIARAKAAHEGEIQRMRGDMHNADSTAAHELSRDFESVYK
FT                   RMNEHHEEARRILEGEKGQVVKQLRESERQLEMTKRELAQQREKIEEVRRESERMWSQR
FT                   LSEKDRTAKELQGVVEELRREQCGAAQITAENLGLRQQLEKQRQDFEASLQSRDRDIQR
FT                   LRHEQEEALQRAAGINEGLSNSQRMRDEEERRLKRLLEEAAIREKELQGEVDDAKKNSR
FT                   SWKEHCEQLQAQAAAALSVGNSSMEALLREKDCEVDRMKTELARQTKERESLTHQLLEA
FT                   CATTKSLEKELMEKQTLIMSLNSDISTLRQAVQMKSTQVEGNIVHLSSAPSISGVAPQT
FT                   SPMSVRSRILASLSPPRAQEITVSKNTLDVVKPAAGVSLATPLSIQPVAVNPPPNKQTP
FT                   LLTPLAPTLLTRELENSSAPSILPLQSPVPVAPQLNPESVGGLPTHSTTSPPQVQVVPA
FT                   TPSRLPLPPQVSPQLSTGNNIVVASNPVNLRLEQLPTPVPLPPEIATAPLLVSAVGGAV
FT                   AAVPAPVPLPVPPLLNSNVAPPVNTDFAGVAVAPVV"
FT                   /protein_id="XP_846915.1"
FT   gene            complement(<217610..>221509)
FT                   /note="synonym: Tb08.12O16.360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659056"
FT                   /locus_tag="Tb927.8.790"
FT   mRNA            complement(<217610..>221509)
FT                   /db_xref="GI:72392230"
FT                   /db_xref="GeneID:3659056"
FT                   /locus_tag="Tb927.8.790"
FT                   /transcript_id="XM_841823.1"
FT   CDS_pept        complement(217610..221509)
FT                   /locus_tag="Tb927.8.790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392231"
FT                   /db_xref="GeneID:3659056"
FT                   /translation="MTGTTENHDEQHPLTCFETISQIPTQMGGSTRHTASTDSEDGGSP
FT                   LIYFAQPNVKDGVKRLMDIAVEFNGLLTDSSEKLLRLRRSLNSTLEILNTSMKGLKEMR
FT                   RPSGCLPSMVVAGATESGKSTVADFLLRCATCSFSDDSPMTKNDDSPAVNTCGTVSSPY
FT                   TSMSLQECSFRKGSCACSTTNISDANAAQNSRARAASTKPCRVSMDPRTERSCMASPRI
FT                   LYSPGRCTIPSAASSFRVVPRDPEIGAPQCQTPSVLPSLWTQERALRRFEYPEDDSKSG
FT                   TLSRVVNFSHLSSSRGRRQREGDTLSTYQAPTPVRVSTIRPGAYDVTIQERICALQKSP
FT                   RKSLIRDKPSPQRRCTLPMCPSKSWCSSEKLYASSIHSSQSGVSRSSPWLLKELASEVV
FT                   WSERGAMSSYQLPDLLLGDGLLYTVPCEVIGTQHMVESVGNLFSPFTQRIDDDNSSEML
FT                   SSSFSSSRAVSKHETHPARENQWQSMEGSSKESESQKIRQLIADMTFFVITFTDAVLMR
FT                   EAGASINDVQLIQRPPPMASSIPELIELFQENMMKLFGVAVSSWQVIPYSGTVSHATHS
FT                   VLSALYNDKLRRLSLAAAEEKQETPARNSQNRERVPSLSPSALTESDAGVGGGGVSRSN
FT                   DRSCEEESARTAVEAYCRVVFGANYGNRKEQLPPQQLEQLVLYDAVNSMWNKSGAQQLL
FT                   RAVRVFEKNTELSVFTRVAVSLVIWCHQLRTVLVRARKSATRRSRSIRMNLTKVQNLDN
FT                   VVREALGGFKEIPAPRVVVRDFETVVQRKFKSVTVAFWGKVLDLLDEAYEDMNDDHLTK
FT                   RRPVVRRCPLPSGPSDVSLAVRKRLLTEFRDLHRHFISLDYRKQIQQLRAIIAEQAMRI
FT                   RNVAAAKTKETVGARLEGADAVVLELVAETRRETIGGFAATKVSATAEDMRHHIPYVED
FT                   NARELKVIMERELTLRLSRFNTEIINYLMQELSEAIPDIAQVCGAQRDVMDLKLVQLFA
FT                   LLKMHECSDRINWNALDSKREQLANCSLLNMQPLGSLEPFVTGLRTSVVEDQIMLMLVG
FT                   EGFFGTDEVKCGGRTLSYLGKCENRICALQRRDLRLAMNLSCGRPLQSHFQNDDLLYTP
FT                   AKPEDLISSLGCWTDNITNVPHDEATSVSTAISEVTSFSDGSCDAPGNESAKQNRLESD
FT                   CRWSSTHPSLNPLWFILAVWQQTLSSMTFRPWFQLDGVNHATLLSSVGTLFTSSCEGLR
FT                   AQLRGEVRHLEDALRVEHREKSRVESRILKALRRLSTNAVTVANDFTRLRKGVFVSDEA
FT                   CKVRESSFSDPAKYV"
FT                   /protein_id="XP_846916.1"
FT   gene            complement(<223044..>229637)
FT                   /note="synonym: Tb08.12O16.370; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659057"
FT                   /locus_tag="Tb927.8.800"
FT   mRNA            complement(<223044..>229637)
FT                   /db_xref="GI:72392232"
FT                   /db_xref="GeneID:3659057"
FT                   /locus_tag="Tb927.8.800"
FT                   /transcript_id="XM_841824.1"
FT   CDS_pept        complement(223044..229637)
FT                   /locus_tag="Tb927.8.800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392233"
FT                   /db_xref="GeneID:3659057"
FT                   /translation="MQSDERSSAEVSLAVGDATDVSKKRNLQEQWLLPYLDRCTHPRLR
FT                   EAIEREDRMAIEKGMLLLLAFGTPEEVAGRINSNNVDEQRGEHGEKGSSCSRFGVADGT
FT                   GTPVPLVPICSSPRNEYSDWSDAEDELVCRCTYFRRTFTNKNFSYNLPRDVQRNVVIFL
FT                   YTWIVNWDFMIRNVSAWSSVVSCFCSVVRGRRKYALKHPGFSLPWKPLVDIVHSLVFES
FT                   SRLSRIRFYTHVKAEVAEILANLCWCASLHFDGESLNGLWEICAPYFSQDSEQAVQALW
FT                   FLYILLPIHATYDRVTGRALPMTERIVRFLLVDARYWQQRSGSWLMVSLDIVFKICRER
FT                   AGIMDLDEYAETLFSMILSVMRPPISSNDKPERLVSSAWSFGGRKVLEVSQGRFMKIVG
FT                   RISEALPCCTTSPLWNQLRRFVSSTSVFLTPCAVDSRALGHLLSFYNTFLETAYLRVKH
FT                   KHSWLLTGEKDPGNGFVINGYRWKRETVDSLVEIVAPAIIPALYHGHHSIINAVGLLTL
FT                   LSPKIMQPPAFKYVEAGIRGCLESPLQCSVALKLFTKTLLPFSECSETRESCRTFLSEI
FT                   LPLVPQWINCSSIQLSNSVREFLFAVFTVLNLDELLGSEVAECEFAVSVVEQLFHSAKR
FT                   GDTEDSDADVLASIIDSLSHNVSDEAYSDCLKKALKEAETQVKNSQVPSVGCLLEPLAR
FT                   RSPERVMKWAIARLLPPLRSDVNTCNDEEVLWCSSLLSSCVCGAGLACFPYRYELLDCI
FT                   QAQLFSITNRKRRCCAALLYTAVFFAFSETRCVGVRAVDSSLVRGDHMMEEESCAAEGD
FT                   SEQKQDKSSMGLYRYFDVEPVWQEPSEEHVSFLHEVYQLFLTDLTDIIQNIEHIRVPSR
FT                   KEAARGLRAFLPPHLSPSSHHDSVNEGLRENGGCVDDSVRQLVSHQAPSAPDAEGSHDV
FT                   VTPHNVLCGAVCWLDTVWAVNCELRVQCATDGETNMTPWHYKDPKTPWPLHEVSPSLLE
FT                   KSTRLTESIHSLLLDYVLRRVTGGVADEAVIATVLRRDQSLLVRGKLPLDVAHTKGVDV
FT                   DTLCYVLTLFFREMGLDTRTNIPNDYTIPFDVEFKHFSAIIVESERHRFYFPALFWRLR
FT                   SEYLLHCRRQQNPMVVYPQYLGDTLSIAYSLLFSPYPDVRKHCSCILRTYLPYLGFDGC
FT                   RQFLLRHFDVLEGIIDFVRQEGDVCSGEKNSICDKEGHTGPGEEILQIENCSSEGNDSC
FT                   VEGDRGSDAAKICDVFFVEGCTGAETSQSKSDDHGKGSALANASDDIATSGVGEKGSLV
FT                   QLRKALSGAIMQTVIGFSLDVYQRDASFIRRMFEVGLKIPDQLRRTGSACSLYGDRAAE
FT                   VCTPFLIEPMAIACLTDELLPLAMKCSHTAPTFAVQMLRTLSCNHIQLHYELLSPASIA
FT                   ALFKLTVDICAETRRSAFSVLRVVLYSLKEKTPKVNILMRKGSMEGEDTTSFFSNRYRF
FT                   LQENHTSFSLHGKMGLVFPPKSIRVDRTCAPPDISGDGEVFTVPDNEVPGLRLRMQSFT
FT                   TCHEEKDLAERRMVRQGLKNLISKLAGILDDNENTSKGAQEQASDTDDSVGKVLVNEAA
FT                   IEKRIRGTWVWNVLLANRDQTSFSVGLASMWRSLGEAAGVEETVKRYIQVAYLWFSDYM
FT                   KLVQSESNRSKEYPQELPCLVDVIVAAICLSKRNPKLRREALDCYVSMLLQACSNILLS
FT                   HTVLMSFISGLGALYGKVKTHDVWSMYEPFFDMLTPLDDGSGSPVNVTSGVRDSDSVEA
FT                   NIKVAFTGVKRGILRALHVITKLLDVFAADVNIVLLPKLCRCILDRKKIFLFSDSNEIR
FT                   HYAATSLRYLLRLSLYQSKYIPSNNSAQSVVLDFLRQLNCIVRLQVCYPPTVLNSGFPF
FT                   QVATTCITAVNANEDMLVVNKHPVASDNKNHGNTSDVSTTAEQAGLKTLTSMWHSPPPE
FT                   LFSVMWMEAITTATTALDGASLDNDDFETVALSTLSSFALSRQRKDVIQSVVKFLCDVL
FT                   EGNYPFGKTRRAKVVLTRAFYQMLLMNLHRIGKYETMRSVFSACVGCMSHGDGDLRANT
FT                   RSLLAVLSRVASIEQINSLVQQCAKELQEYSISSDRDTGGVAEEPLPAVIERENNRKRR
FT                   RAALVRCLCAFLSSDVGPITPHVKFLMRKLAPLEHDAMAEVQREVKVAFEQWWKAHANG
FT                   WELYHRESFTPKEIELIMPLMKMPKYLV"
FT                   /protein_id="XP_846917.1"
FT   gene            complement(<231908..>232909)
FT                   /note="synonym: Tb08.12O16.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659061"
FT                   /locus_tag="Tb927.8.810"
FT   mRNA            complement(<231908..>232909)
FT                   /db_xref="GI:72392234"
FT                   /db_xref="GeneID:3659061"
FT                   /locus_tag="Tb927.8.810"
FT                   /transcript_id="XM_841825.1"
FT   CDS_pept        complement(231908..232909)
FT                   /locus_tag="Tb927.8.810"
FT                   /gene_family="HOG000255409" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392235"
FT                   /db_xref="GeneID:3659061"
FT                   /translation="MSSVSDCIFGLPYVGKALSTAERAALQSSLPLLALKYNLPVQFWG
FT                   KVTGVRGDYLVAQVMPNGLFGARHSFFSVDGGTSWRVLETLSEDQVAFCDQLRGVYIGD
FT                   PSFLYKVRRDIPPEPEPEVKVPDAEDLLKDAKEKYGGEGEENEEDMEEEEEEEEEEQDE
FT                   GELEEEEEEVEEEPPRKKRPKFMIVAVPETIRLAHFIGLHDRACSLIVRGQYVFTPAGD
FT                   VEKNTLFAGQPTRHAMKPSCYLRVFHAGNPERNRILYGPTYSSVTDRLSPITDDEPRGV
FT                   WVVKYEPTASIVTVENLLYPGSLFWYRPGSKDCGQVYCGSGERDFEVCFLLP"
FT                   /protein_id="XP_846918.1"
FT   misc_feature    232383..232460
FT                   /note="CT-rich"
FT   repeat_region   233527..233571
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   gene            complement(<233701..>235362)
FT                   /note="synonym: Tb08.12O16.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659055"
FT                   /locus_tag="Tb927.8.820"
FT   mRNA            complement(<233701..>235362)
FT                   /db_xref="GI:72392236"
FT                   /db_xref="GeneID:3659055"
FT                   /locus_tag="Tb927.8.820"
FT                   /transcript_id="XM_841826.1"
FT   CDS_pept        complement(233701..235362)
FT                   /locus_tag="Tb927.8.820"
FT                   /gene_family="HOG000256593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392237"
FT                   /db_xref="GeneID:3659055"
FT                   /translation="MSFHKLFSSNNRSTRRELFSGSGLLYVKSDDCFVPIIEGKRMGSF
FT                   SLILYENRSEQLPYSFVLVDEEEGEVLKQSLGSGLSLAHCYRECSVHWLSLVDGTFQNL
FT                   AFKFVDLESGGSGEIVTRKFVEMYNRCTYSMLTQTPLDVSTAQDPIYEYIGQTSTYVAP
FT                   EDDYSEPTYHLDLDRERVKATGSGNVCYSESMKHNRIVVVRETQNEVQLQAHSYDANGF
FT                   EGRKPETIDLKSVQTCDGALIDDLERKLLLFSVEDSHLREVDLERGEVVQQFRTPVNLQ
FT                   RVTYSEHVARPEPIYTCLAKDVAFNVDLRIDPRKNIIVEDGMSLADYKLGSLRKPFTCH
FT                   ATSANGYLVIGDGTGSVRLYTGPPGSRRKDGSHNPKTAKTLLETKVPIVDIDVTANGQY
FT                   VVAVCEKFLLLMRTACGNNGEKNGFTSRMGQDKPSPLRLQPTPAQLSALGGIEALKFTS
FT                   GGFDRYEGNGEVCITACSGAYLFTWSLEAAKRAEETGRTCLSQAAAVQQEVINAGAKIA
FT                   NRIVYQTDKDIRMAPLVREEFRETGLRHFGWRSTSE"
FT                   /protein_id="XP_846919.1"
FT   gene            complement(<237154..>241713)
FT                   /note="synonym: Tb08.12O16.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659060"
FT                   /locus_tag="Tb927.8.830"
FT   mRNA            complement(<237154..>241713)
FT                   /db_xref="GI:72392238"
FT                   /db_xref="GeneID:3659060"
FT                   /locus_tag="Tb927.8.830"
FT                   /transcript_id="XM_841827.1"
FT   CDS_pept        complement(237154..241713)
FT                   /locus_tag="Tb927.8.830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392239"
FT                   /db_xref="GeneID:3659060"
FT                   /translation="MATHCQTEGVPLRRRRRQVEKQTTDGQSNILTTIVFRSHAESTST
FT                   VPFLYYPKNYGLPMPAPGEPFTEAIIELFIPSHDSGDGCGEGYRSNSFCGSSCSQGQSI
FT                   APSVGGVGGTSNAGTLFSTGSQLPLRFDGGAARLGVFPSSDPIAIATGRGTTHTDAQSL
FT                   GWDSATATPCVSHESWVCRAYCFGEKDAPHSNGAISVLYSLANKSKFINNIANGKAVAR
FT                   VIPSYDEVCERFGLSHVELSFERQQISRADMFLIAEALRDNIIYEGEEINLLGFCLKVN
FT                   EMLRKRENNPAPHGNSGGGVPQAPPAPRTGLLSNGFEHSGAAQHHRQEGKVEEQSKGYR
FT                   SVRCGLVTKGTVVNFLSLSAVHYIILEISAEMWNLTSDGCIQLDWAVKNFLGEYLTQQL
FT                   SKHKASPHLRIVMAGRLHPKYAIRGCVDVVHVMHVPDDSRSPMITEDINLQCEEFLRRV
FT                   LGEVKEELRAGGVTSVVYCNSAVAGSCTSSSSSKTIENLTARDLFVPSKNSCTVETIGL
FT                   LLDETKELRSDKNTGLMISVVSAGKGIFQVTNDLVQAICIRLLKVGMEKVNIICMGRPP
FT                   LHSAPLLECVNDDENPSFSHFGAEQPCHRLYIDAEWARCYFYQLPSDFTGGNVPSSELF
FT                   TREEWFQKHWKQIDMHRCAGEVAPLSPGLAIPPMQPRGVLLLPVIQPRTSGPSVAKSEA
FT                   PSESEDSQKVKSSAPLSGTPTGLGEDVPRTTQAQRNSREASADPCQTKDVSADALSEGR
FT                   ELREAAFRSLMELSPALPGGDVWGSLGYPQIGSRKQLAHQPFVCARWYRLVNVCLEGKG
FT                   QGNWDTVCEFILKGIGNCCQVSRIGRVGTSIDAPSIVPCGRNIVDFDVQSGNMVLRLDL
FT                   NLVTHSGRAWNPCIINDANTWTWFMDSFSDKMDHFTCEERKNIDPKFCAANIFNRDLSV
FT                   IVADGQTLLLPTRKNNVAFIADERVVLKYRDDFFLPSTTSFPHVDTMPLPSSAGSISSC
FT                   EARGHNAHDQRSGAVTAPVAHVQLKNGVMFAMKPINPYCTSVRTDEASIAAHGASTETI
FT                   LRRRWKFAHPELSSSYSNDAGAAAAQRSHWSALCYCRILPLFGAKPAYPRDSFFDKPIH
FT                   QYSIPMRDTMQSLEYVLQRLQHRHQIVLSLPSVAEIQWPREDVIPHARVVTSIGYQIHE
FT                   LKIDETGQSIHITRLLHRSVYTSLPKMQKVEHKFLLLNYLNTSFSARRVNLEMQISEEA
FT                   AFQWDALDSYIHDRGRSDTFIPRSLTLTFPENEMCLAIIPESLDNACVSYQDFLGFMEK
FT                   SLNSNLRVRTPVTWAENVEELSTGIPVGDSSNEEPTVNCVVLVDEEQLSLGHCRAMDRR
FT                   TGRTRCLEEPPPNRQISINVSLPREYNRRCHYLLRVSWMVCTQPVLLNWVSAVSANAPP
FT                   YHLRCVLLPTYECSAKQDEMIPCYTVLAQNEEEGPHFRARLLDTLTSSTYRYLPDNPMM
FT                   GGKCRLLHMSGLCYVISSPKSNVVACWYENPMMGTGQMNHKMLLEEFLVAVQTARNRP"
FT                   /protein_id="XP_846920.1"
FT   gene            complement(<242762..>246022)
FT                   /note="synonym: Tb08.12O16.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659058"
FT                   /locus_tag="Tb927.8.840"
FT   mRNA            complement(<242762..>246022)
FT                   /db_xref="GI:72392240"
FT                   /db_xref="GeneID:3659058"
FT                   /locus_tag="Tb927.8.840"
FT                   /transcript_id="XM_841828.1"
FT   CDS_pept        complement(242762..246022)
FT                   /locus_tag="Tb927.8.840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392241"
FT                   /db_xref="GeneID:3659058"
FT                   /translation="MQCERFKQTKRDQLPLYCHDVRLAWRMQPLGFSTGSLRSLVHTQR
FT                   AEAYQQELPHNLRGCIESVTHLDGTRESHCDPFANPEEMEHSANPIASEGAQTPSESFV
FT                   RSFGLRRELEGHNGCVNSLSMNASGELLLSGSDDLAFCLYDTFEWQIKQRYRTRHSSNI
FT                   FHAVFVPGNDHHVVSCARDGRTLVTDLEVGESFYKCRHSQVASSIAVSPWWPDTAYVGY
FT                   LNGFISRIDTRTRRLESERTTDGNPCLPSVGEVRTLAVHDRWPFLLASGTNTEAVYLHD
FT                   VRMCSLGAFAAITIPCVRRSNGVSGLSFSANGTSLAVNYREEHVYVVPWLETLYSRAVS
FT                   TSASRNATCTGFSSVLDMGAVDKLTVATADGAVKMSGRRNVQTMFKDVTFMEDDSIVCS
FT                   GCDSGNVFFWRTSDGKLIHTTPGDASIVNVVLYSHRTGRLLTSGIDDTIKVLGPLNGRV
FT                   SQSIEHREEVEDTFSRSVVGVVDTVRRILLGEIPSTRGDRLSEILSLGDNLVTRTPDTE
FT                   DRTDVRVELNTTVSDDSDDDGGGSVDDFDSHYEDESNEEVGQYQSQDRIWHVNFSRSHV
FT                   EASLEQFAAAERALHMSLTDLILLTRQLVATWVFGSRRVVGGIGTVPPLFLANGAMSST
FT                   TAESDAFSGIRGMVVEGAEDDGDVDVDDMITDDATALSSARMSLPEDTSNLGDSIDRHV
FT                   GSDSGVSSASGNGEDDPFLVIGTSILTPATERHISHIRAADEGTLVEELPVVGGGPGQR
FT                   EERGDSTSQRTGDDRNEAAIPGTDVMGTVSSWFQDMHRVFNKLRDGLKTTFRRWTLPGG
FT                   GRVQIPRWDRCTFGVASGAPVVDGGWSPSQAPDVDDDTSFLFYYASGVAQAESSGNVPA
FT                   APPTFDAFLSNKQRIRCFLTLLDVVLRRKELICSSTEERRGYWMFRCVTELCYAYYFMA
FT                   LGEAEAAIHHVEQLERHAEYRCITALGSVDSACLRLGGKRRRQAPVPQGTGSRGTYERR
FT                   GTELLRTLDCGELPPLLVPMALKIRILVLSQRGVVSGEDVLSSGSCSDHGELLRDQAGD
FT                   SYLQSLVNEMRGRLSGHPNEKVKQRVVRMLRGINITLS"
FT                   /protein_id="XP_846921.1"
FT   repeat_region   246130..246153
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<247305..>249572)
FT                   /note="synonym: Tb08.12O16.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659059"
FT                   /locus_tag="Tb927.8.850"
FT   mRNA            complement(<247305..>249572)
FT                   /db_xref="GI:72392242"
FT                   /db_xref="GeneID:3659059"
FT                   /locus_tag="Tb927.8.850"
FT                   /transcript_id="XM_841829.1"
FT   CDS_pept        complement(247305..249572)
FT                   /locus_tag="Tb927.8.850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392243"
FT                   /db_xref="GeneID:3659059"
FT                   /translation="MCRPLLYTRRDSKGAEERMNGRDGVRREHSASIGSATTDLLFMGR
FT                   PLPHRFIVSWLMLVGILVLSLAYHVPSYTTSYVKRKAVLGHFLADDYLGKESGDIVRLP
FT                   TVFVHNRKDLFSRIEDFVAAFYELAAAAEAELKYHYYMSAATGKGTEFLRYILNGETPQ
FT                   RVEEMDRILTKEMNNLADTSEAETVTINAVTPVKMDVELFAFGSREHIGPSDTKIFSVT
FT                   LTEEDPLGPFASEYRDWSNGSSKTNDGEEEYSSRYSRAETSSGNVLDSPPNIRINTACA
FT                   PRLSTLSGKYYSPCRRQIKGDAATNADVFFFSLTDNVRSIRLRGTLPQVIAKLTDGSRS
FT                   TSGFSMIIYQWTIEVKFFFHRGGYVETTYNIISTAKHIQPRIHPRFLLTSVMFLLALLD
FT                   MAIRFRALKSAISFRREAAAEKSREGGYSLPRAREGVGSGRKCHSEGTDVESSPSEIDG
FT                   ADSDRGVTMLIVKSLKRWVRHHADQWIMHRTSRPGARDSGPVGFMNMYEQWHHRLQEKG
FT                   GDGWHFVGLVADLLILLYVSLFSVRLFGVQLSCFFDAVENMTLGVAAFFVCVNLLSQSR
FT                   YFPEMYFNVQAMLRLISKLFLGMLSILPMFIGFVLFYCMVFGPHSDGRFTDVNYSFMTL
FT                   YFMMFGDALVPAIASAGGSSFSLATFLANTVTVVYILLVIIALNLAMSITQYQWVRQRR
FT                   KIGGKDTLLTFRTREDVRVEVLEDITDSIEVLLQLEATEVSAREKKTRSDVAASDSSAV
FT                   SV"
FT                   /protein_id="XP_846922.1"
FT   repeat_region   249799..249876
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    250091..250140
FT                   /note="A-rich"
FT   repeat_region   250800..250837
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   251340..251359
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<251405..>252079)
FT                   /note="synonym: Tb08.12O16.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659062"
FT                   /locus_tag="Tb927.8.860"
FT   mRNA            complement(<251405..>252079)
FT                   /db_xref="GI:72392244"
FT                   /db_xref="GeneID:3659062"
FT                   /locus_tag="Tb927.8.860"
FT                   /transcript_id="XM_841830.1"
FT   CDS_pept        complement(251405..252079)
FT                   /locus_tag="Tb927.8.860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392245"
FT                   /db_xref="GeneID:3659062"
FT                   /translation="MYFFFFQVIDREKLAYASNISIILELLCAVLIFVLIGVFLRVAPL
FT                   KWAHFVAPRRVNVCRAELNIINPKVEDALESTAVERPKENITNVKRHKEEDSRGNKISP
FT                   IVEKTTNRAEKTSRVVRDISLEDTLDEFFREEQLLHDTLLDVETDMNLHRVEIEPTMRL
FT                   LSPPKVVNQRIKVPASPEKRRENGRGKVVPVSKVHEKSLDEALECFFNDEELLEGTLQE
FT                   VF"
FT                   /protein_id="XP_846923.1"
FT   misc_feature    252145..252174
FT                   /note="AT_rich"
FT   misc_feature    252224..252302
FT                   /note="T-rich"
FT   repeat_region   252472..252509
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   252538..252584
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   252695..252732
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   252889..252928
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    254394..254450
FT                   /note="A-rich"
FT   repeat_region   254818..254882
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   255024..255069
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   255283..255325
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   255850..255891
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   255925..255953
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    255954..256037
FT                   /note="CT-rich"
FT   misc_feature    256143..256191
FT                   /note="A-rich"
FT   misc_feature    256334..256467
FT                   /note="T-rich"
FT   repeat_region   256606..256639
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   256777..256845
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   256861..256887
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   257006..257067
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   257208..257252
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   misc_feature    257296..257366
FT                   /note="A-rich"
FT   repeat_region   257576..257622
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<257844..>258734)
FT                   /note="synonym: Tb08.12O16.490; serine/threonine kinase,
FT                   putative"
FT                   /db_xref="GeneID:3659065"
FT                   /locus_tag="Tb927.8.870"
FT   mRNA            complement(<257844..>258734)
FT                   /db_xref="GI:72392246"
FT                   /db_xref="GeneID:3659065"
FT                   /locus_tag="Tb927.8.870"
FT                   /transcript_id="XM_841831.1"
FT   CDS_pept        complement(257844..258734)
FT                   /locus_tag="Tb927.8.870"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72392247"
FT                   /db_xref="GeneID:3659065"
FT                   /translation="MRGTKRIGRYELGKTLGSGNFSKVKIGRDVETGKEWAIKIIDKEQ
FT                   LVRERMEEQLKREIAVMKVLRQPNVIELREVMQTTNHIYIVLELVTGGELFDKIAAAKR
FT                   FDENTARHYFHQLIAGVHYCHSQGIAHRDLKPENLLLDSDDTLKISDFGLSHLHNGNAG
FT                   GQGTMLQTVCGTPNYVAPEVLKERGYDGVMADVWSCGVVLFVMLAGYLPFDDENVNALF
FT                   TKIERGEYRMSRHFSPNARSLISRMLTVDPRRRITVAEITQHPWFVEGGNQTVPNTHQV
FT                   VHVSDEEVQNAVQTV"
FT                   /protein_id="XP_846924.1"
FT   repeat_region   258768..258793
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    258794..258838
FT                   /note="CT-rich"
FT   misc_feature    258907..259058
FT                   /note="T-rich"
FT   misc_feature    259150..259240
FT                   /note="A-rich"
FT   misc_feature    259515..259573
FT                   /note="T-rich"
FT   misc_feature    259669..259740
FT                   /note="A-rich"
FT   repeat_region   259835..259865
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   260075..260231
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   260078..260231
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    260430..260571
FT                   /note="A-rich"
FT   repeat_region   260969..261003
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<261157..>263406)
FT                   /note="synonym: Tb08.12O16.500; hypothetical protein"
FT                   /db_xref="GeneID:3659066"
FT                   /locus_tag="Tb927.8.880"
FT   mRNA            complement(<261157..>263406)
FT                   /db_xref="GI:72392248"
FT                   /db_xref="GeneID:3659066"
FT                   /locus_tag="Tb927.8.880"
FT                   /transcript_id="XM_841832.1"
FT   CDS_pept        complement(261157..263406)
FT                   /locus_tag="Tb927.8.880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392249"
FT                   /db_xref="GeneID:3659066"
FT                   /translation="MTINIFAELEQFKRCKIITHLDPAQDYLLYRTPRTVPTLLGKKVT
FT                   GDPTPRPCDTSSHTLDGDSVMKWFESSATTFTSRAPSPRQCALPAQKTPLNLIPSCDDD
FT                   FEATKSVDAGDGLAKTVIYLPMASSDQPTPQLLSPTPAAPELSCSEWFLPGESAECILM
FT                   SPYSQHLPLTKIASRAAAATRETASPTIVVEHVEVPSTSREEQPPSPDLAVRVERTPRV
FT                   TETAAKKTPRNCGAGNGITGTTDTLRPPVVATRMTHRRPEACVTPTTVKGNNIPASPVG
FT                   DDDVVVELVVDEDVPHIHDAKVVQTSAVVTPRVPKPSAISTLKSCGMEASLSVTNGLVP
FT                   LKVPAVTSRRSLSRKPGAMGGFATASTTPRIPIVTIMGSTRSANAASGRVTSRGTPRTP
FT                   ASSLRRTSRTTEEASGRVVAERVVRWRRLSESGSCLLDSPSSPTASEFFSRRTGITPII
FT                   KMTGASSRASPQPSVVPTARSTAVAADGSQNSLEEAPTAQSPSSPAAASDRLSITPTAD
FT                   ASLVTPEKWTCPALPTTVERSLVTNKISLRSSVAPTVHSHPVTEKASRCSSVADSTELC
FT                   PTTARGPHQSIALHSSRSLPMFSEVPANSPNISTACASSPMSNRVPFFLDTEPAAEVPV
FT                   AVTQTARRRSPIATSEPFPATSEEHSPFSSAPFGSRRRGVIVVSRPPSVAHTAAESHTA
FT                   AESEVTDRTARRSLTSVRSFESCASPQQTVGEAVPSSVLIGLPRQREKTKCCHVM"
FT                   /protein_id="XP_846925.1"
FT   repeat_region   263512..263537
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   repeat_region   263664..263683
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   264266..264303
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tcc"
FT                   /rpt_type="tandem"
FT   misc_feature    264468..264511
FT                   /note="AT_rich"
FT   misc_feature    264725..264993
FT                   /note="T-rich"
FT   repeat_region   265098..265146
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    265215..265308
FT                   /note="A-rich"
FT   repeat_region   265488..265519
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    265581..265623
FT                   /note="A-rich"
FT   misc_feature    265944..266035
FT                   /note="T-rich"
FT   misc_feature    266073..266113
FT                   /note="T-rich"
FT   gene            complement(<266112..>266738)
FT                   /note="synonym: Tb08.12O16.530; small GTP-binding protein
FT                   Rab1, putative"
FT                   /db_xref="GeneID:3659064"
FT                   /locus_tag="Tb927.8.890"
FT   mRNA            complement(<266112..>266738)
FT                   /db_xref="GI:72392250"
FT                   /db_xref="GeneID:3659064"
FT                   /locus_tag="Tb927.8.890"
FT                   /transcript_id="XM_841833.1"
FT   CDS_pept        complement(266112..266738)
FT                   /locus_tag="Tb927.8.890"
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small GTP-binding protein Rab1, putative"
FT                   /note="go_function: GTPase activity [goid 0003924];
FT                   go_process: small GTPase mediated signal transduction [goid
FT                   0007264]"
FT                   /db_xref="GI:72392251"
FT                   /db_xref="GeneID:3659064"
FT                   /translation="MSTEYDHLFKLLLIGDSGVGKSCLLLRFADDSYTESYISTIGVDF
FT                   KIRTLDIDGKVIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDTTDMESFNNVKTWLS
FT                   EIDKFASENVNKLLVGNKCDLVTKKAVDTQMAQEFADSLGIPFLETSAKESSNVETAFI
FT                   EMAKNIKKRVAAQGANSGATAGGRPLLTGNNRPATNSGGQKSGCC"
FT                   /protein_id="XP_846926.1"
FT   misc_feature    267581..267675
FT                   /note="GA-rich"
FT   misc_feature    268590..268620
FT                   /note="AT_rich"
FT   repeat_region   268772..268819
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   269856..269899
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   270134..270156
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<270276..>271262)
FT                   /note="synonym: Tb08.12O16.540; splicing factor TSR1"
FT                   /db_xref="GeneID:3659063"
FT                   /locus_tag="Tb927.8.900"
FT   mRNA            complement(<270276..>271262)
FT                   /db_xref="GI:72392252"
FT                   /db_xref="GeneID:3659063"
FT                   /locus_tag="Tb927.8.900"
FT                   /transcript_id="XM_841834.1"
FT   CDS_pept        complement(270276..271262)
FT                   /locus_tag="Tb927.8.900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="splicing factor TSR1"
FT                   /note="98.2 identity to GB:CAB52245.1: splicing factor
FT                   pTSR1 {Trypanosoma brucei} (PMID:10477180); 98,2 identity
FT                   to GB:CAB52245.1: splicing factor pTSR1 {Trypanosoma
FT                   brucei;}  (PMID:10477180); go_component: nucleus [goid
FT                   0005634]; go_function: RNA binding [goid 0003723];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72392253"
FT                   /db_xref="GeneID:3659063"
FT                   /translation="MDSRDGSGSDNPEVVSLYIGLGPAASTISKEQLWERLEQVAPVSD
FT                   VRIRGRCAFVDVAGPEAADRLITEMDGKYIGEARMVVQHSRGSNREGERDRDRERGRER
FT                   ERGRHRERGRGVPFDGRGADYGGYNNSAGGRTALFVGLGPSGRSISDRELRSKLEEAAP
FT                   IIGFRRRGECAFVDVPSPAHARRMIEMMHNQYMQDCRLSVQQSREGKRGRLDDDRVDRP
FT                   RRRSGSRGRRRRSRNRNRNRSRSRSRSRSRSRSRSHRSNSRGRRRTRNRSRSGSPVSSR
FT                   SSYSRRSSEASAGSRGYKKRDRRRRERSRSASSGSRSGSENYRKRRD"
FT                   /protein_id="XP_846927.1"
FT   repeat_region   270445..270602
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cgg"
FT                   /rpt_type="tandem"
FT   repeat_region   271330..271358
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    272393..272576
FT                   /note="A-rich"
FT   repeat_region   273317..273341
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   273346..273403
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   273479..273510
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   274097..274192
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    274739..274771
FT                   /note="AT_rich"
FT   misc_feature    275188..275246
FT                   /note="CT-rich"
FT   misc_feature    275740..275795
FT                   /note="AT_rich"
FT   repeat_region   276196..276222
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   276225..276245
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   276622..276741
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    276760..276822
FT                   /note="GA-rich"
FT   misc_feature    276856..276893
FT                   /note="AT_rich"
FT   misc_feature    277034..277091
FT                   /note="CT-rich"
FT   misc_feature    277507..277560
FT                   /note="A-rich"
FT   repeat_region   277817..277918
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   278000..278044
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    278188..278230
FT                   /note="AT_rich"
FT   repeat_region   278303..278333
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   misc_feature    278755..278777
FT                   /note="AT_rich"
FT   repeat_region   278803..278831
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   misc_feature    279170..279221
FT                   /note="A-rich"
FT   repeat_region   279404..279446
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   279480..279551
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   misc_feature    279578..279604
FT                   /note="AT_rich"
FT   repeat_region   279760..279797
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cataa"
FT                   /rpt_type="tandem"
FT   misc_feature    279798..279818
FT                   /note="AT_rich"
FT   repeat_region   279946..280081
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   279946..279965
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   279966..280081
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    280213..280289
FT                   /note="AT_rich"
FT   repeat_region   280368..280392
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    280496..280520
FT                   /note="AT_rich"
FT   repeat_region   280547..280579
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gagtg"
FT                   /rpt_type="tandem"
FT   repeat_region   280748..280785
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    280875..280911
FT                   /note="AT_rich"
FT   misc_feature    281002..281032
FT                   /note="AT_rich"
FT   misc_feature    281068..281091
FT                   /note="AT_rich"
FT   misc_feature    281158..281200
FT                   /note="AT_rich"
FT   misc_feature    281278..281317
FT                   /note="AT_rich"
FT   misc_feature    281542..281565
FT                   /note="AT_rich"
FT   misc_feature    281657..281758
FT                   /note="T-rich"
FT   misc_feature    281901..281924
FT                   /note="AT_rich"
FT   misc_feature    281969..282148
FT                   /note="A-rich"
FT   misc_feature    282169..282338
FT                   /note="A-rich"
FT   misc_feature    282419..282636
FT                   /note="T-rich"
FT   repeat_region   282689..282715
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    282815..282883
FT                   /note="T-rich"
FT   repeat_region   283136..283155
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    283379..283528
FT                   /note="A-rich"
FT   gene            complement(<283743..>285140)
FT                   /note="synonym: Tb08.12O16.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659071"
FT                   /locus_tag="Tb927.8.910"
FT   mRNA            complement(<283743..>285140)
FT                   /db_xref="GI:72392254"
FT                   /db_xref="GeneID:3659071"
FT                   /locus_tag="Tb927.8.910"
FT                   /transcript_id="XM_841835.1"
FT   CDS_pept        complement(283743..285140)
FT                   /locus_tag="Tb927.8.910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392255"
FT                   /db_xref="GeneID:3659071"
FT                   /translation="MTEFNYDTMFLCTSDDRDNLDTITESLTRQMNDDDDDDDNIMVMR
FT                   KARSGAAAPASTAVVPEGAANHLHTALDTEAMLRSKDSKSLLVSQESGHSTFETSRTLD
FT                   QVDSKSLLSAYSRFSQPLSSSEPPTPGVMSVTEPSATSPPALVSANPVAGYDQPPAGTG
FT                   QRTLPSYNPQEDCPPPYEWVGERSKHAQMPVAQQMPLANPQVARASAGVQSIVQMPGGV
FT                   YSMGTQIVPSSLLSVSMQKRPAVVPQQQQTALSGAFTPAVGLNQMVQSFAAPPSPMATS
FT                   APGATQRLQATPSLASGTSAPPPGYVQFLTPVQNVNGSTGCQMVMVPTQQISQVGSVQS
FT                   PIGQDLRDFSQQQQQQQVMQYVWKAPPQQLQPQQLAQPQQFVTQQYSNISRPPQGYAIV
FT                   QPGGQQSCMMAISTNQLQQVQPQAYIQQQLQPNSTRQVFITNQHPQQQLFTTPVMPTTL
FT                   PMGCRFN"
FT                   /protein_id="XP_846928.1"
FT   repeat_region   285025..285044
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cat"
FT                   /rpt_type="tandem"
FT   repeat_region   285347..285375
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<285874..>286392)
FT                   /note="synonym: Tb08.12O16.620; ubiquitin-conjugating
FT                   enzyme E2, putative"
FT                   /db_xref="GeneID:3659070"
FT                   /locus_tag="Tb927.8.920"
FT   mRNA            complement(<285874..>286392)
FT                   /db_xref="GI:72392256"
FT                   /db_xref="GeneID:3659070"
FT                   /locus_tag="Tb927.8.920"
FT                   /transcript_id="XM_841836.1"
FT   CDS_pept        complement(285874..286392)
FT                   /locus_tag="Tb927.8.920"
FT                   /gene_family="HOG000233455" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme E2, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ubiquitin conjugating enzyme activity [goid 0004840];
FT                   go_process: protein modification [goid 0006464];
FT                   go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72392257"
FT                   /db_xref="GeneID:3659070"
FT                   /translation="MCRVCRSLITVVMPCPISRLSKELKEVQRDPDNDVVLKLAESNNL
FT                   FSWEAVLDGPPDTPYEGGSFCLRLQIPPDYPMVPPVAWFVTKVFHPNVNFDTGAVCLDI
FT                   LKSRWSPAWTISSVCRAIISLLTEPDARSPFNCDAGNLLRAGDVMGYNSLARMYAITEA
FT                   GAPPFNDGE"
FT                   /protein_id="XP_846929.1"
FT   misc_feature    286758..286800
FT                   /note="AT_rich"
FT   misc_feature    286883..318882
FT                   /note="This entire sequence corresponds to a 36,265 bp
FT                   segment of BAC clone RPCI93-25L8."
FT   misc_feature    286883..309329
FT                   /note="Number of repeated genes in array uncertain."
FT   misc_feature    286887..286907
FT                   /note="AT_rich"
FT   gene            complement(<287095..>288507)
FT                   /note="synonym: Tb08.12O16.630; hypothetical protein"
FT                   /db_xref="GeneID:3659067"
FT                   /locus_tag="Tb927.8.930"
FT   mRNA            complement(<287095..>288507)
FT                   /db_xref="GI:72392258"
FT                   /db_xref="GeneID:3659067"
FT                   /locus_tag="Tb927.8.930"
FT                   /transcript_id="XM_841837.1"
FT   CDS_pept        complement(287095..288507)
FT                   /locus_tag="Tb927.8.930"
FT                   /gene_family="HOG000137443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392259"
FT                   /db_xref="GeneID:3659067"
FT                   /translation="MTRFTCFTAVVLLCMPFAVGKNNNLTLEQTVTLCNALKQFRGLKD
FT                   AVRDLKYWITTESLKISNAKTRSDEYVTLAEDVLWENRNATDPVERAKRVASNVTEAAK
FT                   KAETASIETEFRAENIEEIRSNRIAALERMLKEVAGHNSNWRVRSAAEKCKGAAESVSS
FT                   DSLNGTLLELFSTLPEGASEGLEDDTRESSGELWKLEFVLYNVVTWRSVALKGESTVKE
FT                   LVEGTKASITRKYNLTLNQTQAVCLMVEQYRGLKGAVDAFTEQAVSRSAMVSKVEERSQ
FT                   ADAKRPGGHMDQVKRAVAEVAKAVSKAQNVFKKVSRYARNLKSIRAHYLPLMENTLRKI
FT                   AGNAADEKAKKAAEVCGETAWVVTPKSLDDMRKKLMDNFPNLSERLESDTRVVSHMLED
FT                   LNTSTQLITIASIAVRRKEVKLNKTMEVAGVASLIEFGEGRLSSMGSAASNKNHNLRLL
FT                   LFSLTFTLVGLL"
FT                   /protein_id="XP_846930.1"
FT   gene            complement(<288901..>295485)
FT                   /note="synonym: Tb08.12O16.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659068"
FT                   /locus_tag="Tb927.8.940"
FT   mRNA            complement(<288901..>295485)
FT                   /db_xref="GI:72392260"
FT                   /db_xref="GeneID:3659068"
FT                   /locus_tag="Tb927.8.940"
FT                   /transcript_id="XM_841838.1"
FT   CDS_pept        complement(288901..295485)
FT                   /locus_tag="Tb927.8.940"
FT                   /gene_family="HOG000137444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392261"
FT                   /db_xref="GeneID:3659068"
FT                   /translation="MQMFLRRDSTHCGTGTSHASSLSPRYRHCCKVPFTFWASVLCIVS
FT                   STFLCSSGAASLVLRPNKPLVNVPFSVETTDQSIKADIFVSRMSTCDNTQIIGSKCKIS
FT                   KNAPCNFTVTSNDVGIDPWYDTKVREVYICAGDAFPSLSLSVQLSLVEAIPRYLKRDVD
FT                   NTIRFGDAVPVGTFITFHRNENCDDVSMIQGLPPAELGSNREVRVTRSVQSVIYLCAKV
FT                   PTSDGKTFVVPASVLLAVPRYDTNNTDALRHTNETFRLEAVGNLVWATFSQSPLCDPIL
FT                   QDPVGGETLQVVNMEVSVPKGDYFLCNGWPYHKGGRLYSPSENKVTVREYGVQPRTLYS
FT                   GYGTRIKYTMDAATAAANDVKLVLDFYMYSNCTGAVRVDGPSGIQYRGPPVKKRRSRSD
FT                   GGAVALPVSGTYYACLEGSTTAYPKARAAVVTVLPPPTVSFDEANVISGLDLTVLLSGH
FT                   NAGRSGVITVGLSVTPECEELNSKGDVRVGASSVTFRVPEDALPNMTLCVATPSSVDLQ
FT                   ADEEPDEGYTYPVKNIATRRYKLKHRTLFVGVAETIHLDANVTLKAGTTGYFSLDNCLT
FT                   PVGETYSMNATALYGVAFSTAGRHVLCVKTPGTEHPVNRPYSNVGNVMVYGPAELSPAS
FT                   IVKGVSTPVKVSAVPPEAPIVFSESESCTPSISEVNATAEGEASVTVMRNTVGKVYVCV
FT                   GYHDSDGGAWKVRVSGMLAVSDVEVFPRTVFVGVSNRVNFIVPDKTSLKGLKVLFKETS
FT                   DVNCGEIVDDGTAVAIRITEVGPAYVVYTAVGMKKWKVCLWKGNGYEDVGLIQSQQQLE
FT                   LVPDSPIGVVGLPLSMRFRGEALTALQPTRFLVSESIESCQSAPGGGIRVYGEGWVDPI
FT                   SGSAEPFVVQKAGELHVCVGWGDTNESYYLYGGKVSAEDFAVDSLYAVRRSTNNFVARP
FT                   LLKKASLFLVRCVNAASCKVPLNARICEEATERYYTGPTTPLEDVLLGEYALCQQDERR
FT                   LGVAVGQKPLKVINPFTASFNVSLVRKHTPLRLTLDGGSLHIGASNLTVYIVPPELNCT
FT                   EANASYDSFPFASGEHSKDVTIVKTPAVAKGARVCVGISAYDKLPASTFNIFHYMTPAT
FT                   IIAGRSVTVESSGIQSGRVRISTLEACTDSILSEYDTVIANSMSTLHVDKCKYRNRDLT
FT                   DVYYCERGESGGYVMRGTMQLIHLDECPGGKQPAVRPVTALPAKQVTDYGIDKAILTSP
FT                   FLSTRSDCNGVLSQSRATMTPRYNRNLTFYVCTHTIRDPGYVFTTDGPTLSVENFRVVN
FT                   PSIHGRVDSDSEVLGPANLVMNYATRTPDTYLSDCAVCGEKIVAAPGLAETPVEEAVTL
FT                   IGISGVKCVCVLGEQPTSPPIPVAEVLIITPPIVKKIDPAAVPTARFHAKLQTPVVSGA
FT                   KPLYSLVPGEDAENPLAYLHNSDFRGVYLSENACATTLTGNSVGYVRPSGSVVLGPTFI
FT                   PGRLPSVSLCVGTPAGNLSVVSEVEVSTDIIFPSSFVLGTEAEVYIPLSPNSAFRLRRD
FT                   ASCGGEDVVPFFTTDEEARGNISFKNVNAAGLPSAGVWTLCQEVFDGSATRPKIVKISA
FT                   NGIAARVASAKQLLPIAQIETFDPTYYNIRGRDVLLGVPGVLYLMDDLYAESLLPGFST
FT                   DRSCLRRNESHGSWALVGDDDAASARRVSVTAQNGTDSIYFCATTPVNRSVVSVPLSSS
FT                   LRFIPPVSVFPSIVEPCKVTPLESCRAPDSSHRQTVVRVIKGDCCNPTDKGVTVGEASE
FT                   GSDGKCKLRMNHNKIRDYPAGTEFSVCAWDLTDNTYCVTLGNVKASGDICGGSAWGPLG
FT                   MGAVIAIIVAAVLLFLLLLLLAVCFLRRCCSKEKEERQLVVADKMQLDNLDMSCISGTS
FT                   PDPEYLESGNNPLLLGFYSGDGSPNTNTTARTMIDGMTSGVDDFAWGGDFPGRADWTSV
FT                   EEQECDDRDQIALQEARDRYNMALVFTDGIERIRVDAKELELQFDYSGEFSMYEGPTGR
FT                   GVNVNPIPVTVPADHPDLLNAIYMRRASQRRRLQSQTREEIEVSVHDTMSEMSTDVHDT
FT                   SRLTSYDMMSYTTTQHFYEESTFMLESEAGRRMRLVNWEEEEWQAIVDAEFSDYVRLQQ
FT                   AMRSIPLPLPQAVVLPFNSTATRGRDTINYSGHTHVDGEGVTVLPVYDTPPFHNPHAAS
FT                   VDEAQAYPNHDEESNVSLSCDSSHN"
FT                   /protein_id="XP_846931.1"
FT   misc_feature    296883..318882
FT                   /note="sequence corresponds to BAC RPCI93-25L8"
FT   misc_feature    <296883..>318882
FT                   /note="This entire sequence corresponds to a 36,265 bp
FT                   segment of BAC clone RPCI93-25L8."
FT   misc_feature    <296883..309329
FT                   /note="Number of repeated genes in array uncertain."
FT   misc_feature    297324..297360
FT                   /note="AT_rich"
FT   gene            complement(<297522..>298934)
FT                   /note="synonym: Tb08.25L8.30; hypothetical protein"
FT                   /db_xref="GeneID:3659069"
FT                   /locus_tag="Tb927.8.950"
FT   mRNA            complement(<297522..>298934)
FT                   /db_xref="GI:72392262"
FT                   /db_xref="GeneID:3659069"
FT                   /locus_tag="Tb927.8.950"
FT                   /transcript_id="XM_841839.1"
FT   CDS_pept        complement(297522..298934)
FT                   /locus_tag="Tb927.8.950"
FT                   /gene_family="HOG000137443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392263"
FT                   /db_xref="GeneID:3659069"
FT                   /translation="MTRFTCFTAVVLLCMPFAVGKNNNLTLEQTVTLCNALKQFRGLKD
FT                   AVRDLKYWITTESLKISNAKTRSDEYVTLAEDVLWENRNATDPVERAKRVASNVTEAAK
FT                   KAETASIETEFRAENIEEIRSNRVAALERMLKEVAGHNSNWRVRSAAEKCKGAAESVSS
FT                   DSLNGTLLELFSTLPEGASEGLEDDTRESSGELWKLEFVLYNVVTWRSVALKGESTVKE
FT                   LVEGTKASITRKYNLTLNQTQAVCLMVEQYRGLKGAVDAFTEQAVSRSAMVSKVEERSQ
FT                   ADAKRPGGHMDQVKRAVAEVAKAVSKAQNVFKKVSRYARNLKSIRAHYLPLMENTLRKI
FT                   AGNAADEKAKKAAEVCGGTAWVVTPKSLDDMRKKLMDNFPNLSERLESDTRVVSHMLED
FT                   LNTSTQLITIASIAVRRKEVKLNKTMEVAGVASLIEFGEGRLSSMGSAASNKNHNLRLL
FT                   LFSLTFTLVGLL"
FT                   /protein_id="XP_846932.1"
FT   gene            complement(<299328..>305912)
FT                   /note="synonym: Tb08.25L8.40; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659072"
FT                   /locus_tag="Tb927.8.960"
FT   mRNA            complement(<299328..>305912)
FT                   /db_xref="GI:72392264"
FT                   /db_xref="GeneID:3659072"
FT                   /locus_tag="Tb927.8.960"
FT                   /transcript_id="XM_841840.1"
FT   CDS_pept        complement(299328..305912)
FT                   /locus_tag="Tb927.8.960"
FT                   /gene_family="HOG000137444" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392265"
FT                   /db_xref="GeneID:3659072"
FT                   /translation="MQMFLRRDSTHCGTGTSHASSLSPRYRHCCKVPFTFWASVLCIVS
FT                   STFLCSSGAASLVLRPNKPLVNVPFSVETTDQSIKADIFVSRMSTCDNTQIIGSKCKIS
FT                   KNAPCNFTVTSNDVGIDPWYDTKVREVYICAGDAFPSLSLSVQLSLVEAIPRYLKRDVD
FT                   NTIRFGDAVPVGTFITFHRNENCDDVSMIQGLPPAELGSNREVRVTRSVQSVIYLCAKV
FT                   PTSDGKTFVVPASVLLAVPRYDTNNTDALRHTNETFRLEAVGNLVWATFSQSPICDPIL
FT                   QDPVGGETLQVVNMEVSVPKGDYFLCNGWPYHKGGRLYSPSENKVTVREYGVQPRTLYS
FT                   GYGTRIKYTMDAATAAANDVKLVLDFYMYSNCTGAVRVDGPSGIQYRGPPVKKRRSRSD
FT                   GGAVALPVSGTYYACLEGSTTAYPKARAAVVTVLPPPTVSFDEANVISGLDLTVLLSGH
FT                   NAGRSGVITVGLSVTPECEELNSKGDVRVGASSVTFRVPEDALPNMTLCVATPSSVDLQ
FT                   ADEEPDEGYTYPVKNIATRRYKLKHRTLFVGVAETIHLDANVTLKAGTTGYFSLDNCLT
FT                   PVGETYSMNATALYGVAFSTAGRHVLCVKTPGTEHPVNRPYSNVGNVMVYGPAELSPAS
FT                   IVKGVSTPVKVSAVPPEAPIVFSESESCTPSISEVNATAEGEASVTVMRNTVGKVYVCV
FT                   GYHDSDGGAWKVRVSGMLAVSDVEVFPRTVFVGVSNRVNFIVPDKTSLKGLKVLFKETS
FT                   DVNCGEIVDDGTAVAIRITEVGPAYVVYTAVGMKKWKVCLWKGNGYEDVGLIQSQQQLE
FT                   LVPDSPIGVVGLPLSMRFRGEALTALQPTRFLVSESIESCQSAPGGGIRVYGEGWVDPI
FT                   SGSAEPFVVQKAGELHVCVGWGDTNESYYLYGGKVSAEDFAVDSLYAVRRSTNNFVARP
FT                   LLKKASLFLVRCVNAASCKVPLNARICEEATERYYTGPTTPLEDVLLGEYALCQQDERR
FT                   LGVAVGQKPLKVINPFTASFNVSLVRKHTPLRLTLDGGSLHIGASNLTVYIVPPELNCT
FT                   EANASYDSFPFASGEHSKDVTIVKTPAVAKGARVCVGISAYDKLPASTFNIFHYMTPAT
FT                   IIAGRSVTVESSGIQSGRVRISTLEACTDSILSEYDTVIANSMSTLHVDKCKYRNRDLT
FT                   DVYYCERGESGGYVMRGTMQLIHLDECPGGKQPAVRPVTALPAKQVTDYGIDKAILTSP
FT                   FLSTRSDCNGVLSQSRATMTPRYNRNLTFYVCTHTIRDPGYVFTTDGPTLSVENFRVVN
FT                   PSIHGRVDSDSEVLGPANLVMNYATRTPDTYLSDCAVCGEKIVAAPGLAETPVEEAVTL
FT                   IGISGVKCVCVLGEQPTSPPIPVAEVLIITPPIVKKIDPAAVPTARFHAKLQTPVVSGA
FT                   KPLYSLVPGEDAENPLAYLHNSDFRGVYLSENACATTLTGNSVGYVRPSGSVVLGPTFI
FT                   PGRLPSVSLCVGTPAGNLSVVSEVEVSTDIIFPSSFVLGTEAEVYIPLSPNSAFRLRRD
FT                   ASCGGEDVVPFFTTDEEARGNISFKNVNAAGLPSAGVWTLCQEVFDGSATRPKIVKISA
FT                   NGIAARVASAKQLLPIAQIETFDPTYYNIRGRDVLLGVPGVLYLMDDLYAESLLPGFST
FT                   DRSCLRRNESHGSWALVGDDDAASARRVSVTAQNGTDSIYFCATTPVNRSVVSVPLSSS
FT                   LRFIPPVSVFPSIVEPCKVTPLESCRAPDSSHRQTVVRVIKGDCCNPTDKGVTVGEASE
FT                   GSDGKCKLRMNHNKIRDYPAGTEFSVCAWDLTDNTYCVTLGNVKASGDICGGSAWGPLG
FT                   MGAVIAIIVAAVLLFLLLLLLAVCFLRRCCSKEKEERQLVVADKMQLDNLDMSCISGTS
FT                   PDPEYLESGNNPLLLGFYSGDGSPNTNTTARTMIDGMTSGVDDFAWGGDFPGRADWTSV
FT                   EEQECDDRDQIALQEARDRYNMALVFTDGIERIRVDAKELELQFDYSGEFSMYEGPTGR
FT                   GVNVNPIPVTVPADHPDLLNAIYMRRASQRRRLQSQTREEIEVSVHDTMSEMSTDVHDT
FT                   SRLTSYDMMSYTTTQHFYEESTFMLESEAGRRMRLVNWEEEEWQAIVDAEFSDYVRLQQ
FT                   AMRSIPLPLPQAVVLPFNSTATRGRDTINYSGHTHVDGEGVTVLPVYDTPPFHNPHAAS
FT                   VDEAQAYPNHDEESNVSLSCDSSHN"
FT                   /protein_id="XP_846933.1"
FT   misc_feature    307752..307788
FT                   /note="AT_rich"
FT   gene            complement(<307950..>309329)
FT                   /note="synonym: Tb08.25L8.50; hypothetical protein"
FT                   /db_xref="GeneID:3659075"
FT                   /locus_tag="Tb927.8.970"
FT   mRNA            complement(<307950..>309329)
FT                   /db_xref="GI:72392266"
FT                   /db_xref="GeneID:3659075"
FT                   /locus_tag="Tb927.8.970"
FT                   /transcript_id="XM_841841.1"
FT   CDS_pept        complement(307950..309329)
FT                   /locus_tag="Tb927.8.970"
FT                   /gene_family="HOG000137443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="Gene within a repeat region, may contain
FT                   misassembly."
FT                   /db_xref="GI:72392267"
FT                   /db_xref="GeneID:3659075"
FT                   /translation="MTRFTCFTAVVLLCMPFAVGKNNNLTLEQTVTLCNALKQFRGLKD
FT                   AVRDLKYWITTESLKISNAKTRSDEQLRRVKEPAQATTKAKALEKRARVLAANVTEAVK
FT                   KAEIVILESDVDAGVLGTISSAYVPSLEGALKKLGNEGGTVEVKGVAKSCNKTTKNVTV
FT                   ESLIHALDDMLQYFPAKSIKRLKEATRDASNKLHKLEGAAQSLVEIKINAEYTEFRVRE
FT                   AVTKAVSAYGKRYNLTLQQTQALCIAAEQYRALPIFVSNIEEISKTMAQKAADAKIRSD
FT                   NVVQLAEEANEDGKGKLLSQRVRETVNEIAEAAEAAEKAYRALTGHSVYMKSVAAAYAG
FT                   SLEKTLLSISQYAASQATRKAAEACRETAEVVTPKSLEDTKNGLFHSIPAQSSKRLKKD
FT                   TAKLIESLTILHREYKQLNAAMQYAQAAELKLNRETDYSPTTTPIAFASFLVCLLGTGL
FT                   L"
FT                   /protein_id="XP_846934.1"
FT   misc_feature    310926..310987
FT                   /note="A-rich"
FT   misc_feature    311153..311191
FT                   /note="GA-rich"
FT   gene            complement(<311464..>313272)
FT                   /note="synonym: Tb08.25L8.80; phosphoacetylglucosamine
FT                   mutase, putative"
FT                   /db_xref="GeneID:3659074"
FT                   /locus_tag="Tb927.8.980"
FT   mRNA            complement(<311464..>313272)
FT                   /db_xref="GI:72392268"
FT                   /db_xref="GeneID:3659074"
FT                   /locus_tag="Tb927.8.980"
FT                   /transcript_id="XM_841842.1"
FT   CDS_pept        complement(311464..313272)
FT                   /locus_tag="Tb927.8.980"
FT                   /gene_family="HOG000210027" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoacetylglucosamine mutase, putative"
FT                   /EC_number="5.4.2.3"
FT                   /note="go_function: phosphoacetylglucosamine mutase
FT                   activity [goid 0004610]; go_process: glucosamine metabolism
FT                   [goid 0006041]"
FT                   /db_xref="GI:72392269"
FT                   /db_xref="GeneID:3659074"
FT                   /translation="MVLQAAVADAICAAVAKYPLLHDARVDPMPYGTSGFRTIGTLLPP
FT                   VASRVVYVAVLRVWWAIKKGNFGGLNGCSVGCMVTASHNPCGDNGLKLIDVDGGMLETS
FT                   WETTCTQAANASTGEELLKVLNDCINLHGLEQPKPEDVKIRCPFGAVHLSRDTRPTGVD
FT                   ILSAIFSSLQAIGVTYADHGVLTTPQLHYLVGRANREQLTGPGAMKPADFTSALYAKEV
FT                   FGSLGELLRFVTEGNGGTNPRQRQKIVIDAASGVGAVALKSLLKCAQEVTSGVFEEFFD
FT                   VTVLHDNVDDINALNYMCGADYTQKAQYPSNDTKEWAAAYEKRRSDKNEEVHYYSLDGD
FT                   ADRVVAFFHDRETGEDVWRLLDGDRISILYALSVREWIGGEALKLLDVGVVQTAYANGA
FT                   STDYIQRGLGLRTYSSQTGVKNLHPIAHKCDIGAYFESNGHGTILLNGDAIDAKVPSLP
FT                   SKTRHVLSLLPRLISQVCGDAIANVFACELILLAHKMSFDSWLRLYTDIPSTQLKVKVK
FT                   NPKVITNTQDERRALTPPGLQEAIDAAVAAANEATPSSATVARAFARPSGTEPIVRVYA
FT                   EAATHAVSSKLANDVEEIVRRFCGGA"
FT                   /protein_id="XP_846935.1"
FT   repeat_region   313306..313354
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   313510..313533
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   313817..313842
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   314088..314131
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cag"
FT                   /rpt_type="tandem"
FT   repeat_region   314322..314358
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    314476..314520
FT                   /note="G-rich"
FT   repeat_region   316086..316130
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<316912..>317868)
FT                   /note="synonym: Tb08.25L8.90; RNA-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3659079"
FT                   /locus_tag="Tb927.8.990"
FT   mRNA            complement(<316912..>317868)
FT                   /db_xref="GI:72392270"
FT                   /db_xref="GeneID:3659079"
FT                   /locus_tag="Tb927.8.990"
FT                   /transcript_id="XM_841843.1"
FT   CDS_pept        complement(316912..317868)
FT                   /locus_tag="Tb927.8.990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein, putative"
FT                   /note="go_function: RNA binding [goid 0003723]; go_process:
FT                   RNA processing [goid 0006396]"
FT                   /db_xref="GI:72392271"
FT                   /db_xref="GeneID:3659079"
FT                   /translation="MSTGDPTVPLEEEAISAEKCTRFFIGGLHRQITPQDVEEYFSNFG
FT                   DVMTFILKRDPSGNSRGFGWVVFNSPPTGVQRPEPHYLKGVKLTVEPALANVRTDRVRR
FT                   VPGGGSSIPGRRRERSLSDSSSVSSRNSSLSTGDPRDGVRRPRLYDRHVEGSRLPAFGA
FT                   VASRLPPLPSEAFVQPPQIQATTFELAAPAPSRDAPAASASETYLCIPLSLCPPEFSND
FT                   PRTFCAKLDQSRVGGLSIIPSPSIAQVGPAPHSVPIPQGLPGGTVMVPQHSRSQPVRSG
FT                   GGGGGRHPKSSGSHHSIPPPLPQPAPPNYDSVMRHNS"
FT                   /protein_id="XP_846936.1"
FT   misc_feature    318883..447650
FT                   /note="sequence corresponds to BAC RPCI93-29O4"
FT   gene            complement(<319329..>320102)
FT                   /note="synonym: Tb08.29O4.30; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659077"
FT                   /locus_tag="Tb927.8.1000"
FT   mRNA            complement(<319329..>320102)
FT                   /db_xref="GI:72392272"
FT                   /db_xref="GeneID:3659077"
FT                   /locus_tag="Tb927.8.1000"
FT                   /transcript_id="XM_841844.1"
FT   CDS_pept        complement(319329..320102)
FT                   /locus_tag="Tb927.8.1000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392273"
FT                   /db_xref="GeneID:3659077"
FT                   /translation="MRQRQLQGESAMKRPSWSMSCRSPAFDTIKDRISWVGQQIASPTR
FT                   VVTAASKNFTAGSPMISNDADFSGAADETPAECCGRLKIDAMEEDFFLDVGWGPCRSLT
FT                   VSPVVSNPEDSNDETDEMWARRYVCERRPLKKRASERAREHHLNSSAMGVLFCHPIAMK
FT                   RFHTGVRDIQPNGSSYAGGASNGKCDHSFEEEADAEGSDCGSFSEAKVQFGSGTAFSFT
FT                   SGDVSAGRAIALEMMEEDEKIRSCVNSQQPNRGRR"
FT                   /protein_id="XP_846937.1"
FT   gene            complement(<320857..>322329)
FT                   /note="synonym: Tb08.29O4.50; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3659076"
FT                   /locus_tag="Tb927.8.1010"
FT   mRNA            complement(<320857..>322329)
FT                   /db_xref="GI:72392274"
FT                   /db_xref="GeneID:3659076"
FT                   /locus_tag="Tb927.8.1010"
FT                   /transcript_id="XM_841845.1"
FT   CDS_pept        complement(320857..322329)
FT                   /locus_tag="Tb927.8.1010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72392275"
FT                   /db_xref="GeneID:3659076"
FT                   /translation="MSYGKWAGVYSPHFLMSHVTMCRRVAHILWRRPSCSPQRSRSDTE
FT                   SPFGYVETLVSRPRAYARSTPLMTSAALLRSGLTARTGIRFATLPPAWPQVTARRFASA
FT                   GQRAPTYDEVRDACSVLGVDVDSDPKHLKKIYRGLVQKHHPDAGGDAAAMSRITVAYNR
FT                   LKDLSKLEREQFKAQQATYRGGSYHYSSRAGSSGNGTPSYDTSGRYAAQGSHDAGTSYD
FT                   YRGASNADYFKQTANPRRGFYTYKQSDRSFTDNPFSTSNPFSMHAQVRRAWNMPMSSIL
FT                   LRAIVAYLGICVLFLLAYRRYRDWMHDDGWKMAESFARHERLAELQRLRQEMNDRIQSS
FT                   REAAAAERLDAQRYSLARGFGGQSGTDYNVVTTSKERELRALERARRQRIENNTIARGW
FT                   PFIPEEKGRLVVRAHHPPGVVFFEPSRREEQLRQLTNMQRGRAWSDANQSLAEGAAVNP
FT                   QSVVSDELNAVRAIRTILNGIHDGGQAENRVL"
FT                   /protein_id="XP_846938.1"
FT   repeat_region   323312..323333
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<323522..>325630)
FT                   /note="synonym: Tb08.29O4.60;
FT                   6-phosphofructo-2-kinase/fructose-2,6-biphosphatase,
FT                   putative"
FT                   /db_xref="GeneID:3659073"
FT                   /locus_tag="Tb927.8.1020"
FT   mRNA            complement(<323522..>325630)
FT                   /db_xref="GI:72392276"
FT                   /db_xref="GeneID:3659073"
FT                   /locus_tag="Tb927.8.1020"
FT                   /transcript_id="XM_841846.1"
FT   CDS_pept        complement(323522..325630)
FT                   /locus_tag="Tb927.8.1020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="6-phosphofructo-2-kinase/fructose-2,
FT                   6-biphosphatase, putative"
FT                   /EC_number="2.7.1.105"
FT                   /note="go_function: carbohydrate phosphatase activity [goid
FT                   0019203]; go_process: glycolysis [goid 0006096]"
FT                   /db_xref="GI:72392277"
FT                   /db_xref="GeneID:3659073"
FT                   /translation="MTEAPKPQTTSEAEVLMELSERNAMNKGNRYSRGGCCSEVDASCP
FT                   LDASQRMLVVKKLLHGPIRPFHKWKWRKINLQRRAEIAKTSAHTVVGVSGEQNGEEPGV
FT                   DRGDADTVSKSIASLNSPAVDFQNDVDLCVGEGSHVAGASQVSSTPLYSPAVSASPPLD
FT                   NYTGPLSYQGPVHFDDKTHSYTTTLCVIMVGLPARGKTFLAHKVCRLLGWHGHRAKVLN
FT                   VQVAWRRLLMNYYNGQGDESRSERSRLKEKDPVYVRAEHFHALVSDSNSVERRLYRCVL
FT                   QQYAHDAQNFYAEGGEVLVLNDDFPTEELRDEAEGLFSPLCTQTFFVEVVRSNKFNKTF
FT                   DEFKVRDVMEYHSSVKLNDAKRDFERRVDYLKSVYTSVGAASCCANQSNSKTGDNSACT
FT                   MLEEKVAKQRGTKRYVRVNNFHEVEVCGVMGYIASRIVSFVMNVTQLKVQHPIYFVRNG
FT                   MSVYHCEDRIGGDSPLSPEGEQDTIELLEFVASLTQYVEQERNDTDSCVCETAHTAGDG
FT                   DGRVREGSGTCASTDTHSAYGFPDSPQRVVIWTSQLYRAIQTVEKCEQLLGIKTTRCHS
FT                   LNELYAGVCENLTHAELREQCPLMQELRNCNKFSFRYPKGESYKDLVQRLEPVIMELEN
FT                   TDRVVVIVAHRAVLRALLTYFGSISAESCMWLDVPYRTVWKCTYDSKGMTSLEELRFDE
FT                   QDEAAPVE"
FT                   /protein_id="XP_846939.1"
FT   repeat_region   326533..326572
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   gene            complement(<326869..>327750)
FT                   /note="synonym: Tb08.29O4.70; chaperone protein DNAJ,
FT                   putative"
FT                   /db_xref="GeneID:3659078"
FT                   /locus_tag="Tb927.8.1030"
FT   mRNA            complement(<326869..>327750)
FT                   /db_xref="GI:72392278"
FT                   /db_xref="GeneID:3659078"
FT                   /locus_tag="Tb927.8.1030"
FT                   /transcript_id="XM_841847.1"
FT   CDS_pept        complement(326869..327750)
FT                   /locus_tag="Tb927.8.1030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DNAJ, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein folding [goid 0006457]"
FT                   /db_xref="GI:72392279"
FT                   /db_xref="GeneID:3659078"
FT                   /translation="MRTEGLRRALISDVAARWYVFQRRFLSTSTAHLVEEIRQALRVLS
FT                   LSDSASDAEVRDRFQSLAKSNHPDVLQGGTEESSVAEDKMRRGVEAYKLLRRFTEAERH
FT                   ALLKQRVQQEEETERGRRVYEGVAGRKGEGSRATFEFNKFEQRRREMRNEAPPWKVDNH
FT                   PPRNQRRSFLFYVLGGAATDARVSAAEILREYRRTGHLAGGRFRDCCAGSFGSRAPSGL
FT                   FGANADEWARTRQRAERAQIVSAAFGRHIVAGVFAVTVFLLICMIFVAVKKHYAARGLY
FT                   TNSESFSKRELR"
FT                   /protein_id="XP_846940.1"
FT   gene            complement(<328540..>328974)
FT                   /note="synonym: Tb08.29O4.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659080"
FT                   /locus_tag="Tb927.8.1040"
FT   mRNA            complement(<328540..>328974)
FT                   /db_xref="GI:72392280"
FT                   /db_xref="GeneID:3659080"
FT                   /locus_tag="Tb927.8.1040"
FT                   /transcript_id="XM_841848.1"
FT   CDS_pept        complement(328540..328974)
FT                   /locus_tag="Tb927.8.1040"
FT                   /gene_family="HOG000255395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392281"
FT                   /db_xref="GeneID:3659080"
FT                   /translation="MSSSQQLGTHQAEGIQQTQVAFIPRREVTLHLRPAPSSASRDRHI
FT                   SWEANVKDNQNQRVSKSCCIFHKKKLFGESSSDDDSTSSSCSDQDDSCHGCANNNEAKQ
FT                   NGEACGDGEGGAGAQGSCGSRRKKRPPCTREHCYCGTRFH"
FT                   /protein_id="XP_846941.1"
FT   repeat_region   329945..329984
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<330827..>338788)
FT                   /note="synonym: Tb08.29O4.100; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659081"
FT                   /locus_tag="Tb927.8.1050"
FT   mRNA            complement(<330827..>338788)
FT                   /db_xref="GI:72392282"
FT                   /db_xref="GeneID:3659081"
FT                   /locus_tag="Tb927.8.1050"
FT                   /transcript_id="XM_841849.1"
FT   CDS_pept        complement(330827..338788)
FT                   /locus_tag="Tb927.8.1050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392283"
FT                   /db_xref="GeneID:3659081"
FT                   /translation="MSTLTGSVGPNSAHGSTVGVSLDFEVNAAASHGDDEAETKSCFAE
FT                   FSSPAADTKLAEEGESISRAPASPSGSHAVRNRSVSVPFVSFTDADEQPKDGLWSSKSL
FT                   VPPLKRRPKQSRITRKSFRSLGAYRNPSTLSVLDLATTDLDKLKLSFVAHAAILNHGDL
FT                   NDMQKLVNHVEREMRYGEQHLDRSHRGRQGSKAPSYQASVRSEDDGANADGGTDRAWQS
FT                   LDDQSSSDVSVEESVKSMMDVPSQTKAMLCTWIYDRYVQQRIFELRAKRKARPNDTFTA
FT                   VVSRQFPDAGTKELMVNLRNAPKPRNMRDLDLHDGIGSCLNEAGEKVGHTHLVTDADNL
FT                   VLPLPVFVYVLSRALFRLHYLDRFPAEAFSVKSQQTNQGASCAGGSTPRTEVSLSVVMG
FT                   DSGSNSLHNVSPLVSPRYEALHSLLQEAVSLLEECRRVAMQGFDIFDTEQKGVISWSVF
FT                   TDALTECMEEKLRGLCDQDCGEDSERSGVAVFDDCVVEPFPSMLRRLGYVRAVTKVRHN
FT                   PAAVLVEGTNDFAVCDSSYHGLIQRKLLVRSSEMLLMHCHGATDAWDPERWDIHAGTGE
FT                   NNKEQEKFTKGYVLYEDGRLQDGGGKQSLLFTLQRKQKKEQGLSEEEEDERKKEEKRTD
FT                   QNNYRNKPTIECCMEVKDVGPNLPKTIITLTNDLIIRFYNMDQHIWVVPESLTMNVKET
FT                   ICAMDWCAAAADENLPLKGFLFVGTRSGKVIKLDLQAILRRMISAQTSTSDIMTTGIVA
FT                   ASTVRDRFERRVVQEQKIHSEVVTSVCLTASDMLLTSSLDGAIVLSRASTMTLVRSFRL
FT                   ETGGGVRLAYITPTGNAIVTLSSSNRVSLWGTTHQSSRVDFYDPISPHYFQIASFIVDE
FT                   SLEQLTTVDTSGHIKVWSLRTALVKFSFYAVSEECMNSLGFLSEENMGPNNGFRLFDVD
FT                   DAGNKRLRVAGDTGSRALAAILQTSFAKLEDDQKRRSLHPIRTVAYDAYTRRLFVSGAK
FT                   NNLVCVFISGSVAMKTHSSPPLYVGMCERNRWLVSVSPTDCRVWDCQSSKLVVGFKVNN
FT                   PEFLMARLALTFASRSNLPTDAQLANAAADLERYKLDECKQPLPTINDVIRVATERADL
FT                   ARRENSRAMVAQKHEASTARDAGGGSRPSPESNHQTARGLPTPRFAAAAAAGADNSGED
FT                   DVSSKQMATHRVICAHVDAQERFVFYALGSGDVRMHRIKSGQLVKTLLTMSPSTELIYA
FT                   AVLQCRHMYTYTRNPGENRHNQDCDDVKSPDGYVGAHVGVHDVAFVLQRLLREGHKLPL
FT                   ERSKTSSVHREVVGMMTPRNSHELCVVYVDGVIRFFPLLGSSVHAHRIIIPEFLVSKAL
FT                   SYLRMENTLMRKEAANRSGRTTRCTESEAAEAYRNVMVEADAVSFITVSHALNLVCLVQ
FT                   VNGRVSLMGMGSAVGMALQVFYVASEVSTISFLGGYPCLVVGEVQGTVGFYLLKGASFL
FT                   DLFDNFYKALLLYRRQQQASLHEPSVELFNVDKLTESSVESTNQHGLNSTPCVWWFRVP
FT                   GAPTTLHFDPHCCSLYVGTQQGFVTSYLVRNLIVAANLHPASLSGRSPSLMSRGRMSVQ
FT                   GQSGSAEVELCNVLLVFFNLTPDRVMRTINRQRNDLAFLNRRRRSLVSGSAATVQPTAT
FT                   DDSTDEGNAPSVPKPVSSSRSTSLGTLRLPKGSSNPEVDGQSERPQTAVPLQSWRPSLL
FT                   WIYDSCRSLFHPHPTSTSTFRGPSEPTFSLLDLATVTLSDLLLGAAILHYVLQLMQTQR
FT                   SGQPSSTDYGAMDGDQTTKCAAMINSQDLRHIRQCILEELHHRKSMFEEINSSHPTSTN
FT                   RVSNCHIEEFVETIAASGELEEGPAPITGDWVELLFRRHAVNTVSSSPLTLLSMEAIIE
FT                   RARRERRERVRILMKYVDERRLLAREGTDHREGGASSRWQHKSISVNWNAFLEGAPPDC
FT                   ITEALRRCHEGASRDEEVFFSEDNNAVQCITTRRNGVLYVGSADGSVSVWTPYACARLQ
FT                   EFSPCNPLDAGIRRIGEFVKTQFTKQWKSAENLRQRKAYASGTNKQKLHEAMMRNITLK
FT                   YRVALLKQGAKRGGGSGVYNSPGGGNSSGADGRKQASPRRAMSHVGFQSLGSMPTTLHN
FT                   EMQNLIKKPKELLMAALPIDESEMDSKGIIMEDLYFLPMQMSVLSELEDLDGKAYAAAV
FT                   DLSVARLLRDVCCSDGQGLDPFPSARYSGVLDRVKLNADESQTFAGAGPPLSATDVKRG
FT                   GEAESAVDTSISFFISSHEKHMTSFYVEAKRKLDDGEYTSQHGNSLSRTGHSVTFISLH
FT                   SKLQRPPFSFSRTQDAKESLPSTPDGETAVTASLPQFAQAGVVGRPGVIVVALSERREG
FT                   QLNPQFEFDLPQLAANSQWIALEEALKLYINSSDGALTMDSFQCVSISPSPYLGRGQRV
FT                   GDVSRGSVQVPPIAGILPSILTKETPLRCGDMGKGVTTLADPLLVMSPSNVEEDLGLLQ
FT                   SEGEPQHLDRTRLRRGSSQYLNANANENTATGKRCSFFFTETHDLRSPTKTPSAISTTA
FT                   IGGKWSETHLKPFQEVESRRPRPHLDDVAESGRGSMHPTMNIRWTLESKQQNQRAKLSR
FT                   TGRTVLTPPRSTRDSRPRNYQQPLRANGTTTLGNEWGVSPQGFQKEGNSNAVDGRAGVT
FT                   SPNPRIPQPCRP"
FT                   /protein_id="XP_846942.1"
FT   gene            complement(<339737..>341962)
FT                   /note="synonym: Tb08.29O4.110; malonyl-CoA decarboxylase,
FT                   mitochondrial precursor, putative"
FT                   /db_xref="GeneID:3659082"
FT                   /locus_tag="Tb927.8.1060"
FT   mRNA            complement(<339737..>341962)
FT                   /db_xref="GI:72392284"
FT                   /db_xref="GeneID:3659082"
FT                   /locus_tag="Tb927.8.1060"
FT                   /transcript_id="XM_841850.1"
FT   CDS_pept        complement(339737..341962)
FT                   /locus_tag="Tb927.8.1060"
FT                   /gene_family="HOG000255393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malonyl-CoA decarboxylase, mitochondrial
FT                   precursor, putative"
FT                   /EC_number="4.1.1.9"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: malonyl-CoA decarboxylase activity [goid
FT                   0050080]; go_process: fatty acid biosynthesis [goid
FT                   0006633]"
FT                   /db_xref="GI:72392285"
FT                   /db_xref="GeneID:3659082"
FT                   /translation="MLTLVRRPYCSRRMRFPFHLDNISRVSHRYNATDVTLQLSEDRLA
FT                   NWCRRLWALAQGGGDGDDDGSAVPASNGTTKSGSVFSGRGPHTEFTLVEEMKSVLVGEK
FT                   GQLPPSVVSAVWDVYESIIPPSTLFDLSETISPNQEDAFFSFVALLMELDVDIVEVQAA
FT                   VAQLNNTIQNIEDLNAQSGQFIAGGCSATVSAESCFREENRSGVGAAVLSSKLVKAKNN
FT                   LLRQCVAALHAGSPVYYMWFKQSASVERGVRRLMDLRRCVMYFQKRCHCQVAQLQAELK
FT                   RQHERQSSRQVIDSPPNSGPLTTNRELELWLLRQHHVSSIDVSLEYLFGDFFSKQWLVM
FT                   EELTWRTTPPLLLEKVMAAESVHPFVGGLVDMKQRLQPAKNRHLFAFFHPAVVEEPLIA
FT                   VQVALTRGIARSVDIILGRPHPPSVQERQNDQLGAANGEVADACSGARKHDPVEDVDTS
FT                   MFYSINSVQSALRGVNLGNMLIKRVVREIEARLNGERHCAGLSPITTFSTISPVPGYLR
FT                   WLVGEVAKLQQQVEMRSGSISLCSSSKKFAQPRIFGECSKPKAAELFSILRGAVLGLSH
FT                   HRGRGCGHFISRLHYHLREGNEDAANLVTMQYLLALFGSPEEDGTGESGAPGKADEDVI
FT                   SPWWNDSEFTRTVEKPLLRSVAHYLYKEKHRNRILDPVGNFHISNGATMFRLNFLANCT
FT                   ADGSRQSATVMVNYLYEPACVDERVKAYGMQRSVPIGDDVLRLLNIS"
FT                   /protein_id="XP_846943.1"
FT   repeat_region   341768..341794
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caccat"
FT                   /rpt_type="tandem"
FT   gene            complement(<342517..>345171)
FT                   /note="synonym: Tb08.29O4.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659083"
FT                   /locus_tag="Tb927.8.1070"
FT   mRNA            complement(<342517..>345171)
FT                   /db_xref="GI:72392286"
FT                   /db_xref="GeneID:3659083"
FT                   /locus_tag="Tb927.8.1070"
FT                   /transcript_id="XM_841851.1"
FT   CDS_pept        complement(342517..345171)
FT                   /locus_tag="Tb927.8.1070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392287"
FT                   /db_xref="GeneID:3659083"
FT                   /translation="MHSVTVLSQPSSTVTTCARSTFTNVATVSASPPRSTALSGMCSLS
FT                   SSSSLWNTDPPADDWKDIGDTIRGTHNLAGSPEQQIQQQPAVEGKCGGESVLCGVRKVL
FT                   PFSVSCTAGGDVNGRQTNSRAKHSSALKPPLQASVSQATGRCDSSNHGVAPTKQSCPPE
FT                   ERAVGSSKDELNHGGIGDSGDNDSGFNKCHPPQLPPAVIFMSPLKTASGGNDVNLTVVS
FT                   SAPPPGAAEAAVRDGSNTVSSDDSLDEVGTHSGDSNRRLWSCANTPERPNSMEHVERVV
FT                   SCVSEREDATCVEADGQRKPAVARSCATERRRRCLLRQIKLVDAEVARMEGVQRQNVFR
FT                   IGSASGEALSREKAKLLELRNRYEAALHATTKKALEHRQPSSLSVSSAGGPSHFPSSFR
FT                   SSLEHDGRQEGCPCKTVGRRLALKVSGCSAVPRRRGASVRKARAAKPPTLTTVTPVAVV
FT                   DDNNTTGSAAAVGTDVNRCAERESLRSCCSNHIGKKPSRATAAIHVAEPARTYVDPYAP
FT                   TEGGGSGSRAPRGQTRGASVDAERMAAFYLRNGRSRHLAEVSTLKTAGGEGHGGKAMME
FT                   RNPGTCASSSRCSRTREASKRPGNPKAAAVGPKRDGCSHRTASLCTRASSAVDYTPVCA
FT                   SNNGGCGDLNGNGRHRRGPVYHLCAPSVPNAAHVETWEPTCGDMTRPLVPSKTGTSLAF
FT                   PRKESGQGPWQMPMEQRVSCNAPWGFATSSVPVSSSSSAARCCYSTGLGSSRAAPYDYR
FT                   FARTPSYHHPPSIYEPTQPEAAPQVVHDEVKDAWRAPLGPSLHCGSLLPSGRDYFVSPA
FT                   LPKSDLMWRQLASRSYNNEQCDCSGMEHAAAVGGTIRDCSYGGCGDEALESGRRADLLV
FT                   RIGKLLGGVERKC"
FT                   /protein_id="XP_846944.1"
FT   repeat_region   345566..345591
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   gene            complement(<345870..>346460)
FT                   /note="synonym: Tb08.29O4.130; centrin, putative"
FT                   /db_xref="GeneID:3659084"
FT                   /locus_tag="Tb927.8.1080"
FT   mRNA            complement(<345870..>346460)
FT                   /db_xref="GI:72392288"
FT                   /db_xref="GeneID:3659084"
FT                   /locus_tag="Tb927.8.1080"
FT                   /transcript_id="XM_841852.1"
FT   CDS_pept        complement(345870..346460)
FT                   /locus_tag="Tb927.8.1080"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centrin, putative"
FT                   /note="go_component: centrosome [goid 0005813];
FT                   go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72392289"
FT                   /db_xref="GeneID:3659084"
FT                   /translation="MSTTNRGGNSPVAQSVNRSIAPGMSLSGSALAVLTEEQRQEIKEA
FT                   FDLFDTDGSGTIDVKELKVAMRALGFEPRKDEVRRLIASTMEERGDPAPVKPGTAPGAD
FT                   NHVIGFAEFVDLMARKMNERDSREEMLKAFHLFDDDKTGKITFKNLKRVAQELGENMTD
FT                   SEIQEMIDEADRDGDGEVSEEEFLRIMKKTSLY"
FT                   /protein_id="XP_846945.1"
FT   gene            complement(<347671..>349911)
FT                   /note="synonym: Tb08.29O4.140; DNA polymerase sigma,
FT                   putative"
FT                   /db_xref="GeneID:3659088"
FT                   /locus_tag="Tb927.8.1090"
FT   mRNA            complement(<347671..>349911)
FT                   /db_xref="GI:72392290"
FT                   /db_xref="GeneID:3659088"
FT                   /locus_tag="Tb927.8.1090"
FT                   /transcript_id="XM_841853.1"
FT   CDS_pept        complement(347671..349911)
FT                   /locus_tag="Tb927.8.1090"
FT                   /gene_family="HOG000255390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase sigma, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   nucleic acid binding [goid 0003676]; go_function:
FT                   nucleotidyltransferase activity [goid 0016779]; go_process:
FT                   DNA metabolism [goid 0006259]"
FT                   /db_xref="GI:72392291"
FT                   /db_xref="GeneID:3659088"
FT                   /translation="MKDRSAAVHVGSEDVPTARARGAARNKATSSKNRPGRTPICGKDA
FT                   EENALADEPAKPTSPVAVDSSDAAVDRCGSVSTRNRAGDAITNKRSKVVDIPPPAPSVG
FT                   LFSKFQERRGDFSSDWMLLQEENAANQPSEPPIAAELVMKLRERQAQMQISRDEVTLKT
FT                   TGSSAVKNRDEGRLEALNEELRKQGADDGKSDSDVEYVPQEDTRGYRSLKQQGGEETTV
FT                   VGSAVAAPSTNSDEAEKGFLDDFLGFSKGDSEKNADSRYAVQATVTLKNGKCVLASDEV
FT                   SSGQGGYDPGHSYLGEETRSVPLWCVGRLTGQKEYAKDAAIALHQEICDFVKFHQPTEA
FT                   EIAIRCLVEAEVVTIAKQLWPKCEPVVFGSMATGLLLPLSDVDITILNVDVPTEEALRL
FT                   LAREISLSGICNTAYPQLVLKAKVPLLKFQHCGSLLDVDISINARDGPRNTLIVIDLLK
FT                   HYREAEPLIVVVKYFLHQRGMDEPYHGGLGSFALTLMAISFLQQHPIYTGSPDQRLYCG
FT                   LGRLLVDFFRYYGMYFRYDRCGLSVVGTGRCFKRTDVCASSVRPMTNGANSSLGRGGPQ
FT                   SGPPQVLLEDPGCPENNAASSLRNFNVIATSFTHAFRALTAVFEPNRRPGSSSPDALHI
FT                   DQRPTLLSRILHVDGESVKRRQAIIEAHGSLLQDPNGRLVLQQVVDEHKQRRERMLENV
FT                   SLLSCPPTSDRLVSHKRPREDSNEDKFSKSRRGDSCSSNDSSVRTARSLTRR"
FT                   /protein_id="XP_846946.1"
FT   repeat_region   350461..350492
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(<351667..>354324)
FT                   /note="synonym: Tb08.29O4.170; protein kinase, putative"
FT                   /db_xref="GeneID:3659087"
FT                   /locus_tag="Tb927.8.1100"
FT   mRNA            complement(<351667..>354324)
FT                   /db_xref="GI:72392292"
FT                   /db_xref="GeneID:3659087"
FT                   /locus_tag="Tb927.8.1100"
FT                   /transcript_id="XM_841854.1"
FT   CDS_pept        complement(351667..354324)
FT                   /locus_tag="Tb927.8.1100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72392293"
FT                   /db_xref="GeneID:3659087"
FT                   /translation="MSEDSAAGGCTLRQTGPFLLKFVYATGTRLAAQNSLLPVAVGSAV
FT                   VCTAFFTYICSSSPRWKGAPGLFGHANRNAPRRVKLGATQINVATGESTTTSTLWDIDS
FT                   TDEGTRCAGGSGVVTATSSAVLLPRGTTPLCVEVSPSSSLFSSAHIPILYMHAPICRGG
FT                   RRNGMVRHNKRKNASQGLMAHAIAQGMNLLSDVLWPRAVAIMSLVVDAVPRFVRCEIPN
FT                   LNFLRNRWTFSFPSSQLLLLRSRLISSEADGMHTRCGTQQRPVAQADVKVMDETSDTHC
FT                   ELVVRVGDNSAAGITGALHADAVAQHLLRSSYSTNQYTTVPPLNPPSFSCGHASVAKQT
FT                   DDVEAKAGTAHPPSGPWIQGATVRHGEMRIGRFLGRGRWGKVFQCCNPETGEVLAVKQL
FT                   IFDDNDPKVRQRVGELRLELDVLRLANRCRVPWIVGFRGVERRGSSVLLFMEYCARGSL
FT                   LDYLTQHVAAARRLTSRCGAEIVSERGGSPLPHRRDDLYCQSSCVEKGAGGTSNHRPVE
FT                   GSLREETDGGILPPLPQVSPYSSDCRQRANAERPWSNPLALPIREIQRFMRQTVEALHF
FT                   LHSNGYAHLDVKTANILVTADGDVRLADFGCCGRLRQGPTSLHTCVGHSHAVWPSGLLD
FT                   GTPHAAAFSGSIAPSDPTRHNLSTPPVASMSESGDATAGAAGIHGSGSCNCVSGGDSVM
FT                   YPTLVDDELTAEPRGTALYVAPEVIRLDKSRIGAPSDVWAAGCVAMELATGEVPWQHMA
FT                   EEQLCVMFRVASTKEDLPLPPRIVEAVRDARWWLACYSNDAEANGRDVHDHHSAAKLLA
FT                   HEGEEERRYDAATVLRCDRSENAANHFKCDIESLLNMQLLVSLEDFLHSCLHIRPEERP
FT                   NCEEMLRHPFLVTR"
FT                   /protein_id="XP_846947.1"
FT   repeat_region   354401..354439
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   354798..354841
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<355680..>356252)
FT                   /note="synonym: Tb08.29O4.180; 40S ribosomal protein S9,
FT                   putative"
FT                   /db_xref="GeneID:3659086"
FT                   /locus_tag="Tb927.8.1110"
FT   mRNA            complement(<355680..>356252)
FT                   /db_xref="GI:72392294"
FT                   /db_xref="GeneID:3659086"
FT                   /locus_tag="Tb927.8.1110"
FT                   /transcript_id="XM_841855.1"
FT   CDS_pept        complement(355680..356252)
FT                   /locus_tag="Tb927.8.1110"
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S9, putative"
FT                   /note="go_component: cytosolic small ribosomal subunit
FT                   (sensu Eukaryota) [goid 0005843]; go_function: structural
FT                   constituent of ribosome [goid 0003735]; go_process: protein
FT                   biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72392295"
FT                   /db_xref="GeneID:3659086"
FT                   /translation="MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVN
FT                   MTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHGYGFLDEDKDKLDYVLSLTVPDIL
FT                   ERRLQTVVFKHGLAKSVHHSRVLIQQRHIAVAKQIVTIPSFIVRVSSEHHIAFADASPF
FT                   GNGRPGRVKRVKRNAAKKGSGGGDDDE"
FT                   /protein_id="XP_846948.1"
FT   repeat_region   356306..356349
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<357127..>357498)
FT                   /note="synonym: Tb08.29O4.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659085"
FT                   /locus_tag="Tb927.8.1120"
FT   mRNA            complement(<357127..>357498)
FT                   /db_xref="GI:72392296"
FT                   /db_xref="GeneID:3659085"
FT                   /locus_tag="Tb927.8.1120"
FT                   /transcript_id="XM_841856.1"
FT   CDS_pept        complement(357127..357498)
FT                   /locus_tag="Tb927.8.1120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392297"
FT                   /db_xref="GeneID:3659085"
FT                   /translation="MSGDGVGVYGSKRDGATGGVAKTKSTEQMMREANENLLRALRTNT
FT                   STNEAGYATMQELSRQKETITNSVEHVGETRGELREARRIIRDIRLRVYKEWVIKGLVL
FT                   TLLFVLDVYLFYRKFLGKV"
FT                   /protein_id="XP_846949.1"
FT   misc_feature    358268..358414
FT                   /note="T-rich"
FT   misc_feature    358926..358947
FT                   /note="AT_rich"
FT   gene            complement(<359790..>364082)
FT                   /note="synonym: Tb08.29O4.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659089"
FT                   /locus_tag="Tb927.8.1130"
FT   mRNA            complement(<359790..>364082)
FT                   /db_xref="GI:72392298"
FT                   /db_xref="GeneID:3659089"
FT                   /locus_tag="Tb927.8.1130"
FT                   /transcript_id="XM_841857.1"
FT   CDS_pept        complement(359790..364082)
FT                   /locus_tag="Tb927.8.1130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392299"
FT                   /db_xref="GeneID:3659089"
FT                   /translation="MSHEFSGSGEEYLARFRFNWLMEEWTEEVARVRPTDPFSYLLGLI
FT                   QAYRGGEDNFVTCKNDWCRAFVPQSQRGAHLLKCATDVQLVQCPNCRLRIKESDYRQHK
FT                   QKCLLHQCVYCGERVPARLIECCPSKVRMNNEISSRARSSPNIGKGNKHASTEGAATSH
FT                   HEKLWDEPPLAPFSKFSRIKLDFPERNRNPLTRLQRMWRSASIYERMLDTAFKQVWNGI
FT                   EFRRVSRGPPELGGCISTRSRSHSPRQRPSSPNTAEPADYSITMEEYVDISESILSGGV
FT                   VCFKIAVRILTNAIAIMSKRSAVLRVNIPDGGDAVVVGDLHGQLKDLALVLNRLCGLPS
FT                   PRRYYVFNGDYVDRGSNGVGVLLHVLLLQCLFPDYVFINRGNHEDSRVNAEYGFQAEVF
FT                   SKYTYWEAKQLLDLFSASYDVMAWATLVDEDVIVVHGGVPRNGATVAEIEAVGRVTKFS
FT                   ALEPRTDGERLASELLWNDPVDTYLSRRIGVRHQGANWRSSVRGVGVEYLEPITENFLR
FT                   LNKLKLVVRSHQMVQAGFQFVHGRSNCTVFSASNYTGVSNNRGAIAVLEKGSVQPTFHT
FT                   WFLRDAETVVRDVVMSDLLEGLTDFSRGVDAEESPVGQDGNGSGDTKAMGGVSSVKDGE
FT                   SPSHHESPRAKTVDSSRKAGPVHSPIELVRCVDDTRERMLARARMLDVLVGIIYSSRYS
FT                   LLSSFVRADSGKNGTIHKVEWCDIMRKVLNMDIPWYFLAPYLVGSSYEEGSPYIRYVTF
FT                   LRRFNPCFTSLFSARFQTALLRHVFRDVDMPGDLLSCITTDHFAEEQPITDDNGKFIGS
FT                   GVTLSPSGLMLNLAERTGDGCRGIPNTMGGSSVLPSGGCCGGGNQRDDSWRKIRLSFNS
FT                   LVSALRSISRAGGMMEDNTIFTLFQIFDKDACGHAAVGDIVDVVDSVGVEDSDESVVLD
FT                   LTGSFDIDFFPQRGSDEKPAAGTTVLCDEPSGVSADAVIPMPSPVSKAGEYCDDWTPAN
FT                   SASSTALASYTPAHVEMAVDSDEESSTHSSSVLWSRQSVSATMSDLDCMRVYPVLLHLH
FT                   ERFACDTIRSTLQHFKALNNTHDGKLTFDQFAVTFNHIGRCMLDPPTRQEQQIIFCLIR
FT                   DVGQHLLGSAECCSLSESLGVLSRALSRASSLRCQVALLKSVVNNIGVKNAQADYLTRD
FT                   QFVTFFSTVSISHGEHSCHYDDHVAESGCKEWTTNFGESGSCNSGDTSKVGALKLCPLW
FT                   CLDQCVPSEDTAAVATAVGSADAETRAERPSAVPPVQADGREDAFARREGRRRRRLPRT
FT                   MLPRCAKQERLPISCVARSPHAAPSRFNSEQQSPLLRYRSEQQSPLPRIGSEQQSPLHR
FT                   RALRSCRGHLNRDRARQRTGFSSPLSSDHTSGSVREGSPSPIPPQAPYGEMVPTSESLA
FT                   ANATGRSTCRDNFSLSSTLLGGDGDHSG"
FT                   /protein_id="XP_846950.1"
FT   gene            complement(<365167..>366222)
FT                   /note="synonym: Tb08.29O4.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659091"
FT                   /locus_tag="Tb927.8.1140"
FT   mRNA            complement(<365167..>366222)
FT                   /db_xref="GI:72392300"
FT                   /db_xref="GeneID:3659091"
FT                   /locus_tag="Tb927.8.1140"
FT                   /transcript_id="XM_841858.1"
FT   CDS_pept        complement(365167..366222)
FT                   /locus_tag="Tb927.8.1140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392301"
FT                   /db_xref="GeneID:3659091"
FT                   /translation="MFLRVRGNGASPENSQALLVHLRGFRLTNTRPPAVDFTLSGKTQP
FT                   MIFSHFHVGVQVPDVDNNAEVNAQLCSAVWREIWNMYDIVYDDLCIFPPKANVTTTFFS
FT                   SSFSAGRQSDQNLGSTGYTQLTSRTSSQTPVVVTHYFPPELIQFRLSKDVNFGEVVVLD
FT                   VSYILLEEAATKIAVEVAWLAAYASLRGVFNRIKHVVVRLPYDCIVGCEKKNPIVQEGL
FT                   DFLAEHLTLCARDFVKSGSSCAVDVHFVGSTAAELVSTLRRLSDTSSVGSGSGPQLTAP
FT                   PVVFVGDHHQKGKPMEDVQIISSSLGIGLGLELVPLKGFISGEDVKWDEATSRENQVLN
FT                   FCPCCGHCGGH"
FT                   /protein_id="XP_846951.1"
FT   misc_feature    366319..366366
FT                   /note="A-rich"
FT   misc_feature    367071..367091
FT                   /note="AT_rich"
FT   gene            complement(<367460..>368488)
FT                   /note="synonym: Tb08.29O4.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659090"
FT                   /locus_tag="Tb927.8.1150"
FT   mRNA            complement(<367460..>368488)
FT                   /db_xref="GI:72392302"
FT                   /db_xref="GeneID:3659090"
FT                   /locus_tag="Tb927.8.1150"
FT                   /transcript_id="XM_841859.1"
FT   CDS_pept        complement(367460..368488)
FT                   /locus_tag="Tb927.8.1150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392303"
FT                   /db_xref="GeneID:3659090"
FT                   /translation="MSSVLTRSFSSCAGKLEETRELIKRDLETARKHRIELRKTIDDDL
FT                   KRVEKERAELLGIVEEQEAKINRSVREFEEVRSRREWLKKEHDEAVKRYVKMSDTVTFI
FT                   KEGDKRLQDRTDFEAVLEEENTTWADRERQLIASVSTHNTTLKQARKERRKEVETLETE
FT                   LAEMTKKLEQERIARREDLQQESQGLLRSRRGTPQPPSQRPTVAAVHTQAFEPLEANRK
FT                   EQQFIAINKSSCLPTRQIRSCFKNNNSTGGNRFSNELETGRNTVANRRRSTNGSGSTGQ
FT                   GVSQHFHSAPVSRATSQSLVSGDSENIVKIRGAASQRAFSYADTKRVAGRKHELLRDST
FT                   NI"
FT                   /protein_id="XP_846952.1"
FT   misc_feature    369393..369450
FT                   /note="C-rich"
FT   gene            complement(<369465..>372773)
FT                   /note="synonym: Tb08.29O4.290; vacuolar-type Ca2+-ATPase,
FT                   putative"
FT                   /db_xref="GeneID:3659093"
FT                   /locus_tag="Tb927.8.1160"
FT   mRNA            complement(<369465..>372773)
FT                   /db_xref="GI:72392304"
FT                   /db_xref="GeneID:3659093"
FT                   /locus_tag="Tb927.8.1160"
FT                   /transcript_id="XM_841860.1"
FT   CDS_pept        complement(369465..372773)
FT                   /locus_tag="Tb927.8.1160"
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar-type Ca2+-ATPase, putative"
FT                   /EC_number="3.6.3.-"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_component: acidocalcisome [goid 0020022]; go_function:
FT                   calcium-transporting ATPase activity [goid 0005388];
FT                   go_process: calcium ion homeostasis [goid 0006874];
FT                   go_process: cell growth [goid 0016049]"
FT                   /db_xref="GI:72392305"
FT                   /db_xref="GeneID:3659093"
FT                   /translation="MISPKDTSNYGTLAGRGRERQAFLSTGLTRSDGSVAVEVELEDRI
FT                   GIGIKGELHTLFSCVGDAKPLYEELGGVEGIAERLGTSITDGIDSFSVENRRAVYGRNE
FT                   LPEEAPLTFWKIFKAAWSDRMIILLTLAACVSLILGLTVPEPGHEKVDYKTGWIEGTAI
FT                   LMAVIAVTSASSIQDYRKELKFRALVEENSAQPISVIRDGHKVTVDVTEIVVGDLVSLS
FT                   PGLVIPVDGLYVRGLSVVVDESSVTGENDLKKKGAEHPILLSGTVVSTAEDAYILACAV
FT                   GESSFGGKLLMESRLDGEPRATPLQERLDELAGFIGRIGIGAAVILMSLLSLFYILLVL
FT                   RGKEELRAKKFLDIFLLCVTIVVVAVPEGLPLAVTIALAYSQSQMQKDNNQVRRLCACE
FT                   TMGNATQICSDKTGTLTQNRMTVVQGYIGMRRFRVSNPGDPSSTVNLEGVSSDAQSLLM
FT                   LGLALNSSSEKELLPGNVGAESDLLSRWTWRTDKGNKTDQAILDFVDRVLISVPGSCND
FT                   KELPHQKLRMTNRSRGFAIFPFTSERKFMTAVVAGADGVVMQYVKGGSDRVLGMCNRYL
FT                   SSEGREEPLTEEVTEMITAQIRSIAGDANRTIGVAYGRIGTDGAVPEEEPEGPFVWLAL
FT                   LGIQDPLRPEVVDAVRMCQRAGVTVRMCTGDNLDTAVAISRQCGIYNRLRGDLALTGKD
FT                   FRNLVYDTYGDEANMEKFWPVLDRMMVMGRSQPLDKQLLVLMLMLRGEVVAVTGDGTND
FT                   APALRLANVGFVMRSGTDIAVKSGDIVLLDDNFRSVQRAVVWGRTVNDNIRKFLQLQLS
FT                   INIASIVVVFVGSFLSAHDMSPLTTVQLLWVNLLMDTLAALALATEQPTEDCLNRGPSS
FT                   PRAPLVSRRMWLTILTATVVQVVSVLLLTQYGGKWLKAKGKELPTVVFNVFIFFTIFNM
FT                   FNARKVYDEVNVFEGLFIRSKSFLVIVVCCVGFQVLAVEVLKEFMSCVPLRAEQWIASI
FT                   LIASLTLVFVSVSRLIPVSEPSFEKGAELEDMEPGARRIAVKLAEDVEHHSSASNNVGS
FT                   YMRFGQRLVARAQWQRVREHVTMRGVSQFWWSRHSHPRERGWRRMSAWCEERIR"
FT                   /protein_id="XP_846953.1"
FT   gene            complement(<373426..>374421)
FT                   /note="synonym: Tb08.29O4.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659092"
FT                   /locus_tag="Tb927.8.1170"
FT   mRNA            complement(<373426..>374421)
FT                   /db_xref="GI:72392306"
FT                   /db_xref="GeneID:3659092"
FT                   /locus_tag="Tb927.8.1170"
FT                   /transcript_id="XM_841861.1"
FT   CDS_pept        complement(373426..374421)
FT                   /locus_tag="Tb927.8.1170"
FT                   /gene_family="HOG000255435" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392307"
FT                   /db_xref="GeneID:3659092"
FT                   /translation="MFHGFPQVQVVSDDAPTGESIFAKDSDSHVELPPAKKVRISFPAL
FT                   THLGSFSQDATCHSAVGGRLCGVQQGDTILITSVLPSLGASGDAEDERDDTAESKQQQK
FT                   MYEKVKEMLRKECLDSYSVGYFIVSSACVNDPYSVVTADRLANLAIDGHPSVLLVYDPF
FT                   RTGLMGKLYLRAFVPTDAFLDFSRKNKKTKKTDKKSGMQEEARLLRACSVPKQGVLREV
FT                   KVEVEVDAYQLFCLNGIDIAPLPSNSTVHHSDSMADYKVALLESVQRNLSDLEGKLSRE
FT                   TSRNQRDENNVPPARGVDTMLALVQLREQAQHLEALCDGTLLISSLLRDL"
FT                   /protein_id="XP_846954.1"
FT   gene            complement(<375582..>378902)
FT                   /note="synonym: Tb08.29O4.320; vacuolar-type Ca2+-ATPase 1"
FT                   /db_xref="GeneID:3659098"
FT                   /locus_tag="Tb927.8.1180"
FT   mRNA            complement(<375582..>378902)
FT                   /db_xref="GI:72392308"
FT                   /db_xref="GeneID:3659098"
FT                   /locus_tag="Tb927.8.1180"
FT                   /transcript_id="XM_841862.1"
FT   CDS_pept        complement(375582..378902)
FT                   /locus_tag="Tb927.8.1180"
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar-type Ca2+-ATPase 1"
FT                   /EC_number="3.6.3.-"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_component: acidocalcisome [goid 0020022]; go_function:
FT                   calcium-transporting ATPase activity [goid 0005388];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   calcium ion homeostasis [goid 0006874]; go_process: cell
FT                   growth [goid 0016049]"
FT                   /db_xref="GI:72392309"
FT                   /db_xref="GeneID:3659098"
FT                   /translation="MISPKDTSNYGTLAGRGREKQAFLSTGLTRSDGSVAVEVELEDRI
FT                   GIGIKGELHTLFSCVGDAKPLYEELGGVEGIAERLGTSITDGIDSFSVENRRAVYGRNE
FT                   LPEEAPLTFWKIFKTAWSDRMIILLTLAACVSLILGLTVPEPGHEKVDYKTGWIEGTAI
FT                   LMAVIAVTSASSIQDYRKELKFRALVEENSAQPISVIRDGHKVTVDVTEIVVGDLVSLS
FT                   PGLVIPVDGLYVRGLSVVVDESSVTGENDLKKKGAEHPILLSGTVVSTAEDAYILACAV
FT                   GESSFGGKLLMESRLDGEPRATPLQERSQNLVSFIARVAIISAVLFFIVLCIIEIERIA
FT                   TNKQQFYPKKFLNFLLLCVTIVVIAVPEGLPLVVTIALAYSQSQMQKDNNQVRRLCACE
FT                   TMGNATQICSDKTGTLTQNRMTVVQGYIGMRRFRVSNPGDPSSTVNLEGVSSDAQSLLM
FT                   LGLALNSSSEKELLPGNVGAESDLLSRWTWRTDKGNKTDQAILDFVDRVLISVPGSCND
FT                   KELPHQKLRMTNCSRGFAIFPFTSERKFMTAVVAGADGVVMQYVKGGSDRVLGMCNRYL
FT                   SSEGREEPLTEEVTEMITEQIRSIAGDANRTIGVAYGRIGTDGAVPEEEPEGPFVWLAL
FT                   LGIQDPLRPEVVDAVRMCQRAGVTVRMCTGDNLDTAVAISRQCGIYNRLRGDLALTGKD
FT                   FRNLVYDTYGDEANMEKFWPVLDRMMVMGRSQPLDKQLLVLMLMLRGEVVAVTGDGTND
FT                   APALRLANVGFVMRSGTDIAVKSGDIVLLDDNFRSVQRAVVWGRTVNDNIRKFLQLQFT
FT                   VNLVCFSLTVVGTLVREGKSSPLTTVQLLWVNLLMDTLAAPALATEQPTEDCLNRGPSS
FT                   PRAPLVSRRMWFTIFSVATVQLTAFFSVLTFGGKYFGEDENGKHLHRTFLFNVFVFGTI
FT                   FHMLNCRKLYRELNVFEGMGRSVFFIVVVGSCIAFQVLAICTFNDFMGVRPLSIKQWGV
FT                   SIGIAAISLVVGILSRVVSIREPVFALIPDSRNVDGSASRLIKDVSVAAEQRQRETDGT
FT                   SDASSLLAGRLRAQSRWRRLQAEHVKKPRVVNAFRRAWTDRDMKRGSTRQLYDTLRMV"
FT                   /protein_id="XP_846955.1"
FT   gene            complement(<379555..>380550)
FT                   /note="synonym: Tb08.29O4.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659097"
FT                   /locus_tag="Tb927.8.1190"
FT   mRNA            complement(<379555..>380550)
FT                   /db_xref="GI:72392310"
FT                   /db_xref="GeneID:3659097"
FT                   /locus_tag="Tb927.8.1190"
FT                   /transcript_id="XM_841863.1"
FT   CDS_pept        complement(379555..380550)
FT                   /locus_tag="Tb927.8.1190"
FT                   /gene_family="HOG000255435" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392311"
FT                   /db_xref="GeneID:3659097"
FT                   /translation="MFHGFPQVQVVSDDAPTGESIFAKDSDSHVELPPAKKVRISFPAL
FT                   THLGSFSQDATCHSAVGGRLCGVQQGDTILITSVLPSLGASGDAEDERDDTAESKQQQK
FT                   MYEKVKEMLRKECLDSYSVGYFIVSSACVNDPYSVVTADRLANLAIDGHPSVLLVYDPF
FT                   RTGLMGKLYLRAFVPTDAFLDFSRKNKKTKKTDKKSGMQEEARLLRACSVPKQGVLREV
FT                   KVEVEVDAYQLFCLNGIDIAPLPSNSTVHHSDSMADYKVALLESVQRNLSDLEGKLSRE
FT                   TSRNQRDENNVPPARGVDTMLALVQLREQAQHLEALCDGTLLISSLLRDL"
FT                   /protein_id="XP_846956.1"
FT   gene            complement(<381716..>384958)
FT                   /note="synonym: Tb08.29O4.350; vacuolar-type Ca2+-ATPase 2"
FT                   /db_xref="GeneID:3659100"
FT                   /locus_tag="Tb927.8.1200"
FT   mRNA            complement(<381716..>384958)
FT                   /db_xref="GI:72392312"
FT                   /db_xref="GeneID:3659100"
FT                   /locus_tag="Tb927.8.1200"
FT                   /transcript_id="XM_841864.1"
FT   CDS_pept        complement(381716..384958)
FT                   /locus_tag="Tb927.8.1200"
FT                   /gene_family="HOG000265623" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar-type Ca2+-ATPase 2"
FT                   /EC_number="3.6.3.-"
FT                   /note="go_component: plasma membrane [goid 0005886];
FT                   go_function: calcium-transporting ATPase activity [goid
FT                   0005388]; go_function: ATP binding [goid 0005524];
FT                   go_process: calcium ion homeostasis [goid 0006874];
FT                   go_process: cell growth [goid 0016049]"
FT                   /db_xref="GI:72392313"
FT                   /db_xref="GeneID:3659100"
FT                   /translation="MHPLESPQEHKTQVSPENNGNETKSVLQKLFTCNEDPKPLYEELG
FT                   GVEGIAERLGTSITDGIDSFSVENRRAVYGRNELPEEAPLTFWKILKAAWSDRMIILLT
FT                   LAACVSLILGLTVPEPGHEKVDYKTGWIEGTAILMAVIAVTSASSIQDYRKELKFRALV
FT                   EENSAQPISVIRDGHKVTVDVTEIVVGDLVSLSPGLVIPVDGLYVRGLSVVVDESSVTG
FT                   ENDLKKKGAEHPILLSGTVVSTAEDAYILACAVGESSFGGKLLMESRLDGEPRATPLQE
FT                   RLDELAAFIGRVAIISAVLLFIVLCIIEIERIATNKQQFYPKKFLNFLLLCVTIVVVAV
FT                   PEGLPLAVTIALAYSQNQMQKDNNQVRRLCACETMGNATQICSDKTGTLTQNRMTVVQG
FT                   YIGMRRFRVSNPGDPSSTVNLEGVSSDAQSLLMLGLALNSSSEKELLPGNVGAESDLLS
FT                   RWTWRTDKGNKTDQAILDFVDRVLISVPGSCNDKELPHQKLRMTNRSRGFAIFPFTSER
FT                   KFMTAVVAGADGVVMQYVKGGSDRVLGMCNRYLSSEGREEPLTEEVTEMITEQIRSIAG
FT                   DANRTIGVAYGRIGTDGAVPEEEPEGPFVWLALLGIQDPLRPEVVDAVRMCQRAGVTVR
FT                   MCTGDNLDTAVAISRQCGIYNRLRGDLALTGKDFRNLVYDTYGDEANMEKFWPVLDRMM
FT                   VMGRSQPLDKQLLVLMLMLRGEVVAVTGDGTNDAPALRLANVGFVMRSGTDIAVKSGDI
FT                   VLLDDNFRSVQRAVVWGRTVNDNIRKFLQLQLTVNVVSFLVTVVGTLVREGKSSPLTTV
FT                   QLLWVNLLMDTLAALALATEQPTEDCLNRGPSSPRAPLVSRRMWFTIFSVATVQLTAFF
FT                   SVLTFGGKYFGEDENGKHLHRTFLFNVFVFGTIFHMLNCRKLYRELNVFEGMGRSVFFI
FT                   VVVGSCIAFQVLAICTFNDFMGVRPLSIKQWGVSIGIAAISLVVGILSRVVSIREPVFA
FT                   LIPDSRNVDGSASRLIKDVSVAAEQRQRETDGTSDASSLLAGRLRAQSRWRRLQAEHVK
FT                   KPRVVNAFRRAWTDRDMKRGSTRQLYDTLRMV"
FT                   /protein_id="XP_846957.1"
FT   gene            complement(<385805..>387865)
FT                   /note="synonym: Tb08.29O4.360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659094"
FT                   /locus_tag="Tb927.8.1210"
FT   mRNA            complement(<385805..>387865)
FT                   /db_xref="GI:72392314"
FT                   /db_xref="GeneID:3659094"
FT                   /locus_tag="Tb927.8.1210"
FT                   /transcript_id="XM_841865.1"
FT   CDS_pept        complement(385805..387865)
FT                   /locus_tag="Tb927.8.1210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392315"
FT                   /db_xref="GeneID:3659094"
FT                   /translation="MSAPLAPRRTRTVDLELMTREELIELAKKQSITNREKTQYIAHLE
FT                   ELVKDITNQSSNEKVCPAAAVDSGEVTTTEVSQLQHSLLQLQQEIEQERVTFAQDMSRS
FT                   EELITALREQLEEKTREFQTLRETGSTVLTQSDGIVAAQAKVLEASVQERVRELREYDR
FT                   LERENHKNRINQLENELQRLRESQQITAQQYTASSGGPSAEAIRESIDREVKEKVEQWQ
FT                   DRVRTVVEQDRKTIQDLRNELSRYQDSDLETQSREEAMHALQQEVEQLKAQLAEAQRSH
FT                   DEVAVASEVKCREVMESREEAMHALQQEVEQLKAQLAEAQRSHDEVAVASEVKCREVME
FT                   SREEAMHALQQEVEQLKAQLAEAQRSHDEVAVASEVKCREVMESREEAMHALQQEVEQL
FT                   KAQLAEAQRSHDEVAVASEVKCREVMESREEAMHALQQEVEQLKAQLAEAQRSHDEVAV
FT                   ASEVKCREVMESREEAMHALQQEVEQLKAQLAEAQRSHDEVAVASEVKCREVMESREEA
FT                   MHALQQEVEQLKAQLAEAQRSHDEVAVASEVKCREVMESREEAMHALQQEVEQLKAQLA
FT                   EAQRSHDEVAEGVACGNSASLPLTSKVVEWMDAVGAALSQSDKQETVLVSSLDGWHAEG
FT                   NRRDEIFCKVIQVFRASMANLQSELLNVAGECVKLKRRVVELQALGKCGVA"
FT                   /protein_id="XP_846958.1"
FT   gene            complement(388360..389034)
FT                   /note="synonym: Tb08.29O4.370; hypothetical protein,
FT                   conserved (pseudogene)"
FT                   /db_xref="GeneID:3659095"
FT                   /locus_tag="Tb927.8.1220"
FT                   /pseudo
FT   gene            complement(<389676..>390227)
FT                   /note="synonym: Tb08.29O4.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659096"
FT                   /locus_tag="Tb927.8.1230"
FT   mRNA            complement(<389676..>390227)
FT                   /db_xref="GI:72392316"
FT                   /db_xref="GeneID:3659096"
FT                   /locus_tag="Tb927.8.1230"
FT                   /transcript_id="XM_841866.1"
FT   CDS_pept        complement(389676..390227)
FT                   /locus_tag="Tb927.8.1230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392317"
FT                   /db_xref="GeneID:3659096"
FT                   /translation="MSLHCFFGLELRPDQVAISPPMPPDSSLVLTHCSLTSIVPGAVTL
FT                   YAQSHDLPTRLALCTLSADRELYYVPLHHIFSRKVSFTLVPSSTVGCSGEGPTVHLTGY
FT                   FESDEDRYNADKGDSSDEDRDEEEEDSSDGMEMASRRSRGGEKPKGDGGKPKSSKGKAN
FT                   GNDGGNKRSRIDAEKKGKGN"
FT                   /protein_id="XP_846959.1"
FT   gene            complement(<391386..>393080)
FT                   /note="synonym: Tb08.29O4.390; electron transfer
FT                   flavoprotein-ubiquinone oxidoreductase, putative"
FT                   /db_xref="GeneID:3659099"
FT                   /locus_tag="Tb927.8.1240"
FT   mRNA            complement(<391386..>393080)
FT                   /db_xref="GI:72392318"
FT                   /db_xref="GeneID:3659099"
FT                   /locus_tag="Tb927.8.1240"
FT                   /transcript_id="XM_841867.1"
FT   CDS_pept        complement(391386..393080)
FT                   /locus_tag="Tb927.8.1240"
FT                   /gene_family="HOG000259450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase, putative"
FT                   /EC_number="1.5.5.1"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: electron-transferring-flavoprotein
FT                   dehydrogenase activity [goid 0004174]; go_process: electron
FT                   transport [goid 0006118]"
FT                   /db_xref="GI:72392319"
FT                   /db_xref="GeneID:3659099"
FT                   /translation="MLRRTSCCFCAVAERVIEEFDVVVVGGGPAGLATAIRLKQLGGVA
FT                   GDDFRVALVEKGSEIGAHTISGACVNMRSLDELIPDWEVATDLPTLTTVTSDNFYYLRD
FT                   QKRSFRSPIIPPTLQNHNARIMSLGSLCRWLSERATELGVEVYSGFAAARPVLNSTMTA
FT                   VEGVQLNDVGINKKGEKTERYDPGMIFRAKQTVFAEGCRGSCTKQLEKIFNLRGKQNFQ
FT                   TYGLGVKEVWEVPEGNHRPGSVSHTIGWPLTDKGHDNTYGGSFLYHYGDGLVSLGFVVG
FT                   LDYKNPHIRPYMEFQKWKTHELVTSQLRGGRPLHYGARTLVEGGLVSLPQLHFPGGVLV
FT                   GDCAGFLNLPKIKGTHTAMKSGMLAAEAVYADAFVSGREKLVHVDCKSYQERFRESWLY
FT                   EELYQVRNVRQTFARHFLLGVLYTGVTTLLTRGAEPWTLRHHQPDHKSLKPAASCVQIE
FT                   YPKPDGEITFDLLTNLNLSGTDHNADQPAHLQLHDASVPIDVNLSLYDGPEGKYCPAKV
FT                   YEFVDGKLVINAQNCLHCKACDIKDPTQNIDWTVPEGGGGPNYNSQM"
FT                   /protein_id="XP_846960.1"
FT   repeat_region   393859..393885
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<394308..>396719)
FT                   /note="synonym: Tb08.29O4.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659104"
FT                   /locus_tag="Tb927.8.1250"
FT   mRNA            complement(<394308..>396719)
FT                   /db_xref="GI:72392320"
FT                   /db_xref="GeneID:3659104"
FT                   /locus_tag="Tb927.8.1250"
FT                   /transcript_id="XM_841868.1"
FT   CDS_pept        complement(394308..396719)
FT                   /locus_tag="Tb927.8.1250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392321"
FT                   /db_xref="GeneID:3659104"
FT                   /translation="MRRPLRDLSSRVVRRWIRCDPLVALLVLLFCTCASDVSSLTEFSE
FT                   PPLTAEGDTDPKQTVEGIEPVNGTYLTFDLAMYASRPASRVELSKIYHRALRALYDESN
FT                   LTEALTWIKKGAAMGHGRLHWLLGVMYASGVGVPQSDAHAIMHYKFAALESIPEAHMAL
FT                   GSRYRDGVGAPRNCQLAVSHFREAADAVAMTYGELPGSIGETRLRMLFGGKWHVSTDEE
FT                   TVHALMYGADGGATDKIIALGYMYLKGRNGQRRDRLRARSCFLRALEKGDDAAYGALGQ
FT                   LYATGDRAVEQGVARDLAVAASYFSKGAVKGEPTSLNGMGYMHAIGYYQNDKPVTDAGA
FT                   KRQPDFKTAAKYFRKGANRGNTEAMYNLGVLKLHGRGVPQDPAVAIRLFKVAALRGSVL
FT                   SLWQLARHAQMQGDCQQAVLLYSRVVAHGSMFNEHSDGPYFPRGEETPFTPTTDSTLVQ
FT                   LLERLAFAETGHSDSRRRAVRMLSDEIIEEEEEGQLLNGIFAKDGRPPERAVQQQVKGK
FT                   VYLQWYRDPSGRRQRGTARGSAPSMREIGRGGGHTQRKMLLSQREAYNMLKLRLLQLSA
FT                   LSGNFDSELQLGNFYYNGESRFIGVDMAKALLHYEAAAGSGHSEALFSAGFMYQLGLGV
FT                   GGNIRKPVGVWDAFVSIITNTALDPDDSVDPQELKGLATDPLIMLERRLYLAKRFYDHV
FT                   RDVDGGLGFYAVWFARLSLNFQWWWLYFCRQPYGLSSLLRLPMPNAKYNDDVMRVADVE
FT                   GASTEGLALRGELHAEITLKSAGGWKWDDCVLVFCATLLFMCLLLRHHGA"
FT                   /protein_id="XP_846961.1"
FT   gene            complement(<397388..>400492)
FT                   /note="synonym: Tb08.29O4.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659102"
FT                   /locus_tag="Tb927.8.1260"
FT   mRNA            complement(<397388..>400492)
FT                   /db_xref="GI:72392322"
FT                   /db_xref="GeneID:3659102"
FT                   /locus_tag="Tb927.8.1260"
FT                   /transcript_id="XM_841869.1"
FT   CDS_pept        complement(397388..400492)
FT                   /locus_tag="Tb927.8.1260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392323"
FT                   /db_xref="GeneID:3659102"
FT                   /translation="MRRRRQPLTAGITEVDVGEGEEKKARDGTDFPAVNICSWSVSADA
FT                   IAADLGNQHEGKGDRRDVGDEADVGPPLKRFKIPDKALARIEAQAALARDNVAEQQNPA
FT                   VGDDATDVIRRRKFSALKYCTEVADERDFSGVKKPLISVGRLPRHTAEQRQQLRRAQRN
FT                   VKNMTSTSGPLGLFADGGDVIRFGSVGSDSSDSNPSETSSFDDEGCRTLTGNAVGRSAS
FT                   AAREIRNIDRHFSGYDSEDLPPVSGLLDEETEESEEYEESEESEEERKIADSGVNFGDC
FT                   CAEANGGTVKVMSVKRGFGFQQQRRLQEGARSPGNQHIADEGTEIGVGNETAAGAAVST
FT                   GRCQRYGGVLFEMHINRAAAAPCHHTLLHVRNSITVQGPCCIIGFGIGEITVGGFFLGR
FT                   KHITLLSDSQKVVVMPVRPLKSKSAASESLPVPKRQLHLPAADDCVVVAPPASASFCRF
FT                   MGIGEPTAAGDTASERDCEADDLEMFGTVDWDWVEASVARVQEGRHAADNSCVVLVVQP
FT                   YKSHEKAPTRRRYLVPRDTSSSKRENGGGRHRGKLHSDSFVEVPLFLARQPVPGVDAAL
FT                   LPDVVPAVVRHGSGAVVVLGSKGIGKSTLCRFLANALLSQHGVCYWLELDIGQPEFGPP
FT                   GVLSLYCVSKPLLAPHESDGVDFVRGYYVGGTRLRCPVAGATALTRICGVAEQLRKRYP
FT                   IIVNTHGWVLSTGRRMTVEAVRRLQPTHIIHLAKRQEEQWARFATELVDPIKGLNASVV
FT                   NKRFLVHKQDGIACGAAGADSLPSSRILGLLPHAHDFRPKRSSTSAEATKSSSLPKWSG
FT                   TVHTVQVVRDEGLLRKSMQPKASAIRRGMWGRYLAPIFEYYEATRLRHVKQQVSELYKG
FT                   EEPIIVGGRRTTTLFTGELSHFESLVFTDVADASDLTVDFVCAALAHSVVAFSIRVISS
FT                   SPAQGVAVSHKTESLTNCDAQAFHYPNCRSLVDLPDGFPITCFGIVESNEADMRSSGKI
FT                   RIRLPVGRDDVHKMLSVSGEGKRVCISLACTLADRSETAAVEALF"
FT                   /protein_id="XP_846962.1"
FT   gene            complement(<401510..>403198)
FT                   /note="synonym: Tb08.29O4.460; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659103"
FT                   /locus_tag="Tb927.8.1270"
FT   mRNA            complement(<401510..>403198)
FT                   /db_xref="GI:72392324"
FT                   /db_xref="GeneID:3659103"
FT                   /locus_tag="Tb927.8.1270"
FT                   /transcript_id="XM_841870.1"
FT   CDS_pept        complement(401510..403198)
FT                   /locus_tag="Tb927.8.1270"
FT                   /gene_family="HOG000255373" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392325"
FT                   /db_xref="GeneID:3659103"
FT                   /translation="MVLECDSELSFFFPFGPTVALVFHLSVLPRCSNISLTDCKGLHGK
FT                   LLFVLLYLMLEISSPFHSEVELKGRRSGVPEMAVTSKAKKEEAELRKIAKQARTARKEV
FT                   AAKERRLKLKGKKRQQTDGTDRENISSKPVTGGHSVKRQGAIILPEEAAEVRQRLLSDT
FT                   RIESGAAAPENGGAKRDTAITSSQLSNAAAVSRQKPLLSSSSRVEEPAHSVEVHHKRKQ
FT                   FLVGVALHHVPPQHIDVSGTTATALVVDTCKHTKKYRLVLPMPEGICVDPAQAEYEFDC
FT                   GVLRCVLPIVGEIPSSLRQERDAMLESIQKQKTLRFRMGEDGELKVRSRRALLGNGELK
FT                   DADGDDKRRKIDENNALRVSGGKKREVRQQAEDVEDDGADETAGEKGKAEGARNREGRC
FT                   TKRAREVVETSPLQKAGKLQQQRPSQREEQISNNNIVKKKRKGPDSALEEEQKKALELA
FT                   KAAGRAAKATLRERVAQAKATQQRMLQRMVNRQNRRETQSKKTRDSFARVLEEQKRQLI
FT                   ARAERTAVATAVAAGGKSDGRCGAKGRQSGGKRVTFAESKGSAEE"
FT                   /protein_id="XP_846963.1"
FT   repeat_region   404715..404746
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    404903..404957
FT                   /note="T-rich"
FT   misc_feature    405082..405154
FT                   /note="A-rich"
FT   gene            complement(<405197..>409378)
FT                   /note="synonym: Tb08.29O4.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659101"
FT                   /locus_tag="Tb927.8.1280"
FT   mRNA            complement(<405197..>409378)
FT                   /db_xref="GI:72392326"
FT                   /db_xref="GeneID:3659101"
FT                   /locus_tag="Tb927.8.1280"
FT                   /transcript_id="XM_841871.1"
FT   CDS_pept        complement(405197..409378)
FT                   /locus_tag="Tb927.8.1280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392327"
FT                   /db_xref="GeneID:3659101"
FT                   /translation="MSYEKILCMEHSAEREMRITERSKKKKGCGKNFLCYGEPTPVSGA
FT                   LEDVGTIAAMLAEVMAEETERLEQKRIQEMERSRSHSPRERRNIPSSPAPNDTNTTTAV
FT                   VGGRRPPSGALVRYIRPTLRCRRERLFAYHMAKKMLQQKQEEDARRAAPLCDSSRGTSV
FT                   LRTSFTTSTTGSNNLPCIEGGTSTTLTDGDPWGKASLAVGDNLEKCVYDALHTFVTDYE
FT                   QRYGRQPRVSTEKVESPSFSTGSSTVHDFNMKDEGEKNREQLTTTMGSLIGNANALSGV
FT                   FKFPFLQETKTKANEGVNASAPFFSAAFTNPEASLTRGTMGDSTATGFSSPDRASPKED
FT                   GASEKRLAAEREQRTESVKRLVKLTLKRLSNPGHCRKSSPGPHSHDGPAGLQSSFSPSC
FT                   HSVFGGLWDITLDKRIDSAPHGDLIKLAGILSCHPGLQKCSEAAARFVTYVLMRSLPEE
FT                   LFTGDPEDYCVLRRRVHNAVKNRSSPGPKIDSRMSSSEKVPLPPRKASPRLTRLRFSSS
FT                   SKKSGKSCSLLSTANSVGSSDDGEQRDDRYFLHRDTSTCQQVLQSVALRHGYWLSSTER
FT                   MLQRPPFHACGLPLRTARDIAMWQRPPCREPLGGGGDGGATFNATDTTKDPFADTALTT
FT                   ATSSKLTKTTCHLEAEARLFEGSLHAESSAILRDEVVGKNGGRPKTIAPLLILAHGGYG
FT                   VAPFSVPDSSGVGMTVEKEVDCEEGQGYRRHLANMNNMTEADQDAYLATFLSPDDFLHP
FT                   EPSLLPLYSVMQTIYSSVRQNRNIYIDDATHNSLPIVLDLLMDVVESYEDFFQSIIDTS
FT                   FEPAGMRSFFLHTYREMILSWAAIVVCETAIEYATERVAVGPTGKSWVTLMGAGSFTEV
FT                   QLEKIALSGLVQRTFPSMTQVTYDENLLGKTIEKVRDVVLGTIVRVRGELYYLVTGVDN
FT                   RRLFMEQYQKMLREEKEMQAAMQAEVEEQMNARLPGCSKTGGEAPPQQEKPGLVTFPLN
FT                   ESSLVMAPKRCGSAAPASSSNASQSDNTTAEKVKRSLLSTQSETSDRTPCESTVLLTGR
FT                   CAKEQGTSRVSTPLIRLPSRERRRQERRRTHLETPSTGRPSSRMCSDLHTAHPSEGYVS
FT                   ESRLRSSVGGNAPYFSNTARTESRSNHWDHFWRKGPQCGFSSASVSRRRARRQGGFADL
FT                   PQDLTVRNVRRELVSLHMRRNEQRKSSGLKAGASKPYDTPWGTNGNGASTLGLSSVSVD
FT                   LHSPVADIGHSLSPERSGAGGHWASRYGVDKQFMISPLAAVVGARQAQVVEQMRRAFQN
FT                   TVQFQVHFQETSHGGESGVPRALHESQWYVTGNSEYYERRTVALIRRSRQVAAFDLRHL
FT                   SPITTLGMCVQRSSRGFHRYDPQPRSPHVDHNSIQPKDLHLGRNIVPWTL"
FT                   /protein_id="XP_846964.1"
FT   repeat_region   409611..409636
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    409680..409704
FT                   /note="AT_rich"
FT   misc_feature    410113..410165
FT                   /note="A-rich"
FT   repeat_region   410338..410369
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    410560..410611
FT                   /note="T-rich"
FT   repeat_region   410612..410632
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gtttg"
FT                   /rpt_type="tandem"
FT   misc_feature    410633..410662
FT                   /note="T-rich"
FT   misc_feature    410830..410877
FT                   /note="A-rich"
FT   repeat_region   411390..411409
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   411888..411934
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   412591..412618
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   repeat_region   413244..413286
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   413807..413847
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<414144..>417464)
FT                   /note="synonym: Tb08.29O4.510; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659105"
FT                   /locus_tag="Tb927.8.1290"
FT   mRNA            complement(<414144..>417464)
FT                   /db_xref="GI:72392328"
FT                   /db_xref="GeneID:3659105"
FT                   /locus_tag="Tb927.8.1290"
FT                   /transcript_id="XM_841872.1"
FT   CDS_pept        complement(414144..417464)
FT                   /locus_tag="Tb927.8.1290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392329"
FT                   /db_xref="GeneID:3659105"
FT                   /translation="MSPSSLTLRYVLPCHSCTSCDEATVADRVSLLDTPSVPVITWTTP
FT                   SEFLTAVKATVPVDSAKHNGSLAVGEDGLGLHLLSADSAGAAAGDGEAGPRVIQLTLDW
FT                   VLALPCVSDDAEGNSGVELHVLRTNRLDFLVQTWSAVTSHIVRLTTWPRMEVSFFPSGF
FT                   PCEIVSGMINGSEPSYYEVRACIPIRLVLSPTPEGTKERKNDDRGSVSEMLEEFASTKR
FT                   MYAHQLRALIHDAAFSCISSNPTSFCGFDEAPSSGRGTDTASPGESVKEEEAVSSASTN
FT                   QQSGGGVSAGKEPKGPQQVLPRVFHSIPPPPVPVALNICLTHHGEDGEVPTEGDDQRER
FT                   DVVLFVHTVVRAVRPRSGASPRLRPRRIALDALVNLFPERFAVHGVSDVAVAEVNVEDL
FT                   SCMWVPFNDTTIGGDVLALSAEEYFSFHGRQDSEASGQASPRGNGSKMQHNPYDRMRVS
FT                   PADVDPHGRKTAPQPCFGWGRGMCFNGGGPGRPFTFNPALCGTFQCFPWTPSFALRKGR
FT                   TASAGAAETSEVRDVVRSSWTGVSSWKNVTPGLSCSWRGESSGSRRGGKSGSLRSGASE
FT                   APWAPWAAETPDDVSVKVPPQAEETSAVSASPQDDNEVMDLSDSRQMILEWADSIGLSR
FT                   RRTANLAQQLERLGEQFASISLQHCVTTDGADKRKKGRGGRNGQKAVDAGAPEEDSDAV
FT                   HLVEGLIGASMRPHGSISEEVLRFAARLLGGAKQCEEDYGSVDECAKEAFDMIQKLDQD
FT                   LRATALEVQRTQKDIRKTLSGILTPKGERKAKVETPNLFYPAIKALNPEQSHRTELFGI
FT                   GAPSGLSRSGDILTLLRFKKGDYEVAEQSVMTVSDKLRKAEVWCAAQLEQMQLVVKLYK
FT                   DILVPCLDARVATKRDEERKRSKLIVDWAVSIAIVLESQRSAESQESNGVERHEDEHLS
FT                   HKGPRGAASTEKPLRLSNGKPLLNGGSNGRAHEGQAEPLKTHDATTRSEGKGLEASSER
FT                   PAKVERPVKAERPAKTERPMKADRVAPPVTETTRDLHRSTSPKRKRKAPAVVAQPWSLM
FT                   TVTPAPVVTTQRRGSRYRRFLWRLARFSQVDRLRRNAYLLALLASVAVAYLVVVFLYG"
FT                   /protein_id="XP_846965.1"
FT   repeat_region   418798..418818
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   419070..419094
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<419851..>422019)
FT                   /note="synonym: Tb08.29O4.520; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659106"
FT                   /locus_tag="Tb927.8.1300"
FT   mRNA            complement(<419851..>422019)
FT                   /db_xref="GI:72392330"
FT                   /db_xref="GeneID:3659106"
FT                   /locus_tag="Tb927.8.1300"
FT                   /transcript_id="XM_841873.1"
FT   CDS_pept        complement(419851..422019)
FT                   /locus_tag="Tb927.8.1300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392331"
FT                   /db_xref="GeneID:3659106"
FT                   /translation="MSRRNSASRCFPLEQEIYPQQQHHYQDMTGSVTPAYDHSIDHQVA
FT                   PMRASSRPHQSVGERRSIGERPGGCSRRGSAVSGMHVGPDTFSHNQGPNYASGATTRVP
FT                   SLATNGEFVEAEPLRYDKKHMINQPSQPGNTSLDGGVRKTAASRRGSKADPKQASMSQP
FT                   FLRTSSKQCYQDVTSLDPSGRRQDADETLMRRDDSLTALYGTKGRGEVGRLRERRGGEE
FT                   GLIVAVHNHSSIDECFKNSGPDGGNGCDRALSKPVSRRGSADMSRQGSRPERVAVSSNS
FT                   TGGRRDGLATGVSGNGFSSFPVNSSLSPTARLSDRMAADNAANVSSSSLGRREGGKNRS
FT                   NPTTFPSDVHAENLHTIIYYLKNHYALDAQESRKGLETMTPEDVLGLVQCFYVDMYRTV
FT                   RDYRDSVGIGRAGFKDEDPVVACVVEPEDFPILTKGTPRHSVDRRDVHGGDACDVSPHH
FT                   RSGERGLEGARAWRAVPVNSSQFGGPLPQSQQPCALSRQRLRAHSRALGQRDLSAAGLR
FT                   AGRSASRSAASRQRALSCRSAAACANTSMETTPEAVNRQRGGVSGRAVGCPLHGLVPML
FT                   RRGNNICKHVTGGRPHLRYFRVEMLPAKRGGASPTPHLIWGPSPTSLTSASLKGCKNAL
FT                   SLHTLFCASPLCEGTLEQFSRFFKRDKRGVVQDHNGSAVPNEMCAVLRFNERDLALTFL
FT                   TEEDRDLWMRAMSFIVERNKLQPTGPSS"
FT                   /protein_id="XP_846966.1"
FT   misc_feature    422159..422182
FT                   /note="AT_rich"
FT   repeat_region   422645..422670
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<424654..>425658)
FT                   /note="synonym: Tb08.29O4.550; mitochondrial carrier
FT                   protein, putative"
FT                   /db_xref="GeneID:3659107"
FT                   /locus_tag="Tb927.8.1310"
FT   mRNA            complement(<424654..>425658)
FT                   /db_xref="GI:72392332"
FT                   /db_xref="GeneID:3659107"
FT                   /locus_tag="Tb927.8.1310"
FT                   /transcript_id="XM_841874.1"
FT   CDS_pept        complement(424654..425658)
FT                   /locus_tag="Tb927.8.1310"
FT                   /gene_family="HOG000255377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /note="go_component: membrane [goid 0016020]; go_component:
FT                   integral to membrane [goid 0016021]; go_function: ATP:ADP
FT                   antiporter activity [goid 0005471]; go_process: transport
FT                   [goid 0006810]"
FT                   /db_xref="GI:72392333"
FT                   /db_xref="GeneID:3659107"
FT                   /translation="MVGGDGEEPGLQRQAKRALGDPLPLDNEMESEAPNDFSNDPSDNI
FT                   SVQSLQVACVQKCCLCTIVAPLDRIKFVMQCQKELQRTGVLDRTFRSSWHCFRCIHSIE
FT                   GIRSFWRGNLVQVGSLLPVTAAHMLLGGPMQMWVYNNFPRGFPFGHSAATYASILCGAL
FT                   AVSAVSYPLEFARFRLAVDLRRSPCDLYDYRHSLAFFAQSVFSEAPHLLYAGFGLYVTG
FT                   SIIYGVMYTGLTQQVLSRLPSEPGGYTATVVQVGAGVGVSAVSTLGLHPLDTMRRRMMI
FT                   AVTMDGLRYASARHCFHHILSTEGIAGFYRGAAFTMVRMVYISSLYMWFLPAA"
FT                   /protein_id="XP_846967.1"
FT   gene            complement(<426876..>427598)
FT                   /note="synonym: Tb08.29O4.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659110"
FT                   /locus_tag="Tb927.8.1320"
FT   mRNA            complement(<426876..>427598)
FT                   /db_xref="GI:72392334"
FT                   /db_xref="GeneID:3659110"
FT                   /locus_tag="Tb927.8.1320"
FT                   /transcript_id="XM_841875.1"
FT   CDS_pept        complement(426876..427598)
FT                   /locus_tag="Tb927.8.1320"
FT                   /gene_family="HOG000255378" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392335"
FT                   /db_xref="GeneID:3659110"
FT                   /translation="MTSKVEELVGEVEEALEKLVNASDSIFNASTTLDKKQAELSAKPV
FT                   MREARSKVEMLNDELRRTEDAAVRSHYEKVCRAAEEKIRVLDAEIKKHVYAKHTKVALE
FT                   KTHAERREEELLGPGGADGSGFQDSQQVLEAAVNVQKDMLVSLQRTEKVMIMTEETGQE
FT                   TLQALQRQTEQMYQVDEGLEELQGQLDRAGRDVRWFFRQLAGDKCFLSLFGILVVAMAV
FT                   LMGVMIYKKRQAKKNAEK"
FT                   /protein_id="XP_846968.1"
FT   misc_feature    427902..427922
FT                   /note="AT_rich"
FT   gene            complement(<428242..>429072)
FT                   /note="synonym: Tb08.29O4.580; 60S ribosomal protein L7a,
FT                   putative"
FT                   /db_xref="GeneID:3659111"
FT                   /locus_tag="Tb927.8.1330"
FT   mRNA            complement(<428242..>429072)
FT                   /db_xref="GI:72392336"
FT                   /db_xref="GeneID:3659111"
FT                   /locus_tag="Tb927.8.1330"
FT                   /transcript_id="XM_841876.1"
FT   CDS_pept        complement(428242..429072)
FT                   /locus_tag="Tb927.8.1330"
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L7a, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72392337"
FT                   /db_xref="GeneID:3659111"
FT                   /translation="MAGKEVKKAVKPTKKAGVPYKKPEVTQKKAKASAAAPSPFVARPK
FT                   DFGIGRDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRSSRNELL
FT                   KLVKKYAPETRKARRDRLTKVAEEKKKNPKGTVSTKAPLCVVSGLQEVTRTIEKKTARL
FT                   VLIANNVDPIELVLWMPTLCRANKIPYAIVKDKARLGDAIGRKTATCVAFTDVNAEDQA
FT                   ALKNLTRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRARTAGNDAAAKAA"
FT                   /protein_id="XP_846969.1"
FT   gene            complement(<429328..>430158)
FT                   /note="synonym: Tb08.29O4.590; 60S ribosomal protein L7a,
FT                   putative"
FT                   /db_xref="GeneID:3659108"
FT                   /locus_tag="Tb927.8.1340"
FT   mRNA            complement(<429328..>430158)
FT                   /db_xref="GI:72392338"
FT                   /db_xref="GeneID:3659108"
FT                   /locus_tag="Tb927.8.1340"
FT                   /transcript_id="XM_841877.1"
FT   CDS_pept        complement(429328..430158)
FT                   /locus_tag="Tb927.8.1340"
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L7a, putative"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:72392339"
FT                   /db_xref="GeneID:3659108"
FT                   /translation="MAGKEVKKAVKPTKKAGVPYKKPEVTQKKAKASAAAPSPFVARPK
FT                   DFGIGRDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRSSRNELL
FT                   KLVKKYAPETRKARRDRLTKVAEEKKKNPKGTVSTKAPLCVVSGLQEVTRTIEKKTARL
FT                   VLIANNVDPIELVLWMPTLCRANKIPYAIVKDKARLGDAIGRKTATCVAFTDVNAEDQA
FT                   ALKNLTRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRARTAGNDAAAKAA"
FT                   /protein_id="XP_846970.1"
FT   gene            complement(<430515..>431603)
FT                   /note="synonym: Tb08.29O4.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659109"
FT                   /locus_tag="Tb927.8.1350"
FT   mRNA            complement(<430515..>431603)
FT                   /db_xref="GI:72392340"
FT                   /db_xref="GeneID:3659109"
FT                   /locus_tag="Tb927.8.1350"
FT                   /transcript_id="XM_841878.1"
FT   CDS_pept        complement(430515..431603)
FT                   /locus_tag="Tb927.8.1350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392341"
FT                   /db_xref="GeneID:3659109"
FT                   /translation="MQKLWHDLYEAETLSDARRAVLSTVPQWVPWLGGGVCLIAYAAVL
FT                   RTRLFLARWRRAARKRAERKFSGFRRWKGCDVPPPCVVITRIEDEVDGDEDGDGGSDAE
FT                   GGRCGDGGAATMLSVEDIAEFRCSVGLRSPRDDDLLIMIEEMLLVDDVPDGWVLCRTTS
FT                   GVVRFMNLSTQELCLFPPGRQGRGHYIRKELRRRNKLEIESGFSLSYNNDEVFNESWGG
FT                   GGGHTGKFPINDSLGKTSETDSSLQRNHSRGTDRSTRDDAHFVSDEDTLSFSSDEADLY
FT                   GEGEQSAFRRVFRYFLEREKRRIERDVEMQFWSCDTNGDGTGKDDNVASAKVENCGLRL
FT                   LVSNGSPGQNMRDIVSRPNGRD"
FT                   /protein_id="XP_846971.1"
FT   gene            complement(<432137..>444811)
FT                   /note="synonym: Tb08.29O4.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659114"
FT                   /locus_tag="Tb927.8.1360"
FT   mRNA            complement(<432137..>444811)
FT                   /db_xref="GI:72392342"
FT                   /db_xref="GeneID:3659114"
FT                   /locus_tag="Tb927.8.1360"
FT                   /transcript_id="XM_841879.1"
FT   CDS_pept        complement(432137..444811)
FT                   /locus_tag="Tb927.8.1360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392343"
FT                   /db_xref="GeneID:3659114"
FT                   /translation="MNYRRDCGGQIRFEKVLAYFLDGIPRPFITVATDAGFGETFGFGS
FT                   FGIAPDYTGRTEVLHFPEFKESDLFDAICSWKKASSSPSSRIGCHYSPYVGTFCYDGKR
FT                   QYIQVSQLQSQRRSVRVPVGISEEALCTSGKSGRDFRTSLLIDLYENVAKGCITHETGC
FT                   LRRIVILATQGTTADHRDVVERTMKEIEQVYIRVCVEAIYDYMNLNSLFRRIMAPLRLV
FT                   CRNEDIKRFEEDNGRDDGSDHGGFLAFNESLYCLKHSLIWSEGKNDFFVRLHHLWSDRF
FT                   ERLAVFNTTTFNWRTDADDFLSQLGCSMRAAFTRIRIEFYTEVEQLLFTTIPEAGTLLS
FT                   MDLNDLKESELWRVFLMVRIFLTNRIRILISDAIDDLVSFFATGGDRIVTPLKARKMSL
FT                   IEVYFVVGGCGLPSSPSFAQLHFGIADLLDELLDSANNLPTPETVIMRTIQFERHSLNL
FT                   FDDDSFPGKATLIRYLGAACTVVEDLTEKYSMFARMPTLNGVCFTKCSEEEVVSNVNLL
FT                   RDTILEVGKISPDVVFCGCIAINCTDVKKWYVKQWSSYLKSFLNMVQKDILSFIRSSLE
FT                   KCRSYNDQLSVIPNSVEELEKLQSDITYAEHLSKQIEAGDCRRAIEFFSYLEKLLIPAD
FT                   SQLYEVAAELMRCPNELLVLTNNAKKACAERKPALVVQLVEYRNDLHGKITVVRNGVIE
FT                   LLGLLSVDVCDICAQTCEELRVIVDDVVKGIDHVFYCEKSLGLETVETFDDVHPVLRVF
FT                   DVLEQFWCSVFDSTRVKDYYIIPLSALNSEKTIDEVQRCRRLLHSSVRNLRGYPGLVCL
FT                   GRQQEQVLADFESLQTLLAYLSTPGLRKNHWKEIGRILQLGRKQSTQIDSNVTLKQLLE
FT                   NGIIDHLDEIKLIVDPAFLDFEAEATLERMKSDAKKTRFVFEVAEGSNDALILSPRCRT
FT                   SISSQLEAFSHELSALRQVEHLSQYTISSVMEFDSVVQRMKETLLTWEDVEKEWKEVLP
FT                   FGITLETTTDEDFIGLTPRDLKLLREKVSSTSDTFKSLAATLRKAQYTLFTAMMQENIQ
FT                   DQVTLARTILGDVRKILASSLDAKREVFPRFYLMDDESLLSFLSVHNATKLKRHLTTLY
FT                   SRVCDVNLEGNVVTSFITTDGSVLRTDTPIELSPLPVEQWMKTFDRTLRSSLLNEIKMS
FT                   VENHYRMDTLVWLGDSCVQVIDVALRTICHHDLREAVSVAGTAGMNAYTRRSKDVLEEY
FT                   VRLADDTLGARVQRILSTAITSLLRYRDELRLVSKSGVETLEDLKATAMVQTLLEGGKI
FT                   VVQMMGLQLPYGMEFFGDYNIPILTPEYVEKGLCSMLMSIRASSFPILIGKNNENSELE
FT                   YYAQYLGRFCWFLQCHPTLPFEGIVRALRGCLGAGVILCLKDIELLGRELADSVSALLK
FT                   GVESACRNEKRHNDGGMSTVEFQAGDNSICAIRDACFHVVLTTRELDEIPTALSLAFRP
FT                   IYVPSVDLGLLAQGTLQALGVPHFASIGQRLATMFSQFVAMLPAVFTCRSFLSVIRDAA
FT                   DCKTGTMAESLCSAFLRQFWHVIESDERLLKLFEWNVVHTLGIPRHVLEEVLEKFKSKL
FT                   GFDSCLERFTYFMKFNKNAMLVGSAYSGKTPLWKSWVGDTHYIVLSHRLLCSAEVYGDE
FT                   SRPGLLVSIARKWDPISTHTIVMEHTNVVDVPTFLESAAHVRVRSYSGPDFIQGSSTRI
FT                   ITVVTTLESANPRIVSEVAIYALPEPSGWKDLLKNELYSDPNCSPGAAFPVISALIEAV
FT                   LDVSAVPRISSLDEDVFGVVCRCSRFYKRWYAFARSCGKAEGEHSSDDVFASQCAVFAT
FT                   CWSVMLCMQVSEISTGIVAFKKSQSGLTAVAQHIGVDENVIFPPDDDLLNYIATPFGWK
FT                   KLGKEASDVGFPTPWASRDPGVNFKQHAWTYFFPLRSRQRTLMHLEYMAAVGQPVLLVG
FT                   ERGQGKSTLLNHMRCSSRWAYELVHNTVACTAGDVQDALLQGLSRSQHNTYVPSSGQRL
FT                   VLCVDDVHLVGEMGYPQAMCVFAFIDHYSALCTPSKGYVPIKDVICVGTSLPTPPHEPE
FT                   VENSVLRIMIPDFIEDEILHEVEKLIGKTRGVRRGEGFLKGVGDFLIASQSMAFHFINS
FT                   LLGDNHSGLDRLKSTLASIEGICAFEDTSLLSFSDDRADNQSQLPYPYVLLRVVDKVLR
FT                   ILSTQLDEASIVKGIYHSVYTFFMPLIAGEGRREELMAELLKMAKETMRYSPGARQREG
FT                   ADETYVTEVLNSLEYPSVGHDVIRKWLEKHDVMMPPALVDEIRSESPYISTGKSRMESP
FT                   STKEAQQQAAVGGAPHVNCTPHWTVSLISDVHHCLRQEGSHVALVGAYGIGIRRALHVW
FT                   AAGRGVNLRSLLSDFAAPDAKNSFTRELIEILQGTCRSGSRMVVFVPNEVLTLVWPLSL
FT                   LYYTLRGGNVRQLFSVEEQLYLLHGRRGIQRQSGKLTPAEEVQLRERISSRLSIVAHFV
FT                   SFEEMRRLGTVIPFVLQMLPVVLHAPDMLREHVDVVIRSEKATFVVPETGRAESADVPP
FT                   GGEGCGKDAPVESIPCFLGVPMDTETLLGRPYSQLLCDIFFCLRTNTEISVEQLQEFAT
FT                   LANRLRGTLFRICHCVSQSLRVDDLFNAIPTKMQEYANKSKEAEETKVTVVQHRGELVA
FT                   RLERSKECATRHQSEWEFLQRKSCDLLPLVTAAENALRLKRESISDGLSSTKARLCSMK
FT                   TAQIRQYASSLPSPKGVLLVKAVCRVLGEDLRATSTRDVWDRGRSIMTASKFIARLRDL
FT                   DHESLSYESLASVHSSLRGVRFTDVSPFADALSDYLLSVMEAVRVKKELQIEQMELDSL
FT                   RLEYTTIEDRKNEAGCGVSESRRKIECVEQEVNNVDEKSQGLETTVVDMTKRQKSLEFI
FT                   TDALDRFSLFHTPGKTAAQCNEMAKGEGAVIMVAAHFAFFASLPLEVQRSCHKALYSLL
FT                   CDWGIQAPADLEDPAASLLFPSVDETVESLLLSACSTYERQCIAGLLQKIFSNCPIFCG
FT                   VTNVFEEVLGRCLAFICGDCVVVSVMQKDFCDEVVRAASSGIGLLICDVHAPSVLERLR
FT                   PLLLLLKALPQAALQKRNLRCTLFGQEVPVKPSFLMVCVSPAVMLHEEAKAATRCYTTV
FT                   VNIPSPRRIEEGVHTILLGCPTAYARPLVENVFSVRDKQDNDALCAFRVTLPEVREMLS
FT                   GDLDELAGNNNGELERLDFLLRELHTLHMTVLRIEAHNKSVQKPLASLWEGLKRGIQAA
FT                   ERAVRVIEKEILGRLWEWRMLEPFIVGATNLSSAYVRRISPGTFDKLPPPQRDFYATVN
FT                   FVESLVDVMASGWPMELRGIFAWYILSTVVHSCGFMLAHSGVLYSSHITFLTSQQYDVL
FT                   NRLLTRQNIAADKQTVRNLYESSMDPLLNSIARDNSTLDDTESGLSLESTLFVKDTNTS
FT                   WVLKAGEELIRFLFQQWMLLNHRACDAAASDLYAAFFTSVKKKVTEEGGLSIYDSLDSQ
FT                   CTNLRYSEEWWQFSGNTSIPLLLKGANTHELVGYVRQRANSASFFFRYLTVTNVRDLDQ
FT                   LVGYVSHSFQQPPTHVVRGHCVMAVFVPPAGVSEEASFLQAISSRFSALWRYGIWGLLR
FT                   GGGHSTRTPVVLCCTVRGAPNMVRNNVVRAMQEWCFPVVVDSVSPRHQLLSVIGGKVFA
FT                   PPWKREGVTLLLERECTKSGVSCSHLDSCKRGDRGNTMVTPLGYVLELHAGISAGGAVQ
FT                   RALVEDRGLDNVFTDLYRTDINTDDLLLILRLVSLKQLDDPQEEEPSSKRHPSTTLHAA
FT                   THTVSSTELKSATLQRRSISERLYRLFNKVAYLVYTSRSERHQGCLLIENMLYERGPLL
FT                   MLRDDGRLCYSTALDELLREKPTDEVFMATLRRSDKSFLHLCGDDHTIVTYRSMASSAL
FT                   RRSLCGVPFSTRADPLFSTSDGPLCSQGGVDGASQTEPHEDFESNSAVSLLLVWEGVYG
FT                   EKTVRALERAQHKELSSRLRVATAQFRGWQPGSVLSVWLPALQYPKLLLNILLADALER
FT                   KGDLLSHIEAVLVVTRRYMLLHDDVLLTGAAPSRQLEREVSIQAGWKPCEMRWNKEVGA
FT                   SKHDMDIVIAVRYQSDFTDCPSRQPSGVLWDLRSGKKGSEPRQEGSAMCNSVLFLTEPE
FT                   PPQVCDVVKRSVATVPVVGLDLQWAVSHPLNPDDKPDEATSRVWQPLFELPLYVTVPAC
FT                   ERSELNATPPRSVGQRPLGGRGGGRKALASSGPVVDTLGDSLGFFIAVS"
FT                   /protein_id="XP_846972.1"
FT   misc_feature    444856..444884
FT                   /note="AT_rich"
FT   gene            complement(<445051..>445557)
FT                   /note="synonym: Tb08.29O4.629; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659113"
FT                   /locus_tag="Tb927.8.1370"
FT   mRNA            complement(<445051..>445557)
FT                   /db_xref="GI:72392344"
FT                   /db_xref="GeneID:3659113"
FT                   /locus_tag="Tb927.8.1370"
FT                   /transcript_id="XM_841880.1"
FT   CDS_pept        complement(445051..445557)
FT                   /locus_tag="Tb927.8.1370"
FT                   /gene_family="HOG000255381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392345"
FT                   /db_xref="GeneID:3659113"
FT                   /translation="MHFLLSFFLPFFLSVMSSKVGQEFSQYVTEISQSQRHHVADRVEQ
FT                   LARHQSRAWYYLVGCVTFTTSSVMLVFRLWGPRHIFKNSVYYTRPLPPAISMGVVLYGI
FT                   LYTCRGMLMRSRICTMMEDYEYELKRISAHHCEEGVNQLAWLQFVTEQLKQGAEHRFDF
FT                   NKLRS"
FT                   /protein_id="XP_846973.1"
FT   repeat_region   445517..445552
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   gene            <446031..>447095
FT                   /note="synonym: Tb08.29O4.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659112"
FT                   /locus_tag="Tb927.8.1380"
FT   mRNA            <446031..>447095
FT                   /db_xref="GI:72392346"
FT                   /db_xref="GeneID:3659112"
FT                   /locus_tag="Tb927.8.1380"
FT                   /transcript_id="XM_841881.1"
FT   CDS_pept        446031..447095
FT                   /locus_tag="Tb927.8.1380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392347"
FT                   /db_xref="GeneID:3659112"
FT                   /translation="MEMAAPPPPARRRRQPFITSFLENVLPFLPARELLVCATVSRTWR
FT                   EESRALSIWRALLISNPRTVQYGYQGLTLGEMQKIALRAANLSDNRGDAGGVTDQETSG
FT                   MERSDLRDSERRAEPSLENARGKQRRQFSSCGGVSTLERGAIMIQRTGGAICVETKSCT
FT                   NDIQKTFETVQTYIVHVRENVKSIACVIDALRQKVPSSESIKFHQQCVGLWKRLNVFEE
FT                   IVIDSLDEGETASLRGLRNFKQVEVVMSGQVESQAYIQWCFFKQALPLDETYYDYVDLL
FT                   YSLGPARCGPAIATLSEIELAVERIRMNNQLQTVIDGVIMMKSVDIGRLCWESLMAYVN
FT                   TERRAADLGGRRPE"
FT                   /protein_id="XP_846974.1"
FT   misc_feature    447651..569646
FT                   /note="sequence corresponds to BAC RPCI93-29O9"
FT   gene            complement(454111..454229)
FT                   /db_xref="GeneID:3659117"
FT                   /locus_tag="Tb927.8.1381"
FT   rRNA            complement(454111..454229)
FT                   /db_xref="GeneID:3659117"
FT                   /locus_tag="Tb927.8.1381"
FT                   /product="5S(M5) ribosomal RNA"
FT   gene            complement(454846..454964)
FT                   /db_xref="GeneID:3659118"
FT                   /locus_tag="Tb927.8.1382"
FT   rRNA            complement(454846..454964)
FT                   /db_xref="GeneID:3659118"
FT                   /locus_tag="Tb927.8.1382"
FT                   /product="rRNA 5S (M5)"
FT   repeat_region   455047..455073
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   gene            complement(455582..455700)
FT                   /db_xref="GeneID:3659119"
FT                   /locus_tag="Tb927.8.1383"
FT   rRNA            complement(455582..455700)
FT                   /db_xref="GeneID:3659119"
FT                   /locus_tag="Tb927.8.1383"
FT                   /product="5S(M5) ribosomal RNA"
FT   repeat_region   455783..455809
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   gene            complement(456318..456436)
FT                   /db_xref="GeneID:3659122"
FT                   /locus_tag="Tb927.8.1384"
FT   rRNA            complement(456318..456436)
FT                   /db_xref="GeneID:3659122"
FT                   /locus_tag="Tb927.8.1384"
FT                   /product="rRNA 5S (M5)"
FT   gene            complement(457054..457172)
FT                   /db_xref="GeneID:3659116"
FT                   /locus_tag="Tb927.8.1385"
FT   rRNA            complement(457054..457172)
FT                   /db_xref="GeneID:3659116"
FT                   /locus_tag="Tb927.8.1385"
FT                   /product="5S(M5) ribosomal RNA"
FT   gene            complement(457790..457908)
FT                   /db_xref="GeneID:3659115"
FT                   /locus_tag="Tb927.8.1386"
FT   rRNA            complement(457790..457908)
FT                   /db_xref="GeneID:3659115"
FT                   /locus_tag="Tb927.8.1386"
FT                   /product="rRNA 5S (M5)"
FT   gene            complement(458526..458644)
FT                   /db_xref="GeneID:3659128"
FT                   /locus_tag="Tb927.8.1387"
FT   rRNA            complement(458526..458644)
FT                   /db_xref="GeneID:3659128"
FT                   /locus_tag="Tb927.8.1387"
FT                   /product="5S(M5) ribosomal RNA"
FT   gene            complement(459261..459379)
FT                   /db_xref="GeneID:3659120"
FT                   /locus_tag="Tb927.8.1388"
FT   rRNA            complement(459261..459379)
FT                   /db_xref="GeneID:3659120"
FT                   /locus_tag="Tb927.8.1388"
FT                   /product="5S(M5) ribosomal RNA"
FT   misc_feature    459988..460047
FT                   /note="Ns indicate region of repeats unresolved within the
FT                   5S ribosomal genes cluster. Complete 5S ribosomal genes
FT                   cluster could be 12 to 18kb long."
FT   rRNA            complement(460411..460441)
FT                   /product="5S(M5) ribosomal RNA, truncated"
FT   repeat_region   complement(460447..460714)
FT                   /transposon="ingi"
FT   repeat_region   complement(460468..460714)
FT                   /transposon="RIME-A"
FT   gene            460827..461729
FT                   /note="synonym: Tb08.29O9.30; hypothetical protein,
FT                   conserved (pseudogene)"
FT                   /db_xref="GeneID:3659123"
FT                   /locus_tag="Tb927.8.1390"
FT                   /pseudo
FT   repeat_region   461927..462173
FT                   /transposon="RIME-A"
FT   repeat_region   462174..462424
FT                   /transposon="RIME-B"
FT   gene            462702..463460
FT                   /note="synonym: Tb08.29O9.40; hypothetical protein,
FT                   conserved (pseudogene)"
FT                   /db_xref="GeneID:3659126"
FT                   /locus_tag="Tb927.8.1400"
FT                   /pseudo
FT   misc_feature    463991..464021
FT                   /note="AT_rich"
FT   gene            <464033..>466366
FT                   /note="synonym: Tb08.29O9.50; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659127"
FT                   /locus_tag="Tb927.8.1410"
FT   mRNA            <464033..>466366
FT                   /db_xref="GI:72392348"
FT                   /db_xref="GeneID:3659127"
FT                   /locus_tag="Tb927.8.1410"
FT                   /transcript_id="XM_841882.1"
FT   CDS_pept        464033..466366
FT                   /locus_tag="Tb927.8.1410"
FT                   /gene_family="HOG000136277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392349"
FT                   /db_xref="GeneID:3659127"
FT                   /translation="MARNKAHKQRFASKRAVSGLAKGRTIPTKKESVKALHPLEAKERS
FT                   RQSLAALRDKKRANALQQKRIGKISGLPRAVGVLPANESANTNAVIRGLCFSLGSEVRD
FT                   TCLPFTASSKEKKASFTFMSERNGNLQSCVDIGKVADFLVLALDVSRSVQEMIRNVQES
FT                   MEVEDCDDVGSVVATTWYGDIGLCITAFTRELIAALNAQGVPSVAVVLQNLDTFTEKQR
FT                   HKVIKVHQRYFLSVLPETTKVFTVIDQGDYDPVLRHLHVAKLRSLAWRDQHPYLIVEEG
FT                   YFDDDAQKLVVGGYLRGMALSAEQLIHLTNHGTFQIENICRGDPRGDEAQVIDSCEKAH
FT                   RESLDYVQVNATLDDADGPTEEDIAYHKSIGFKKVKVPEGVSDYQAAWYEFEGSDINSE
FT                   TDIGESVPGDDEYAASDHFSQGTLRTTVDFLKVEDVIRLERMNDDERAAEIQRLKEESE
FT                   EDAWNPDIVDTPFNLPARQRFMKYRGLKSFQTGKWDAAENLPPHYAYIYKLQGITRIRE
FT                   AALAKCASGSVATEQFVYITLVDVPSKVWRSAVEGGCIIASGQLEHEQKWSVLHFRIQR
FT                   SSDCDEPIKSKIPMLAHIGFRKFYVSPIFSDITTSDRTKFARFFHPNEKFCMASFFGPI
FT                   SYQPCPILLFEVPSLEEQNEDNSLHLACFGGALPPNPDLLVLKRAVLTGRVATIHKKQI
FT                   VVKYMFFNDEDVQWFQSVDLRTRLGRRGKIIKAVGTRGLFKASLNDQVMQHDLVCMDLY
FT                   KRVFPKWTTLPFCISDVPKVVAEE"
FT                   /protein_id="XP_846975.1"
FT   gene            <466770..>468329
FT                   /note="synonym: Tb08.29O9.60; acyl-CoA dehydrogenase,
FT                   mitochondrial precursor, putative"
FT                   /db_xref="GeneID:3659129"
FT                   /locus_tag="Tb927.8.1420"
FT   mRNA            <466770..>468329
FT                   /db_xref="GI:72392350"
FT                   /db_xref="GeneID:3659129"
FT                   /locus_tag="Tb927.8.1420"
FT                   /transcript_id="XM_841883.1"
FT   CDS_pept        466770..468329
FT                   /locus_tag="Tb927.8.1420"
FT                   /gene_family="HOG000255371" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase, mitochondrial precursor,
FT                   putative"
FT                   /EC_number="1.3.99.-"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: acyl-CoA dehydrogenase activity [goid
FT                   0003995]"
FT                   /db_xref="GI:72392351"
FT                   /db_xref="GeneID:3659129"
FT                   /translation="MRRFISVSKHMPGRHSSYAAGLFNFKIVPDEMFPYPCRKVDGDEA
FT                   ENLQLLLEDVRKNGSTLTNLYGARISTEYGGMDLGHTAHALIYEEVGAKCNADMLSLIG
FT                   HSGMCTYLLSAVGDKSLKGEYLTAMSDGSVVMGWAVEESNGSDFSMTSTKASLRDDKYV
FT                   LTGEKHCFNAAKATHFLVLGKTFTQIVAEEGATTVERLSFFICAKDAPGVKVVGNSVAM
FT                   ENTPARCAVGVVGEGFKNAMITLFTEQYLYTASLLGIMKRILQILGESNAGEGAGGLIG
FT                   SFACFVYAMESTIYALAAIADTPVEDSLLECTLTAAFTQSTVTKLLKDLEISIPPSVQL
FT                   EECISCARSILNQTEQDHFLYAAAVCCGIEDYGLFFQNASTLQVMQARLLRSLGVRDRI
FT                   PIKNVRNASLIDEVVVTFGNAVETTFVRSGSHVQYQQLLLDRLGEAASLIYAASAVASR
FT                   ASLCVAKGLPSLELEESLAACFVSSAVSRSRVLCEEVCNVGKTADDILRRIALDICEDA
FT                   LQ"
FT                   /protein_id="XP_846976.1"
FT   gene            <468569..>469069
FT                   /note="synonym: Tb08.29O9.64; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659130"
FT                   /locus_tag="Tb927.8.1430"
FT   mRNA            <468569..>469069
FT                   /db_xref="GI:72392352"
FT                   /db_xref="GeneID:3659130"
FT                   /locus_tag="Tb927.8.1430"
FT                   /transcript_id="XM_841884.1"
FT   CDS_pept        468569..469069
FT                   /locus_tag="Tb927.8.1430"
FT                   /gene_family="HOG000255370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392353"
FT                   /db_xref="GeneID:3659130"
FT                   /translation="MFCFSRGLWMRHIGQDVPKRHTHFVLESRLMYEKSFRDCWLHSVC
FT                   RAISQLDEPLSKTVVGTHQKMLQRKVTCFQYNQYGLFKTPYYRLANVDRYHAVQGVAGT
FT                   REWVPYVNVSYWTMNKMVRGGNLLVHRVHYTGWGTDSHLKKGGWEHRWNKVLQRNVLQY
FT                   SRI"
FT                   /protein_id="XP_846977.1"
FT   gene            <469241..>469729
FT                   /note="synonym: Tb08.29O9.70; maoC-like dehydratase,
FT                   putative"
FT                   /db_xref="GeneID:3659124"
FT                   /locus_tag="Tb927.8.1440"
FT   mRNA            <469241..>469729
FT                   /db_xref="GI:72392354"
FT                   /db_xref="GeneID:3659124"
FT                   /locus_tag="Tb927.8.1440"
FT                   /transcript_id="XM_841885.1"
FT   CDS_pept        469241..469729
FT                   /locus_tag="Tb927.8.1440"
FT                   /gene_family="HOG000242268" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="maoC-like dehydratase, putative"
FT                   /note="go_function: fatty-acid synthase activity [goid
FT                   0004312]; go_function: oxidoreductase activity [goid
FT                   0016491]; go_process: fatty acid biosynthesis [goid
FT                   0006633]"
FT                   /db_xref="GI:72392355"
FT                   /db_xref="GeneID:3659124"
FT                   /translation="MLKVGQRHMGRVIRIGDFASTRRVITLDDVKAFGPLVGDSNPIHV
FT                   DEAAAKAAGFQSPVVHGMLAGSLFSGLLGSELPGPQSIYMSQTLRFVVPLFVGDEVEAR
FT                   IEVTQFRRTKFMIAFRTTVFRIDKQTGEKTLCIEGTAVGMNKTVTFEGESEWNVPRVE"
FT                   /protein_id="XP_846978.1"
FT   gene            <470464..>471897
FT                   /note="synonym: Tb08.29O9.80; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659131"
FT                   /locus_tag="Tb927.8.1450"
FT   mRNA            <470464..>471897
FT                   /db_xref="GI:72392356"
FT                   /db_xref="GeneID:3659131"
FT                   /locus_tag="Tb927.8.1450"
FT                   /transcript_id="XM_841886.1"
FT   CDS_pept        470464..471897
FT                   /locus_tag="Tb927.8.1450"
FT                   /gene_family="HOG000136278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392357"
FT                   /db_xref="GeneID:3659131"
FT                   /translation="MIRWTVNLAGVDAEADLQRDDRMKAPVNPSSGRRESGKPADAARA
FT                   GGGTPQSLGTVATLAMSELLELQRARRETSLADSSLGQFWIGPPLSKEEGGHAKGSEIR
FT                   IFSTFTNAQGRRTVCTVQARQALFRGVDVVNAFLQQTLVPDERLFSRFSTNPRHYKLYI
FT                   ADEFTGEEDLVFQLDSAIQKLTCFAVQPLPTAKLFLFPQRTRLLPTAAEDINLSVEVRP
FT                   LDSQAKVVKRQVLVPADMLAESLERVIFSRLPGIWLVAGSLRIKYGPVELNINEYYNFG
FT                   TGCGHMDIPVAERTILSLHRFGVTEVLVQGRVTDGAADVPAPVEDIVINIDAEKAQTLE
FT                   QFEVIRINKHGARQQRILCVDGERLYMKQPYNAGREASQGCEEKLVRDIEEVRSSPTRP
FT                   KCLEICYNHASKHEDDHIECTTAYCRALLDEKLRVVQRELRKRDDSERQKVDNVALSRL
FT                   FGWLKSGFGKYAQHSDGSE"
FT                   /protein_id="XP_846979.1"
FT   gene            <472502..>473725
FT                   /note="synonym: Tb08.29O9.90; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659125"
FT                   /locus_tag="Tb927.8.1460"
FT   mRNA            <472502..>473725
FT                   /db_xref="GI:72392358"
FT                   /db_xref="GeneID:3659125"
FT                   /locus_tag="Tb927.8.1460"
FT                   /transcript_id="XM_841887.1"
FT   CDS_pept        472502..473725
FT                   /locus_tag="Tb927.8.1460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392359"
FT                   /db_xref="GeneID:3659125"
FT                   /translation="MASQNAATNGDGVTAYRTESASLMNDNKRRNDKQTEDQRPPFTVG
FT                   SYALGIVMILCVAVIWTYASVLIQYIYEAEEYEKPYFMTYFNTNTFAVNNIGFLLLSSW
FT                   RRLPWKNGERTSSLVIYDDALKRTFVSGASAPDNEPADGADVSRGGPQSEAERIRPYSK
FT                   FRVFKCAAFFCPIWFLANSLFNASLAATSVSSVTVLSNTSAIWTFLLSLIFFNQKATWP
FT                   CLLAMTMTIIGACLVGFSDAENTENETVGGDIYALLAAIFYAVYTSIIRWHASDDDRYS
FT                   ILMLFGFVGALNTILFWPLLLIFHFTDFETFQTPGGIQFALLLVNALVGTNLSEVLWAR
FT                   AVLLTSPTAATLGLTLTTPLAMTSDLLIKQKSFNAMYIIGAVLLTLGFICFNLEQQLMK
FT                   LLKGSRSS"
FT                   /protein_id="XP_846980.1"
FT   repeat_region   475215..475234
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <475945..>477681
FT                   /note="synonym: Tb08.29O9.110; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659132"
FT                   /locus_tag="Tb927.8.1470"
FT   mRNA            <475945..>477681
FT                   /db_xref="GI:72392360"
FT                   /db_xref="GeneID:3659132"
FT                   /locus_tag="Tb927.8.1470"
FT                   /transcript_id="XM_841888.1"
FT   CDS_pept        475945..477681
FT                   /locus_tag="Tb927.8.1470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392361"
FT                   /db_xref="GeneID:3659132"
FT                   /translation="MERGMCLVERDVDGLSCKTMLAPQGWVQRVHHDVRDKCSVNVTHF
FT                   TSLDSLSTSLYVTEYFLPRPTSVESGSSAGVTPEALAASLAQLLDPSKFSLCTAWEVPQ
FT                   SAPTESCGPLGKLLCKYVLLVSVALSTRERDATYARCSFDAVVYDLKERYLQLSRGSDV
FT                   VGLSSTEWVAGNSAVCTRRGCCVIHVTAPPGRNICWHPQLGGEATCKLGEAAKELGLVS
FT                   ENLNFLLYEDAAGSVEVMFALLPLTPGVCIMKRGDLQRAWLRRTRGSRWRSLRLPTPRL
FT                   TTGVVDPCNSLYDVRPPGSFYLLVRGEGGTARSVIAWLMEPRVGSDSSIVLLTTFHTAR
FT                   GGAVSATASVVATDAAITVDTAAVDPATAAQCLKHCKWLRSTFCASVGMTFSWSALCVG
FT                   KSPGLLFRQGNLVIQLPSESTRYASASAVAAASAVSRGNESAALGSITVEAVDRADGTE
FT                   RRATITLLREFRCAIDFMDYVVTEFTYEAHVDRRSAVMRRCKAPLALLPGGGQGTGKCP
FT                   EAYSFWIRLGERDAIHYVVRECGIGRLLLAQACVTDCSPFSDVVAERWESWVGGIGVAS
FT                   IL"
FT                   /protein_id="XP_846981.1"
FT   gene            <478123..>485529
FT                   /note="synonym: Tb08.29O9.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659133"
FT                   /locus_tag="Tb927.8.1480"
FT   mRNA            <478123..>485529
FT                   /db_xref="GI:72392362"
FT                   /db_xref="GeneID:3659133"
FT                   /locus_tag="Tb927.8.1480"
FT                   /transcript_id="XM_841889.1"
FT   CDS_pept        478123..485529
FT                   /locus_tag="Tb927.8.1480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392363"
FT                   /db_xref="GeneID:3659133"
FT                   /translation="MSLSGILFPQRCHHAAHAFSSRGELWTALVTDHNFLVLRGGTLCA
FT                   SGPLSAPCDGDGAGFEAEAHSDLPEPPPTPLACRICCSERDDDIRVIVISMSGVYVVDV
FT                   TGPRMQMTYHSLCVCGGIPGCSRATVHSSPNEAQMPVCLSEWSHTQKEECARKALDAEF
FT                   VTSTVLVIAYSDAVELIELSWRGRQWHERRDRNEEERSRGVMRWRVRGSYSKLAVCRVS
FT                   MYLSVSQRSSLVEVFPLQPRLSDQEQRTEQSTVSFPPVLHAPREACVDSFRSLSYRTPT
FT                   PSLLETAEGSAYVWRGASTRLCNYKITSLEWHRVSGYSLLCVTCHESDRGQPFIVFFIA
FT                   QLCPVHEGAHVRAGLETQHGSGMVGVNSSTVHEVMLTLVPAGKVPHSSISGTPLSVHIV
FT                   PNYICSHSEVQGSDKLELLCVEKDGSVFRSSYCYDPHQGNCLVRCSSTECLVPQLLGPI
FT                   QKHYGDITTVDVLPAWRPRAVAFGPLTPAVAALLEAQRYRLVLRFRNGMVARVVVDLAA
FT                   ATVRVEAFLTLGVDAHPPLLATAVVDGVSGPQQIVLGLTQDRLFVVRRTLFSGGLTEAS
FT                   VSVVGPLALEHLQKLVCGSSVCGDDDAGNEMKGNTCVEESEALRSFMQAKCPEKLHMLP
FT                   VLLKACGGDARKLLRQLTAKYGSPTPAAFSDKTILDEGRSCDGSGDRSKNGRFNSVTPS
FT                   LLPSALKVGALRLTTGGIRCCVEMSVKDTDKPHHHQWWYIPATPLASVVGEWDSLIAHG
FT                   VLPPSTALVQCLDAPLPAELLRERRPSRDGLACVSWSTSAQSLVVQSRLLPHETPLKFR
FT                   PFESMAQPYNPVRVDCVKLVNNVIVVCVMGATRDEEIKTVLMVYVLDALRDVATQPVFE
FT                   QELVIHNVATFFMCDTGGLFVLRRDSKSIVRWMRVTTNGVGSGHCWREYCVRGGSESQE
FT                   AITTMAPLYTKSSGMNCHCYEGASCTHFVYVSSEEGLIKVCETSPKKDLRSALKGEIIV
FT                   EEGGSCPYTEVGRTSTRCAKVELYHPTVITLLLAMHRPRVARAALEGILESAAEASVAS
FT                   QSVDDSGPRRVAEVLCQNSTKGPLDAWPVPAATEEIAGVAVRTHQLEGGEEENLCDYAA
FT                   AFGLDIPLELLDQMTEVVMHAKLRGLSSQEQLTLLCTVESLRAVRVSGVANDAGASRCL
FT                   FSHKFLQLQQRRRAAVASAESLPANHTSFLWAALSDCQPQLLDVLSATDGNVLSWANVE
FT                   VSGVPFWLDSVHRLRAIAERVAREQYQRSRDVRECALMYCLARKPGVISALCRTCGNTK
FT                   LEMFFSRDFNEAKNRSAASANAFAAVSKNLIEYGAAFFVLAAEPRNAAQVLLQREGNVS
FT                   LALFLIRIATDDNPDDLSWFIEQRRLEETSCGAMSKSEEACLLWRGGRKHEALSLLTVQ
FT                   APLHVLEGADRLALLKFARRRTGAERGPAQREMLRLLMHTVRLSHAAGMRLPTSLFCQE
FT                   ALSWLLGLSKEDAGDDPTAQGNGSAANRVATSGIVADFNSGTLAFNAFDMDGDDGERGE
FT                   MAASSQSPEVAVASPMSEAVSVPTVRAGAGEIYRIDPAIVYSLLRELDFIREELQNSVS
FT                   TQPQQQVQKHQNTAVCDILSCAARLLVAVGGRDPAAGAFSCLQQMLECLPQGQWGKSCV
FT                   DRLSESPRYAEGEGNGMGLCTVIIALRVSLMSVATYNKDCALATALLGLPMIDDILLVE
FT                   GAQTVTVNTIAVYVRTVCHVLENLRSQTAEWAQEEEKRETSMGSDMHGVDGSESLNFAL
FT                   YNPFEGSGSAGSGVRPNDNSGRLRNDKLRAMLLVWCTARLHLSALKELLLEASGLRSAS
FT                   QDSQSTQVALQQWLVSYMLCRVTLDFNAAAVQFVGDVVSVLQLRDPLPADPNGVFIEVE
FT                   QQLLQIAGVLGHSLPTATSLLGDNGVCESCGQQQRYVDLLKLCVSHSEVFCQTTTCNTS
FT                   LSGMTESALTLLSNTVAPRTVENLLHGRLVQGTKEALRFVEATWLQRHLTRHNYREQFL
FT                   SPLREGPSVLRRDESLVLQQCGRAVTSVDYDRSSHDVIVWATAADVSVRGGYCGMLSRP
FT                   NDTSPVVRPRADNGGPSFHPTREGGVTGLSPGGSSREGVLFGSPIRSLTKPAASPNSTP
FT                   GSDRKLLSRRPSLPLLDGSRVAAHPRLPFFSAPHLDGCIDFYSFTAAECVKTFDCGDSR
FT                   AVTGVAYSTDGCTFVAGLEDGSVRGWRFDLQPVDRAVQPLFVYHVLPTGGIRTVMFCGA
FT                   SQSHIAVIGFSYDSLATGQRNPEEEEGVCGLRGEPKPASAKPKSKKGLLGFPRFGNYER
FT                   NTTELLLLVDLVLRPGTFAWQELSVVPEHAVYIKGLDSIMCISTNGAVALYDMWSSRLY
FT                   TFVRTPNVTVTCVAASYHDDIVAVGLVDGAVLLLHSNSIRGAVQACNGSTSHVASECVA
FT                   EKALASKESLLLKASRLQLIPSTSPRCDVHSVVFTPSVMLAGLGDGRVLAVGFPFSTIK
FT                   FGKA"
FT                   /protein_id="XP_846982.1"
FT   gene            <486195..>486506
FT                   /note="synonym: Tb08.29O9.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659135"
FT                   /locus_tag="Tb927.8.1490"
FT   mRNA            <486195..>486506
FT                   /db_xref="GI:72392364"
FT                   /db_xref="GeneID:3659135"
FT                   /locus_tag="Tb927.8.1490"
FT                   /transcript_id="XM_841890.1"
FT   CDS_pept        486195..486506
FT                   /locus_tag="Tb927.8.1490"
FT                   /gene_family="HOG000137462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392365"
FT                   /db_xref="GeneID:3659135"
FT                   /translation="MRRSFSRLIGADGGIFMSAVHDKQYLQHRLATLGKAEQQQPLSEE
FT                   TIQRLTTSTGSAESLFNKAAGAQPTNIVDEATGVPVGSVQLDPVRYGDWESNGRCHDF"
FT                   /protein_id="XP_846983.1"
FT   gene            <487358..>489163
FT                   /note="synonym: Tb08.29O9.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659134"
FT                   /locus_tag="Tb927.8.1500"
FT   mRNA            <487358..>489163
FT                   /db_xref="GI:72392366"
FT                   /db_xref="GeneID:3659134"
FT                   /locus_tag="Tb927.8.1500"
FT                   /transcript_id="XM_841891.1"
FT   CDS_pept        487358..489163
FT                   /locus_tag="Tb927.8.1500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392367"
FT                   /db_xref="GeneID:3659134"
FT                   /translation="MAMQLFTFGHPCEHQLRRQCIGGKSCPLCGYPNEWCCSYIKGKIN
FT                   FKRDKPCEGSRCRWNYQHPPQSLFDAVTQVLNESRPIALKIDEGDDKEILALSIDNHHI
FT                   VDTVQCALQMLRNPPSTYSARVGQLLAYAALRARDTKVFMQLLKTMKKPVDGYILGAYD
FT                   YLMRGTIPAPLNSSSNTVGGNANNNSVNSGNNNSAGSNQGRAAAKKAGTGSNGNNSSNN
FT                   NNNDKKEDIADELKSDMVDLMNAALSSGGQLVDREDQHTLQAVFIQSLRSYPKSNKKRQ
FT                   EMLESAVAMFGSKPGPRSTTAAVTAVEQTPPNNISGNSNSPPTTAAVVTNATNNNNNNN
FT                   NNSAASRAGSVAAATGGAVPGARTVARVVEAAQDENVSVPQRSGSFSNTNNSSGNSGNA
FT                   SYVNVCSAGAGATTAAAVVAAAVAAAGAPSRRPQGTTGSTTPVTPVSTRSKEPCVPTTT
FT                   IAPTTTVQPTRQQQQQQQQQRPPPPIVGISQLVQQPRQPAACRYEPIRTDLPLPNITLF
FT                   GGLFGLTTQSAAWAPLGAATSRKTSPPSLPGVVVGSGAATPGLAADMDEKAFRFLSPTT
FT                   SGVNFFGGIDSLPPEHQLLKGICDD"
FT                   /protein_id="XP_846984.1"
FT   repeat_region   487999..488037
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   488357..488383
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   488765..488792
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   490037..490069
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    490418..490451
FT                   /note="AT_rich"
FT   gene            <490829..>493862
FT                   /note="synonym: Tb08.29O9.160; ATP-dependent DEAD/H RNA
FT                   helicase, putative"
FT                   /db_xref="GeneID:3659136"
FT                   /locus_tag="Tb927.8.1510"
FT   mRNA            join(<490829..492053,493378..>493862)
FT                   /db_xref="GI:72392368"
FT                   /db_xref="GeneID:3659136"
FT                   /locus_tag="Tb927.8.1510"
FT                   /transcript_id="XM_841892.1"
FT   CDS_pept        join(490829..492053,493378..493862)
FT                   /locus_tag="Tb927.8.1510"
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAD/H RNA helicase, putative"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_process: nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism [goid 0006139]"
FT                   /db_xref="GI:72392369"
FT                   /db_xref="GeneID:3659136"
FT                   /translation="MYGMNRGGGGGYRNDRMGALGANLQDVKWDQVNVVAPQWNYYKPQ
FT                   ERCSDEEVAQYMRDNHITIYGDSVPQPMLKFSDLVAPDTIHQAFIDLGYKSPTPIQSIA
FT                   WPILLNSRDLVGVAKTGSGKTMGFMVPAALHIMAQPPIRVGEGPIALVLAPTRELAVQI
FT                   EEETRKVLRRVPTITTACLYGGTPKGPQIRALRAGVHVCIATPGRLIDLLEIRAANLLR
FT                   VTFLVLDEADRMLDMGFEVQIRKICQQIRKDRQTLMFSATWPQEIRNLAASFQRDFIRV
FT                   HVGSEDLIANADVTQHVSVVEDYDKQRRLEEILQKVGKQRVLIFVKTKRTADSLHHSLQ
FT                   RLIGGSVMAIHGDKEQSQRDYVLDRFRRDERSVLVATDVAARGLDIKNLDVVINFDMPT
FT                   NIEDYVHRIGRTGRAGQRGDAYTFVSGADPSKTVRDLIDILRRANQEIPPGLHSLAGRG
FT                   GGGSGGGGFRGGRRGGYGGGGGGYGYGRSGAQYGSGPTYGRDYRGAPSHHQSGISVGGN
FT                   TSDAYWRGGAPPPGQQPYYPVCGGNKRTREVSGGFHSDPQNSYRQQPTGGSY"
FT                   /protein_id="XP_846985.1"
FT   repeat_region   492181..492232
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   492431..492456
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <495041..>496219
FT                   /note="synonym: Tb08.29O9.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659137"
FT                   /locus_tag="Tb927.8.1520"
FT   mRNA            <495041..>496219
FT                   /db_xref="GI:72392370"
FT                   /db_xref="GeneID:3659137"
FT                   /locus_tag="Tb927.8.1520"
FT                   /transcript_id="XM_841893.1"
FT   CDS_pept        495041..496219
FT                   /locus_tag="Tb927.8.1520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392371"
FT                   /db_xref="GeneID:3659137"
FT                   /translation="MSLPAVDLKFLSNVSRRLQERALHVYVPGDSRSSVAIIFRFGDDR
FT                   QQHAVRRLLAGAKEVQQVFQRHLSAGIGMDLPSTLQVLLVRRLDLVKDRWSGSVTYPGG
FT                   RRDRGDADDYSALCARVNEMLGIPLTSSEFLLLGRLRDYPIRSRRLQLGGMVQSRFVFL
FT                   HIGELAPTLRFASHMVEAARWIPFSALEVNQRCARSTVSHPLRSFVHPSDAETRLLLTE
FT                   LFPHACLSFPAVQVPDQQWKVWGLALRSASELMALDDRSTADWPLVSSNNALLQHFVID
FT                   PLHGYYELLYTYHRVRGQWGRKGNELRNLSRCDVIPPTCHPILWAVSDEANPRHVFFLL
FT                   LCAAFVTMMAYAIATVVHGACTVVRLAFGCNEGDGFERTLGYCTASNNDGEV"
FT                   /protein_id="XP_846986.1"
FT   gene            <496662..>498110
FT                   /note="synonym: Tb08.29O9.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659139"
FT                   /locus_tag="Tb927.8.1530"
FT   mRNA            <496662..>498110
FT                   /db_xref="GI:72392372"
FT                   /db_xref="GeneID:3659139"
FT                   /locus_tag="Tb927.8.1530"
FT                   /transcript_id="XM_841894.1"
FT   CDS_pept        496662..498110
FT                   /locus_tag="Tb927.8.1530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392373"
FT                   /db_xref="GeneID:3659139"
FT                   /translation="MLLKLGAVLLLLVLYHVGSLFSRLVFVYTIQQGTTKFCFRFVFAL
FT                   STYAFILLLLDASQVSERIKSNFSIQTLRCVLAVDLVLIALFCPFLVVRSLLPNVRLYY
FT                   FFLVLLACGLVKMLFGASVAAWSWTLSSTQGIPTLFSWDVVSVAVSTTGVVVVGLLSGY
FT                   AAVTTPLAFVEPLFEHGSGDQARLAVGVLAKRQKHLLELWMLKRQQIARAYGAVSRADG
FT                   GRDGSNRGSIAAGRRMWNWVANSIYSSVRASGADIAAMETESDGIRAVSMAVFLQMSEM
FT                   DTLVRSAGSGETWRRRFNALFGLILFTHALVKFLSTVISLLRWGVLAAENAAPHREDTA
FT                   TKVMNFLEAYGLATPHGDGAEQRVVWVSIALNAWMIASAIRGFFLLVFRLTTHIAFISL
FT                   DTTVTILTAGMGAFFVGQLVLLRLTPSLERESVLYTALREQLPQHGAYCHLNDLVFVVA
FT                   AALVAMMRRCMFSSSATALCAAAD"
FT                   /protein_id="XP_846987.1"
FT   gene            <499315..>501987
FT                   /note="synonym: Tb08.29O9.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659138"
FT                   /locus_tag="Tb927.8.1540"
FT   mRNA            <499315..>501987
FT                   /db_xref="GI:72392374"
FT                   /db_xref="GeneID:3659138"
FT                   /locus_tag="Tb927.8.1540"
FT                   /transcript_id="XM_841895.1"
FT   CDS_pept        499315..501987
FT                   /locus_tag="Tb927.8.1540"
FT                   /gene_family="HOG000255358" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392375"
FT                   /db_xref="GeneID:3659138"
FT                   /translation="MSTPSVVGSEQQQDRNRVAYGMRREWKFSLTFAHQAARIILHLSP
FT                   YWESTFIDPRELEQLNRLDRDVKHCPMRPALRYNDLGTTPTRMEEVWTENLKKVTILYS
FT                   HIPPDTTLVGYCVRSVQHVLSDPQVVDVDGCTDFSRLQVGNKLRCRHKLGGRRSFHFRY
FT                   TTSSKTKTKSTVYVIGTIINQRGYLCTVESTGGEDLDSYVKKHFLPHYTDKDKFMIDQD
FT                   LVYSDVSSTILKEQQELFGELRYSDTDAAVAFTIPMHPMSIRPDYSPTQTVGVGSIACM
FT                   TLELNVYQRPVESDEIDIAGVINFKVNQALLFLDVEDMVRMGYPRIMSTEQYSNMKINR
FT                   LLDIFSDAKVVGTPGTSYLGVRTGRSRTLTFTYEPFNAVVKVMMTSAIVCGLGVTAVFI
FT                   TKLGGGIFDAHLYLYQQLLRGIKFMESDIPRGCLSRFNSTCVRLVEQNITRCYAAAPAD
FT                   GRHTMEQHLKLLRESCDTRVEGGISVNVPVKEGGLGKLPGEGQRCSSASDGNLRTATPT
FT                   EELASEQEKVSCHEGDATEDTPTSPVGSSTGGSHSSFHSTLSISVTGIRTKQEVVGGDG
FT                   TPTYGRSHPQRASILASATPDVTDLNVEPPASPTVTVLLPSPQPPTSAAAIPSPAQAVA
FT                   AASGSPRTSSEQVSGGADMSRQLSVAVPPSSSVESNVRVPSPARSPADGVEANVAGSPS
FT                   SVVFPQMPKDELEEDQDSKVQAVLKADDADAYFGLSMYDAYVHSCDMLKCKPNSYLLKK
FT                   FPTNPRFSNLIHEVDISSNYLGHGGFVAVLNILPNFPNVHTLHFNDMSLDNEDVEHLCE
FT                   VLKDNKSVREVHLRDNDKITLPSTRFFSRLLKVNPNIVTLSLEGTRLGPSVIGRLQEDV
FT                   KKNAEKKGDAEAASVSDSK"
FT                   /protein_id="XP_846988.1"
FT   repeat_region   502435..502465
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <503216..>505552
FT                   /note="synonym: Tb08.29O9.260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659141"
FT                   /locus_tag="Tb927.8.1550"
FT   mRNA            <503216..>505552
FT                   /db_xref="GI:72392376"
FT                   /db_xref="GeneID:3659141"
FT                   /locus_tag="Tb927.8.1550"
FT                   /transcript_id="XM_841896.1"
FT   CDS_pept        503216..505552
FT                   /locus_tag="Tb927.8.1550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392377"
FT                   /db_xref="GeneID:3659141"
FT                   /translation="MSATYPERRPYATTVPHSGYLSKPTLPPVEALRILSSTVGIDLPR
FT                   SVRHSANTLLRRSPTPRSVSPTRGVQLFKPPTLETATPFEFQEKDYHKSQQSVLNVQLS
FT                   NAVEELFKVWRVKVRDLMHYLDSFPCEAGHSFSRTNGALSSFFEGYRTTDITPMTAHQL
FT                   VNDFKLCTSVSMLDEIQNSPEVLGDQVRAALDALLNAKHFLAPLENFVDRLEPIAAFAL
FT                   PDKRPECLDGTRGPVWPSKVAVALHEKFHYDPSEYVLAELRKSDQPIERLENRVLQVKE
FT                   RKEDAIDREIPGDALNYLTTQVDLSNDLLLMNKARMELVYLHGKDIQEMKRMLEDLIVD
FT                   ARHSVELLKGRVERDMPLVKKDIDGVYQDVENTQKHIKDLDQKNAEANKAAHEAYSKLN
FT                   DTEVELWVLLTDTIRKLVDIAGEKEAFVRNEMRLRELRGRDMAIAEELLAAQQSYFSRL
FT                   RKSEDVLKRWENAAETYEAYVQAYVPTLLKKIHDAEEADKDLYNREAQNYVRRYEMFEY
FT                   AVEEGRATRSVHVDRLQTLQRSKLLDVERALSTLDPFADKYRKELDEAQAQLDEGLAFI
FT                   QLVENLAKERRGEVEPILQHVISYNRTLQTKTLEIEAEAEAQALLLRDGPATEGAPSTM
FT                   NTVDAKVDTSLLQSARGSSGKRPATAAVSEVTHFCDAPPTSAALRLRSVVDANNMMCTV
FT                   SHPHVMARTVGINHEEAFLEKYRRFTDEEQVAVEGVAGRVRQSNTSLEMLGEKYNNKDY
FT                   IRMLLLSPGAKQSNSATEAAVEECA"
FT                   /protein_id="XP_846989.1"
FT   repeat_region   506489..506541
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    506724..506808
FT                   /note="T-rich"
FT   repeat_region   506949..506981
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    507011..507067
FT                   /note="GA-rich"
FT   repeat_region   507470..507621
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   507486..507624
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatg"
FT                   /rpt_type="tandem"
FT   gene            <508257..>510107
FT                   /note="synonym: Tb08.29O9.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659143"
FT                   /locus_tag="Tb927.8.1560"
FT   mRNA            <508257..>510107
FT                   /db_xref="GI:72392378"
FT                   /db_xref="GeneID:3659143"
FT                   /locus_tag="Tb927.8.1560"
FT                   /transcript_id="XM_841897.1"
FT   CDS_pept        508257..510107
FT                   /locus_tag="Tb927.8.1560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392379"
FT                   /db_xref="GeneID:3659143"
FT                   /translation="MEFEQLEIGKKSITNAIARQEVTDYYDLLHPNVLLVSHFRYPPLS
FT                   PVIADTIPALDRVLRKENKNLSGVTKGHNPWKVPEFLQTGAVTKSAPVAAPAVTATSPT
FT                   TTSTTVTTRANSPHLAGTPTRASIVPKAPGGRPVARGFAARKRRGTSTNGRSTATGDRS
FT                   TSAATRERREDPNKKKQRQSTITGPYEADIVEGPLLVTARFYAILQWMNQGAHIADTVF
FT                   DMEARKVVLQESDVVLQLPAPKTEAEWYAQLGRQHTDRNQRLSRLTVTYGRDLLLFRDE
FT                   CYFEDGFIVTIHRFMLTQQEMLDLSSLVEYHQQAEINRRIEAMKVERDNFYAAEQRRVN
FT                   AFRRSVEPLLDFTFCDVSDPILLLSVEPVAGKRHICKDVRPKNVTALPPMGYGAQQNDA
FT                   QRGKDQRIVVKARNKAGDEEVYEFVDNSKPRYDFLYDPKTNAESTLQNLADKMKSMFCT
FT                   SSVRISSCGMRSTDQLVPVLRRLVANAIMTIRALDLSDNEISTLPDLSLLPLQRLLLHK
FT                   NKISDWMEVENRVCVLPLLEVVTLHGNPISESNEQYRQELLARLLRHPRRAARVRQVDF
FT                   VTLTAQDLNIAGTFEMFTTGNTSVLEKARKFNVSDVRKKI"
FT                   /protein_id="XP_846990.1"
FT   gene            <511166..>511984
FT                   /note="synonym: Tb08.29O9.280; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659142"
FT                   /locus_tag="Tb927.8.1570"
FT   mRNA            <511166..>511984
FT                   /db_xref="GI:72392380"
FT                   /db_xref="GeneID:3659142"
FT                   /locus_tag="Tb927.8.1570"
FT                   /transcript_id="XM_841898.1"
FT   CDS_pept        511166..511984
FT                   /locus_tag="Tb927.8.1570"
FT                   /gene_family="HOG000255355" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392381"
FT                   /db_xref="GeneID:3659142"
FT                   /translation="MPGQVSSASLPPVISSVQAYVKALLHCHKYPTQAVSGFLIGKRIS
FT                   ATSNTNASSPASNSSAAATPTTVLGANAIPNFTANAISATNADGNNVNSSGSSSDEAEC
FT                   IFVADAVPLFHTIIMTDPHPMMTVAYAQVSSYARTKGLVLLGYYIANERTGDTAVCSLT
FT                   ENVLRMLHSRKSGVHEPLLWRIVSTPSGDSVDVRGAYYNSGSSSFTDAPSLTFGRWNSD
FT                   TLSCETTEPKAAAVEAFENSMDALKQFQLVDFEDHLESVQLNYLDQTVSA"
FT                   /protein_id="XP_846991.1"
FT   misc_feature    512184..512225
FT                   /note="AT_rich"
FT   repeat_region   513927..513951
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <514037..>514870
FT                   /note="synonym: Tb08.29O9.290; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659145"
FT                   /locus_tag="Tb927.8.1580"
FT   mRNA            <514037..>514870
FT                   /db_xref="GI:72392382"
FT                   /db_xref="GeneID:3659145"
FT                   /locus_tag="Tb927.8.1580"
FT                   /transcript_id="XM_841899.1"
FT   CDS_pept        514037..514870
FT                   /locus_tag="Tb927.8.1580"
FT                   /gene_family="HOG000259281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392383"
FT                   /db_xref="GeneID:3659145"
FT                   /translation="MLRCATSFRCYMRVICLTMAPDGAMTSALRKLDYTPYTLRSAFSQ
FT                   GRANRHPTEWASALRGERDIDLCKLMADFDAAVGPPAAMLYAKLLRECPDYTKVILVKE
FT                   TDKQQWAREHERCVISLLKGHRHPPQNRIAKAFYTILSEMAPHPIEQPLGAISGNGDDD
FT                   TRISGRVDALERYEAEVCREVPSSRLLVYHHGDGWEPLCSFLGREVPGEPFPPYDGGMH
FT                   VIRNLHERVERTEKIAYVAVLLLGGTALYAFFPVLLDMKEYFEKLYRDYQIAYGQ"
FT                   /protein_id="XP_846992.1"
FT   repeat_region   515716..515751
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   515975..516005
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttcc"
FT                   /rpt_type="tandem"
FT   gene            <516817..>529731
FT                   /note="synonym: Tb08.29O9.320; ubiquitin-protein ligase,
FT                   putative"
FT                   /db_xref="GeneID:3659140"
FT                   /locus_tag="Tb927.8.1590"
FT   mRNA            <516817..>529731
FT                   /db_xref="GI:72392384"
FT                   /db_xref="GeneID:3659140"
FT                   /locus_tag="Tb927.8.1590"
FT                   /transcript_id="XM_841900.1"
FT   CDS_pept        516817..529731
FT                   /locus_tag="Tb927.8.1590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /EC_number="6.3.2.-"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: mitochondrion [goid 0005739]; go_function:
FT                   ubiquitin-protein ligase activity [goid 0004842];
FT                   go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72392385"
FT                   /db_xref="GeneID:3659140"
FT                   /translation="MLAVRGRAGSFRNQGGMTFQGNEYHVTQQLQLLPPVLQRYVGRLH
FT                   ECLVDCRLTPQVFHEILNDEEFFRDVRGSYNKRFGDIIKTVAGEWWSTCMKDILQRVSS
FT                   AADGVDNAPAASCSAVRAANEETTEGTSSLDQVLPGKCDDEASSIEVCRDLRAVLLLAV
FT                   VVCSPYCVIRGPDTPVITCTARVMLCRDPSIIYLGLLINLAQSNQAERSLDSAMVLRTL
FT                   AHGWGSSPTFEDVVKCCLRARRRRQRRLAAPNEEEQVNAISTEEDDAEEAADIALLQLP
FT                   GLVRDPLQIVPDRSAAQSSGGGGKCMSDSLHIGRCVLQSMASAAGNPERLLWWCRCRLL
FT                   CMQLLSPADCEELLAGPSCDFFRSLWKVERMFGDILDLAEHDDDGEESDACYGGISSTS
FT                   GVGSAPTVAALVGIVADIVRGWHRAENSGGAMGSIVLNYTSRNPFETVNRVVPGHRKFQ
FT                   QRSHRCLARDWQYGLLVQYHSTHLAVFPHPNSSYATMLPVMVAQLTDVLRHYPHYSPIQ
FT                   LMYSLALTRENTNTSVALNSGLVPAIVTVMRTYMDEKQEYGENASADNGTEGIRYGWSY
FT                   KAAGVLHWCFTVLEQLATLSTHESVNPIVFLLSPAEEDGYELCHHICKKIFYPGGHPVL
FT                   LVAAFRFFSACIHHNVRDVVPALQQRGVLDTLLKIGESTDILERYNCPRGEANSEEGVA
FT                   VQQAGEGQPPLATSVKGNKVAPITLAEYSAYYEQAVPIVCICSMLQAFAVHNSTHASLV
FT                   NRMIMRRFVWSLTVPYFPEVSSPLSVPSSPSTLAVLCVERVEPQRVFTRLAAAAGVDLL
FT                   VLIRTLPPLQDYFFESVEETLKSLIEEAKQKGPPLRDVGLSMWNILACFSDLEYKQLAQ
FT                   RGSGRRGRSQRADQASEAADALLDKFKNCGKVVAGSLGTLLKLSSTVPFASPVSLLSNG
FT                   NVLTSNLFDVQCMMFESLTREVIQFASDIVKDALQGGNNGVLTEEQAGALWSLFFLFFR
FT                   KTSHGSSSANGTNHFRRDLANVIFDAFIALEMATGTQRTQEESAGSAVPALTPVAASPT
FT                   VGDQVIGLMDAHSMWSSDFELSALANNLLSSALSMALPPSDRSPANTPLNFFAAVVDGA
FT                   NAGNDAFGVRHVDTTSADAERGNTETGPNAVSGSSSAVERFRNDVSRLLTSSQTRHRHS
FT                   LPTFHTHYHGSGVPLNPHTSGSGHIMLVAPSYILGGVRELLQKVAKSVTAAARVRKEEE
FT                   DIKEEGDTSEAGCPPQKMQWEQMHHFAALEAVDLAPLREAEMRLQAAEAALSVGWKYIS
FT                   GNSGLVAFLHNIIGNLWRITECLLPVQNSQLLTGPLSSTSSALVNNPCNFCGVGGVAER
FT                   GSAVATSDTTANSGATAGPPLDAEKLKTVVGYLTGILEALLKLPPDRGLQRFPWQPRLL
FT                   YFALITWRSRGLELSPAMILGALAHLVDLGSEVFKRGATVISPSISACESEVDVEAVGD
FT                   DRSPLTLGSPPRPDSHHPNRSEEDSMVRIRVAGDFADLFGEVLPSVSLRSERLVQLSLR
FT                   NRTSRSDTPVAPRTPEVSATGFPRDTEEWRGFGPVSLAEYAPCWVLEVAATMHANDKSV
FT                   GKMWVLIRRLCSKLCWIYHTYSSPVSANSGAGDDDQPKKGILLIERIIRLVLEDPVRNY
FT                   TLLEFLAVVLSQDETTAQREALVTRTQLPYAILDCIVKEVRRIENEQNEDASKRKEKWS
FT                   LRNSMLGQLFCFLSSCSVGALTEKGTGACPHYRGNSTSFCWMGHLCPHPHVGDKSGSHM
FT                   RRGSARSSKVTRQIAKVLEEFGYKGDVSPQAPPSELETVTSDAVTGATSRRATGRNMRG
FT                   TEAPGQNPAENARNDGDETATHQDDAVSGVSSVTKKCVDVKLKLSSVVGGTSSLPKSML
FT                   SECAVLVLDYLADDDETNEAEKWESLNTEDTRSDTLCTPRHVARRAAKVSGETNVLETP
FT                   IICIAVALLAQLLDAGDTTLLSHIYKLNETSKKGFVMRAVSRLLREDMIPTSVCVHVLK
FT                   ALVDQSDHTEWVVYSAMVSAVQNCIRAGVTVLLKETDVRDMYASSVLGAGRKAIAPRVG
FT                   GDVYRHSVPMDEFVTCLRTVVDKHPKAFCTVFNSACIVHIVSAEGNPKGDTRSAVLLAP
FT                   RKPPRIHAMGSAPSPQRTTVEYVLDTLLRRLAQKQLPPSFVAAVLNNITTLPAVASIVT
FT                   TYCVNVPVPESMRGAFLDQKAEEDEPTLNQKQEFGDSFLLHEATPRPLTPFLAVLLFMD
FT                   ERQLECLEPFLSNVAQKAPSRMAHILLQALDVTLTALSSENSGGNCLVTRNEEMELVHR
FT                   ASSRPSPRTMACSLLHALRLLLVVTSSSLVWRLCEELWQRGALDLLYRMVEQKCYSTEK
FT                   DAATLILVIRRLLLAHSKCAGRSNGKVSPAAGHGVTAGSSVSRGTMTGLQGAELSDAHL
FT                   GLMRHRQRRQQQQSGAEEDEEDSQTPPPDTGREEGRTLGEAGMSPLPTGMQQPHRQQFL
FT                   QSGSVDDSFYLNALVNGNDSRREASDSNNRRRRSLEEGTFSGFLLGLGELLRPTQDIVS
FT                   FESRNISDSTHDEDESDVTGDGDIGGVSPGQQAIHLVVGRIGGGFTPRGSGDGDDNSGH
FT                   NEGGEGNIARGARSESGFDMSGVDDDDMGGNDDGGPHSDGGDDDDVEGADFDLNDTDDD
FT                   DDDDDDDDDDDDDDDDDDDDDDDDDEELLNFDSEYYDDEMERGSVSFSLHNRYPPGGLL
FT                   GGTGPQIPFDSFTVGNEPRMDGRPASIEAWDFSSVRRDQRIRLEDLHPHGEGWSLPSAV
FT                   PDPADFWSVFAHGRLEGADHMFHTLYGSSRHSSTSRLVNICSIVNMEVREQWESAQALH
FT                   PVRQVLRETSEAPPDPEVTPPAPEAAGEPRNGDETAAWNAGGDDITLIGGNGDTQPLLY
FT                   EPGHGEGQLQQQVNDRTGTDIATMAEANVAHVPGETATQGFSNSESSGATRILASPGSA
FT                   TDDVGAGLALLDFGGQSVAPQADPAETHIASDAGVTSSVVASAGSALTAPPTAIAEPPM
FT                   EEQPWFNVIRPHFLLELPETLRRELLFDHMNVLLGSETRELEGHQTRIFAAFFTQLPAD
FT                   VQREAAEVEQRWRQVTGDVPSSAGNETPSRSVLLDLLATVDTELRQEILATCDLGDLEE
FT                   YPELLREANRARQSRAVEAVSEGDASVPRQLRRREGALTVIRGRRPADAEGANAAVSVF
FT                   GTDALSTLTLPRIPPVLRRIRGLGPVAYHQHRDNSLSWFTSNMSGNHHPRNLGRRQNSR
FT                   IRDESSDDDNVNRRGYSSRGFAFITEAHLVSCIRAQQSRVVRDERVTPPPNRQNGAAGV
FT                   ENAVPAIPSAILKQLVELIWLSKASYSPLDRPTSSSTDLYVGSQLVQLLVTACRKPETA
FT                   AEAMLFLVDTVLERIPSTSYSLSHESVGSESSQTGPHGVTDSGRNALPTASLVTSTSGV
FT                   GRAVGASVDVIRDCGRVALRTLLVIGQLIERCRAAGLSVTTLPDSVYMKVTQSSAESPI
FT                   TAQEETTGSRLFKKLVELVLRVPLPRVEAAFTRVLCRLNQQLQRLEEIAPVSRRAPRDV
FT                   DLESQGDNVIFHLRHPHPLRWQNLHRYPYVDSGYICNRCNTTFHTETVAFHCEMCRFDI
FT                   CPACSFVSLTVEEERVRGRHWGYSLVSSKGTMEAALQLLRHPNCTDDMAQEVMEFFRRG
FT                   IKESAHRDKGVAAANTSAAIAMVERVIIDLANSITVEIHECVNALRAAFPHKVFQSFFL
FT                   SATSNEDGNSGGTESQQWTAQEASVALSYMCLNSTSNKLLALFHPYAESHRPEPREVSL
FT                   MWHAVQMYLAEVAFILQHIQNRSSVLLPQAVLLLLSTFCQFHMAEPRRDSSASTASESV
FT                   SSLSLEKTDTERFMLDSTHASSTVSDAADAAAKLANSEQRQHRDPPPHEGPDVGSTDSD
FT                   GSGDERPMMPRVVRQFVERNKLTINALIQYDPKVLEGGFKFLRSEPGFVDFNIRLNDFH
FT                   RQISYASQGPRISLSINRGQCLRDSFAQLSKLNNFHGSISVRFSGEEGADAGGLTREWF
FT                   QLIAEEMVNDNYALFIHSREGMTYQPNPLSGVNPLHLQYFRFAGIVVGMAVAHRVAIDV
FT                   HFTRAVYRHMIGIQPTFGDLKSVDPELYENLKWLLVNDVSDLGLFFTVSCEKFGVTEEV
FT                   ELIPNGSQVAVTNANKSQYVRLRCEFCMTRQIEEQLQEFLKGFYAVIPRKEIRNFSAQE
FT                   LELVICGMPDIDVEDLRLNTTYDGYTSTSLQIRWFWEVVAAMSKEDRANLLQFATGASR
FT                   VPHGGFSNLESSNGSPQRFTVSRWADSAELLPQAHTCFNKIALPEYSSCEELRKKLMVA
FT                   ITLGSRGFTMT"
FT                   /protein_id="XP_846993.1"
FT   repeat_region   524625..524707
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atggtg"
FT                   /rpt_type="tandem"
FT   repeat_region   524731..524816
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atg"
FT                   /rpt_type="tandem"
FT   repeat_region   530536..530574
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <531411..>533165
FT                   /note="synonym: Tb08.29O9.340; lysyl-tRNA synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3659146"
FT                   /locus_tag="Tb927.8.1600"
FT   mRNA            <531411..>533165
FT                   /db_xref="GI:72392386"
FT                   /db_xref="GeneID:3659146"
FT                   /locus_tag="Tb927.8.1600"
FT                   /transcript_id="XM_841901.1"
FT   CDS_pept        531411..533165
FT                   /locus_tag="Tb927.8.1600"
FT                   /gene_family="HOG000236577" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.6"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ATP binding [goid 0005524]; go_process: tRNA aminoacylation
FT                   for protein translation [goid 0006418]"
FT                   /db_xref="GI:72392387"
FT                   /db_xref="GeneID:3659146"
FT                   /translation="MSAVEELRAQIDALASQISAVKKEQGASSEACKSLVAKMTELRKQ
FT                   LPQEKKEKKAEKAPEISYYDTRLAMVKEMGPLGAAYPHKFHRDYTLPAFRECFKPMLQE
FT                   KGQRLDKVVTIAGRIVVKRSSSSKLHFLALQGDGEVLQVISMASDYVNDGFADIHSKIK
FT                   RGDIIGVRGVPSFSNTGEFSMSAYEITLLSTCFHMLPDEHYGLSSVEQRFRQRYLDLIV
FT                   NRENAKTFILRSKIISYIRSFFDQKDFLEVETPMLNQIAGGAAARPFITHHNELNQTMY
FT                   LRIAPELYLKKLVVGGLDRVYEIGKQFRNEGIDLTHNPEFTSVESYWAYADYNDWMETT
FT                   EELLYGMVMHLYGSPIVKYSPRDSEGRQLPEVTFNFNRPFKRLHIVPKLEEILGLKFPA
FT                   DFYSSEANSFFLDICKKNQVECNPPFTTTRLLDALVSHYLEPQCHDPTFLCDHPRIMSP
FT                   LAKWHRKDLRLSERFELFINKKEICNSYTELNSPLVQREEFERQLRDREKGDDEAMDID
FT                   EGYVQALEYALPPTGGWGLGIDRLVMYLTSQNNIKEVLLFPAMKPEGTSSATFPPGTML
FT                   NGQGVPLL"
FT                   /protein_id="XP_846994.1"
FT   gene            533529..533606
FT                   /db_xref="GeneID:4443207"
FT                   /locus_tag="Tb927.8.1601"
FT   snoRNA          533529..533606
FT                   /db_xref="GeneID:4443207"
FT                   /locus_tag="Tb927.8.1601"
FT                   /product="C/D snoRNA, TB8C1C4"
FT   gene            533634..533716
FT                   /db_xref="GeneID:4443208"
FT                   /locus_tag="Tb927.8.1602"
FT   snoRNA          533634..533716
FT                   /db_xref="GeneID:4443208"
FT                   /locus_tag="Tb927.8.1602"
FT                   /product="C/D snoRNA, TB8C1C1"
FT   gene            533809..533882
FT                   /db_xref="GeneID:4443209"
FT                   /locus_tag="Tb927.8.1603"
FT   snoRNA          533809..533882
FT                   /db_xref="GeneID:4443209"
FT                   /locus_tag="Tb927.8.1603"
FT                   /product="C/D snoRNA, TB8C1C2"
FT   gene            533918..534035
FT                   /db_xref="GeneID:4443210"
FT                   /locus_tag="Tb927.8.1604"
FT   snoRNA          533918..534035
FT                   /db_xref="GeneID:4443210"
FT                   /locus_tag="Tb927.8.1604"
FT                   /product="C/D snoRNA, TB8C1C3"
FT   gene            534178..534255
FT                   /db_xref="GeneID:4443211"
FT                   /locus_tag="Tb927.8.1605"
FT   snoRNA          534178..534255
FT                   /db_xref="GeneID:4443211"
FT                   /locus_tag="Tb927.8.1605"
FT                   /product="C/D snoRNA, TB8C1C4"
FT   gene            534283..534365
FT                   /db_xref="GeneID:4443212"
FT                   /locus_tag="Tb927.8.1606"
FT   snoRNA          534283..534365
FT                   /db_xref="GeneID:4443212"
FT                   /locus_tag="Tb927.8.1606"
FT                   /product="C/D snoRNA, TB8C1C1"
FT   gene            534458..534531
FT                   /db_xref="GeneID:4443213"
FT                   /locus_tag="Tb927.8.1607"
FT   snoRNA          534458..534531
FT                   /db_xref="GeneID:4443213"
FT                   /locus_tag="Tb927.8.1607"
FT                   /product="C/D snoRNA, TB8C1C2"
FT   gene            534567..534684
FT                   /db_xref="GeneID:4443214"
FT                   /locus_tag="Tb927.8.1608"
FT   snoRNA          534567..534684
FT                   /db_xref="GeneID:4443214"
FT                   /locus_tag="Tb927.8.1608"
FT                   /product="C/D snoRNA, TB8C1C3"
FT   gene            534827..534904
FT                   /db_xref="GeneID:4443215"
FT                   /locus_tag="Tb927.8.1609"
FT   snoRNA          534827..534904
FT                   /db_xref="GeneID:4443215"
FT                   /locus_tag="Tb927.8.1609"
FT                   /product="C/D snoRNA, TB8C1C4"
FT   gene            534932..535014
FT                   /db_xref="GeneID:4443216"
FT                   /locus_tag="Tb927.8.1611"
FT   snoRNA          534932..535014
FT                   /db_xref="GeneID:4443216"
FT                   /locus_tag="Tb927.8.1611"
FT                   /product="C/D snoRNA, TB8C1C1"
FT   gene            535107..535180
FT                   /db_xref="GeneID:4443217"
FT                   /locus_tag="Tb927.8.1612"
FT   snoRNA          535107..535180
FT                   /db_xref="GeneID:4443217"
FT                   /locus_tag="Tb927.8.1612"
FT                   /product="C/D snoRNA, TB8C1C2"
FT   gene            535216..535333
FT                   /db_xref="GeneID:4443218"
FT                   /locus_tag="Tb927.8.1613"
FT   snoRNA          535216..535333
FT                   /db_xref="GeneID:4443218"
FT                   /locus_tag="Tb927.8.1613"
FT                   /product="C/D snoRNA, TB8C1C3"
FT   gene            535476..535553
FT                   /db_xref="GeneID:4443219"
FT                   /locus_tag="Tb927.8.1614"
FT   snoRNA          535476..535553
FT                   /db_xref="GeneID:4443219"
FT                   /locus_tag="Tb927.8.1614"
FT                   /product="C/D snoRNA, TB8C1C4"
FT   gene            535581..535663
FT                   /db_xref="GeneID:4443220"
FT                   /locus_tag="Tb927.8.1615"
FT   snoRNA          535581..535663
FT                   /db_xref="GeneID:4443220"
FT                   /locus_tag="Tb927.8.1615"
FT                   /product="C/D snoRNA, TB8C1C1"
FT   gene            535756..535829
FT                   /db_xref="GeneID:4443221"
FT                   /locus_tag="Tb927.8.1616"
FT   snoRNA          535756..535829
FT                   /db_xref="GeneID:4443221"
FT                   /locus_tag="Tb927.8.1616"
FT                   /product="C/D snoRNA, TB8C1C2"
FT   gene            535865..535982
FT                   /db_xref="GeneID:4443222"
FT                   /locus_tag="Tb927.8.1617"
FT   snoRNA          535865..535982
FT                   /db_xref="GeneID:4443222"
FT                   /locus_tag="Tb927.8.1617"
FT                   /product="C/D snoRNA, TB8C1C3"
FT   gene            536125..536202
FT                   /db_xref="GeneID:4443223"
FT                   /locus_tag="Tb927.8.1618"
FT   snoRNA          536125..536202
FT                   /db_xref="GeneID:4443223"
FT                   /locus_tag="Tb927.8.1618"
FT                   /product="C/D snoRNA, TB8C1C4"
FT   gene            536230..536312
FT                   /db_xref="GeneID:4443224"
FT                   /locus_tag="Tb927.8.1619"
FT   snoRNA          536230..536312
FT                   /db_xref="GeneID:4443224"
FT                   /locus_tag="Tb927.8.1619"
FT                   /product="C/D snoRNA, TB8C1C1"
FT   gene            536405..536478
FT                   /db_xref="GeneID:4443225"
FT                   /locus_tag="Tb927.8.1621"
FT   snoRNA          536405..536478
FT                   /db_xref="GeneID:4443225"
FT                   /locus_tag="Tb927.8.1621"
FT                   /product="C/D snoRNA, TB8C1C2"
FT   gene            536514..536631
FT                   /db_xref="GeneID:4443226"
FT                   /locus_tag="Tb927.8.1622"
FT   snoRNA          536514..536631
FT                   /db_xref="GeneID:4443226"
FT                   /locus_tag="Tb927.8.1622"
FT                   /product="C/D snoRNA, TB8C1C3"
FT   gene            536774..536851
FT                   /db_xref="GeneID:4443227"
FT                   /locus_tag="Tb927.8.1623"
FT   snoRNA          536774..536851
FT                   /db_xref="GeneID:4443227"
FT                   /locus_tag="Tb927.8.1623"
FT                   /product="C/D snoRNA, TB8C1C4"
FT   gene            536879..536961
FT                   /db_xref="GeneID:4443228"
FT                   /locus_tag="Tb927.8.1624"
FT   snoRNA          536879..536961
FT                   /db_xref="GeneID:4443228"
FT                   /locus_tag="Tb927.8.1624"
FT                   /product="C/D snoRNA, TB8C1C1"
FT   gene            <537061..>538806
FT                   /note="synonym: Tb08.29O9.350; major surface protease gp63,
FT                   putative"
FT                   /db_xref="GeneID:3659147"
FT                   /locus_tag="Tb927.8.1610"
FT   mRNA            <537061..>538806
FT                   /db_xref="GI:72392388"
FT                   /db_xref="GeneID:3659147"
FT                   /locus_tag="Tb927.8.1610"
FT                   /transcript_id="XM_841902.1"
FT   CDS_pept        537061..538806
FT                   /locus_tag="Tb927.8.1610"
FT                   /gene_family="HOG000255742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major surface protease gp63, putative"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   metalloendopeptidase activity [goid 0004222]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]; go_process:
FT                   cell adhesion [goid 0007155]"
FT                   /db_xref="GI:72392389"
FT                   /db_xref="GeneID:3659147"
FT                   /translation="MFNTITDVTLLFSLFPLFLPCVKRKRLMMLPACVIPMHGALKLAI
FT                   LLMLVWCCSLCLAKSGGRCMFDEIAAKAGRPRVLALRRTKAGMENVKYDRTGSVDPEWQ
FT                   HIRIVVFAEDMKDRSRYCTSAGQERPTFFGETATCSQEDILTAAKRDIAVTKLLPSAVQ
FT                   MHMDRLLVDPITEPLVFPPFDGSVCSEFKVPSSHFSEGVPDADMVMYAAAGPTPEGVAA
FT                   WATGCITLDDGRAVAGVTNLGPGSISLSETSIRTAAHEIAHALGFDFEAMNDAGMVQRI
FT                   PGVRGKVDVTLISSPRTLQKAREHYNCPDAPGMELEDEGGSGTALSHWERRNAKDEIMS
FT                   GISSPGRYTALTMAAFEDLGYYRGAWGSEEPMGWGNNSGCELLNESCLVNGVTAHPDMF
FT                   CNETVSKLVCNSERDGLGRCNVIKHENPLPPQYHYFSDPSRGAPSHLLMDYCPSIDAFS
FT                   NTPCADGETKFMRGSLIGPSSMCLKAEGLRDSQGVIGDVCADVRCDGGEVSIRYLGDDA
FT                   WHPCPEGSHIKPTTTFTDGVIVCPTYSEVCIKATVVVRPSSASYRSSVPQSLLLTLFAI
FT                   VYAAC"
FT                   /protein_id="XP_846995.1"
FT   gene            <539236..>540999
FT                   /note="synonym: Tb08.29O9.360; major surface protease gp63,
FT                   putative"
FT                   /db_xref="GeneID:3659144"
FT                   /locus_tag="Tb927.8.1620"
FT   mRNA            <539236..>540999
FT                   /db_xref="GI:72392390"
FT                   /db_xref="GeneID:3659144"
FT                   /locus_tag="Tb927.8.1620"
FT                   /transcript_id="XM_841903.1"
FT   CDS_pept        539236..540999
FT                   /locus_tag="Tb927.8.1620"
FT                   /gene_family="HOG000255742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major surface protease gp63, putative"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   metalloendopeptidase activity [goid 0004222]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]; go_process:
FT                   cell adhesion [goid 0007155]"
FT                   /db_xref="GI:72392391"
FT                   /db_xref="GeneID:3659144"
FT                   /translation="MLTTHFRCCISPRVSGAYSLFPLFLPCIKRKRLMMLPACVIPMHG
FT                   ALKLAILLMLVWCCSLCLAKSGGRCMFDEIAAKAGRPRVLALRRTKAGMENVKYDRTGS
FT                   VDPEWQHIRIVVFAEDMKDRSRYCTSAGQERPTFFGETATCSQEDILTAAKRDIAVTKL
FT                   LPSAVQMHMDRLLVDPITEPLVFPPFDGSVCSEFKVPSSHFSEGVPDADMVMYAAAGPT
FT                   PEGVAAWATGCITLDDGRAVAGVTNLGPGSISLSETSIRTAAHEIAHALGFDFEAMNDA
FT                   GMVQRIPGVRGKVDVTLISSPRTLQKAREHYNCPDAPGMELEDEGGSGTALSHWERRNA
FT                   KDEIMSGISSPGRYTALTMAAFEDLGYYRGAWGSEEPMGWGNNSGCELLNESCLVNGVT
FT                   AHPDMFCNETVSKLVCNSERDGLGRCNVIKHENPLPPQYHYFSDPSRGAPSHLLMDYCP
FT                   SIDAFSNTPCADGETKFMRGSLIGPSSMCLKAEGLRDSQGVIGDVCADVRCDGGEVSIR
FT                   YLGDDAWHPCPEGSHIKPTTTFTDGVIVCPTYSEVCIKATVVVRPSSASYRSSVPQSLL
FT                   LTLFAIVYAAC"
FT                   /protein_id="XP_846996.1"
FT   gene            <541429..>543192
FT                   /note="synonym: Tb08.29O9.370; major surface protease gp63,
FT                   putative"
FT                   /db_xref="GeneID:3659150"
FT                   /locus_tag="Tb927.8.1630"
FT   mRNA            <541429..>543192
FT                   /db_xref="GI:72392392"
FT                   /db_xref="GeneID:3659150"
FT                   /locus_tag="Tb927.8.1630"
FT                   /transcript_id="XM_841904.1"
FT   CDS_pept        541429..543192
FT                   /locus_tag="Tb927.8.1630"
FT                   /gene_family="HOG000255742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major surface protease gp63, putative"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   metalloendopeptidase activity [goid 0004222]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]; go_process:
FT                   cell adhesion [goid 0007155]"
FT                   /db_xref="GI:72392393"
FT                   /db_xref="GeneID:3659150"
FT                   /translation="MLTTHFRCCISPRVSGAYSLFPLFLPCIKRKRLMMLPACVIPMHG
FT                   ALKLAILLMLVWCCSLCLAKSGGRCMFDEIAAKAGRPRVLALRRTKAGMENVKYDRTGS
FT                   VDPEWQHIRIVVFAEDMKDRSRYCTSAGQERPTFFGETATCSQEDILTAAKRDIAVTKL
FT                   LPSAVQMHMDRLLVDPITEPLVFPPFDGSVCSEFKVPSSHFSEGVPDADMVMYAAAGPT
FT                   PEGVAAWATGCITLDDGRAVAGVTNLGPGSISLSETSIRTAAHEIAHALGFDFEAMNDA
FT                   GMVQRIPGVRGKVDVTLISSPRTLQKAREHYNCPDAPGMELEDEGGSGTALSHWERRNA
FT                   KDEIMSGISSPGRYTALTMAAFEDLGYYRGAWGSEEPMGWGNNSGCELLNESCLVNGVT
FT                   AHPDMFCNETVSKLVCNSERDGLGRCNVIKHENPLPPQYHYFSDPSRGAPSHLLMDYCP
FT                   SIDAFSNTPCADGETKFMRGSLIGPSSMCLKAEGLRDSQGVIGDVCADVRCDGGEVSIR
FT                   YLGDDAWHPCPEGSHIKPTTTFTDGVIVCPTYSEVCIKATVVVRPSSASYRSSVPQSLL
FT                   LTLFAIVYAAC"
FT                   /protein_id="XP_846997.1"
FT   gene            <543622..>545385
FT                   /note="synonym: Tb08.29O9.380; major surface protease gp63,
FT                   putative"
FT                   /db_xref="GeneID:3659154"
FT                   /locus_tag="Tb927.8.1640"
FT   mRNA            <543622..>545385
FT                   /db_xref="GI:72392394"
FT                   /db_xref="GeneID:3659154"
FT                   /locus_tag="Tb927.8.1640"
FT                   /transcript_id="XM_841905.1"
FT   CDS_pept        543622..545385
FT                   /locus_tag="Tb927.8.1640"
FT                   /gene_family="HOG000255742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major surface protease gp63, putative"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   metalloendopeptidase activity [goid 0004222]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]; go_process:
FT                   cell adhesion [goid 0007155]"
FT                   /db_xref="GI:72392395"
FT                   /db_xref="GeneID:3659154"
FT                   /translation="MLTTHFRCCISPRVSGAYSLFPLFLPCIKRKRLMMLPACVIPMHG
FT                   ALKLAILLMLVWCCSLCLAKSGDRCMFDEIAAKAGRPRVLALRRTKAGMENVKYDRTGS
FT                   VDPEWQHIRIVVFAEDMKDRSRYCTSAGQERPTFFGETATCSQEDILTAAKRDIAVTKL
FT                   LPSAVQMHMDRLLVDPITEPLVFPPFDGSVCSEFKVPSSHFSEGVPDADMVMYAAAGPT
FT                   PEGVAAWATGCITLDDGRAVAGVTNLGPGSISLSETSIRTAAHEIAHILGFNFRAMNDA
FT                   GMVQRIPGVRGKVDVTLISSPRTLQKAREHYNCPDAPGMELEDEGGSGTALSHWERRNA
FT                   KDEIMSGISSPGRYTALTMAAFEDLGYYRGAWGSEEPMGWGNNSGCELLNESCLVNGVT
FT                   AHPDMFCNETVSKLVCNSERDGLGRCNVIKHENPLPPQYHYFSDPSRGAPSHLLMDYCP
FT                   SIDAFSNTPCADGETKFMRGSLIGPSSMCLKAEGLRDSQGVIGDVCADVRCDGGEVSIR
FT                   YLGDDAWHPCPEGSHIKPTTTFTDGVIVCPTYSEVCIKATVVVRPSSASYRSSVPQSLL
FT                   LTLFAIVYAAC"
FT                   /protein_id="XP_846998.1"
FT   gene            <546659..>548434
FT                   /note="synonym: Tb08.29O9.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659149"
FT                   /locus_tag="Tb927.8.1650"
FT   mRNA            <546659..>548434
FT                   /db_xref="GI:72392396"
FT                   /db_xref="GeneID:3659149"
FT                   /locus_tag="Tb927.8.1650"
FT                   /transcript_id="XM_841906.1"
FT   CDS_pept        546659..548434
FT                   /locus_tag="Tb927.8.1650"
FT                   /gene_family="HOG000254987" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392397"
FT                   /db_xref="GeneID:3659149"
FT                   /translation="MNCAADHVVERLPTARQQPAGEPHRFGLLAVAAFSCICVSLTYGF
FT                   NLISGAMQERYGLTQRDLSTISTVGIAVGYFGLPYSFIYDHFGPKPIYFLGLLCYLLGT
FT                   VMFALTFQGVIEGTVLRLSIYNASVTLGCSMFDMGALVTLLSVFPSNRGAVVAMLKTLN
FT                   GLGAAIVGSVRLAFFSENTSAYFYFLMTLVIVIGTLATAYVRLPSYHLTGYEENHLSEE
FT                   EKVKRLMRKAVYLRQKAPTWRFVHGFVILIALIVFLPTQGALLAYLKLGSDYKVGFAVV
FT                   TIILTLLLPLMAIPTTKFDGNNQRIGIDDKSPTEGAVGSNDGDSSGSNVVETNVDYIAP
FT                   QFQESFLAGLRTLRLWCLMFTIFFCAGSLFVVMFNARYIYTAMVGEAPDEALNTLLTVL
FT                   GGAGSATGRLGMSFFEVWSQKRKPEQRVPITVVLFIPTTFVIIMLTMFLTVPKSVLPLS
FT                   YFIGALANGCNSATIILVSRTIFAKDPAKHYYFCYIGSLLSAIFLNRLLYGEWYTHEAE
FT                   KRGEVVCTDKVCVMMPMMLLLVLSLLAFVSSSYVHVQYRRLCTKALEERRRIREEEAAA
FT                   RRQLSGATATAELPN"
FT                   /protein_id="XP_846999.1"
FT   misc_feature    548538..548562
FT                   /note="AT_rich"
FT   gene            549674..549769
FT                   /db_xref="GeneID:4443229"
FT                   /locus_tag="Tb927.8.1651"
FT   snoRNA          549674..549769
FT                   /db_xref="GeneID:4443229"
FT                   /locus_tag="Tb927.8.1651"
FT                   /product="C/D snoRNA, TB8C2C0"
FT   gene            549815..549881
FT                   /db_xref="GeneID:4443230"
FT                   /locus_tag="Tb927.8.1652"
FT   snoRNA          549815..549881
FT                   /db_xref="GeneID:4443230"
FT                   /locus_tag="Tb927.8.1652"
FT                   /product="H/ACA snoRNA, TB8Cs2H1"
FT   gene            549933..550026
FT                   /db_xref="GeneID:4443231"
FT                   /locus_tag="Tb927.8.1653"
FT   snoRNA          549933..550026
FT                   /db_xref="GeneID:4443231"
FT                   /locus_tag="Tb927.8.1653"
FT                   /product="C/D snoRNA, TB8C2C1"
FT   gene            550193..550259
FT                   /db_xref="GeneID:4443232"
FT                   /locus_tag="Tb927.8.1654"
FT   snoRNA          550193..550259
FT                   /db_xref="GeneID:4443232"
FT                   /locus_tag="Tb927.8.1654"
FT                   /product="H/ACA snoRNA, TB8Cs2H1"
FT   gene            550311..550404
FT                   /db_xref="GeneID:4443233"
FT                   /locus_tag="Tb927.8.1655"
FT   snoRNA          550311..550404
FT                   /db_xref="GeneID:4443233"
FT                   /locus_tag="Tb927.8.1655"
FT                   /product="C/D snoRNA, TB8C2C1"
FT   gene            550571..550637
FT                   /db_xref="GeneID:4443234"
FT                   /locus_tag="Tb927.8.1656"
FT   snoRNA          550571..550637
FT                   /db_xref="GeneID:4443234"
FT                   /locus_tag="Tb927.8.1656"
FT                   /product="H/ACA snoRNA, TB8Cs2H1"
FT   gene            550689..550782
FT                   /db_xref="GeneID:4443235"
FT                   /locus_tag="Tb927.8.1657"
FT   snoRNA          550689..550782
FT                   /db_xref="GeneID:4443235"
FT                   /locus_tag="Tb927.8.1657"
FT                   /product="C/D snoRNA, TB8C2C1"
FT   gene            550949..551015
FT                   /db_xref="GeneID:4443236"
FT                   /locus_tag="Tb927.8.1658"
FT   snoRNA          550949..551015
FT                   /db_xref="GeneID:4443236"
FT                   /locus_tag="Tb927.8.1658"
FT                   /product="H/ACA snoRNA, TB8Cs2H1"
FT   repeat_region   551026..551273
FT                   /transposon="RIME-A"
FT   repeat_region   551274..551512
FT                   /transposon="RIME-B"
FT   misc_feature    551509..551531
FT                   /note="AT_rich"
FT   gene            552517..552753
FT                   /note="synonym: Tb08.29O9.400; procyclin-associated gene
FT                   (pseudogene), putative"
FT                   /db_xref="GeneID:3659152"
FT                   /locus_tag="Tb927.8.1660"
FT                   /pseudo
FT   repeat_region   557636..557675
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   gene            complement(<558245..>560023)
FT                   /note="synonym: Tb08.29O9.440; serine/threonine-protein
FT                   kinase, putative"
FT                   /db_xref="GeneID:3659153"
FT                   /locus_tag="Tb927.8.1670"
FT   mRNA            complement(<558245..>560023)
FT                   /db_xref="GI:72392398"
FT                   /db_xref="GeneID:3659153"
FT                   /locus_tag="Tb927.8.1670"
FT                   /transcript_id="XM_841907.1"
FT   CDS_pept        complement(558245..560023)
FT                   /locus_tag="Tb927.8.1670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72392399"
FT                   /db_xref="GeneID:3659153"
FT                   /translation="MGMDHYTVIRQLGGTSGAYLAVDKQNETKRVVIKRLADGTQGMQE
FT                   VNVSMRARHPNIIPYLESFVHDGGLYVVLQYAEGGDLESHLERLARRKKALPHLALLRG
FT                   FQQLISALKCCHGLSIMHRDVKPGNVFVNADASELYLGDFGSSKAMSGSASLTTTFVGS
FT                   PIWLSPELLLGMPYSYPSDVWSLGCVFYEMACLRRPFSSDSFASLVRQITAGDIAPLPA
FT                   AVPEDIQAIIMGMLQTDPNKRYGLEKVMEMTERAIQVRQTTAAVTPDEKASSPRHRKVV
FT                   LKKQQQQQQRALGPKRALHASVMVHKKPQHLHPQRQPELEAQQEGTPQKLPQKQRKQQP
FT                   RQAKRGPIGHAAGSSDSSGESQLSQWIHARNNDVKFIESYLQKFRPADDILIAEGPVES
FT                   QGGSQDGLQPCAVASKVDTSVRKGATPQKGLRAGRKVAVAPREEKQQNRQNTRSDVEAV
FT                   SPADLSVVSVGIAKGKRPKQAACAARPSRRHSPFAREPSLVNHLAAQGFIRIKSTGSAC
FT                   RQLSPLRHSPQREEERQAQRAKREQERAKMLEMIREQKAKAMRQKKARGKSEGGADVSV
FT                   EIVLPDHVRYFAPAVQ"
FT                   /protein_id="XP_847000.1"
FT   misc_feature    560199..560231
FT                   /note="AT_rich"
FT   gene            complement(<560864..>561466)
FT                   /note="synonym: Tb08.29O9.460; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659148"
FT                   /locus_tag="Tb927.8.1680"
FT   mRNA            complement(<560864..>561466)
FT                   /db_xref="GI:72392400"
FT                   /db_xref="GeneID:3659148"
FT                   /locus_tag="Tb927.8.1680"
FT                   /transcript_id="XM_841908.1"
FT   CDS_pept        complement(560864..561466)
FT                   /locus_tag="Tb927.8.1680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392401"
FT                   /db_xref="GeneID:3659148"
FT                   /translation="MMASAPMAGDYQTRSAAISEKMNTVQLRRRIVEDLRRRAESLSGQ
FT                   LRQRQQDLQRLIDEFTQKKASQEAKISEKRRCELGQKELLDSLLKEEERLTNVQKDYAE
FT                   SIGKLQQEVAQRQATVGKVSQAREELTRVKMMLEEKDREILALERNVEKVRLNAKRRHE
FT                   QFEMQLPDVTLPCLGEVERGGLEETASESILLIGDPS"
FT                   /protein_id="XP_847001.1"
FT   gene            complement(<561910..>563889)
FT                   /note="synonym: Tb08.29O9.470; serine/threonine-protein
FT                   kinase, putative"
FT                   /db_xref="GeneID:3659156"
FT                   /locus_tag="Tb927.8.1690"
FT   mRNA            complement(<561910..>563889)
FT                   /db_xref="GI:72392402"
FT                   /db_xref="GeneID:3659156"
FT                   /locus_tag="Tb927.8.1690"
FT                   /transcript_id="XM_841909.1"
FT   CDS_pept        complement(561910..563889)
FT                   /locus_tag="Tb927.8.1690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72392403"
FT                   /db_xref="GeneID:3659156"
FT                   /translation="MNEYHIIEKMAVGSFGVVFKVRRAIDDGVFVMKRINLAEFQDQQR
FT                   LDAVREIEVMSLLNHPFIVAQRDAFLFNKENLCIVMDYYDGGDLDRLVAQQREKDEYLP
FT                   LESVMKWFASVCFAMQYLHAQGIVHRDLKTSNIFLDLQSQEVAVGDFGVAEVMRTPATD
FT                   KLAWKVGEHRGGKVSGQNAWEEEQKSSEDGGCTVRSSPTTRASPGLEGNVSLGEDGLGV
FT                   FNGAMRGTPLYMSPENLERGVCSPSSDVWSLGCILYELLSLRHPFESRDITTLMMRVIT
FT                   GARQPLPSHYPPEVAELVDRMLALDPQQRPSCDDILRCPIMSGAVHAVVSQHVSHDTPD
FT                   SVGEHIFLAQQRELGVVDNTGKLSFVSLPREGHPALPPSQERVQAEARATASLGRLTPP
FT                   RFFPATPTATCESTAAMPPRAFSCNGGSNVSFGMDFERADEGRRGARSVSNVEDMRHKP
FT                   IAQIEEEVAWYRQLVQNEMRALKQRRDAAVQRRRLGTNGSTLNGGSVNENKHHTEGDGR
FT                   TSSWLPALPTQHTVERRSPRQLSQMHSKYPSPRHSEANNCNLNRTPSVGGGEDTSSARP
FT                   PGGLEASLLARRQLRWDVAVKALGLEVTHNVYNYYRCVDVAERDAVLVMQMVPDRAQWH
FT                   VLPDVEEVVVIDRLLEGTAVAGPA"
FT                   /protein_id="XP_847002.1"
FT   gene            complement(<564780..>567035)
FT                   /note="synonym: Tb08.29O9.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659151"
FT                   /locus_tag="Tb927.8.1700"
FT   mRNA            complement(<564780..>567035)
FT                   /db_xref="GI:72392404"
FT                   /db_xref="GeneID:3659151"
FT                   /locus_tag="Tb927.8.1700"
FT                   /transcript_id="XM_841910.1"
FT   CDS_pept        complement(564780..567035)
FT                   /locus_tag="Tb927.8.1700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392405"
FT                   /db_xref="GeneID:3659151"
FT                   /translation="MLPFLFPSFPAWRGVAASHYASIVPVGKNVGDIRTSVILPKKKMY
FT                   TTLHPYGQPLSFSNTGFHLQEEQLPTLHRERNGSNNAMPLKFVHQTDRHGSDVSLALLC
FT                   KLRHEGDAVLRSYTASGISSSEQRHRPLRSLPHAREMLHNYEVAAMEPSRLPLLPACST
FT                   VVNATTHREGEHSCPGAGSFSEEVEPPPLLRPLQVTTVIQWLFIKHGEFLLMLTPRCCA
FT                   PGACGSRSKLLQRALAGSTIRTTWHDALSVFHCASRAVTLPPAAELLVDEPTLPSAIQL
FT                   VKPQWSAPHSADEAAAILDGPIIPHTSLLSSGNGRSRLQSSMRRCLLLESVIEATRLGS
FT                   TVTSLQCHIKEVALHGGSNCQRTGVADPQFPQQPPLRVGNEVEVLFGVKDVGTGGKELQ
FT                   RIVVPYTTHDRDCDPAFSHDRRNYRRRRHAKRGGALRRASEQWVVPAISQNAELKLPDG
FT                   KQLRRTLTLRNIAAENLRGRTTSVMNELRELKDNQSFCDGTFPNGGKKRPLRHRYFPGL
FT                   WLFVGTSAAQLCSELAASSVSRGISHPLKGLPPVGRITDCDEQVGNKFRCWHSLGERPL
FT                   SPWSEAGASTNTVPDFSELWIPLAVAVGSDGNCEAGSDSKRGRVPLNICSSGKGASYDV
FT                   NADKSNIYCYLDCCSAEEVRMFPPRVFSRWEELQCFKVLSDGCLGQQPPRLVIHEMNNE
FT                   GRQDVIEKWYNAAYEHDVCTMPLPYRGAATVADDAKLHYCYRLALHRERRRLGFDAV"
FT                   /protein_id="XP_847003.1"
FT   gene            complement(<567707..>568921)
FT                   /note="synonym: Tb08.29O9.490; protein phosphatase 2A,
FT                   regulatory subunit B, putative"
FT                   /db_xref="GeneID:3659157"
FT                   /locus_tag="Tb927.8.1710"
FT   mRNA            complement(<567707..>568921)
FT                   /db_xref="GI:72392406"
FT                   /db_xref="GeneID:3659157"
FT                   /locus_tag="Tb927.8.1710"
FT                   /transcript_id="XM_841911.1"
FT   CDS_pept        complement(567707..568921)
FT                   /locus_tag="Tb927.8.1710"
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein phosphatase 2A, regulatory subunit B,
FT                   putative"
FT                   /db_xref="GI:72392407"
FT                   /db_xref="GeneID:3659157"
FT                   /translation="MSQVAGNPHVPRKYILEKPQLVETFHSSPSFAKIVSYVQCCAEAV
FT                   EEMSRSAWLQQRREEKHPTIVFFTDVFFPHLRSIVASIPLEDMKQQRFGNRSFRVFHSR
FT                   LEENIFDLMRGLVATLNRGLGDTTERQNRDISAGEVLKEARANENGDDPLVLELAEYMK
FT                   DAFGNSVRIDYGTGHELHFFIVMLICMQECGDNGAPLQSDVPVVVPHKVQRPPPPPVEQ
FT                   RDALLQLRRAMVFDVFSAYLSFMRHLQHHYKLEPAGSHGVWGLDDYHHLPFVFGASQLI
FT                   NKEVPTATPETTTNANNNAENGSENSNGNANHELILPKHVCEADIVRRHAEEYLYFAQV
FT                   LWVIENKSGPFFEHSSMLYNISGVDSWKKTYTGMVKMYAAEVLLKFNVVQHLLFGEHLP
FT                   WPEQQ"
FT                   /protein_id="XP_847004.1"
FT   misc_feature    569647..688021
FT                   /note="sequence corresponds to BAC RPCI93-26N11"
FT   gene            complement(<570368..>572215)
FT                   /note="synonym: Tb08.26N11.70; phosphatidylglycerophosphate
FT                   synthase-like protein, putative"
FT                   /db_xref="GeneID:3659155"
FT                   /locus_tag="Tb927.8.1720"
FT   mRNA            complement(<570368..>572215)
FT                   /db_xref="GI:72392408"
FT                   /db_xref="GeneID:3659155"
FT                   /locus_tag="Tb927.8.1720"
FT                   /transcript_id="XM_841912.1"
FT   CDS_pept        complement(570368..572215)
FT                   /locus_tag="Tb927.8.1720"
FT                   /gene_family="HOG000255348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylglycerophosphate synthase-like
FT                   protein, putative"
FT                   /EC_number="2.7.8.5"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   catalytic activity [goid 0003824]; go_process: metabolism
FT                   [goid 0008152]"
FT                   /db_xref="GI:72392409"
FT                   /db_xref="GeneID:3659155"
FT                   /translation="MLFLLAYALVFGTSLLLAFRLFSLSGSVQTSTCHSNGTLFHALDN
FT                   KVTVGGRTRGASSVVTDGPQAEMLRFLGETCCTLPARGKDLRVLAGPKQFFSELLRQIS
FT                   AAQHRIVLSALYIGDGPLARQLVTALRNRVSKARSDKKALDVCILLDYNRMHVRQNLKT
FT                   VAELLNLQSEAASPGADSAVNVRLFLFQSPCRWNWLVAPFGRAREALGVQHTKIFCFDN
FT                   CQTILTGANLSDDYFDTRVDRYLAVHDNPHVAAWFSGLVDALCALSYPVGIHKECNTNA
FT                   GSATVAGCGDTKKWGQNANSSSGEFVVHAGSNLTIFPNMAGVDPSTQWYEFCEVAERRL
FT                   RDFAHSSGAVAAEAWQVEQHPEMEDEATGHYDTLLFPTMQCARANIFHDSFIVQMLLRM
FT                   APRSTHIYLASPYLNMYGHFVDELLASSSPYDFITASVSTNGWYGSKGFARYIPYFYLQ
FT                   LQRAFRYLMKEYKCAHRIRLHEFSAEGKTYHAKGLWFMKDQKQGGAPVGRVGISSACAG
FT                   GANNNDVVNCEETWDHVGEPYLVSYGSTNYGSRSVHRDVEVEVFLYTTNEGLRGALRQD
FT                   LISLLQESTSVSDERFVGNGEGRFQPLVSLMAQMGQDLL"
FT                   /protein_id="XP_847005.1"
FT   gene            complement(<572606..>573058)
FT                   /note="synonym: Tb08.26N11.80; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659158"
FT                   /locus_tag="Tb927.8.1730"
FT   mRNA            complement(<572606..>573058)
FT                   /db_xref="GI:72392410"
FT                   /db_xref="GeneID:3659158"
FT                   /locus_tag="Tb927.8.1730"
FT                   /transcript_id="XM_841913.1"
FT   CDS_pept        complement(572606..573058)
FT                   /locus_tag="Tb927.8.1730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392411"
FT                   /db_xref="GeneID:3659158"
FT                   /translation="MCVCASDCVTPMKRDTKGKLSYDMEPAEHRLSSSRSSSCNVVMTA
FT                   ADELAMQINDCRSLFPCIDAGSAVASIRPTSPSGRTVVARVPWTKSTGTTQTPAPEPTR
FT                   CAVEVRFGYAEGFVCDEKVYEALLPLLLENGLQGAACVVDSDVSDS"
FT                   /protein_id="XP_847006.1"
FT   repeat_region   573049..573099
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    573831..573864
FT                   /note="AT_rich"
FT   gene            complement(<574026..>575789)
FT                   /note="synonym: Tb08.26N11.110; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659159"
FT                   /locus_tag="Tb927.8.1740"
FT   mRNA            complement(<574026..>575789)
FT                   /db_xref="GI:72392412"
FT                   /db_xref="GeneID:3659159"
FT                   /locus_tag="Tb927.8.1740"
FT                   /transcript_id="XM_841914.1"
FT   CDS_pept        complement(574026..575789)
FT                   /locus_tag="Tb927.8.1740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392413"
FT                   /db_xref="GeneID:3659159"
FT                   /translation="MRRGFFLRARPDFVAALLTQGRLVDVLLFQHFGAEPAITDTNDNN
FT                   GIGPAATKKDGNTDGVKVNASDVEKSSGKAAELTTAKSPVTAPSQRSLLRERCDAVRTA
FT                   TKRSAHPVMWPVDVGTAATEWRAPPNSQDHVRVALGSDGSNEPGRKVVLHGSFIAIAAP
FT                   GSIPKTMQLLASQECGKEDQVKGTASNREPLLLSLPMQQAGGHISVSPATGGLCTVTLS
FT                   GAEAAIVSNSAAAVDAFTAEHNLLAAAASSGMIDRLLEICALHATHAVRHDALLIRNPF
FT                   VQKALAAMACSRYGIDALTSFVVGCSADDPSQLAKDTNPVDSKENEVGDARHPPLAECV
FT                   AVSTYAGQALATALQLTREVINGVLQLDPQGGVPHASKPDRLIDYAYAVRMVRDESQIL
FT                   AALSFRGSLQHQRYIAPLLLHTESGLQGAAGSVSKGIGSSLFMRAISAPSDVPRLVSPH
FT                   VYLRLSANELEGDVATFLKLLREGERRRDAAFIRTTAQYVAEVFASVAVLYRATAALTR
FT                   TGNNAPRDWLLAQAFCGESAVCRAALLRNFEMSKAARTALLSAGNNSGTIHPVELMNAQ
FT                   PVRKMAKTPTH"
FT                   /protein_id="XP_847007.1"
FT   repeat_region   576339..576368
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   gene            complement(<576442..>576816)
FT                   /note="synonym: Tb08.26N11.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659164"
FT                   /locus_tag="Tb927.8.1750"
FT   mRNA            complement(<576442..>576816)
FT                   /db_xref="GI:72392414"
FT                   /db_xref="GeneID:3659164"
FT                   /locus_tag="Tb927.8.1750"
FT                   /transcript_id="XM_841915.1"
FT   CDS_pept        complement(576442..576816)
FT                   /locus_tag="Tb927.8.1750"
FT                   /gene_family="HOG000255351" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392415"
FT                   /db_xref="GeneID:3659164"
FT                   /translation="MSSPAPSTSHNAANSTQAFSLKTRRPIDEDDLLTAEDREAKSTVE
FT                   KLDCATRRRACKNCTCGRAELERQLEAGGSQVMGAMPPGGCGNCAKGDAFRCAGCPYLG
FT                   MPAFDNAVDGKVKLDLTDDI"
FT                   /protein_id="XP_847008.1"
FT   repeat_region   576894..576932
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<577011..>577571)
FT                   /note="synonym: Tb08.26N11.130; hypothetical protein"
FT                   /db_xref="GeneID:3659165"
FT                   /locus_tag="Tb927.8.1760"
FT   mRNA            complement(<577011..>577571)
FT                   /db_xref="GI:72392416"
FT                   /db_xref="GeneID:3659165"
FT                   /locus_tag="Tb927.8.1760"
FT                   /transcript_id="XM_841916.1"
FT   CDS_pept        complement(577011..577571)
FT                   /locus_tag="Tb927.8.1760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392417"
FT                   /db_xref="GeneID:3659165"
FT                   /translation="MEERLIYTFFIVSLPFFFFSCGFLCVCVFICLITPIAQSELLFTS
FT                   RYVNSDKSACVGMPLEKHFPFCYCVYSVALPKSEFLKFCSHAPLAFVVPPHNIPLFFLK
FT                   KKDVSCFSDDVFEHNSASFKCHCSLTEYTDFFFVHLFHPLLSLLFFNVDPSTQIVAHCV
FT                   QTHTPQKKKNTVLVLKLGYFSYK"
FT                   /protein_id="XP_847009.1"
FT   misc_feature    577577..577614
FT                   /note="AT_rich"
FT   misc_feature    577907..577998
FT                   /note="A-rich"
FT   repeat_region   578296..578330
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   578784..578808
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    578845..578881
FT                   /note="T-rich"
FT   gene            complement(<579691..>581253)
FT                   /note="synonym: Tb08.26N11.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659161"
FT                   /locus_tag="Tb927.8.1770"
FT   mRNA            complement(<579691..>581253)
FT                   /db_xref="GI:72392418"
FT                   /db_xref="GeneID:3659161"
FT                   /locus_tag="Tb927.8.1770"
FT                   /transcript_id="XM_841917.1"
FT   CDS_pept        complement(579691..581253)
FT                   /locus_tag="Tb927.8.1770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392419"
FT                   /db_xref="GeneID:3659161"
FT                   /translation="MGLFIQQQRRWGIRGLFFHAPRVDSRRFIHLGCSQNALLRPSIAP
FT                   FATNSFPLTHQKQHQHHSQTQSQYQPHHYHHKQQHHHSQTQHQTHQHQHQYSKQQQQQQ
FT                   QQQQLGRFSVLRPFRSGWNRFCSQCRGRKCLIVAAACILGCCSYVVLCLALWWRQQEAV
FT                   GRLFSPLEEHPLEEWSLVEPTLREGDIILMMGTGEISSKITAAQYVYSGMRAAALRYSH
FT                   VAVVVEPAHFDRLRSRRTSFAYDIRNNSDNGSSRSNNNSVDGNIADSVNAEYGGMLLTR
FT                   PLSAGIMGEGQSLFERRPRRGAVIMEAIDNIDVNAPDVNGHVRHNCVQLVEASRRLFGR
FT                   HDEKWCYRRFAVRRLKGFEWTPQRKRLLREFINENVGRPLDTNSALMLSYIHPRLYEWV
FT                   GGRPHGNEISCGELIVDLYKHCGVIRRRERPITNSGVMTSGLLSPTPVTSAVALTTSLE
FT                   DGVEGNKEREKECVEEYYARPSIQTAPYQFAEGEEVGVLDFAEGISLGPEVRMCHPYAT
FT                   QQS"
FT                   /protein_id="XP_847010.1"
FT   repeat_region   580929..581092
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    581296..581371
FT                   /note="CT-rich"
FT   misc_feature    581372..581406
FT                   /note="AT_rich"
FT   misc_feature    581563..581590
FT                   /note="AT_rich"
FT   misc_feature    581668..581688
FT                   /note="AT_rich"
FT   misc_feature    581737..581810
FT                   /note="A-rich"
FT   repeat_region   582233..582258
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   582863..582893
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    583230..583267
FT                   /note="AT_rich"
FT   gene            complement(<584141..>586480)
FT                   /note="synonym: Tb08.26N11.170; protein kinase, putative"
FT                   /db_xref="GeneID:3659166"
FT                   /locus_tag="Tb927.8.1780"
FT   mRNA            complement(<584141..>586480)
FT                   /db_xref="GI:72392420"
FT                   /db_xref="GeneID:3659166"
FT                   /locus_tag="Tb927.8.1780"
FT                   /transcript_id="XM_841918.1"
FT   CDS_pept        complement(584141..586480)
FT                   /locus_tag="Tb927.8.1780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase, putative"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72392421"
FT                   /db_xref="GeneID:3659166"
FT                   /translation="MDHKTATVDGSIPGNIYSCASAQLHNVTSNPEESPSSCNGVLSAT
FT                   AIGRQVKQRPPPLFSLTPPSLLPPTEPLHIPSSLQLTAHASSTVTPKRDRFQQLRPPLL
FT                   NRSACSTAAGASVASLNMLAPEDFFGHHPRAQWISLSDDGQHLHVGPFIVSGDGCLTME
FT                   SVLQLNANLGIHGGEVSPAPLGSHGRRSVPGALLKPKLSLTTEPLSNNSFTLLSTSLDT
FT                   PYSPITYSLNAHNAKTSGFTTPRPTFAAAGGDSATHTYVMPSFNLPSPSVLPPNNADSS
FT                   SSNEPGLTAVKYSDVKLKSIVGEGASANVYMAEHYPTGKLLAVKRIDLSSMIYGWEHMN
FT                   ICRTHSVRASPYIRQLHRFVLRELQTLHMAYRNPFMVKVYNAFFNKEEMALDFVMEYMH
FT                   YGGLDRLQRLLGGYVTDNDVSNGVSTGNDVNCQVVSAGGSRTKKRQNQNGGTHGARRRN
FT                   RSNRHNGDGAVCMTEEKEMRESEVDAKDERKVVSVPERLVAVVGEQLLRGVEHMHSRGF
FT                   VHRDIKPGNVLINNRGIVKLGDFGLSSRCTGEEESVVSLPHFPADFIASGDTGADVKIK
FT                   SRDDSCEERRCNPRVNNKRGSVDNGFESDAASNMSGNGYGHSINGIHTGSGYESPPLVG
FT                   VASASESGAATGDDPQCSGTSKYMSPERQRGRPHGKPSDIWAVGMTLAEFAVGQYPVDL
FT                   TDCADPFVTIHRMEEPLDLRRFPRDVPLSDAFLDFIHSCMDPEPRRRPTARELLSHPFF
FT                   RQWTTTFSIEAYLELHTAGCSNLQKR"
FT                   /protein_id="XP_847011.1"
FT   repeat_region   587511..587661
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   587765..587796
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttca"
FT                   /rpt_type="tandem"
FT   misc_feature    587998..588027
FT                   /note="AT_rich"
FT   repeat_region   588426..588458
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tctccc"
FT                   /rpt_type="tandem"
FT   misc_feature    588849..588875
FT                   /note="AT_rich"
FT   gene            complement(<588911..>589381)
FT                   /note="synonym: Tb08.26N11.180; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659162"
FT                   /locus_tag="Tb927.8.1790"
FT   mRNA            complement(<588911..>589381)
FT                   /db_xref="GI:72392422"
FT                   /db_xref="GeneID:3659162"
FT                   /locus_tag="Tb927.8.1790"
FT                   /transcript_id="XM_841919.1"
FT   CDS_pept        complement(588911..589381)
FT                   /locus_tag="Tb927.8.1790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392423"
FT                   /db_xref="GeneID:3659162"
FT                   /translation="MSLCAEINRTGFLGIIGFDQCGWNGTAGFVWEFWRLAPCCGAPDF
FT                   ANALLCIFNCLFCSPCILCKTYASSLGDVCSVWPHCLMVLLCPCARWFTRYNLRKRTGT
FT                   SGNIIGDFFCVFCCCAPCACCQEFRSINIGSWRIVPDASRMQFFTPGCRLLR"
FT                   /protein_id="XP_847012.1"
FT   gene            complement(<589982..>591730)
FT                   /note="synonym: Tb08.26N11.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659163"
FT                   /locus_tag="Tb927.8.1800"
FT   mRNA            complement(<589982..>591730)
FT                   /db_xref="GI:72392424"
FT                   /db_xref="GeneID:3659163"
FT                   /locus_tag="Tb927.8.1800"
FT                   /transcript_id="XM_841920.1"
FT   CDS_pept        complement(589982..591730)
FT                   /locus_tag="Tb927.8.1800"
FT                   /gene_family="HOG000255361" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392425"
FT                   /db_xref="GeneID:3659163"
FT                   /translation="MNAQGKVCVIVHGGRCYVSLLLESIPFDCITPILADIQVCILKAT
FT                   CMTVLSLFYSFSLFLRPTLFSQSIRGSRQPVLVTCQMQARLLRSLFGPSDRERCPDASR
FT                   HEGSTMCGQQDIGFVKQLRHFVRMPDMFVDIEYFFALTILGMVENLLSLLILPLKLIVS
FT                   VHRFERRDAVALVLIVVGVLTYTLLSFKTVELYAYLYHAVRRTSFIKLMMVFNILEVAD
FT                   KLLSALSHEATEVLTACVGDWRGAAQTCGEQCERFAATWLPVLSAVVAVVSVAAHAVVL
FT                   LLSVVTLNVAVNSEGNLLLTLIVSSSLSELKGAVYKKHNRESLYSVAAADAIERVKFLL
FT                   FVLVMVMQHMHERFCGLDFADTLFVLLSEVAVDFTKHLFVAKFNGISLSVYRSFTQLTL
FT                   IDMAAETVLWRLTHIRACCVDSALYDSQDLRKLLRPSDGFFPKYVRRTGFVPVPYAALL
FT                   LWSFSPIAHALFRNAPLLLLLVLVAVMLLKVFMSELIHSVSMRFVVRSMLSAESCAGEC
FT                   QYSKWQNTVGSQLHGVSPLATPPRVRKQRGEEPMHGTAKVLQLTSFLCSLMTLDPFDLQ
FT                   VGKLRR"
FT                   /protein_id="XP_847013.1"
FT   gene            complement(<591914..>592852)
FT                   /note="synonym: Tb08.26N11.210; rhomboid-like protein"
FT                   /db_xref="GeneID:3659167"
FT                   /locus_tag="Tb927.8.1810"
FT   mRNA            complement(<591914..>592852)
FT                   /db_xref="GI:72392426"
FT                   /db_xref="GeneID:3659167"
FT                   /locus_tag="Tb927.8.1810"
FT                   /transcript_id="XM_841921.1"
FT   CDS_pept        complement(591914..592852)
FT                   /locus_tag="Tb927.8.1810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rhomboid-like protein"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392427"
FT                   /db_xref="GeneID:3659167"
FT                   /translation="MAGEGAVSGAIAAVLCGTALLSTFSTVVPRVLGFIPAHTFSARSY
FT                   PWNLITYVVVETNIVLAVCSAVYMLTFGVAVESIIGTRALVRLIAASTVSASLTLLILS
FT                   ALLYNVGFTWFLQCYCGVWPAASGILVPWVGVSPRSPAFPSQLPRQVQRQHVPTALLAI
FT                   TLVIDWLFRGQHRITENDVGGTKVFLGSVFTPALLGLLTTWYLQSALNTPSVVPLSVLL
FT                   EPLLKLCGMVSKAPRQQGSGDGSRAGSGSGGITDTVAVPVLQGAAAGALLPGSTEEEAQ
FT                   RRRNIALAALSSRVQQTTADTAATQHDAAVV"
FT                   /protein_id="XP_847014.1"
FT   gene            complement(<593275..>594504)
FT                   /note="synonym: Tb08.26N11.220; nonspecific lipid-transfer
FT                   protein, putative"
FT                   /db_xref="GeneID:3659160"
FT                   /locus_tag="Tb927.8.1820"
FT   mRNA            complement(<593275..>594504)
FT                   /db_xref="GI:72392428"
FT                   /db_xref="GeneID:3659160"
FT                   /locus_tag="Tb927.8.1820"
FT                   /transcript_id="XM_841922.1"
FT   CDS_pept        complement(593275..594504)
FT                   /locus_tag="Tb927.8.1820"
FT                   /gene_family="HOG000221740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nonspecific lipid-transfer protein, putative"
FT                   /note="go_process: lipid transport [goid 0006869];
FT                   go_process: regulation of steroid biosynthesis [goid
FT                   0050810]"
FT                   /db_xref="GI:72392429"
FT                   /db_xref="GeneID:3659160"
FT                   /translation="MASQVVRIVGVGRTGIGKLHKSVDELAASALKCALVDANMKQCDL
FT                   QALIAVPSLASPQFMQAHHIATVAGLFPTKGKFIVRTVDTGGAGPITALGMAVDLVRTG
FT                   CAQTVAVIAADAVLSMGSGAFAERSNASLRRSGLPEPCIPHGYDRYAQWYMSRYGLKRE
FT                   QLAMVPVLMSKMAERHPEAMCRKAYTLDEVLHSRCVAPVTNLLECARRADGAVALIVSG
FT                   EAHYAEHFAQGKQEQRHLGGSKPIIASVAEASGPLFPPGSSDDIVPDIFSCRHAARDAF
FT                   LSANLNVGDIHFFGLYDCFPICLIQAVEAVGLCPEGKGGEFMETAYNEMLNNGGVLDPS
FT                   KFPINTHGGLQCFGAPWEVPAMYNITEAIAQLSEEAGDRQLTPVPKRALVYGNGGIFSA
FT                   SSVAILISDL"
FT                   /protein_id="XP_847015.1"
FT   gene            complement(<594809..>596482)
FT                   /note="synonym: Tb08.26N11.230; tRNA-methyl transferase,
FT                   putative"
FT                   /db_xref="GeneID:3659169"
FT                   /locus_tag="Tb927.8.1830"
FT   mRNA            complement(<594809..>596482)
FT                   /db_xref="GI:72392430"
FT                   /db_xref="GeneID:3659169"
FT                   /locus_tag="Tb927.8.1830"
FT                   /transcript_id="XM_841923.1"
FT   CDS_pept        complement(594809..596482)
FT                   /locus_tag="Tb927.8.1830"
FT                   /gene_family="HOG000136280" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA-methyl transferase, putative"
FT                   /EC_number="2.1.1.61"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   activity [goid 0004808]; go_process: RNA processing [goid
FT                   0006396]"
FT                   /db_xref="GI:72392431"
FT                   /db_xref="GeneID:3659169"
FT                   /translation="MTSQAVRVAVALSGGVDSAVAALFLCRCVSTWRDVEALWRSPRPL
FT                   PLDTVMDAIVKRRAWADITQSSATTPMQQNPTTAVHYFPLFMKNWDDVSEDSDGSASDT
FT                   CENVGGNHRRRWCEAAEQDYHDAAEVARFAGLLSESEALPLFNFSSHYVTSCFDRMLNS
FT                   YARGNTLNVDVLCNSEIKFGALLHALHTSGRAQYVATGHYARTISLADTVFCSAAASES
FT                   GNGRYTRVIARPFTAGQDLNDQTLFLSRLSQLQLSNVIFPLGHVFQRKADVRVVASHLG
FT                   LTRVSAKKTSTGLCFVGERYKRKSGKGGGFGAFLTEYMASAPEESGGEGVHADEETKYL
FT                   DAETEQIIAADQLNIPGIVRRQDRTLLPAHYLTVGQRIRGAAGNSGSPRCYYVQRKEVS
FT                   PIHGYEKCGENCCIRYLRNVWLVNRWNHPLLYNTLVKLSDVVLPLRMTQLLMLSLAFPP
FT                   SRSPRHGEEGEEVCLRCSCCTRHQDPLHPAVLRFRACEVQEFAGGTSVNFAVVEFDTPV
FT                   RAATAGQTLVGYCPINPVTLSVSSAVHSASWYVVASGWII"
FT                   /protein_id="XP_847016.1"
FT   repeat_region   596921..596940
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<597457..>603648)
FT                   /note="synonym: Tb08.26N11.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659168"
FT                   /locus_tag="Tb927.8.1840"
FT   mRNA            complement(<597457..>603648)
FT                   /db_xref="GI:72392432"
FT                   /db_xref="GeneID:3659168"
FT                   /locus_tag="Tb927.8.1840"
FT                   /transcript_id="XM_841924.1"
FT   CDS_pept        complement(597457..603648)
FT                   /locus_tag="Tb927.8.1840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392433"
FT                   /db_xref="GeneID:3659168"
FT                   /translation="MQLAPNKTVVDLENRATFMVQLHAFLLQARHVVSGTPKGKLQEVL
FT                   RNVDEWIKEVSLGDATTSSGSASGNASVTERTGGEASGPLRQGASEADTGAAEDPKPPP
FT                   NSSPSASPCEDPSPATAVAAEGDERGQLVHPDPNAGFSSDLSKRNLEDLARFLATLFVG
FT                   TSSENGKLRNIARNAARIVITRCFSIIDNTLRQVLREVYDDPTANNGGEAGGNGAARRK
FT                   ESNPLFVSLGHDINVCRNTIGICVDTLSGSTDFPSVRFAVQVCIDILKQLRQCVVHFER
FT                   QFASREIGHIQDMVEATGNGHNGEVRAADDEEDRCMAEQRVEELKRLLGPTLLESITHL
FT                   VGLVRPVVGYLFSIVSVKSATASEDERTTKSDVVSNLFGFAKWYGRTSHLSRCGDASVD
FT                   DSVTLSRSTEFDDNVPIHSRSHRILCCVLESVLATSFSPEYTACVAQHCGDRAEGQFLA
FT                   VRLLKDTVSELCEGSAAELEYVLRHDNWRKRILDGIFNCVMSLRPSVLDAGLETLRRVV
FT                   TSCPDCLSTEVGSIYCNGIFGLLGSDSTPPFMQRSFLHHIIDTFFQGSAVSGEAPLLLR
FT                   CYRRFDLNVHWHQLNLIQKVVTVLSRAVCTARPEEFVDIEGPKPRASGTASGSAVGNAE
FT                   ASNESIVYAETGGGDSANVTQTVNCASFADDGTVMMQRSVPFLALHGLALVVEILTKQI
FT                   PQNTGLSNWKPLPRLLNRKKKIEQLRFVEAINSSPIKGLRKLFNIRDEEWQTEADRAIA
FT                   ENNWSHRHIPEPATPQAEEKVQHIAQFLMETPSLNSDAVAEILSYPAVISLQVCRAFMD
FT                   LLPLAGKTLINGLRELFRVVKLPKEGQRIERLIEFFCSAYYKAGSRSCVDTDVFPFASE
FT                   DACFIAGIGIIMLNTNLHNPNVSTTKMTAASFYAQMRGCNDNKDFPRRFTDSVFEEVST
FT                   RSLSNVHESMLTEAKRRGSVVSHMRMDAFFFTSEDRKEAEFNVVRRRLTDETRELLFRS
FT                   SRLCEDDGEIREGGDTEQEYWTSVTQDLFLSTWPSLNAVFGAAVDGNQIPEDALLLYAT
FT                   GLRSSLLLSAAFGLHTECDAAQMALVRLSAFDSLRDVCHGCLLEVASSRHSVHFSSRCW
FT                   LPVVELLVTIRKEQSQTQSQQSYQQQSQSQQQQRRAILVQMESLFGHLEEITREYCNMS
FT                   VHEAPPVIVVAVRELLQGVAALLRDQGMDFPTLTAALYVVRRVLSYSVISHDQELGPVV
FT                   TNLINVRDLSGIVMPALVDVVEARREKGDECLHAVTSFVVDVLSVVWNSCVRDANCSHQ
FT                   AVKLTELANCFCFFQMCHERCVNSSVVQMHMLQGVKELVSCTVLAESSVKQRTTRGVQT
FT                   RVSFTMALVWERLLHSVAHALSGKSTVGTETCSLAVHVLQKLVLICCGAGSVPPSVQMR
FT                   QEPLNVLLSLLCNVAYVGGMCSDVESAQSCLAQLSCVCTAALNREVTTSLEATAVTSDE
FT                   DDYEVDGLNEVQVQLTRRLLQGIQGQDDFTVLHALERICMLLGCHTQETRTEAIGVLRA
FT                   VSKQLGVRDQKQHLAVQLADTVLQVLLGHTAPGSKSSANTPEAAEDVGRVSFAILNLRT
FT                   PPTMRKCPAVAFHATLPQLLNFMSHELIVDASLEDVASLGAVVMERCLLPLAVSQKSSS
FT                   HVRPLAVRSMMQCATLCVAALGKLSESSAAREKAAGDRCLNAIINSVSLVLLDTHLFKQ
FT                   SIVPHNAQYVGSRWDAGLSQMLGAYSKAGRSAIRALSASDPCNITGSRGCVTLSMRMLH
FT                   EEQVSEHSKVAPNDLPGKKQGTVAGCEEGLSSGTDSTVLSDEQLVEYCNLMAPLLSPLP
FT                   KVLAAITPAMYTRSERPFSGDEGASTTEGCEQPVWWSPPPCNYKLMAELLLDAEGAFFA
FT                   VLWRVNHASEMDQFVMQSVTKGREATPLSKSSALLPHTAVRGGLNAYLSLALQMDFSHL
FT                   RHVLVEILEEVAFVQSLSSGSRKPRRTGDSMSDSPVGQQLSPREQQHVRSCNVGMYQEL
FT                   TSVVVHWVKNLMYQLDPETSALTGQRQSELADVVRDPEVFKGLVQLLTAAGGSIVSTVR
FT                   DYLTWYIEAQQR"
FT                   /protein_id="XP_847017.1"
FT   gene            complement(<604175..>605407)
FT                   /note="synonym: Tb08.26N11.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659171"
FT                   /locus_tag="Tb927.8.1850"
FT   mRNA            complement(<604175..>605407)
FT                   /db_xref="GI:72392434"
FT                   /db_xref="GeneID:3659171"
FT                   /locus_tag="Tb927.8.1850"
FT                   /transcript_id="XM_841925.1"
FT   CDS_pept        complement(604175..605407)
FT                   /locus_tag="Tb927.8.1850"
FT                   /gene_family="HOG000255364" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72392435"
FT                   /db_xref="GeneID:3659171"
FT                   /translation="MLSIWRAVKVSFPQAGHCHSYSVTAMLWSRLWLREMCQRIVGDSR
FT                   MGCTALTLCVACIGASSWGAATVLCHPLATPEYLIPYYLRSIKSRFRHYASVRSADDGA
FT                   MLMTMEDFVRSVLVLRKDEPLGASSLEDMSDLFASLDADGNVCLNLTEYTFLMVLLTAK
FT                   LKDIRMLFTIVDKDRVGTLGLSEFAGVLRGLGCTANEANSLTTGCKNGIVRRLFGDDGE
FT                   LRCSYDEMEGSINAINEAIWRAEFHLFDPNNVGCIGAEEFGKLLAKQMIGSNVPFYVVE
FT                   NIRRMRGINTTVTVDQWIGFHQVMREADTIGEAVRLFMESGLSLGKREFNRVVKAAGVR
FT                   PFKEEELDLIMALFDRNGDGALDFDEFISLMKRKLSYQYSGSSANEPREVKHFPTRLVE
FT                   CVGETLRGSVG"
FT                   /protein_id="XP_847018.1"
FT   gene            complement(<605805..>608897)
FT                   /note="synonym: Tb08.26N11.280; pitrilysin-like
FT                   metalloprotease"
FT                   /db_xref="GeneID:3659170"
FT                   /locus_tag="Tb927.8.1860"
FT   mRNA            complement(<605805..>608897)
FT                   /db_xref="GI:72392436"
FT                   /db_xref="GeneID:3659170"
FT                   /locus_tag="Tb927.8.1860"
FT                   /transcript_id="XM_841926.1"
FT   CDS_pept        complement(605805..608897)
FT                   /locus_tag="Tb927.8.1860"
FT                   /gene_family="HOG000255366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pitrilysin-like metalloprotease"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: metalloendopeptidase activity [goid 0004222];
FT                   go_process: proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:72392437"
FT                   /db_xref="GeneID:3659170"
FT                   /translation="MIRRCAVPLCAASAMPRGGHPLLKLKNAHGFTHKSTRRFDELNIT
FT                   AYEWQHDSTGALYYHLDTNDRNCTFCIGFRTPAKDNKGISHVLEHTTLCGSKKYPVRDP
FT                   FFMMLKRSLNNFMNAMTGADYTLYPFATTNARDFCNLLDVYLDAVFHPLLRLEDFKQEG
FT                   HRVEVEEDDSAKRRLVYNGVVFNEMRGVVSEPSQHYAHSLMKTMLPNTHYEHISGGYPP
FT                   EVLKLTYEELVAFHKRHYHPTNSITITYGEQNPGSWMATLNEYFSSFERGEVVAVFGLA
FT                   EKNRFAEPKRVTMEGPLNPMGNPQCQKRVSVSFGVQKEDKNMKDIVELSVLDILLSSGP
FT                   SSPIYQALIESQIGSRYAPMNGYSSYLASPLVSYGVEGVDEARANSDEEVLSAVITALE
FT                   RVSKEGFEQRRVQSVIFQEELQQRHRAADYGVNLCTGLCAMGLCRAENNPLDFIDWLPH
FT                   LRQLEAEQAKSLLPRISRNLLNNPHRALVSVSAKKDFLDSLRDTITHMEEKLNDGATDA
FT                   QKDEIKKETEKWLERVRAPQNGDILPTLKVGDIPCQSFQEPLPQPKADGQNTSLLRAPP
FT                   PLKPPVGVYTIGYPTNGLVYVHGLAPFSAATVLLLEKAENDALAGIPLSHSLLGSLGAG
FT                   KYTFKELSIATDLVCGGFSFSPQLNQSYCNKSEYITGTAYGFYTTKEKLHDALELLKMT
FT                   LLEPHTSVEDDGVRGRTLSVAKARCSGVIQRLQHEGNRVATSLAVSHLTRCGAVRESWH
FT                   GLAQSSYASEMLEKLQSSNEGISHSAVATILEHHSCFVQSFAANLCRGVLWATCEEQHR
FT                   CEVENMLASFLSGFPKGEDTSSCACLPSLGRIAREDVVELCRSLPIDTSYAAIAIANDL
FT                   DWTHKQQAPLRVACQLLANEYLHRRVREEGGAYGSGVKATLGAEVGGVTMSSYRDPTPE
FT                   ATVRVFKEAGDWLSEASNVTQLRVDESKLRLFAGIDAPYAADSFGESYFLHGIRPEQKQ
FT                   EMRDALLSVEPKDVVEVARYFDVGKNHGAVVGILRPEERKE"
FT                   /protein_id="XP_847019.1"
FT   gene            complement(<610513..>612363)
FT                   /note="synonym: Tb08.26N11.310; Golgi/lysosome glycoprotein
FT                   1"
FT                   /db_xref="GeneID:3659176"
FT                   /locus_tag="Tb927.8.1870"
FT   mRNA            complement(<610513..>612363)
FT                   /db_xref="GI:72392438"
FT                   /db_xref="GeneID:3659176"
FT                   /locus_tag="Tb927.8.1870"
FT                   /transcript_id="XM_841927.1"
FT   CDS_pept        complement(610513..612363)
FT                   /locus_tag="Tb927.8.1870"
FT                   /gene_family="HOG000255367" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Golgi/lysosome glycoprotein 1"
FT                   /note="go_component: lysosomal membrane [goid 0005765];
FT                   go_component: Golgi apparatus [goid 0005794]"
FT                   /db_xref="GI:72392439"
FT                   /db_xref="GeneID:3659176"
FT                   /translation="MRRSFFVALLLQLSHASVRALSLFPTCSENEYTGGGLPGKEWVVQ
FT                   RFDKPGRNLTIHCLAYEVKPVDTTNAKDMGPGPCQIDHQTEFSFRLFVRATYKDSKSGE
FT                   QVTEEYDVKDMAGGSLSDVAIRLAHKSDLSLVFANTAANHECGLEARVSFRFTHDAKVA
FT                   AVSDVPVLVGVQPRIVHAKNSVPTRFIFRSSDSTKGGVSEREEFFLISAKEECSTSTGS
FT                   NSYLMSHPSSPPLFDEDFTGANTSTFAARDVFIDTARAYRICSRKANTEDVTEVGVVRS
FT                   FEVNPSYYQVVGGQNADGKVYVMKRTTIKFYGSDLDTRPRRNQAKFVSDTEDCDASAAG
FT                   GVPETLALEPEDRFGPKATSVLWSWVLKRGGAYKVCFKRTGMPWVEVPSIDIVNSAADI
FT                   TNADGNITYRQPVDPVTKELCPMAPPNTPENRWSMYNSIMLTLKSKTLPSNYLQTLSKA
FT                   LCVPRTAMALSRVTHGKDGRVRLFISIFCEELGEDRTCDTVERQNYIISASKQGSEALA
FT                   AAGIESAEGSRDMFALGDDPNPRMGWGRVLSIFAICGTVVAVACLVVYGVLKYRENRQY
FT                   FVNFGVEDEDVDDMYISNIPTAGAAVNSAGTKGSVIEVED"
FT                   /protein_id="XP_847020.1"
FT   gene            complement(<612941..>613513)
FT                   /note="synonym: Tb08.26N11.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659178"
FT                   /locus_tag="Tb927.8.1880"
FT   mRNA            complement(<612941..>613513)
FT                   /db_xref="GI:72392440"
FT                   /db_xref="GeneID:3659178"
FT                   /locus_tag="Tb927.8.1880"
FT                   /transcript_id="XM_841928.1"
FT   CDS_pept        complement(612941..613513)
FT                   /locus_tag="Tb927.8.1880"
FT                   /gene_family="HOG000255368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392441"
FT                   /db_xref="GeneID:3659178"
FT                   /translation="MLQINAFKLVRATPFLLKRTGKPADTPDYKQVYLPYDAAPTEREL
FT                   ERERRRFKQAHHGRMEHRKLVEVKEVPLNVYTYGKEGMSLPIAIFKDQKDPVIGPEWTY
FT                   PGIYENKIAAQHWYTEELFDKESKEAFESPWQQQILDNQVKRRMAKVMFRMRQVNMKAV
FT                   DLFQKERGSSRRSGGAGEKGKDGGGKK"
FT                   /protein_id="XP_847021.1"
FT   gene            complement(<614630..>615406)
FT                   /note="synonym: Tb08.26N11.340; cytochrome c1, heme
FT                   protein, mitochondrial precursor"
FT                   /db_xref="GeneID:3659175"
FT                   /locus_tag="Tb927.8.1890"
FT   mRNA            complement(<614630..>615406)
FT                   /db_xref="GI:72392442"
FT                   /db_xref="GeneID:3659175"
FT                   /locus_tag="Tb927.8.1890"
FT                   /transcript_id="XM_841929.1"
FT   CDS_pept        complement(614630..615406)
FT                   /locus_tag="Tb927.8.1890"
FT                   /gene_family="HOG000003867" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c1, heme protein, mitochondrial
FT                   precursor"
FT                   /EC_number="1.10.2.2"
FT                   /note="go_component: mitochondrial electron transport chain
FT                   [goid 0005746]; go_function: electron transporter activity
FT                   [goid 0005489]; go_process: electron transport [goid
FT                   0006118]"
FT                   /db_xref="GI:72392443"
FT                   /db_xref="GeneID:3659175"
FT                   /translation="MAGKKAHPIKRDWYWNHNDRFEIWHSLDWPSVRRGRQIYTEVFAP
FT                   CHPLGRMTFTHFQGFMTREEIKQLASQYEVVDSAPDAQGMLNPRPGKPTDTLPIPFPNQ
FT                   RAAQFANNGSEPPDLQHSVFGKEGGPDYIFSLITGYNWGNGELMEIPPFAPELKPGQFW
FT                   NPYFKDCVLSMPPPLSDGMVDYEDGTPATISQMAKDVVNFLRWSAESEYDDRRVMFWKC
FT                   FTTLGLVNCILLHYCQKNTNWRIYGRTTFRYWKKTW"
FT                   /protein_id="XP_847022.1"
FT   gene            complement(<616279..>617463)
FT                   /note="synonym: Tb08.26N11.360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659172"
FT                   /locus_tag="Tb927.8.1900"
FT   mRNA            complement(<616279..>617463)
FT                   /db_xref="GI:72392444"
FT                   /db_xref="GeneID:3659172"
FT                   /locus_tag="Tb927.8.1900"
FT                   /transcript_id="XM_841930.1"
FT   CDS_pept        complement(616279..617463)
FT                   /locus_tag="Tb927.8.1900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392445"
FT                   /db_xref="GeneID:3659172"
FT                   /translation="MHEEDLMKCVSALSRCTSRDEQTLESILGDIHRSVFGANEGGGES
FT                   LKPSDLLSLCNNAVEWIGGNLGKRKRSAAMRLSIGVVVVELLARLTRVLLWGMGDPEEM
FT                   SLCCDRLREIKEDAEQLEVFLLPRFFLKLPISPITLRDVLLKTPWGLFSQKYGVQTTSH
FT                   GTVPAQVATVLSDLRTNFGCDFLHNCRVDVELPLPAYPASALTDTGVSRSTKSNATSDI
FT                   AALTCESSAAPGAVVSSTVDTVNVGASVDGSSVCVARSAPKSLRSGRSTLRGAAKHEMF
FT                   GAKAATIPANIKNPLPMHPTRSLPAYMLRKWKPGAAPRATVGCGGREIAGTEENNLPVT
FT                   PDTQSSAGDDSDTEVLATESPVRKRVCSDGTVVPPSPSRLTRDEMEPCAPGIKK"
FT                   /protein_id="XP_847023.1"
FT   misc_feature    617748..617769
FT                   /note="AT_rich"
FT   gene            complement(<617921..>619105)
FT                   /note="synonym: Tb08.26N11.370; acetylornithine
FT                   deacetylase, putative"
FT                   /db_xref="GeneID:3659179"
FT                   /locus_tag="Tb927.8.1910"
FT   mRNA            complement(<617921..>619105)
FT                   /db_xref="GI:72392446"
FT                   /db_xref="GeneID:3659179"
FT                   /locus_tag="Tb927.8.1910"
FT                   /transcript_id="XM_841931.1"
FT   CDS_pept        complement(617921..619105)
FT                   /locus_tag="Tb927.8.1910"
FT                   /gene_family="HOG000243772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetylornithine deacetylase, putative"
FT                   /EC_number="3.5.1.16"
FT                   /note="go_function: metallopeptidase activity [goid
FT                   0008237]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:72392447"
FT                   /db_xref="GeneID:3659179"
FT                   /translation="MNCREWLAKLVSYDTTSRNSNLELIYCIRSYLTALGVPSTLVYND
FT                   EKTKANLWATLAGEGGITDGGIILSGHTDVVPVDGQKWESDPFTLTERDGKFYGRGTCD
FT                   MKGFIAVCMSLVPELLQMKRRKPIHLAWTYDEEVGCIGGQVLTQFLREQGVKAYGCIVG
FT                   EPTSNQVVVAHKGIAVYRARVQGKAAHSSYALTRRSCNAIDYAAKLIVKIREIAEDFRC
FT                   NGTCDSYFDVPNTTISTNLVTGGNAENTVPAVCEFVFEMRYLTNTDLGLIEKQIKTYAE
FT                   GELLPLMKTEFDCASIEIVKMVGAPPLKQADEEDPFLILLRRIARDNAVRKVAYATEAG
FT                   HYQGIGIPVGVCGPGSILQAHGANEFVTLEQLEGCAKIIREVAQDGDIGRKPHL"
FT                   /protein_id="XP_847024.1"
FT   gene            complement(<620030..>620917)
FT                   /note="synonym: Tb08.26N11.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659180"
FT                   /locus_tag="Tb927.8.1920"
FT   mRNA            complement(<620030..>620917)
FT                   /db_xref="GI:72392448"
FT                   /db_xref="GeneID:3659180"
FT                   /locus_tag="Tb927.8.1920"
FT                   /transcript_id="XM_841932.1"
FT   CDS_pept        complement(620030..620917)
FT                   /locus_tag="Tb927.8.1920"
FT                   /gene_family="HOG000255335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392449"
FT                   /db_xref="GeneID:3659180"
FT                   /translation="MPGLLISRKRTRSEASGKPIGEIKCVAENRVQALKPPLGELVPKG
FT                   ELGAGTPHEPYNLPLRGNPNKSGCHHCLADQCHCVFFERLLDATFRRLDIKRITEVSGS
FT                   RHLCAKSLLPTFVSRMVRLMEITSEDTFYDLGCGNGSILFQVAFLTGARCVGIEISEHN
FT                   AKVAKKAWEVIRPELEGSSGRSMPEVNIITSDMTKILADERLFESERGKTVILLSNLLF
FT                   PKSLTHYLSERFRRVPSGTRILCFDDLYPHSRSVAAIRDPEAFRLFAMTDYRWQECSVE
FT                   WCTRDGPFFIHRRR"
FT                   /protein_id="XP_847025.1"
FT   gene            complement(<621146..>621976)
FT                   /note="synonym: Tb08.26N11.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659177"
FT                   /locus_tag="Tb927.8.1930"
FT   mRNA            complement(<621146..>621976)
FT                   /db_xref="GI:72392450"
FT                   /db_xref="GeneID:3659177"
FT                   /locus_tag="Tb927.8.1930"
FT                   /transcript_id="XM_841933.1"
FT   CDS_pept        complement(621146..621976)
FT                   /locus_tag="Tb927.8.1930"
FT                   /gene_family="HOG000255334" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392451"
FT                   /db_xref="GeneID:3659177"
FT                   /translation="MHIYPQLAHFQYFYSMQDYLREIEGRLARKRERQNTVLYRLAKRK
FT                   ADEKRLSSLGIRSLPSSPLETADVNVVKFVIFKTKQEIGDKVARLRNPELVSIETHGEV
FT                   VVRAKNDEVNQLISKKNLWERRLATLNGETHRRAAPRKIYFGCAAGLPEAKRDDAKEVV
FT                   AHVENEEDGWESGSHASSNSDDDDDDAPKPSTLYREELASRGSEDLLRCIETEAERNLR
FT                   SVYSHGSESSPGRSQMAEETFIVDVVLPTEEEFRIKHLERRKQAIQKRLDALKN"
FT                   /protein_id="XP_847026.1"
FT   gene            complement(<622214..>624100)
FT                   /note="synonym: Tb08.26N11.400; endosomal integral membrane
FT                   protein, putative"
FT                   /db_xref="GeneID:3659181"
FT                   /locus_tag="Tb927.8.1940"
FT   mRNA            complement(<622214..>624100)
FT                   /db_xref="GI:72392452"
FT                   /db_xref="GeneID:3659181"
FT                   /locus_tag="Tb927.8.1940"
FT                   /transcript_id="XM_841934.1"
FT   CDS_pept        complement(622214..624100)
FT                   /locus_tag="Tb927.8.1940"
FT                   /gene_family="HOG000216679" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endosomal integral membrane protein, putative"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392453"
FT                   /db_xref="GeneID:3659181"
FT                   /translation="MAMLLNNLYGHLVSLTVWLIAVCGSVDCLLPSINPHAFARNEVVP
FT                   IEVNVLTSLRTHLPYDYYKALPTCRPKEPISKKSNNIGGSLMGDRIKTSPYENIRLLSN
FT                   VSCSVVCEKGVDKDKQTRFLKKAIEKNYRINLLMDGLPLAEASGNNNFVMGVPLGFMRD
FT                   GRSYVNNHIHFTISYTPDNVKQNGGEEKYRILTFVAEASSVAHKSEAPCAQPLDGHLAS
FT                   NIAPLPADTDRIIWSYGVSWIESKEKWSTRWDIYLSVHKEKNHWYSIMNSTLLVIFLTI
FT                   VIAVLLVRIVRRDLGKLADVDIDETEYLDDIGWKLLCRDVFRPPPNGWLLACFTGAGVQ
FT                   LLGMSFTVVVFATMGFFSPQNRGSLFTALLVCFALLGVTGGYVSARLLKLWNRTKWMYV
FT                   FLTGTIVPASSFAIFFVVNLLVWSQSSSAAVPFSSVVLVVCIWFFVSLPLVYFGAVLGF
FT                   KQGTISVPSNYNQIPRHIPAQPWYSSTLAVLSAGVPPFAAVFFETYFILGAIWLNRFYY
FT                   IFGFLFLVGVLFVIITAETAIVFIYYSLCAEDHRWWWKSFFIGSSSGLYLFLYTLYYAT
FT                   EGSVKIEGMVPTVLYVGYMGLLSFLFSVAAGSVGFLACFLFVRWIYRYGKAD"
FT                   /protein_id="XP_847027.1"
FT   gene            <627302..>629434
FT                   /note="synonym: Tb08.26N11.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659173"
FT                   /locus_tag="Tb927.8.1950"
FT   mRNA            <627302..>629434
FT                   /db_xref="GI:72392454"
FT                   /db_xref="GeneID:3659173"
FT                   /locus_tag="Tb927.8.1950"
FT                   /transcript_id="XM_841935.1"
FT   CDS_pept        627302..629434
FT                   /locus_tag="Tb927.8.1950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392455"
FT                   /db_xref="GeneID:3659173"
FT                   /translation="MLSWNPESYVSEAVSRILAEEAKQGRGGAIPSYYDAVTSHLEAHE
FT                   LSKSIKVALEEQRRQNIGISCDIGGNVLEILFNPVDIEDAGVAEERVKKCVADIGCLFG
FT                   NVSDELNSLNGKSGLVAVSEDVLDILHHLQSMGLLTNFRFNPVSEKLGCILSATDRSSI
FT                   LKSMVLYNSQVEWPKGMTLNFTDYMKAWLVDRVAARLEVLNEHRGCLIRLEDFARVFGT
FT                   SRGSSVWKYGVSVSDLDGEQKFIGCLELDALRPTAAAHAVEDPFFDHLGMQSCVACCRT
FT                   TTTSYCLANALSVCSHGEKALFFVREWREVNGPESKDSLLSFTLYFGYGKPISDEGDVR
FT                   IGENDDKRIYLHSEKDQIVRTYKQMGDVKRYESHVETVIANSKNADLFHNISGYIGETT
FT                   CENLERAMSLFPRMCVVASCIGNENAVCVSVLKAADVLRGDATFVFCISQRSPLFNHVF
FT                   APRSQVTLNFLFDNAQAVCQAINDTYPLWINETGNEPVVFESESRTYVTTKALMDISKQ
FT                   VAFETAESFLVGEEVLVVGRCLDSIPSTVVINVKNTLVLQDHVPPQEFYPFLFTIVHKI
FT                   YGTVGFVGYGCQLCSLSPLTMYIYSPIESSQFALDEVYTGPKCNLTFLSSFGAPIFDGK
FT                   DFEELGCGMPMAASSVSSLPQQNIYFQVEGMLIRIVRDISDKYVICVVAANECRFNQTD
FT                   PCKLLVRPDDERLIPA"
FT                   /protein_id="XP_847028.1"
FT   gene            <629740..>631044
FT                   /note="synonym: Tb08.26N11.430; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659174"
FT                   /locus_tag="Tb927.8.1960"
FT   mRNA            <629740..>631044
FT                   /db_xref="GI:72392456"
FT                   /db_xref="GeneID:3659174"
FT                   /locus_tag="Tb927.8.1960"
FT                   /transcript_id="XM_841936.1"
FT   CDS_pept        629740..631044
FT                   /locus_tag="Tb927.8.1960"
FT                   /gene_family="HOG000257394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392457"
FT                   /db_xref="GeneID:3659174"
FT                   /translation="MVVEYLGPADVQRLLALLSEGNCKFSFVEKEFKETFSKDTFAKVS
FT                   RAIQRMIHDMIASPDGVGLVSSFFVLDVMCKMNCEQAKSAFYDALLELERIMRQDVCVM
FT                   EQIKYASKEAKEGRRAHESVNSERYRLRSAVKSFAFRLLANRVAPDETPLMAISDKQEQ
FT                   IDTALNAWESNSICLKEPIAGVAEAWTLEAEKNACGTLSRISATLDNGGRAALVLKPVT
FT                   PQLPSLSLVSGELQFLLPASPLNDLLLINSEVPTEEWKTAKRMVAAGCKGLLNKEEQQK
FT                   LLQTLLAGDVFARVGISSVVLSRMAEHNPDVAASLILKLPAQEANQCVQSILKSSVPSE
FT                   HVETVLLHASKVLQQASFRAYITNKLHHFKEKTTLSNEDKDEVKNFVRTLHQLLTKASK
FT                   ENKELYVADTLKTDITRLCERCDIPEVVTRWDELK"
FT                   /protein_id="XP_847029.1"
FT   gene            <631389..>632303
FT                   /note="synonym: Tb08.26N11.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659184"
FT                   /locus_tag="Tb927.8.1970"
FT   mRNA            <631389..>632303
FT                   /db_xref="GI:72392458"
FT                   /db_xref="GeneID:3659184"
FT                   /locus_tag="Tb927.8.1970"
FT                   /transcript_id="XM_841937.1"
FT   CDS_pept        631389..632303
FT                   /locus_tag="Tb927.8.1970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392459"
FT                   /db_xref="GeneID:3659184"
FT                   /translation="MIGESEAFVSFVYLTPAEGLPCETVDRYPQAQLKEGSSCSETSAL
FT                   SRSDASAEVTPGKENWESKVYVKFFDALRKIAKVQWFSVEAGTKMMYLYEMIRAWLPEV
FT                   TNVVCYTAHSDNWGRHFPLIKDVLSPGTDVPERVFCQEVFLPPCRDMWNWGIVNVVVMQ
FT                   PHGDFTTGYVPLVVHGLFMRSRETLEEQISQMCCTSSAEISYMRMLPLLNCSIRDGLVE
FT                   LTSFFQENEEVEALSQVAVVYPALTTGDLVCADVESRVGQRYTMQGMIKRCHHKNGIVC
FT                   YDVEDTVLGYVAEGLTCVQVLPL"
FT                   /protein_id="XP_847030.1"
FT   gene            <632487..>633920
FT                   /note="synonym: Tb08.26N11.450; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659183"
FT                   /locus_tag="Tb927.8.1980"
FT   mRNA            <632487..>633920
FT                   /db_xref="GI:72392460"
FT                   /db_xref="GeneID:3659183"
FT                   /locus_tag="Tb927.8.1980"
FT                   /transcript_id="XM_841938.1"
FT   CDS_pept        632487..633920
FT                   /locus_tag="Tb927.8.1980"
FT                   /gene_family="HOG000257397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392461"
FT                   /db_xref="GeneID:3659183"
FT                   /translation="MQNKSWALPIKQVPVVEKLDRSIVWNNVRLCYEQKLFGQISCIRY
FT                   NNAGTVVGCASTNQLSLLRVPQTEGVITNEQRERKCFSLRFRDDDKMTIMSVDQRVVIR
FT                   STETLFERQFPGHVREVRDALFLDRRSFVSGSDDTTIKLWDVMGECELAVGKAHTDYVR
FT                   CLENRSPGCFFSGSYDHVINLWDTRAGFSCPTQTSGQAVPNPVESLLCLDTNLLVCGAS
FT                   DQIILFDIRKGLSLPLTQDSYHTKTVVALGYSKKYNVLLSGSLDQRVKIFSLERGCPDP
FT                   VASKKFDAPVTAVAVHPRSSEFAVGTASGDLRIMKLGSASDGDEMGGGKDEESRGRQKD
FT                   EELIAMKVNDVRRQLVSYQYNRALKTALYSRHADVVVSTLEELLRRGALHVALSGQNDR
FT                   TIARILRFALGFIDTPQFCESMMVVLDTIFDIYGTCVGKSIFLHRELMKAHRRLGSVLA
FT                   NLQRMAGTLSIMELIVNDV"
FT                   /protein_id="XP_847031.1"
FT   gene            <634173..>634853
FT                   /note="synonym: Tb08.26N11.460; tryparedoxin peroxidase"
FT                   /db_xref="GeneID:3659187"
FT                   /locus_tag="Tb927.8.1990"
FT   mRNA            <634173..>634853
FT                   /db_xref="GI:72392462"
FT                   /db_xref="GeneID:3659187"
FT                   /locus_tag="Tb927.8.1990"
FT                   /transcript_id="XM_841939.1"
FT   CDS_pept        634173..634853
FT                   /locus_tag="Tb927.8.1990"
FT                   /gene_family="HOG000022343" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tryparedoxin peroxidase"
FT                   /EC_number="1.11.1.-"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: trypanothione-disulfide reductase activity
FT                   [goid 0015042]; go_process: electron transport [goid
FT                   0006118]"
FT                   /db_xref="GI:72392463"
FT                   /db_xref="GeneID:3659187"
FT                   /translation="MLRRFSMLPLSGGIARRSFFRTAPLFNLDYQAYRTATVREAAPEF
FT                   AGKAVVDGKIKDISMNDYKGKYIVLFFYPLDFTFVCPTEIVSFSDSHAEFEKLNTQVIA
FT                   VSCDSHFSHLAWVETPRKKGGLGEMKIPLLSDFTKEISRDYGVLVEEQGLSLRALFVID
FT                   DKGILRHVTINDLPVGRNVDEVLRVVQAFQYADKTGDVIPCNWKPGKETMKVEAAKEYF
FT                   EKNL"
FT                   /protein_id="XP_847032.1"
FT   gene            <635215..>636120
FT                   /note="synonym: Tb08.26N11.470; cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase, putative"
FT                   /db_xref="GeneID:3659185"
FT                   /locus_tag="Tb927.8.2000"
FT   mRNA            <635215..>636120
FT                   /db_xref="GI:72392464"
FT                   /db_xref="GeneID:3659185"
FT                   /locus_tag="Tb927.8.2000"
FT                   /transcript_id="XM_841940.1"
FT   CDS_pept        635215..636120
FT                   /locus_tag="Tb927.8.2000"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="go_function: peptidyl-prolyl cis-trans isomerase
FT                   activity [goid 0003755]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:72392465"
FT                   /db_xref="GeneID:3659185"
FT                   /translation="MLKSPQNFRKCGLLFVSTFDFLYACNLFPPVLFSSGKESMPKVSV
FT                   PPKTERHGKIEAPETNNPKVFFDVSINEKAAGRIVMELYADTVPRTAENFRALCTGEKG
FT                   RGKSGKPLHYKGCIFHRVIPGFMLQGGDITRGNGTGGESIYGTTFRDESFAGKAGKHTG
FT                   LGCLSMANAGPNTNGSQFFICTANTPWLNGKHVVFGRVTEGIDVVKSIERLGSDSGKTR
FT                   GRIIIANCGELQTQKEGAAKKEKVKAKEGNNAGKLSTIVEGTGGAKRPREDVEDLEERK
FT                   KRIREKRERIAKLRAQAEEK"
FT                   /protein_id="XP_847033.1"
FT   gene            <636421..>636981
FT                   /note="synonym: Tb08.26N11.480; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659186"
FT                   /locus_tag="Tb927.8.2010"
FT   mRNA            <636421..>636981
FT                   /db_xref="GI:72392466"
FT                   /db_xref="GeneID:3659186"
FT                   /locus_tag="Tb927.8.2010"
FT                   /transcript_id="XM_841941.1"
FT   CDS_pept        636421..636981
FT                   /locus_tag="Tb927.8.2010"
FT                   /gene_family="HOG000257398" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392467"
FT                   /db_xref="GeneID:3659186"
FT                   /translation="MLRGRWGIFQCTLIFRASFHDVRSKKMWERRQRELQKAGEQMELD
FT                   EDVTPPPSIPRSSRVATRDESCEGDKEAMLALLQEQWQRRVARREAFIQWQAGQREKGA
FT                   AQRLVRQAKTQEKFKSHRYHTQSGRIISVGLAREDGTSSNSDASVDLYSVGMCGSQLRS
FT                   ADFLVQPGSRNTHGTVNLVLQKR"
FT                   /protein_id="XP_847034.1"
FT   gene            <637313..>638308
FT                   /note="synonym: Tb08.26N11.490; arginase, putative"
FT                   /db_xref="GeneID:3659182"
FT                   /locus_tag="Tb927.8.2020"
FT   mRNA            <637313..>638308
FT                   /db_xref="GI:72392468"
FT                   /db_xref="GeneID:3659182"
FT                   /locus_tag="Tb927.8.2020"
FT                   /transcript_id="XM_841942.1"
FT   CDS_pept        637313..638308
FT                   /locus_tag="Tb927.8.2020"
FT                   /gene_family="HOG000257399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arginase, putative"
FT                   /EC_number="3.5.3.1"
FT                   /note="go_function: arginase activity [goid 0004053];
FT                   go_process: arginine metabolism [goid 0006525]"
FT                   /db_xref="GI:72392469"
FT                   /db_xref="GeneID:3659182"
FT                   /translation="MFSKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDFF
FT                   LQSPRDCDHYAELTIHDKGPIECPPETVMFMPVLNCGQMLDEAAGTETPTSDEWYLGSL
FT                   EASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFPSDDIVIVHFSARPSVSDPRSPLRV
FT                   LLDKGLLKGVVSVGNRQVSSEDRKVRKLHKMFYMDMHAIYSKGLFCIRDIRNDYPVFIS
FT                   IDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDVYRKDNV
FT                   GLTAIALSKIIKEGILKAYSISTHTEEEGMERVKMLQRQGTVSENPYPDH"
FT                   /protein_id="XP_847035.1"
FT   gene            <638854..>640119
FT                   /note="synonym: Tb08.26N11.500; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659188"
FT                   /locus_tag="Tb927.8.2030"
FT   mRNA            <638854..>640119
FT                   /db_xref="GI:72392470"
FT                   /db_xref="GeneID:3659188"
FT                   /locus_tag="Tb927.8.2030"
FT                   /transcript_id="XM_841943.1"
FT   CDS_pept        638854..640119
FT                   /locus_tag="Tb927.8.2030"
FT                   /gene_family="HOG000257400" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392471"
FT                   /db_xref="GeneID:3659188"
FT                   /translation="MADSNAVVEHREESDVNIQLEQRRSQVRGLEIQLTRKEAELRRAK
FT                   EEQALLKELHAVNEVTLRKKQQKESDGAGSRLKIPRESLDEILRLEGEIKCANRRTVEL
FT                   QNEASTTSVQLNDVEKGIESICNRTALVKQVTGWISSGSQSSSVVGVSSEWIMRKKVLT
FT                   ELQDEQNAIKALTALLDKQAEFYTKRLEEQRTKDEEFAEAQRVLREKTVQYENLLGELK
FT                   SFERLTKKKERLLDTASGKVTDDYKTVKMIEGDKKVLYANLSKLQEANVRNSKSILSLE
FT                   MRLRQLETKLEAVNLFLQQVFADVEEEDEHIENIPEGATEVPLEQFEELCRELELSRAT
FT                   LLHREEQLNAGDAKVEQLERKTTILENAIASHAVSAQLQVKGKEREFETLMSHVDYMKA
FT                   EFDEEYKRLTKENAALVSKLGK"
FT                   /protein_id="XP_847036.1"
FT   gene            <640605..>641360
FT                   /note="synonym: Tb08.26N11.520; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659189"
FT                   /locus_tag="Tb927.8.2040"
FT   mRNA            <640605..>641360
FT                   /db_xref="GI:72392472"
FT                   /db_xref="GeneID:3659189"
FT                   /locus_tag="Tb927.8.2040"
FT                   /transcript_id="XM_841944.1"
FT   CDS_pept        640605..641360
FT                   /locus_tag="Tb927.8.2040"
FT                   /gene_family="HOG000257401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392473"
FT                   /db_xref="GeneID:3659189"
FT                   /translation="MAALHEEVRTRYHIAVCTRFVERVCVDTPSPTAEFIYKMALNENL
FT                   KDITDVCTLPRVSLLQLNSLPCSLVLQVSSSRDVTQPLRPCLDASEEEPILTAAFQKNL
FT                   KTRLLRLVLSDGHSEVPAVELSTLSVFRSIPVPGEKLLVKEGAEIKNGAIIMTDDCVVP
FT                   LGGGVQQLKKEVLIQQSRSDAPRFQPLRFGVSTPAGARAAAGPLSDSFDRDRGGNVGRA
FT                   RGRGLGYRGGRGSGYRGQRPHNHHYNRPQ"
FT                   /protein_id="XP_847037.1"
FT   gene            <642645..>643754
FT                   /note="synonym: Tb08.26N11.540; mannose-1-phosphate
FT                   guanyltransferase, putative"
FT                   /db_xref="GeneID:3659190"
FT                   /locus_tag="Tb927.8.2050"
FT   mRNA            <642645..>643754
FT                   /db_xref="GI:72392474"
FT                   /db_xref="GeneID:3659190"
FT                   /locus_tag="Tb927.8.2050"
FT                   /transcript_id="XM_841945.1"
FT   CDS_pept        642645..643754
FT                   /locus_tag="Tb927.8.2050"
FT                   /gene_family="HOG000283479" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannose-1-phosphate guanyltransferase, putative"
FT                   /EC_number="2.7.7.13"
FT                   /note="go_function: mannose-1-phosphate guanylyltransferase
FT                   activity [goid 0004475]; go_process: protein amino acid
FT                   glycosylation [goid 0006486]; go_process: GDP-mannose
FT                   biosynthesis [goid 0009298]"
FT                   /db_xref="GI:72392475"
FT                   /db_xref="GeneID:3659190"
FT                   /translation="MRAVILVGGYGTRLRPLTLTTPKPLVPFCNKSITLRQLEALRDVG
FT                   VTQVVLAVAYRSEVMAEVTQKWARELGISVVCSLEVEPLGTAGPLALAREYLLQDDKPF
FT                   FVFNADVICTFPLQKLLDFHLSHGREGTIAVTKVKDWRKYGVVVHDEVTGAIKQFVEKP
FT                   PEFVGDRINAGIYIFNKSILNRIKLEKTSIERQVFPMMASDSQLSAFHLEGFWMDIGVP
FT                   KDYIEGMGKYLDSLAGTSTEVGFSCDERRVSDRSYVLKGCVMIHPTAKIGEGSVIGPHV
FT                   SIGPGCVIGPCCRIQRTAILDNSTVGRGTLIESSIVGWNGRIGSWCRIVNDTVLGEDVR
FT                   VDDGKYLNGVKVLPNKEITQNHPEPEVVM"
FT                   /protein_id="XP_847038.1"
FT   gene            <644458..>653307
FT                   /note="synonym: Tb08.26N11.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659195"
FT                   /locus_tag="Tb927.8.2060"
FT   mRNA            <644458..>653307
FT                   /db_xref="GI:72392476"
FT                   /db_xref="GeneID:3659195"
FT                   /locus_tag="Tb927.8.2060"
FT                   /transcript_id="XM_841946.1"
FT   CDS_pept        644458..653307
FT                   /locus_tag="Tb927.8.2060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392477"
FT                   /db_xref="GeneID:3659195"
FT                   /translation="MLAESPGFAKALSTLTLLGTESFYSTTLEWRKRVTDIIHMTSDEQ
FT                   LPALLMRVYDVLLQVLLDDGRKQPNYLELASTAVAVMCFVHRLFLHYREERLLLDEYRR
FT                   WVFLRAVVRTFEFTLSNHFEGSAALSDASRGVIALMFLPDADLSRLSVGEAEFSAEDAS
FT                   FQRALHLAHSFMPSAKDLGAFLECLVCCIESLLSVRSVLGHPEVETTDFGVVFSVLFPL
FT                   QSAMAQRYEHAERLFRSICSIASAIRGPPSATTSSGTAKGVANFFSAVFTPSQVNTIQR
FT                   FVSSVGASGSPKRSPITCREAVECVTSFFVCATEEMAIEACARPLFDLVCLDDVEEELV
FT                   RFVLYSCTENLLLLKPCQLQRVTQLLLTAVKRGIAISETVSSVAAVLRKESKAVVEVKI
FT                   FVLEFLSFYSTAVSHASEVETLHSVFKWTLEEVTSISDWVQPQAVSYLAAVTQFVRSAL
FT                   ASAPLVALLARLEWPHEVLLLLLRAHGDGVREVAVTFRNLFCSMVFNEGQFVDVLISEL
FT                   RAMGGQSPWPSQISILLCVFVYLLQDKRGAWAAIRSNDIYVCLYLLHYLDQSTCIEEDA
FT                   HLIGTSLALLLSHLRWSEAGGIVAHYVDAVRTPWMVQLLVDLATGFYTTTKNLIAADAM
FT                   RVETVKTMTPGSRLCCEVVGGFSIPLSCRFEHTFPFGVLLRWIVEPGNQSGDWQKNLME
FT                   LLSGMLHRRCLPLVDDAFTSTVVKQKLYELLPYVADVSRRDVLALLSSSKEYLTLEDVS
FT                   NAQAIWERLAYGRIGEGLQHEFHDYITWYGNGALHGVLRGVQKGCSLNDRFTTAVWVYW
FT                   ESCIGTDTGSMIQLWELLWPGAEGSTKVSLSVDTMQRKVIFAVSPADEAQQVVTLPFIP
FT                   PGQWMHVVVSFLCNRLFSSTVTAFYDGVRTLQTDITVPGSHTFLPYPGGPSFMARILSE
FT                   STYDFTCTVGFSHEGSSEGCMQRFVSFQLFNAALSQLEVMSLFCVDPYSLTGLRAAKRC
FT                   PLELPLLRPEALRYLVASAAHGELQELTSSRALNFAPFPAEFLILSLHVQNAELVECSQ
FT                   LQSLHNKRWVVPDSAGRNGVTNFLLHGSHSEPVATGGNITKVLISHNVPCEWLRWLCVI
FT                   SCAYDEVTMPNTKNVLDSADAKMAVLQRIAATTLRIIATYYWKAEEVSDGNVAIFINYV
FT                   TLQVKQRPQVYLATTDGVDAVFGLGAAKESTGEHCVVYNTVPVEDVFFNWKVTSFLPEQ
FT                   CQQRILFHLTALLQKSNPFRAVNALRLQHSSFFDGFICGLVREYVWPPVLESAVAVIAL
FT                   YIECIAGDAVALREVLNLCASIVPVERDVLTVAKRLVSKIPLVAFECIVVVVLNHLLKV
FT                   LCGACVSLHNEGLMFAEALSHAMPQCWFHILTSEWAHPVSVTMAMHLFTLCYKRSETFR
FT                   RRFGDVIPLLYENLRHHAHQSDLLIVLISGFWGSDWDQQKPPYALLNQLYTTSEGTVPS
FT                   FLQLAMHLLGRSASLLLRPDAAVNYPHITCASFYAAMGAAATAEHCRARSQLRCYISVV
FT                   VFCARLRRGQKIPDDGANRISFTKRESADHGEMRRTVVAILQWVARRYPSDRRVSKAMY
FT                   VSQKSYNPMDMALLCLFPALPMDKDVGSVGNMPLPLLDVVEGLGTTVGHRDIFDGGYSG
FT                   TGGFDFDDCDDEREELVCDARGPNTSPATEARDCDFDALLHQPESELYNACRALFVAHI
FT                   KRYARSAKCQPFVTGRKSVRSPPKLVLALQRALALCPSGIGLRARYMFCVAVCCFCLKA
FT                   LTDMLREEQPGETGQCVLDNMVATGKYLADRLVSGAATPTMAVTKFLQHLLKLHLNTEQ
FT                   VKDLCESLSECLLLLMDSVSCGRDARSAASVIDSLHDEHIGVFGYRIPSEELLRLTTHR
FT                   LLDISEVLLASDVDRHSVNMEKLVGLWRTFLVANREVPFFRLVWNTEEKAARVFYMLTE
FT                   STDGGVGDLVAWVMADHSNFKQSLCKDEWTQMTLRKTFLQKRDRRWAACAVEQRDRECA
FT                   DLMSSCKVKCNAMNEEWSKLTDTSTFVDTTLLARRIECCDVLHRHLQVQLLPNYGMEEK
FT                   PGTLHLHPSGAVGYPCGVPFDLLHNLTNAHIRYPSLRCRLAASTASDDGSVSSHSRASV
FT                   PAALLRIVGSHFTNPVLFVGNVYYLHGDECSISVMSVTPREVVIVGDSQFSASGDFSIG
FT                   VLNPRDAWGTLSLDNGSPSCDNRNFLPWLSERGNTEKLEIARHSCCFRTICVESRVPNS
FT                   PSFTWRFSTGSILKVHQRFFQHRPVALEFQLENGDRCFIAALDERLCFSRAKQEEIMSA
FT                   VSRVAPQADMETYSQKESRMSELGERWKQRRISNRMYLLQLNDIAGRTVADMGQYPVMP
FT                   WVLSDYESSTIDLRDPGVYRDLAKPIGALNEAKERQLRDRYEQWFDKSQPPFHHGTHYS
FT                   SSAVVMYYLIRLQPFTQRSVRYQGGRLDIAGRIFHSVSEAWNSCGGVGDVKELVPEFFC
FT                   LPEMFMNKSRIDLGVRLDGVQLGDVVLPEWCGGDVERFVHLHAEALESDVVSGKLHEWV
FT                   DLVFGNKQRGRGAVDAINVFLHLSYGQAVGRAIAEASSEEDCKAIVATAANFGQTPRQL
FT                   FNRAHARRFDNRYGPTPQQAFINEAGKLFVRWRSVCYPWGNKRCCTPITSLRIVDSSAI
FT                   ASTRFSLILPTTPMQVCHYSNVTRELSCHEYGKPTLLCVLPNVWHQGYGELTTMCTSSL
FT                   GGIICIGTTNGKVVICSRVTSTAPFTIMSILNACRNDDSAPVKLLKMWNSGHLSVVCED
FT                   GPRGSLWHVAHSGVMFCFKFDISDVVDESSTIRDITRDEQSNCYFIATHNHIVQLSSTG
FT                   RVLGVASVSKASTATTARKGTTAPPANNDAAADGPKQHFCAAEYINFESYSKTNILLAG
FT                   HEDGTISFWTVRPLLGFDQNTFATEIKMFHSFTVDGDTRITTITHDGAGFSAGTASGEV
FT                   HTYSVPDPFADEE"
FT                   /protein_id="XP_847039.1"
FT   gene            653501..653583
FT                   /db_xref="GeneID:4443237"
FT                   /locus_tag="Tb927.8.2062"
FT   snoRNA          653501..653583
FT                   /db_xref="GeneID:4443237"
FT                   /locus_tag="Tb927.8.2062"
FT                   /product="C/D snoRNA, TB8C3C1"
FT   gene            653618..653704
FT                   /db_xref="GeneID:4443238"
FT                   /locus_tag="Tb927.8.2064"
FT   snoRNA          653618..653704
FT                   /db_xref="GeneID:4443238"
FT                   /locus_tag="Tb927.8.2064"
FT                   /product="C/D snoRNA, TB8C3C2"
FT   gene            653762..653843
FT                   /db_xref="GeneID:4443239"
FT                   /locus_tag="Tb927.8.2066"
FT   snoRNA          653762..653843
FT                   /db_xref="GeneID:4443239"
FT                   /locus_tag="Tb927.8.2066"
FT                   /product="C/D snoRNA, TB8C3C3"
FT   gene            654055..654119
FT                   /db_xref="GeneID:4443240"
FT                   /locus_tag="Tb927.8.2068"
FT   snoRNA          654055..654119
FT                   /db_xref="GeneID:4443240"
FT                   /locus_tag="Tb927.8.2068"
FT                   /product="H/ACA snoRNA, TB8Cs3H1"
FT   gene            <654365..>654964
FT                   /note="synonym: Tb08.26N11.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659197"
FT                   /locus_tag="Tb927.8.2070"
FT   mRNA            <654365..>654964
FT                   /db_xref="GI:72392478"
FT                   /db_xref="GeneID:3659197"
FT                   /locus_tag="Tb927.8.2070"
FT                   /transcript_id="XM_841947.1"
FT   CDS_pept        654365..654964
FT                   /locus_tag="Tb927.8.2070"
FT                   /gene_family="HOG000137442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392479"
FT                   /db_xref="GeneID:3659197"
FT                   /translation="MGCGGSAPANKDKHVGADPPKPSEHSEHSKPSDPSDPADATRFKQ
FT                   FCTLPLHDKDKPVAAAAIRVTDPKCISDILPPEFLEGKKVHNEFCAITLSFDDGKPEDE
FT                   GLFEKLKELEGTSIELKPTHIVMNEKVAAIGVCNNDEFPCQDAHPHILVATAPDATQED
FT                   IDDVTKKGKIKIFCARKLPDLPPDITIPGEFRFMHW"
FT                   /protein_id="XP_847040.1"
FT   misc_feature    655380..655455
FT                   /note="T-rich"
FT   gene            655717..655781
FT                   /db_xref="GeneID:4443241"
FT                   /locus_tag="Tb927.8.2075"
FT   snoRNA          655717..655781
FT                   /db_xref="GeneID:4443241"
FT                   /locus_tag="Tb927.8.2075"
FT                   /product="H/ACA snoRNA, TB8Cs3H1"
FT   gene            <656024..>656584
FT                   /note="synonym: Tb08.26N11.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659194"
FT                   /locus_tag="Tb927.8.2080"
FT   mRNA            <656024..>656584
FT                   /db_xref="GI:72392480"
FT                   /db_xref="GeneID:3659194"
FT                   /locus_tag="Tb927.8.2080"
FT                   /transcript_id="XM_841948.1"
FT   CDS_pept        656024..656584
FT                   /locus_tag="Tb927.8.2080"
FT                   /gene_family="HOG000137442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392481"
FT                   /db_xref="GeneID:3659194"
FT                   /translation="MMGCGGSKLSAKSKQADADPPKPSDPADAHRFERICTLPLHDGEK
FT                   PMIFGAIMINDLAAVRSLVPADYLEGKNMQDEFHITTIYLGGKPPQDDELFKKLQTLEG
FT                   TSIQVAPVRIASDAKATAIEIRNNNEFPCQNVHPHITIATAPGVPAKYSNELLSKVSTE
FT                   TSDIKVMELSPDVSISGVFQFVR"
FT                   /protein_id="XP_847041.1"
FT   gene            657195..657277
FT                   /db_xref="GeneID:4443242"
FT                   /locus_tag="Tb927.8.2083"
FT   snoRNA          657195..657277
FT                   /db_xref="GeneID:4443242"
FT                   /locus_tag="Tb927.8.2083"
FT                   /product="C/D snoRNA, TB8C3C1"
FT   gene            657312..657398
FT                   /db_xref="GeneID:4443243"
FT                   /locus_tag="Tb927.8.2086"
FT   snoRNA          657312..657398
FT                   /db_xref="GeneID:4443243"
FT                   /locus_tag="Tb927.8.2086"
FT                   /product="C/D snoRNA, TB8C3C2"
FT   gene            657456..657537
FT                   /db_xref="GeneID:4443244"
FT                   /locus_tag="Tb927.8.2089"
FT   snoRNA          657456..657537
FT                   /db_xref="GeneID:4443244"
FT                   /locus_tag="Tb927.8.2089"
FT                   /product="C/D snoRNA, TB8C3C3"
FT   gene            <657751..>658335
FT                   /note="synonym: Tb08.26N11.610; cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase, putative"
FT                   /db_xref="GeneID:3659196"
FT                   /locus_tag="Tb927.8.2090"
FT   mRNA            <657751..>658335
FT                   /db_xref="GI:72392482"
FT                   /db_xref="GeneID:3659196"
FT                   /locus_tag="Tb927.8.2090"
FT                   /transcript_id="XM_841949.1"
FT   CDS_pept        657751..658335
FT                   /locus_tag="Tb927.8.2090"
FT                   /gene_family="HOG000257404" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase, putative"
FT                   /EC_number="5.2.1.8"
FT                   /note="go_function: peptidyl-prolyl cis-trans isomerase
FT                   activity [goid 0003755]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:72392483"
FT                   /db_xref="GeneID:3659196"
FT                   /translation="MKVVVNEMSQVVEIITNEGVISVELYDTFAPRAAESFRRFAESGQ
FT                   LDGAVFDRMVPTFLLECRLSEFSVYGELVGREENNHLHHTGAGILTCFGTVLESGAFFI
FT                   TLGPQPELDNVCTIFGRVRSGMRVVEKISRSRVAEKTFRLYTPVVVERCLTRVLPKERR
FT                   PECVGGEQLDVLPQSVSRHCGTQSSILNDLE"
FT                   /protein_id="XP_847042.1"
FT   gene            <658652..>659149
FT                   /note="synonym: Tb08.26N11.630; vacuolar ATP synthase 16
FT                   kDa proteolipid subunit, putative"
FT                   /db_xref="GeneID:3659193"
FT                   /locus_tag="Tb927.8.2100"
FT   mRNA            <658652..>659149
FT                   /db_xref="GI:72392484"
FT                   /db_xref="GeneID:3659193"
FT                   /locus_tag="Tb927.8.2100"
FT                   /transcript_id="XM_841950.1"
FT   CDS_pept        658652..659149
FT                   /locus_tag="Tb927.8.2100"
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar ATP synthase 16 kDa proteolipid subunit,
FT                   putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_component: hydrogen-translocating V-type ATPase complex
FT                   [goid 0016471]; go_function: hydrogen-exporting ATPase
FT                   activity, phosphorylative mechanism [goid 0008553];
FT                   go_function: pyrophosphatase activity [goid 0016462];
FT                   go_process: ATP hydrolysis coupled proton transport [goid
FT                   0015991]; go_process: protein homooligomerization [goid
FT                   0051260]"
FT                   /db_xref="GI:72392485"
FT                   /db_xref="GeneID:3659193"
FT                   /translation="MLSDDTCQPEAVLFGMLGAAASLALSNIGAAYGTAKSGVAVAHLG
FT                   IVEPSRVMRGIVPVVMAGILGIYGLIVSVIISNNLKLSGYAMFSGFMHLGAGLAAGFAS
FT                   LASGYAIGIVGDICCFAYAKTEKIFVPMILMLIFAEALGLYGLIMALLMNNRATSYTGG
FT                   CS"
FT                   /protein_id="XP_847043.1"
FT   gene            <659961..>661034
FT                   /note="synonym: Tb08.26N11.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659192"
FT                   /locus_tag="Tb927.8.2110"
FT   mRNA            <659961..>661034
FT                   /db_xref="GI:72392486"
FT                   /db_xref="GeneID:3659192"
FT                   /locus_tag="Tb927.8.2110"
FT                   /transcript_id="XM_841951.1"
FT   CDS_pept        659961..661034
FT                   /locus_tag="Tb927.8.2110"
FT                   /gene_family="HOG000257405" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392487"
FT                   /db_xref="GeneID:3659192"
FT                   /translation="MQGATVSAPNFRPPTELLDEVPQPEGSSWWLQTSAARLQSFELRM
FT                   LHAIKYRQGFVAGLNTITTLGLQQSAANSSKEIMVLIHGFAGGLACWAQNWEFLSEHYI
FT                   LCALDLPGFGRSMRPNVTARTPREVLDFFCQCLDDWFGEMRFKIPVILVGHSFGAYIAA
FT                   HYSMRRGPSCVRLLVFVDPWGVNRRDQSGSKRVPFTWRLALSIANRMNPLTLVRAAGPL
FT                   GPLFFRLIRPDFANRWRGYLPDPVTFYEYTYHCNAQLPPLGEELFKICYHHDITAKEPL
FT                   EDELPSSLSKDIPLVLLYGSETWMDAERGTTMADKMEGMGFKVEVDTVMSAGHQVFTDN
FT                   PSEFNNKLLLALAELLA"
FT                   /protein_id="XP_847044.1"
FT   gene            <661502..>662602
FT                   /note="synonym: Tb08.26N11.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659199"
FT                   /locus_tag="Tb927.8.2120"
FT   mRNA            <661502..>662602
FT                   /db_xref="GI:72392488"
FT                   /db_xref="GeneID:3659199"
FT                   /locus_tag="Tb927.8.2120"
FT                   /transcript_id="XM_841952.1"
FT   CDS_pept        661502..662602
FT                   /locus_tag="Tb927.8.2120"
FT                   /gene_family="HOG000257406" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392489"
FT                   /db_xref="GeneID:3659199"
FT                   /translation="MWEETYVRACANLGVQPRNEVLAAVGGTAQLCGNTFANFENRLTD
FT                   EELAALCETCRQISLVAVVRLPYNNITCRGATALAKAMKEGFSTLQYLDLSYNSINEEG
FT                   ANAIAAAATNYEMLSTLLLNGNPIGGGSGPCLKTLLESENTQLVTLDLEQTDQGLKSLV
FT                   HIARGLVHNTTLTTLNLGRPLMTNPMDVSYVVEHLSLALKENRTLRFLGLSHFNMADCD
FT                   LALLLSTLRDSAVTTLSLKGNKLSQASGEPLAQLLAHRPDFLSLDVTANRLRDVGALAI
FT                   AAVIANHPGLRELQIGFNTIGGVGISALAQSLAANASITTLKLWGNDLTDESVRDLYAI
FT                   RGRFESMEVTDFSFYVVDGCPMVARE"
FT                   /protein_id="XP_847045.1"
FT   gene            <663075..>664613
FT                   /note="synonym: Tb08.26N11.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659191"
FT                   /locus_tag="Tb927.8.2130"
FT   mRNA            <663075..>664613
FT                   /db_xref="GI:72392490"
FT                   /db_xref="GeneID:3659191"
FT                   /locus_tag="Tb927.8.2130"
FT                   /transcript_id="XM_841953.1"
FT   CDS_pept        663075..664613
FT                   /locus_tag="Tb927.8.2130"
FT                   /gene_family="HOG000257407" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392491"
FT                   /db_xref="GeneID:3659191"
FT                   /translation="MWTVFAPDQNQLYALYMHRCGAHGVGKPSREMLALLTEDDKAWQS
FT                   RVTEEAHQRGVKVEDLQEIEGDTVERQRERESVTPLAFHRVFRLTPFIANNERDGSAAR
FT                   IHVGARGLLAILDVVRELPFLEVLDLSNLTSLFLADTYQYDGVKGNDVISALCSIAATH
FT                   PSLRVIDVRGQPLGTLAAHHFLELLKENTRIQEVHYDTDAVACHLVAAINKQQEKNAAT
FT                   PRQPPKLPQEPSDMIRRMPFLDRKTVKEQQLLRRLVESETGIGDVMSEEEVSTFVLYAR
FT                   TMSTTEVITRSRGLLGDGIHLFLLKSGVIRAAAEARGFEMRRGDFFGDTHGDILFSQNL
FT                   LQEVERGVVYAIPIEHCGALRAVWARRVAAHYSTLKYNTLLQAVDVWTRLRTCCCSVSR
FT                   VFEEGEEVIAKGDPFKGLFLVVSGVFSVIGCAGARVGGKEFTVGDAFGEEPLLTRRECS
FT                   SVTIVAGKNESSGENCCLVVEGCAARILFNYLRPVLLTLVSAYSQHEELQPVQK"
FT                   /protein_id="XP_847046.1"
FT   gene            <665114..>665812
FT                   /note="synonym: Tb08.26N11.690; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659198"
FT                   /locus_tag="Tb927.8.2140"
FT   mRNA            <665114..>665812
FT                   /db_xref="GI:72392492"
FT                   /db_xref="GeneID:3659198"
FT                   /locus_tag="Tb927.8.2140"
FT                   /transcript_id="XM_841954.1"
FT   CDS_pept        665114..665812
FT                   /locus_tag="Tb927.8.2140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392493"
FT                   /db_xref="GeneID:3659198"
FT                   /translation="MACGAIVLLQDSCSAIAVLEEVRKHVRMRGNEAEAICSNINDYVY
FT                   HSLAAQATFVLGETEVPRMLARAGVGELQAYTINCSGGKAELCLFCVGTSSTVLPCFVA
FT                   LPSSRGRVFLDMCLTWAFRAHYEQARQCASRFKLALLQTIGGGWASLRRVDKALRCALL
FT                   LRETAAELNDAVTERKSRVFVGWALLWSGDVRQAVTIFEQECKEARCEGDTAQERRCVA
FT                   ALHYVRHNAF"
FT                   /protein_id="XP_847047.1"
FT   gene            <666462..>666827
FT                   /note="synonym: Tb08.26N11.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659200"
FT                   /locus_tag="Tb927.8.2150"
FT   mRNA            <666462..>666827
FT                   /db_xref="GI:72392494"
FT                   /db_xref="GeneID:3659200"
FT                   /locus_tag="Tb927.8.2150"
FT                   /transcript_id="XM_841955.1"
FT   CDS_pept        666462..666827
FT                   /locus_tag="Tb927.8.2150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392495"
FT                   /db_xref="GeneID:3659200"
FT                   /translation="MTCNVTPEQELQVLQMILKLCAAGAEESGEKFRLKVRKALQESAN
FT                   DEAAIEAVASLLRHYGKVLKKLDGSYEKERELKRLRSERGALRASRFVDDQAESGDEDE
FT                   DEDVSGDEEVEDVEVET"
FT                   /protein_id="XP_847048.1"
FT   gene            <667841..>672586
FT                   /note="synonym: Tb08.26N11.730; multidrug resistance
FT                   protein A"
FT                   /db_xref="GeneID:3659201"
FT                   /locus_tag="Tb927.8.2160"
FT   mRNA            <667841..>672586
FT                   /db_xref="GI:72392496"
FT                   /db_xref="GeneID:3659201"
FT                   /locus_tag="Tb927.8.2160"
FT                   /transcript_id="XM_841956.1"
FT   CDS_pept        667841..672586
FT                   /locus_tag="Tb927.8.2160"
FT                   /gene_family="HOG000257411" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multidrug resistance protein A"
FT                   /note="identical to GP:16304672: multidrug resistance
FT                   protein A {Trypanosoma brucei brucei}; 99% identical to
FT                   GP:16304672: multidrug resistance protein A {Trypanosoma
FT                   brucei brucei}; go_component: integral to membrane [goid
FT                   0016021]; go_component: ATP-binding cassette (ABC)
FT                   transporter complex (sensu Eukaryota) [goid 0043191];
FT                   go_function: ATP binding [goid 0005524]; go_function:
FT                   ATPase activity, coupled to transmembrane movement of
FT                   substances [goid 0042626]; go_process: transport [goid
FT                   0006810]; go_process: response to drug [goid 0042493]"
FT                   /db_xref="GI:72392497"
FT                   /db_xref="GeneID:3659201"
FT                   /translation="MTPNKTPVGDIKLDDNTETNYPINTSGGEPTENHADTDLDTQYKI
FT                   HEYDTRHAELKQRLMQIWGDDVEYVARGEENANWLQKITYTWVKKYIRTAVKEELTLEG
FT                   LPTAQSDHRAHKCGRQLSAVTAESYYRRHLWDPIVGAGVSRRGDSQSRGTLRWVGVLQS
FT                   GRYKEVMAAVTWQTPPLQRLSEHENGVSPFFSGAVHGEVLFPPEASNNSTMEKPEDLQL
FT                   LGCGSVSANVVDQLAFPGRISAARNLFNAKRGIILWQFPLRVLGDLLTLTVPLILKEYV
FT                   RYLDAPSHTWGRGMLLAFGLFVAHCVQSVVLHWFYHMGIKGGLCWRSALSAVILEKCFV
FT                   ISPKALALPEMNTGRILNMLTTDVERANEFVQLCLYLWSSPVIFIASTFLLYSLVGWSA
FT                   LVTVVVLPLTLTLNGYIVRQAMKIQRKIMKVADSRVKATNEFISGIRIVKFMAWEPSFI
FT                   AAIEKQRDTELRYLRRLQRCHTLTSFLNNAMPPLTIAIVFVTYHLLGNKLTPEVVFPTL
FT                   MLLSVIRMPFLLLPMTLRTVTQFVISMKRVSVFLECENTVKGVGDVTELLATQKNAPPC
FT                   WCEAAAVFDNAEVTALFPVKLPRIPTVVTSLCGRIMARLCCCGACQPKRHSLSPLEVID
FT                   SEDEGEGSAQAGNEKPPGRPGGNQKQPSPEETPRGVNKKVGEARYQLRPKKLLRDISIE
FT                   VPKGKLTVVLGATGSGKSTLLETLLGNFEVTHGSVLAAKSFAYVPQQPWIMNATLRDNI
FT                   LFFTPENEERLHKAVRVCQLEADLQQLPAGMETEIGEKGINLSGGQKARVSLARAVYAD
FT                   RDFYILDDPLSALDAHVGELIVRDLILGHLACKTRVLATHQLHVLPHADFVVAMEDGTV
FT                   KFAGESKDFMRSPLCKKLAAEGCERKHEGSSDREVDESDILDGKPVHSNGNEPTQDGGN
FT                   EGGEKKNTEAVDGRLTLMEEKAVGSVPWKTYKRYVGACGGGCKALLVIFTYFFTELLTV
FT                   AANLWLSMWSTNKFKLDETTNLYVYLGIVIAGTISVPLRYTTTFGSMRHGSRTLHRFLL
FT                   RSISTGKMSFFDTTPLGRIVNRFSRDIDRLDNSLPMTFIFLMQVTFSIISAIAVYIGSQ
FT                   PYVLVALIPVCYVYYRLTLFYSASNREIRRVGSTAKAPLMSLVGEALVGSSTISAYGCQ
FT                   TAIMKKALAYIDLVYASSLLENAANRWIGLRVEFLNTVVILVIALTGVIGAMLGVDSHD
FT                   IALVSLSLTMALMTTAALNWLVRMCGSMEADMNSVERILYYTDNIENEDMPELDELVRA
FT                   AKKAEETTPRPKASSATTTAVHVPVNGPVERNVVPGWVEFRDVDLRYRDGLPLVLNKVS
FT                   FRVNPGQKVGIVGRTGSGKSTLLLTFMRMIDTCGGEIIVSGRPIASYGLRELRQLFSMI
FT                   PQDPVLFDGTVASNLDPFSQATPEEVWRALELVGMRGHVAAESGGIEARVQEGGLNYSV
FT                   GQRQLLCLARALLKRDSAFILMDEATANIDHALDKQIQNTVRTAFANHTVITIAHRLHT
FT                   VAQYDKIIVMDNGVVAECGAPRDLALSTSSKFRELLNSLGTNEVKNFMAVVEGAAASRS
FT                   SG"
FT                   /protein_id="XP_847049.1"
FT   repeat_region   673033..673057
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            <673605..>673919
FT                   /note="synonym: Tb08.26N11.740; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659202"
FT                   /locus_tag="Tb927.8.2170"
FT   mRNA            <673605..>673919
FT                   /db_xref="GI:72392498"
FT                   /db_xref="GeneID:3659202"
FT                   /locus_tag="Tb927.8.2170"
FT                   /transcript_id="XM_841957.1"
FT   CDS_pept        673605..673919
FT                   /locus_tag="Tb927.8.2170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392499"
FT                   /db_xref="GeneID:3659202"
FT                   /translation="MRRCACKMTASWLLIYRHGARRPFGNAPNRVRPVETPCDFSSWQS
FT                   SREVSGFLVIVAVFAVPVWFIVLSGTQEERKREVVLEWARKQAERHGHESNNSGAEEKV
FT                   "
FT                   /protein_id="XP_847050.1"
FT   gene            <674373..>674867
FT                   /note="synonym: Tb08.26N11.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659205"
FT                   /locus_tag="Tb927.8.2180"
FT   mRNA            <674373..>674867
FT                   /db_xref="GI:72392500"
FT                   /db_xref="GeneID:3659205"
FT                   /locus_tag="Tb927.8.2180"
FT                   /transcript_id="XM_841958.1"
FT   CDS_pept        674373..674867
FT                   /locus_tag="Tb927.8.2180"
FT                   /gene_family="HOG000257413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392501"
FT                   /db_xref="GeneID:3659205"
FT                   /translation="MRRRGSTLFCEGAVLTWRRSFARGRPYTPLGTVQDFTSSPHHAQL
FT                   AEKQRELDRMCGRPPSHLYEGPTITTPHGARPLFERDMRDDPRNDELPEHYVAAQQRMA
FT                   VLQSDSYGESIRGVVAPPPPLGEFDAVRAYQTPRVELGTVWWTAMATIVLIFLLMVRYG
FT                   H"
FT                   /protein_id="XP_847051.1"
FT   repeat_region   675526..675567
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <675666..>676235
FT                   /note="synonym: Tb08.26N11.760; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659206"
FT                   /locus_tag="Tb927.8.2190"
FT   mRNA            <675666..>676235
FT                   /db_xref="GI:72392502"
FT                   /db_xref="GeneID:3659206"
FT                   /locus_tag="Tb927.8.2190"
FT                   /transcript_id="XM_841959.1"
FT   CDS_pept        675666..676235
FT                   /locus_tag="Tb927.8.2190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392503"
FT                   /db_xref="GeneID:3659206"
FT                   /translation="MRQCSRTINGLGVSCFSPCMWKECTSRRGKHTIAKGKQVITEERE
FT                   VRREPTASKANLPLREASYITRSVKRFLTTSSRDRWNRRDVICPRQYAREYRNRFQKVN
FT                   DAFHSAGKKGRMYSFEAITLQFSGVEWSYLILPATLALFVIVFIGIVERRRRGGELLVL
FT                   QQQVEAWAAERSRSDPYLETVGSTRG"
FT                   /protein_id="XP_847052.1"
FT   gene            <676674..>677243
FT                   /note="synonym: Tb08.26N11.770; terbinafine resistance
FT                   locus protein (yip1), putative"
FT                   /db_xref="GeneID:3659204"
FT                   /locus_tag="Tb927.8.2200"
FT   mRNA            <676674..>677243
FT                   /db_xref="GI:72392504"
FT                   /db_xref="GeneID:3659204"
FT                   /locus_tag="Tb927.8.2200"
FT                   /transcript_id="XM_841960.1"
FT   CDS_pept        676674..677243
FT                   /locus_tag="Tb927.8.2200"
FT                   /gene_family="HOG000163579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="terbinafine resistance locus protein (yip1),
FT                   putative"
FT                   /note="go_component: Golgi apparatus [goid 0005794];
FT                   go_component: integral to membrane [goid 0016021];
FT                   go_process: vesicle-mediated transport [goid 0016192];
FT                   go_process: response to drug [goid 0042493]"
FT                   /db_xref="GI:72392505"
FT                   /db_xref="GeneID:3659204"
FT                   /translation="MSQQVGEVPSPYAHSTLDEPVLETIKRDFFAIGRKLLAVLIPPLG
FT                   SKSDLRDWELWGPLLFSLTLAIILALSAGEHQGGLIFSAVFVLVWVGAALVTLNAKFLG
FT                   SPISFFQTVCVMGYCMAPLCVGAIIGVLIPSFWVSLVVSSFVWVWCCWAALCSFRGCVS
FT                   PDREMLVVYPVGLFYLFMTWMVMVGS"
FT                   /protein_id="XP_847053.1"
FT   gene            <677634..>678743
FT                   /note="synonym: Tb08.26N11.790; pteridine reductase,
FT                   putative"
FT                   /db_xref="GeneID:3659203"
FT                   /locus_tag="Tb927.8.2210"
FT   mRNA            <677634..>678743
FT                   /db_xref="GI:72392506"
FT                   /db_xref="GeneID:3659203"
FT                   /locus_tag="Tb927.8.2210"
FT                   /transcript_id="XM_841961.1"
FT   CDS_pept        677634..678743
FT                   /locus_tag="Tb927.8.2210"
FT                   /codon_start="1"
FT                   /product="pteridine reductase, putative"
FT                   /EC_number="1.5.1.33"
FT                   /note="go_function: oxidoreductase activity [goid 0016491];
FT                   go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:72392507"
FT                   /db_xref="GeneID:3659203"
FT                   /translation="MYCTEYKFPCFRHTHTIKLVLLHLRECNGVHPPQFYRRMYEWVGS
FT                   VVIFSPTIIFAPIHDPYLEGGEKWRINNIVQGASISVAVKKKRKSPTYPLFRVKGVMEA
FT                   PAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQAD
FT                   LTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVA
FT                   ELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHA
FT                   LVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIAD
FT                   AVIFLVSGSAQYITGSIIKVDGGLSLVHA"
FT                   /protein_id="XP_847054.1"
FT   repeat_region   678827..678855
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <679752..>684239
FT                   /note="synonym: Tb08.26N11.820; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659207"
FT                   /locus_tag="Tb927.8.2220"
FT   mRNA            <679752..>684239
FT                   /db_xref="GI:72392508"
FT                   /db_xref="GeneID:3659207"
FT                   /locus_tag="Tb927.8.2220"
FT                   /transcript_id="XM_841962.1"
FT   CDS_pept        679752..684239
FT                   /locus_tag="Tb927.8.2220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:72392509"
FT                   /db_xref="GeneID:3659207"
FT                   /translation="MDTTNGGGNCNVRGLGGSLIRLLELYPVKQVAADEGTTETEQGMS
FT                   KEEVNSPSPVKSQREGNMKRNRVVNSHPPKQDVLDCAEVGQYLIATGSKDKVSAMQANV
FT                   LEVRSALSAPSPVAIPNANQCPSNVLLTPLVPTGEYVPSYDTKEQIKYSLVGEPGTRCQ
FT                   SPLPLFRGSRVDDQVREATMFFSNLLAARQHECADQEMGPLHGGSGAPYQLPAFYDILS
FT                   RTIGTSRSREAGQESREAGGYLPLISPVHAGATSSGRLFRGVRHSSARLRSNTPLGNDF
FT                   CVGGVCGLMGRRLIGVPVHDRRLNAHLMSSWEKGVKARLPARKAFKAIKSSCWWRLAGS
FT                   REGLLLAARLVNLDADVYESLLTRWVDGIRHSYTRFVTVNVDAFVSEDIGQNLITGPRG
FT                   RKLGPVLPFSGSEAVMNSLFPGDVELSDMLGVARQLGYLQMGGALCEDDVARVLQCDTR
FT                   TIQRELRRLMLQRSGGTVQPLGVLPIFEGKGCRLYEPNTAIRQISRAILRARRRAAAEE
FT                   AKKKGRKIRFSLLPDVTTCSRVLQRRLQKIAASRPGDVQALLEQLGVLADAVNSGGLES
FT                   IKSCPEVLSRLQEIIADMPPDVQASLQQLGFLTDDSGRISVSSDGRPRVSRGRSRKAAN
FT                   VVPSNVHKFLKKLDNISRTITGGGPPESDGSAELLQRGLQEIAASRPGDVQALLEQLGV
FT                   LADAVNSGGLESIKSCPEALSRLQEIAASMPPDVRASLQQLGFLPDGDGVIGVENLCEV
FT                   AKRQQELSSGAPHPSEGMRGATTEGLKSPTEGASFSVSARRKIRRRTPKVVKMAAADEK
FT                   GPIVHNVPPSSVKDQGEGPAARDKSALSASSPLGDEATAWPGNHAAFAVDESEADAKDQ
FT                   SWEDTAFGTKKGLLKKRRRLRSKTSSELETLTDDDAERALFADKHASFGKRSSPGRFRG
FT                   RTSPMGVLGIESFPTSGDADDPLSGFVASQLKESYSGPQEGEETDDYEYTPRERSRMNR
FT                   SRAQPVFSEWDTEQLPPQLPSGAKDPRLLSQTASILVFPNSGRRGSRAASVASRTACSD
FT                   TESVRGVEDPWELSSMFSNDDNELALFLATFPDEERHVQLRREAHRVLDDINAGSKVLE
FT                   EYAIKLKVRPSSMGPSAGAGGGMQPCEQEWTERDEQMEKRMLECRVDIQSMVERFKAEA
FT                   QEEYADLWRTLQELRKRVEVQEALLEETKLDINRLSYPMEGEDTDAFALRLTREVNAFA
FT                   EQNKLDPQQLKDLTTAKQDREAAVRSFLESFARTRGRRGGVSVGCQCTPKDLGYIDTEV
FT                   LELNKQMEDLQYHARGLLNSIKLVVISMGNVLSFHSALELESTCKRCFCIFEEPRTLWP
FT                   CGHSFCLHCLTQMISKGGELICDECGTLCLVGYTPNFAIEMVAGYQLMWINSAEDDVSE
FT                   DSLCSSPSPKSSLTSSNSKGSKPSSHAGQKRRTVEKVLAGLLKDLLSTQGSGKATRKTE
FT                   RKSKKPSKSTSGELPLPPLKGGLPPSAATKVQCA"
FT                   /protein_id="XP_847055.1"
FT   gene            <684814..>685950
FT                   /note="synonym: Tb08.26N11.830; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659208"
FT                   /locus_tag="Tb927.8.2230"
FT   mRNA            <684814..>685950
FT                   /db_xref="GI:72392510"
FT                   /db_xref="GeneID:3659208"
FT                   /locus_tag="Tb927.8.2230"
FT                   /transcript_id="XM_841963.1"
FT   CDS_pept        684814..685950
FT                   /locus_tag="Tb927.8.2230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392511"
FT                   /db_xref="GeneID:3659208"
FT                   /translation="MHFFLFDQNITHYFAWLVVLSLCSPFSPTFYQLFEGSTMKFKATV
FT                   RDRRMLVALCEACRRSENGGVVLKLHASRIRVFTRTRAGSDIQVVAVCRTDVVFGEFKA
FT                   QLAGRNSRSKAAAEDDADDGDAIYCEIADTRRLTHVLRQSERCQLISIKLSTNQKRRPV
FT                   LRVSLGDTQTNLDVSHDVPVEVLGSNEARSLSAPSLSCAARPLVLDGLLELATFVDRAR
FT                   CASCEQVTFSAWKNKSSSKGSKDCNNAGSPVYTLLIEAECFLGSFALEYNSLTVAKEGE
FT                   EEEEEEEEEEEEEKEGAEGAPGTPGDTESFVEAQGSKQGPLLASVTVEARALARFLPIR
FT                   DLTVDFVWLYLDHQKAIVMYICASGCTKLLGCIPAVTN"
FT                   /protein_id="XP_847056.1"
FT   repeat_region   685646..685700
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gga"
FT                   /rpt_type="tandem"
FT   gene            <686483..>687904
FT                   /note="synonym: Tb08.26N11.840; tryptophanyl-tRNA
FT                   synthetase, putative"
FT                   /db_xref="GeneID:3659210"
FT                   /locus_tag="Tb927.8.2240"
FT   mRNA            <686483..>687904
FT                   /db_xref="GI:72392512"
FT                   /db_xref="GeneID:3659210"
FT                   /locus_tag="Tb927.8.2240"
FT                   /transcript_id="XM_841964.1"
FT   CDS_pept        686483..687904
FT                   /locus_tag="Tb927.8.2240"
FT                   /gene_family="HOG000224742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tryptophanyl-tRNA synthetase, putative"
FT                   /EC_number="6.1.1.2"
FT                   /note="go_component: cytosol [goid 0005829]; go_function:
FT                   tRNA ligase activity [goid 0004812]; go_process: tRNA
FT                   aminoacylation for protein translation [goid 0006418]"
FT                   /db_xref="GI:72392513"
FT                   /db_xref="GeneID:3659210"
FT                   /translation="MRRASHVCTSCELLGFQKQFLMLSNRGNSSGDNDVIDTSGGKFRN
FT                   GNGDGKDDDVVTPWNVSATGVRGVNYDRVLVRFKSQPIGEPLLKRMQDVCVERVKCNNS
FT                   ERGHNAERSAVGEEVQPLHHFFRRGIAFSHRDFDIALTNVQEALRSGTQGAYLYTGRGP
FT                   STRTMHLGHVIPFMLTRYLQDALGLPLVIQITDDEKFFFRDVPLHDNRCSDGIDIVTEN
FT                   IKDIIAFGFDPKRTFIFRNTSYMGSMYPTVVRLQRTMTLSAVKNTLGLIDNDNIGKASF
FT                   AATQAAPCFSSSFPCILGEQDFEKPLQCIVPCAIDQDPYFVLARASASRMKYRAPALLH
FT                   TKFLPALKGMRLKMSSSAEESGVITLHDSPEQVQKKMKKAFSGGSGTLDDMKTKGVDLE
FT                   ADVAYQFIRFFSPDDEMVGEVSAKYVVGEMNSCYVKSLAADVVVRHVLRNWQAKRKLVT
FT                   DEEVRRFTEVRNIMA"
FT                   /protein_id="XP_847057.1"
FT   misc_feature    688022..828536
FT                   /note="sequence corresponds to BAC RPCI93-26A17"
FT   gene            <688146..>690689
FT                   /note="synonym: Tb08.26A17.20; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659209"
FT                   /locus_tag="Tb927.8.2250"
FT   mRNA            <688146..>690689
FT                   /db_xref="GI:72392514"
FT                   /db_xref="GeneID:3659209"
FT                   /locus_tag="Tb927.8.2250"
FT                   /transcript_id="XM_841965.1"
FT   CDS_pept        688146..690689
FT                   /locus_tag="Tb927.8.2250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392515"
FT                   /db_xref="GeneID:3659209"
FT                   /translation="MDAQVGVVQQPVTTSSTIWVGECQCPKWKKSTHRAVEQNLTTSLE
FT                   CGGERDALLDVACGSGIDIDSFLREKWIRVAFTSSFGSNSRVRVRARRVRIGSHEFVVV
FT                   ERNVFGCDDSVYRKDNKLWEGLPRGQACVFVESGDRAGFIPIGRLQGLRKFNSFDGPYG
FT                   IRGRQPVSAVAMEAIDGDCGHISAFVHTGERYWLVGNKDTHLLVSFSVPEKDIFSNTAE
FT                   GGAITNEGDKPLQGANYSPPSLAVRIARLWGQTLRALPDEKSFGLHEFLSSNRYTACFD
FT                   AVLQDCGHLVDYGEDELLQFYALTQSGESLAEGLCVDPVSAIVNLQSFGLRVVPFHSEQ
FT                   CSSVPEILDLGTDEYSQYGGQVARRLNCRGAVMYGLDAQGIVVRLWKLPSHAYVVERAA
FT                   QEAIVTHRLSGTVLRDKLRRKLDRLPKEIRRCVTEWSSARLEPLLNLAAWLHIMGKVTP
FT                   EVGLDGLQEVRRSWITLQQQLVKHTKDMREHLQLYEPPVAEAAINNPDVIMCVGPQGCG
FT                   KSTFCRAFCVLLQKVGQKPRWINQDEVGGRNEFIEAIRRAKESDCTHILIDKMNLDDAA
FT                   RNADYASFNLKTITVAWVHPCDVDVMVSTCLERVCHRGNAHRTFRGTVSPGKKRKMMTI
FT                   IRGCVQRCEPPTTGIVIEANVLDPPAITIESVWKGLCRHTMSELPDIKDLSVADALEIA
FT                   RRYELLLSHSSRPFNCGIIKVVNSELLVALVPADYLEGKKMRKELDISTIYLGDRSHFD
FT                   LTLLSELQTLEGTSIQVAPVRIASDAKATAIEIRNNNEFPCQNAHPHITIATAPGVPAK
FT                   YSNELLSKVSTETSDIKVMEVSPDVSISGVFQFVR"
FT                   /protein_id="XP_847058.1"
FT   gene            691295..691377
FT                   /db_xref="GeneID:4443245"
FT                   /locus_tag="Tb927.8.2252"
FT   snoRNA          691295..691377
FT                   /db_xref="GeneID:4443245"
FT                   /locus_tag="Tb927.8.2252"
FT                   /product="C/D snoRNA, TB8C3C1"
FT   gene            691412..691498
FT                   /db_xref="GeneID:4443246"
FT                   /locus_tag="Tb927.8.2254"
FT   snoRNA          691412..691498
FT                   /db_xref="GeneID:4443246"
FT                   /locus_tag="Tb927.8.2254"
FT                   /product="C/D snoRNA, TB8C3C2"
FT   gene            691556..691637
FT                   /db_xref="GeneID:4443247"
FT                   /locus_tag="Tb927.8.2256"
FT   snoRNA          691556..691637
FT                   /db_xref="GeneID:4443247"
FT                   /locus_tag="Tb927.8.2256"
FT                   /product="C/D snoRNA, TB8C3C3"
FT   gene            691849..691913
FT                   /db_xref="GeneID:4443248"
FT                   /locus_tag="Tb927.8.2258"
FT   snoRNA          691849..691913
FT                   /db_xref="GeneID:4443248"
FT                   /locus_tag="Tb927.8.2258"
FT                   /product="H/ACA snoRNA, TB8Cs3H1"
FT   gene            <692159..>692758
FT                   /note="synonym: Tb08.26A17.40; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659214"
FT                   /locus_tag="Tb927.8.2260"
FT   mRNA            <692159..>692758
FT                   /db_xref="GI:72392516"
FT                   /db_xref="GeneID:3659214"
FT                   /locus_tag="Tb927.8.2260"
FT                   /transcript_id="XM_841966.1"
FT   CDS_pept        692159..692758
FT                   /locus_tag="Tb927.8.2260"
FT                   /gene_family="HOG000137442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392517"
FT                   /db_xref="GeneID:3659214"
FT                   /translation="MGCGGSAPANKDRHVGADPPKPSEHSEHSKPSDPSDPADATRIHK
FT                   ICTLPLHDKDKPVAAAAIRVTDPKCISDILPPEFLEGKKVHNEFCAITLSFDDGKPEDE
FT                   GLFEKLKELEGTSIELKPTHIVMNEKVAAIGVCNNDEFPCQDAHPHILVATAPDATQED
FT                   IDDVTKKGKIEIFCARKLPDLPPDITIPGEFRFMHW"
FT                   /protein_id="XP_847059.1"
FT   misc_feature    693174..693250
FT                   /note="T-rich"
FT   gene            693512..693576
FT                   /db_xref="GeneID:4443249"
FT                   /locus_tag="Tb927.8.2265"
FT   snoRNA          693512..693576
FT                   /db_xref="GeneID:4443249"
FT                   /locus_tag="Tb927.8.2265"
FT                   /product="H/ACA snoRNA, TB8Cs3H1"
FT   gene            <693822..>694421
FT                   /note="synonym: Tb08.26A17.50; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659212"
FT                   /locus_tag="Tb927.8.2270"
FT   mRNA            <693822..>694421
FT                   /db_xref="GI:72392518"
FT                   /db_xref="GeneID:3659212"
FT                   /locus_tag="Tb927.8.2270"
FT                   /transcript_id="XM_841967.1"
FT   CDS_pept        693822..694421
FT                   /locus_tag="Tb927.8.2270"
FT                   /gene_family="HOG000137442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392519"
FT                   /db_xref="GeneID:3659212"
FT                   /translation="MGCGGSAPANKNRHVGADPPKPSEHSEHSKPSDPSDPADATRIHK
FT                   ICTLPLHDKDKPVAAAAIRVTDPKCISDILPPEFLEGKKVHNEFCAITLSFDDGKPEDE
FT                   GLFEKLKELEGTSIELKPTHIVMNEKVAAIGVCNNDEFPCQDAHPHILVATAPDATQED
FT                   IDDVTKKGKIKIFCARKLPDLPPDITIPGEFRFMHW"
FT                   /protein_id="XP_847060.1"
FT   misc_feature    694837..694913
FT                   /note="T-rich"
FT   gene            695175..695239
FT                   /db_xref="GeneID:4443250"
FT                   /locus_tag="Tb927.8.2275"
FT   snoRNA          695175..695239
FT                   /db_xref="GeneID:4443250"
FT                   /locus_tag="Tb927.8.2275"
FT                   /product="H/ACA snoRNA, TB8Cs3H1"
FT   gene            <695485..>696084
FT                   /note="synonym: Tb08.26A17.60; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659213"
FT                   /locus_tag="Tb927.8.2280"
FT   mRNA            <695485..>696084
FT                   /db_xref="GI:72392520"
FT                   /db_xref="GeneID:3659213"
FT                   /locus_tag="Tb927.8.2280"
FT                   /transcript_id="XM_841968.1"
FT   CDS_pept        695485..696084
FT                   /locus_tag="Tb927.8.2280"
FT                   /gene_family="HOG000137442" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392521"
FT                   /db_xref="GeneID:3659213"
FT                   /translation="MGCGGSAPANKDRHVGADPPKPSEHSEHSKPSDPSDPADATRIHK
FT                   ICTLPLHDKDKPVAAAAIRVTDPKCISDILPPEFLEGKKVHNEFCAITLSFDDGKPEDE
FT                   GLFEKLKELEGTSIELKPTHIVMNEKVAAIGVCNNDEFPCQDAHPHILVATAPDATQED
FT                   IDDVTKKGKIEIFCARKLPDLPPDITIPGEFRFMHW"
FT                   /protein_id="XP_847061.1"
FT   misc_feature    696500..696576
FT                   /note="T-rich"
FT   gene            <697189..>697848
FT                   /note="synonym: Tb08.26A17.70; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659215"
FT                   /locus_tag="Tb927.8.2290"
FT   mRNA            <697189..>697848
FT                   /db_xref="GI:72392522"
FT                   /db_xref="GeneID:3659215"
FT                   /locus_tag="Tb927.8.2290"
FT                   /transcript_id="XM_841969.1"
FT   CDS_pept        697189..697848
FT                   /locus_tag="Tb927.8.2290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392523"
FT                   /db_xref="GeneID:3659215"
FT                   /translation="MLMFHLNANRHLLQPPTKNRRGEVVSQTQRNRVCPAAIRAYRFLS
FT                   DDISSQLNICCAVLQVPFSGIPGAPPSTVVTKESVHPSSMLVVWNDTTAAEIAMSLLRE
FT                   VRGDVDSAFAAAESATKAEGADEVVGAANPEDNLGASRDDSATAVYVIKLSVGAVSADG
FT                   NATLSPIASVELRQVIRGEPLVFPSRRAGMPAVDVPISTLPYRLGDPIFFTCKRLR"
FT                   /protein_id="XP_847062.1"
FT   repeat_region   698242..698263
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <698275..>698940
FT                   /note="synonym: Tb08.26A17.80; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659216"
FT                   /locus_tag="Tb927.8.2300"
FT   mRNA            <698275..>698940
FT                   /db_xref="GI:72392524"
FT                   /db_xref="GeneID:3659216"
FT                   /locus_tag="Tb927.8.2300"
FT                   /transcript_id="XM_841970.1"
FT   CDS_pept        698275..698940
FT                   /locus_tag="Tb927.8.2300"
FT                   /gene_family="HOG000257423" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392525"
FT                   /db_xref="GeneID:3659216"
FT                   /translation="MDDVKRKSAMLMTKGIIELRQSPPALVCTIRRFKHPMSGKEVTLY
FT                   PVPNIAAPHYFRRVLDAHHLTNNFDKVLCEDGRLPFQAGTALARRHEVFKRLLPFLSLR
FT                   PVVVNGDKFDGIVERDPLESRMAYQMLLDGADPPVDPRARRAIERIEGYADATKTVCPW
FT                   GVYHLVYMTYRLRTLGYTVESEEELEVVGMKEVMVLGCFMGITTFWMMYALYRMLFGF"
FT                   /protein_id="XP_847063.1"
FT   repeat_region   699388..699414
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <699549..>699878
FT                   /note="synonym: Tb08.26A17.100; (H+)-ATPase G subunit,
FT                   putative"
FT                   /db_xref="GeneID:3659211"
FT                   /locus_tag="Tb927.8.2310"
FT   mRNA            <699549..>699878
FT                   /db_xref="GI:72392526"
FT                   /db_xref="GeneID:3659211"
FT                   /locus_tag="Tb927.8.2310"
FT                   /transcript_id="XM_841971.1"
FT   CDS_pept        699549..699878
FT                   /locus_tag="Tb927.8.2310"
FT                   /gene_family="HOG000257424" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="(H+)-ATPase G subunit, putative"
FT                   /EC_number="3.6.3.14"
FT                   /note="go_component: vacuolar hydrogen-transporting ATPase
FT                   [goid 0000219]; go_function: ATPase activity [goid
FT                   0016887]; go_process: vacuolar acidification [goid
FT                   0007035]"
FT                   /db_xref="GI:72392527"
FT                   /db_xref="GeneID:3659211"
FT                   /translation="MPPKYDNVQRLLDAERRRNEVIANAKAQKQAKVKQAKVDAEREVA
FT                   AFHAEKEREYEAYRQQQEALTEKEKEQLRSDTDVWLQQLNAMAANRMQAVETMMTGLIL
FT                   RCQDN"
FT                   /protein_id="XP_847064.1"
FT   misc_feature    699946..700083
FT                   /note="GA-rich"
FT   gene            <700426..>701040
FT                   /note="synonym: Tb08.26A17.110; hypothetical protein"
FT                   /db_xref="GeneID:3659217"
FT                   /locus_tag="Tb927.8.2320"
FT   mRNA            <700426..>701040
FT                   /db_xref="GI:72392528"
FT                   /db_xref="GeneID:3659217"
FT                   /locus_tag="Tb927.8.2320"
FT                   /transcript_id="XM_841972.1"
FT   CDS_pept        700426..701040
FT                   /locus_tag="Tb927.8.2320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392529"
FT                   /db_xref="GeneID:3659217"
FT                   /translation="MSLFIISCTITFAYFGFYQMRLPRTSFFLFVFFRYFVGAVDLIFV
FT                   CLCFSPSPLSFPLLNDAMCFVSLLQPITLLSFNILVPIYGHGTFVPLLFHSLSKKRQNN
FT                   KNVQLPVPVLVELWDSSCYSFKILRFFKLRGATLPSFASVPYPPPLFHVVRLSWSNEAQ
FT                   IFLLRMCLRYVSYVFRFSPSFSFLFSPFSFSPCGCDMALSR"
FT                   /protein_id="XP_847065.1"
FT   misc_feature    700956..701004
FT                   /note="T-rich"
FT   misc_feature    701139..701164
FT                   /note="AT_rich"
FT   gene            <701686..>702390
FT                   /note="synonym: Tb08.26A17.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659218"
FT                   /locus_tag="Tb927.8.2330"
FT   mRNA            <701686..>702390
FT                   /db_xref="GI:72392530"
FT                   /db_xref="GeneID:3659218"
FT                   /locus_tag="Tb927.8.2330"
FT                   /transcript_id="XM_841973.1"
FT   CDS_pept        701686..702390
FT                   /locus_tag="Tb927.8.2330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392531"
FT                   /db_xref="GeneID:3659218"
FT                   /translation="MSSAERHAVMLQDWLFAWEIIASFSSPRTVCDLETLSRDVHKVIR
FT                   DSSTGTRLMQRYWNVQYHRLVWGDEDLDIGKRTLHFSLPRASGRKNWKKLYREEYPLWL
FT                   ARTFQGMGSRNNDINEAKVRFQVEPANELLSGEAMESLELTQEETVARRVAKGFVRVEE
FT                   GSGSGPNSVDRRGRRKSGGSQNRKEKLVAKDPAEGLQREDYKNDRRLQKHRTKHNKGKG
FT                   GTWDGYADGEFD"
FT                   /protein_id="XP_847066.1"
FT   repeat_region   702783..702810
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gga"
FT                   /rpt_type="tandem"
FT   misc_feature    703189..703219
FT                   /note="AT_rich"
FT   gene            <703283..>703636
FT                   /note="synonym: Tb08.26A17.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659221"
FT                   /locus_tag="Tb927.8.2340"
FT   mRNA            <703283..>703636
FT                   /db_xref="GI:72392532"
FT                   /db_xref="GeneID:3659221"
FT                   /locus_tag="Tb927.8.2340"
FT                   /transcript_id="XM_841974.1"
FT   CDS_pept        703283..703636
FT                   /locus_tag="Tb927.8.2340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392533"
FT                   /db_xref="GeneID:3659221"
FT                   /translation="MNRFCRPFAAATSLRVGSSERCSSRAALMVSTRGKYVRQPSPQWD
FT                   PVHEDINAHVKKRIPGETRVDRVRRFAREWRNVELELGVYKDSRGREIKYRKTFVYRYT
FT                   YPNAFDEFWWPCK"
FT                   /protein_id="XP_847067.1"
FT   gene            <704489..>705568
FT                   /note="synonym: Tb08.26A17.150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659219"
FT                   /locus_tag="Tb927.8.2350"
FT   mRNA            <704489..>705568
FT                   /db_xref="GI:72392534"
FT                   /db_xref="GeneID:3659219"
FT                   /locus_tag="Tb927.8.2350"
FT                   /transcript_id="XM_841975.1"
FT   CDS_pept        704489..705568
FT                   /locus_tag="Tb927.8.2350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392535"
FT                   /db_xref="GeneID:3659219"
FT                   /translation="MEAGTSPIRAGSSDGGGSVRGDIFRRHSVNSGENNMNDNKDNDSN
FT                   TEWSEQFRLIARRMSRALLRNPHPDVQTDKRVMYGVLYELFEQWSERQQRAHSVSLTVE
FT                   QVGSILRYGEQTLRQASLTAPALNKAQVVVDLIAASPLITIGALTQELRGLQPPVVLTP
FT                   MAEVLELARLLDVSQGVRTPVGAVNLVHFIALSSTLCPAPDMGALLLLVASNVKRCHLL
FT                   CAAIYYEWAMIDAQNREGLLLLSRELEEKHQQMCEGFTVDILTPLLTGSFEPFGARPTD
FT                   PVAVDYLGMGSLPCTGTAEEQQRCHQLAPPSGNELEPTCEDSDTGGHGEGDCESSVEDE
FT                   YDSDCRDTVDTEFWLRLSS"
FT                   /protein_id="XP_847068.1"
FT   gene            <705928..>706488
FT                   /note="synonym: Tb08.26A17.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659222"
FT                   /locus_tag="Tb927.8.2360"
FT   mRNA            <705928..>706488
FT                   /db_xref="GI:72392536"
FT                   /db_xref="GeneID:3659222"
FT                   /locus_tag="Tb927.8.2360"
FT                   /transcript_id="XM_841976.1"
FT   CDS_pept        705928..706488
FT                   /locus_tag="Tb927.8.2360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392537"
FT                   /db_xref="GeneID:3659222"
FT                   /translation="MTDPFYRLRRRCLFLFDRGAIGEALSKPDMLKRVDAILQQARQSN
FT                   GVETESTSTAACGAVGTFDELCVCISRWQRRRQFADWEECLEWLLFLQERVQTPEAERD
FT                   AYRWALREMITLFSEEEREYKDALSEEGVKYWRKTIISMQPYFHFTNSAQAMDVEGREG
FT                   HHQVSWSIGGELSPLVRQVFLPF"
FT                   /protein_id="XP_847069.1"
FT   gene            <706861..>711807
FT                   /note="synonym: Tb08.26A17.170; hypothetical protein"
FT                   /db_xref="GeneID:3659223"
FT                   /locus_tag="Tb927.8.2370"
FT   mRNA            <706861..>711807
FT                   /db_xref="GI:72392538"
FT                   /db_xref="GeneID:3659223"
FT                   /locus_tag="Tb927.8.2370"
FT                   /transcript_id="XM_841977.1"
FT   CDS_pept        706861..711807
FT                   /locus_tag="Tb927.8.2370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392539"
FT                   /db_xref="GeneID:3659223"
FT                   /translation="MDEVGALTVQDVLTVWLCDLPLKTTLKDALSGVTQLTGEENINQI
FT                   LRFHPPHASALTQSGECKGMLSLVGEKIIKAVASQYALLSFPVGDTYKLTNATRVLISN
FT                   ETFGTVLKQYTGPTFGEREMFTRFLALSLYGHGVRVACMLLLPVFRATLLANQYAIDLP
FT                   AVLNSLVPCASFSRRNLGEKLEMLRGELEKRGVVVKRVVESGPCGWGGCERYTVEVLYG
FT                   GELSRCEKGKVLSEFYHIVMEEAKKTIANTEVKKPRTVTFEPEHLKMWMHNLRFLLRLS
FT                   DRYRDEFDDNTLQSIKQSAGWIPISEVQQLLEAQVTRSNRQQPPGRDWICELVKRHDLL
FT                   GRFQVGTCDVEGSEFEGLQCARALYGHEGRNLLMKSVFDSFSTIRDPGGRPSTGWMRID
FT                   GKRMKLVSKDKGYSLHDSIPHVTIHSTESLHAFQWYRLKKPLEEQYDEILSSRKPLYFA
FT                   EFRLHDALNDDRMLVRELKGIGAVPPQWVVFTEHNRDDDHQRSTLVIPENYFTGKVAVL
FT                   CTNAEDVATEGMIDTKDRQTPEDEELLIVYKTWLLSADTQNSGDSKDGEENLSPRHRLP
FT                   AHHTSTGATSSDDKGTTSVGAHDCVVMDQAEQPSVPTADYMEMLLDEEKRKIELFENTN
FT                   TYATFVAFPKYNLHGAQIQNRSKGIAAFKTWIQERGLKYSRWRTGENDQEETYEVRKPR
FT                   NWSAEFVECIAGELGLTHMPDKTLLKWATTRECEDKEQNYEILEFIGDAIMDFIVVSDS
FT                   FLLGEPWHKDVNTKLCCNEVLATLIPPGLSEELSRVYDEVHYKVKADMVESILGAVYQS
FT                   GMGLDEVRKQLRRFFRWIPDIIMDVKNLCNSTVEALRAAERVCPYLHPNEEALDQLFKY
FT                   DCESLIDEEFFSMFGCVDRKRFDARGASHYALTPFHRIQDKMFATHFTTGSCYSYRYVP
FT                   SIDTPSIFNRILSAFSAGSIAFVNELVTEDTHVTIDFDGASVHAHGALRLIWSWFIGKF
FT                   PSKSSMFLLDCSGMSVVTNRLKYSYHIHFPQAVTTLSKSKSLVEELQSYVVKCVGAGSL
FT                   LGDIVGFHWKEGEGNQEREAAVAGRVILCTKLLHQRLREAGGRVDAKFSAYMDLQSILA
FT                   LGRTCREIRHATLSYLCEKLHPKEPWGFVVMGWSRHPVGQTSEREPQFVLVRTLWASQQ
FT                   EKDYIGTLILFPTESLSDTTDETSSVWKAVVRKVKEKECKPKEFFLEVVKSSREQCIFS
FT                   SAYWERVIDSSLHSSRKLRMYLNDKFDVKYGQEFRPLFLERLVNSSQEVRTVTPKESNV
FT                   SRFVRSQEMKASAKDNGEEEYPVEVAHGSTLRLVSLRCPGYRDVYGKLWNAWSVGNNSD
FT                   DTFVSIELGTPVDDLLPVFGAEYKEDEILSTEWTRFVEGAFGLQPSVETLGGGSSEQKT
FT                   AALQPAYWIYDPKLGQANFCIAGEVAFFIRPCTCLLEGLTTQGGMKQMVQYIVPTVKLE
FT                   DLPTREWMRSYPSNCFPLFLAPRKGSCFQPAGEPHPVVASNDGQTITVQAPVTAAAVTR
FT                   VRSKVIEVTLNSSTQRPVDFEQLYKAMDDVFSGSYGPSLFVTSDMAIFSVLLDRFPCVV
FT                   TPDYFKSSVSEDYTIHNGRTFHYIFIMDNACDHYQHTKVSTGLLELLDKEVGMILVTSA
FT                   TIQKFFRTNR"
FT                   /protein_id="XP_847070.1"
FT   gene            <713071..>716547
FT                   /note="synonym: Tb08.26A17.190; ABC transporter, putative"
FT                   /db_xref="GeneID:3659220"
FT                   /locus_tag="Tb927.8.2380"
FT   mRNA            <713071..>716547
FT                   /db_xref="GI:72392540"
FT                   /db_xref="GeneID:3659220"
FT                   /locus_tag="Tb927.8.2380"
FT                   /transcript_id="XM_841978.1"
FT   CDS_pept        713071..716547
FT                   /locus_tag="Tb927.8.2380"
FT                   /gene_family="HOG000257427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter, putative"
FT                   /note="go_component: internal side of plasma membrane [goid
FT                   0009898]; go_component: integral to membrane [goid
FT                   0016021]; go_function: ATP binding [goid 0005524];
FT                   go_function: ATPase activity, coupled to transmembrane
FT                   movement of substances [goid 0042626]; go_process:
FT                   transport [goid 0006810]"
FT                   /db_xref="GI:72392541"
FT                   /db_xref="GeneID:3659220"
FT                   /translation="MHSELKAYAVLVAFTLLGELGPFRGAYSSVEDEVAASHSLQEVLD
FT                   FPTVSYYDSLVGEPLTGGHHRGIVDMFSGSSTECFNGGVPPTNGDSNCTCPARSKFSGL
FT                   KCEMCQTDGSCDSIAGPQSVCERRLAIWGSNKQFECSFNTPFFIKQMGGGRDVEALVTL
FT                   NCSTPDGTAFHESNSGTCEMTLFRVEPKHEYVDPFFSCSVEQCTMHLEEIKTNKANKTP
FT                   TNSNIISKAGLIAWRVLIVALCLLLAMLQCVSPKVGRGRTAKLLYVLACLLVAVTLLFI
FT                   LVMVLNMHQGTPELNAVYECNKTHCDCSEDPPKEYGPFCSGTVMKKFILPQIKNSIKIV
FT                   CNLQDKTCRLTLKDVKIIIDLNCTASECTNKRKFPNGPSLPVPADDKAQRALLTFIALG
FT                   FLVLLVLFGLHVLWVLRRTQKRKAEFVDRFGLPELWTQEGEEGVPETRCNGQGWGVATQ
FT                   RQRRHEGGAGGLTTARSAMSIGEAGGSAQRSCSGDMPSLSESERHFTSNTNRHDKKDFI
FT                   RGVTKSPLKLQLTDLDYKLESSCFSSNNNDASQHILQQVNFSVRSGDVLAIIGPSGAGK
FT                   TSLLDLLSARRKQGRVFGEMTINNTPLVGASNEVTEQYRNIIGYVSQEDTLIPALTVYE
FT                   TIKYAARLKLPQAFSSESINGIVDRMIEALRLTRCKDTVIGDGTKLRGVSGGEKRRVSI
FT                   AVELLANPRILFLDEPTSGLDAVSAKHVIDAVVQLAKESPMRAYAPHYFAFRPIVIFSI
FT                   HQPSQEIYELCDKILLLSRGMSIYCGPASCAAETLEARVQRVMGGVQTIPRLADNPNHA
FT                   EYLMKLEEIVDDVARVELQRENTAQMLSRDETSSGMRHEEQAIIRGDIILKTTFGFRRY
FT                   YANVYQQVGLLTSRAARSLLTSSHLIVCHAAVTASVSTLMMILYHEEGLDLPGALNRAG
FT                   SVTFLLLVVSFASLSCLEHLVTERKLFAVERENGYYTTLPYLLSKIIVDIIPLRVLPTL
FT                   VMAALIYVPMGLRGDSGIHLFWFIIIVALFSVCITLIVMCVGVVTGSFGSAALLSSVVI
FT                   LWNFVFGGLLVQSTTVPAALRPFQAASPFFLAFESLLVNELDGQDCTFAPTDATGKPSS
FT                   TNVPILCVQYLTNMGLTPARFTRDVGQLAVMVLVLLCLAWLLLFQFTTVAR"
FT                   /protein_id="XP_847071.1"
FT   gene            <717345..>721940
FT                   /note="synonym: Tb08.26A17.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659224"
FT                   /locus_tag="Tb927.8.2390"
FT   mRNA            <717345..>721940
FT                   /db_xref="GI:72392542"
FT                   /db_xref="GeneID:3659224"
FT                   /locus_tag="Tb927.8.2390"
FT                   /transcript_id="XM_841979.1"
FT   CDS_pept        717345..721940
FT                   /locus_tag="Tb927.8.2390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392543"
FT                   /db_xref="GeneID:3659224"
FT                   /translation="MFSILRFLLARCSFFFSSPLPLLPRSFIGYCYHCHRHHPQRRKQF
FT                   QYVPLLTNPHPGLTVVEKKGEMATLRFNLPALNEYQWRNLYLKKYGSCTYGPPMPKHEY
FT                   RIDPCTVEWRRKREQEVWKSTTGQGDENSRKLGGGDITSRMLQTSDYMDASDDGRMAEF
FT                   SGTHNGDSDGESLYKEASTYDNQLFTTDMFAFLSSGDSDSQSSTMSEMFTFLPQNGSRS
FT                   FPTRLPTVSEFTAADSLIPARESRNTKPEDSILKSNDLVRLQRETWQLLMDDRIMMWFE
FT                   REVKEHGRIAANVQKKLLEIVTKKPDAHSDVTTRSSASEKKKAQEPPAELPFSYVHETK
FT                   PESSEDEKLMQTLEKFSPFFAVISPPEVLQRVASQVSTSKGGEVLSGTSNTIGLPIFSQ
FT                   YHTWRETFEFRQTWRLAPFSFFLIHDSSYNHAQICALYILLDVICRTSHTHTAECAMNE
FT                   QSRQLMAERRVRRRRSAKTDDVVRAQSCPLVLIQQLTEDILLAYEQSSARTALSAALQV
FT                   LRFLTNIVLDACTASRFVSPEALRRQCGFDGDPNPAGTTTAESVASVSVSIVRDDETSS
FT                   LRRRRPQPSPLNEVARGLGIAECSVDGDDGVRDRQAPTEDEENMYRMDINSCIASIPLQ
FT                   HLNESSFEQLFELVYWFVDAPTANSTVTEKVTQGRITWDAKAPSSPTATAGGPTSGERG
FT                   RGAPTSPAADTGSPTRRDGAGAQQRAQDFEATASVVEAIVRFETNMTFNLNAPVDDPYF
FT                   SPLAAQSTRKNSKKKEGERRAAIQATPAAAPNNEAGVAIFRVSLTFVTTYIRLHGATWL
FT                   KELLNRLFNILRRESVLLYLNDSDFNINQGLSARKKNSSFLSWGAKRFAAYSSSVQDSG
FT                   LSTSSGDWDSTLQGKLEKLEQLICQDIGYVMGEFFSSLHGKRAITRLPQAISVMLTDYC
FT                   STIHLHLLNQRTPMEYSHEPPAVRVKKYLAEMRQRRVTGGLALGPQGKGQGVAEDTLIH
FT                   NVGCHRLAKFILFDCWILPALNNAVAFGYLPEDAPHHLRSNVNAFTRYLKIIVNAPFAS
FT                   RCRPGPAARDVSQFPSCGTRKPVAEKKLQAFDDVAHAWRCNTLRLPSRITGIYNACTGS
FT                   LNRLTRDTTAEDEKPNKRRAAASTSFSKMTLTKVITGDMSSSIDRVRETWSEKFTALDT
FT                   LNAFLDLNSNSLDWGEVHDDDVDMSPSQILNIFCDRASYDISTKIVVSEFTVSPSTSAA
FT                   CISNIYSLMSGQHYLVRNACLSGTLVGRFKSSPYLACLIGVLTHPYMAVQVAENVLRNS
FT                   RALYNALMTPLNDETLLSMMSSLVSGKNNTVLMDTNQLVTAVAALPFKARPGSADRSNS
FT                   TSETPDMARAKLWQNTAQILLERRSLATTGARHPSHVLRRLIAKVRAPADPTDVLKNTS
FT                   LAMENEVGHAPLCFDAWWRAMVVALTVKAMNVIEESSGARAMQWEQWCEVKVNDMQKEF
FT                   RGLCAYLSKHKSAKTCIPEDKIMSYCRDGTTTRPKPAKQEISQPQRVKSAQEKRSVSRS
FT                   KHRAKKKKATK"
FT                   /protein_id="XP_847072.1"
FT   misc_feature    722868..722888
FT                   /note="AT_rich"
FT   gene            <723474..>724259
FT                   /note="synonym: Tb08.26A17.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659226"
FT                   /locus_tag="Tb927.8.2400"
FT   mRNA            <723474..>724259
FT                   /db_xref="GI:72392544"
FT                   /db_xref="GeneID:3659226"
FT                   /locus_tag="Tb927.8.2400"
FT                   /transcript_id="XM_841980.1"
FT   CDS_pept        723474..724259
FT                   /locus_tag="Tb927.8.2400"
FT                   /gene_family="HOG000257433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392545"
FT                   /db_xref="GeneID:3659226"
FT                   /translation="MNIVTSYFLVKRIPGSIFLGEASLRNAEARQREYLECIRQNVTHR
FT                   EVDSLHLLIEGSDAYNHFRTHIMENNNSFPDGRLRQKIVPILWQKGQPTYADLFEHANK
FT                   LLRGRLAMVCNADVYISQHGASVRDLARLFDQGVPRVALALTRYESENFMDAPLQDNYR
FT                   GSHDAFVVRPPLEDSLLRSVKHPQNCYKAENVVLHELQRHGYMVKNPCRDFMLVHRHEA
FT                   DLRQWLPSVDEERYARAPPCSIEEAVIALKEENDRLERH"
FT                   /protein_id="XP_847073.1"
FT   gene            <724816..>725529
FT                   /note="synonym: Tb08.26A17.230; trypanothione synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3659227"
FT                   /locus_tag="Tb927.8.2410"
FT   mRNA            <724816..>725529
FT                   /db_xref="GI:72392546"
FT                   /db_xref="GeneID:3659227"
FT                   /locus_tag="Tb927.8.2410"
FT                   /transcript_id="XM_841981.1"
FT   CDS_pept        724816..725529
FT                   /locus_tag="Tb927.8.2410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="trypanothione synthetase, putative"
FT                   /EC_number="6.3.1.9"
FT                   /note="go_process: trypanothione biosynthesis [goid
FT                   0019342]; go_process: trypanothione metabolism [goid
FT                   0046206]"
FT                   /db_xref="GI:72392547"
FT                   /db_xref="GeneID:3659227"
FT                   /translation="MVVREVVKRVPKQVVPLHGVCGYAPGCIPAYSNGTDTTFTYQGHY
FT                   ADNFFMGYKWQCVEFARRWLLLRKGLALPQYDFAAHLIHMREVCDAETGEVVPCKFVSQ
FT                   GSPEPPVADALIVYPGTRENIFGHVGVITHVTDALVGVADQNRFFHDWDGRPYAAEFPL
FT                   ECVDGQYFIRDPLVECRGWVTFPERPNRVEGVPLVVSPHVRGPPKVHICKRINYVAGQL
FT                   WSWCFNRECITFART"
FT                   /protein_id="XP_847074.1"
FT   repeat_region   725600..725621
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <725998..>726915
FT                   /note="synonym: Tb08.26A17.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659228"
FT                   /locus_tag="Tb927.8.2420"
FT   mRNA            <725998..>726915
FT                   /db_xref="GI:72392548"
FT                   /db_xref="GeneID:3659228"
FT                   /locus_tag="Tb927.8.2420"
FT                   /transcript_id="XM_841982.1"
FT   CDS_pept        725998..726915
FT                   /locus_tag="Tb927.8.2420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392549"
FT                   /db_xref="GeneID:3659228"
FT                   /translation="MYGPHHRVAPLRHTGAGVTKLPRNHCNQGLQRQCSYATNTLQSLP
FT                   YDTQGATSAAGGGIGSHTMPARMQQPRLSVPSHSHPPPFSQLATQSTPTQLGDGLVSGR
FT                   SVPNVNYQQPSQQQPQGSMEAATALLAFTQAIQGQERHMATGCQSLLHLRAIAEAQSAQ
FT                   VAAVNALATEVRAMVEATRDVCLLLTRTREQLPETKTSGVHRRESHGPFRPFSRLVLGE
FT                   ECSPHASPVEVASEHSGNENKTNVKTCGWRDGVNDTGAAYISATAGLKSVVLRGAGDGA
FT                   AAAAASPVENTSQPQYIEDDIFSM"
FT                   /protein_id="XP_847075.1"
FT   gene            <727545..>731084
FT                   /note="synonym: Tb08.26A17.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659225"
FT                   /locus_tag="Tb927.8.2430"
FT   mRNA            <727545..>731084
FT                   /db_xref="GI:72392550"
FT                   /db_xref="GeneID:3659225"
FT                   /locus_tag="Tb927.8.2430"
FT                   /transcript_id="XM_841983.1"
FT   CDS_pept        727545..731084
FT                   /locus_tag="Tb927.8.2430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392551"
FT                   /db_xref="GeneID:3659225"
FT                   /translation="MSDFDNKCQPSLRNNLRSATETLNRLCRATPEQDIGRMLRGNKTT
FT                   PQYKAAVTPSARENNTYPTRSSPAVATSASRAPGTAGEWANAFRLLQSQVYNCVVELDT
FT                   ERVVRSNNIREVEQTLSGHVGELRAMILQMKKENEYLTGVVRSLQKRVSPHRAGRSIGN
FT                   GEHTITSAAPPQTMTTVAGMAALTERLEALEDTVARQQRVVGDRNTRLEGNIREMVGNA
FT                   VNIEVERTRRIAREAARDCTDELVRTHLASIQAVLQSERQHQQKVDSASSDAVREVVQH
FT                   FRRLEVDVQRRLQEMNSTITVIRQQQQQRESEIQELSVRVAQDVSAVERSVEAARRELQ
FT                   SGIAKNAQANEARAEATQLALEAAVAERAIAASKEVVMHRATIIDAAEAGAKQKEQQEE
FT                   QRLLRRLEDAQRTNETVQRQQEKLEEQLKGLQSVVQELQQQLVEAVKASNVASADITKW
FT                   KARIREALTTSEEARTLAQESTACAQKTEDSVREALARSGVQLKRLVADHENGTLLTQQ
FT                   LTEKLEATEARLASTRTVVDDLSERHKNSLLPMTARVETLHRSLQDIFGPKMEEISGSL
FT                   VELKATVEQLQLNASSRSKSDARQLSDMRREYTTDIQQLKDCLHQQVREWKQECCTSSS
FT                   TLKAAVDGLSDTVKLQEQSTTRREALHASAAEVAVLSDRVQALEAAREAVEWRVARGGK
FT                   TSNLATATEGAQQSAGETTVNSSVGEPGAATDSELGNNGEVIYELRHRITAVEQCVRSR
FT                   EDNLQKLVRNDIQKEVGRLEQLVNRMDEENTSRMQLLRVQLSDDVATRCKGMLCEVETP
FT                   AQRQLQLQVDRLRESLNPAKLIAAIEADVELQNHLSLALQDAFAPRVGTSESFVQMKRR
FT                   LQKAEDELAEVKVHTREQNERMKIIESNSEKYMWESSNQTQGEGSAGGRSEVGVLLQLL
FT                   QTSMKQLQEEQAAARRERELLRTTAKVVETAAPAVEVTSGEGPSAGHHCTSADEMVRSD
FT                   LKTYLEGCINAVEAKVEAAAQSTADTLDVLKQSIEMCVSFFVDEVNASALLNPLFLPIE
FT                   AGQNKLNVNTVKGLDGVLLFLWQHQCGLQAAVQALQDGSLGTLDLLQHHEEQLALLQPV
FT                   GPLATHTAAQLERLAVSLGLPLDTDAMDEMEEEVEVEGELIEDDDNDDELMEESEELVE
FT                   EEEDEAEQPDEEV"
FT                   /protein_id="XP_847076.1"
FT   misc_feature    730946..731058
FT                   /note="GA-rich"
FT   misc_feature    731835..731857
FT                   /note="AT_rich"
FT   gene            <732010..>732615
FT                   /note="synonym: Tb08.26A17.290; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659235"
FT                   /locus_tag="Tb927.8.2440"
FT   mRNA            <732010..>732615
FT                   /db_xref="GI:72392552"
FT                   /db_xref="GeneID:3659235"
FT                   /locus_tag="Tb927.8.2440"
FT                   /transcript_id="XM_841984.1"
FT   CDS_pept        732010..732615
FT                   /locus_tag="Tb927.8.2440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392553"
FT                   /db_xref="GeneID:3659235"
FT                   /translation="MSLLKADQLRRDLFIKYSDKIAELLGETEECSPTEEQREKEEIET
FT                   TEQRGLSSLPKRFRISYPRQHLLRQRAMQMPPAADVGDAENSPASASNSTCPPLGETAT
FT                   DEDENVETIWVELDEEEKRPVYNEPYPSVKRMMRRMQDESLRLLMREARIPVTPHQGDA
FT                   YLLQRMEVLQQLEKNIGDDRIKILARLQKMDGKLHTCE"
FT                   /protein_id="XP_847077.1"
FT   repeat_region   733226..733253
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <733252..>734184
FT                   /note="synonym: Tb08.26A17.310; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659231"
FT                   /locus_tag="Tb927.8.2450"
FT   mRNA            <733252..>734184
FT                   /db_xref="GI:72392554"
FT                   /db_xref="GeneID:3659231"
FT                   /locus_tag="Tb927.8.2450"
FT                   /transcript_id="XM_841985.1"
FT   CDS_pept        733252..734184
FT                   /locus_tag="Tb927.8.2450"
FT                   /gene_family="HOG000257438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392555"
FT                   /db_xref="GeneID:3659231"
FT                   /translation="MGQHSAKEFRGSRRGESNSGVFPLGPGHAHVGMGSTKKPLGIHTS
FT                   AVQNNVLRQRNQHRRVMHEEGGSHPRGQEADGSHGEDIAEEKFPVVIRYAAHDVRSLLS
FT                   SNEKVYVAVESLNWSKLPMTASEDSFYAIVELPQGPQRFRFVVGETEVVDTAQPIEDIA
FT                   EGTPLLEPRGDVGHKGETRANVIHVNKALLLTKEDEEVPDDGSGWGQEEIIHKEDRKHP
FT                   PIMPVHLRYTPVNTPLTAARCALDGFMRTTDEDTVSPENLPIPLSVTVNHVYFQRREDH
FT                   CVTAMTTRFCNKYSTMVYYSKAEPTASLQ"
FT                   /protein_id="XP_847078.1"
FT   gene            <734935..>735789
FT                   /note="synonym: Tb08.26A17.330; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659230"
FT                   /locus_tag="Tb927.8.2460"
FT   mRNA            <734935..>735789
FT                   /db_xref="GI:72392556"
FT                   /db_xref="GeneID:3659230"
FT                   /locus_tag="Tb927.8.2460"
FT                   /transcript_id="XM_841986.1"
FT   CDS_pept        734935..735789
FT                   /locus_tag="Tb927.8.2460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392557"
FT                   /db_xref="GeneID:3659230"
FT                   /translation="MKKRVAVSCCVAGVLLFAAAVAIHRTAPTTIEQKKLAAWVYTGFR
FT                   SATERTKATVTALVPEPMKPHIKQLLAGATSVTLVGQGFRRIPGIATAISASAQTTKQQ
FT                   NVVEIIMAKPVDKLLYAVGAIFAQAFLLRLLVKPPGYWGPVKDQKVWRNFFTTQAGWFL
FT                   LVVCVALPNCVVDAGFIITLLGRLPSETYLPALVVGKLLQPYVATALFCSPTFVRWLPQ
FT                   VWKVMDAKGSEDDQSGAKVVFWALLTTAVLLAGTNGVTMLWRRDGSNDEEEELVLEDAE
FT                   AEN"
FT                   /protein_id="XP_847079.1"
FT   gene            <736792..>737076
FT                   /note="synonym: Tb08.26A17.350; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659229"
FT                   /locus_tag="Tb927.8.2470"
FT   mRNA            <736792..>737076
FT                   /db_xref="GI:72392558"
FT                   /db_xref="GeneID:3659229"
FT                   /locus_tag="Tb927.8.2470"
FT                   /transcript_id="XM_841987.1"
FT   CDS_pept        736792..737076
FT                   /locus_tag="Tb927.8.2470"
FT                   /gene_family="HOG000257440" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392559"
FT                   /db_xref="GeneID:3659229"
FT                   /translation="MPMLQPYFTKNPQRITRLQENYDEGVQREKVPAAVREQLDIQYLN
FT                   VTPEKLHFLHQNVMGSYSPGEKNEKVRRYNELHPPEKEHSPKFWGKIFA"
FT                   /protein_id="XP_847080.1"
FT   gene            <737566..>738573
FT                   /note="synonym: Tb08.26A17.360; 3-oxo-5-alpha-steroid
FT                   4-dehydrogenase-like, putative"
FT                   /db_xref="GeneID:3659236"
FT                   /locus_tag="Tb927.8.2480"
FT   mRNA            <737566..>738573
FT                   /db_xref="GI:72392560"
FT                   /db_xref="GeneID:3659236"
FT                   /locus_tag="Tb927.8.2480"
FT                   /transcript_id="XM_841988.1"
FT   CDS_pept        737566..738573
FT                   /locus_tag="Tb927.8.2480"
FT                   /gene_family="HOG000050133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-oxo-5-alpha-steroid 4-dehydrogenase-like,
FT                   putative"
FT                   /EC_number="1.3.99.5"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: 3-oxo-5-alpha-steroid 4-dehydrogenase activity
FT                   [goid 0003865]"
FT                   /db_xref="GI:72392561"
FT                   /db_xref="GeneID:3659236"
FT                   /translation="MMISQSHSPFTEAGGFAAAVTLLFTAMGMVILSSHLMPLTGTRVL
FT                   ELSSKIHLTMAAGTFLLLRFALIAPFGKHSGLSTVRIRVPALLSWSLQECPTLLSIIYY
FT                   IVVEYPCYVHQCNPLQWLHMILDRPSMEVTTTVASAAPTLRLGLLFFAVHYFNRSVLYP
FT                   LRVANHGTSVPLHITLSAMLYCALNGRLQLLANIDSVDASQRLVVDSTWQTILTILGAV
FT                   IFFAGMLVNVTSDCYLIRLKKRPPLGAYKIPYGGLFVFVSCANFFGEIVEWFGYVAVVY
FT                   GTNGTVAGLAALSFAAYVVANLLPRAYAHHQWYIQHFGAEYTALQRRAVIPFVY"
FT                   /protein_id="XP_847081.1"
FT   gene            <739775..>740707
FT                   /note="synonym: Tb08.26A17.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659237"
FT                   /locus_tag="Tb927.8.2490"
FT   mRNA            <739775..>740707
FT                   /db_xref="GI:72392562"
FT                   /db_xref="GeneID:3659237"
FT                   /locus_tag="Tb927.8.2490"
FT                   /transcript_id="XM_841989.1"
FT   CDS_pept        739775..740707
FT                   /locus_tag="Tb927.8.2490"
FT                   /gene_family="HOG000257441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392563"
FT                   /db_xref="GeneID:3659237"
FT                   /translation="MPVFENKHLLRVLQPPQQLAQNFVAYCKAHQVLTRGLCRVGKTKR
FT                   GELRGLIANKDIKKDDNIVMLSERACLHPGRALKCERFLAIFPQNVKEMLLQNPLFVQN
FT                   SRVAERSIIRHNQFLLACYMTYLILRNDENAEGQALKYINFMPRNEGNFEQLISNMNGV
FT                   LDGAAACQSAQAALSLQFGITQAEVRPLLQWSMAMIFSRMAPIDHRWTLQCAFKNTPFA
FT                   PAFDIRGPDDDANMVKEPIAFLCPVIDMCNHSDHENVALMVPQRTDSSHESVICLRSLR
FT                   DIDRGEELTMTYGGSPTELRVIWGMQRVL"
FT                   /protein_id="XP_847082.1"
FT   gene            <741128..>741895
FT                   /note="synonym: Tb08.26A17.400; ribosomal RNA
FT                   methyltransferase, putative"
FT                   /db_xref="GeneID:3659238"
FT                   /locus_tag="Tb927.8.2500"
FT   mRNA            <741128..>741895
FT                   /db_xref="GI:72392564"
FT                   /db_xref="GeneID:3659238"
FT                   /locus_tag="Tb927.8.2500"
FT                   /transcript_id="XM_841990.1"
FT   CDS_pept        741128..741895
FT                   /locus_tag="Tb927.8.2500"
FT                   /gene_family="HOG000162366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal RNA methyltransferase, putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: rRNA methyltransferase activity [goid
FT                   0008649]; go_process: RNA methylation [goid 0001510]"
FT                   /db_xref="GI:72392565"
FT                   /db_xref="GeneID:3659238"
FT                   /translation="MHFPSIVFRRHGGRQWMQQQSRDPFVLEARRRGYVARSAFKLLEM
FT                   DDKFTLFSRGNTRVVVDIGCSPGSWLQVIRERCGDKCAVFGVDVLRVASTVTGAVCIQG
FT                   DFTNPAVREELLARMVTVRAAGVVDVVTSDMCLNRGTGSTSDRQKQEELNRSALAFALE
FT                   QLVPGGNFVCKVLGSPTAYEELRRDTCRWFVRTDICKPSSSRLTSDEAFMVCRGKREIP
FT                   RDRSGGCDGTYGGRFGLDDWPGQLRGSPRRRKP"
FT                   /protein_id="XP_847083.1"
FT   gene            <742192..>742920
FT                   /note="synonym: Tb08.26A17.410; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659234"
FT                   /locus_tag="Tb927.8.2510"
FT   mRNA            <742192..>742920
FT                   /db_xref="GI:72392566"
FT                   /db_xref="GeneID:3659234"
FT                   /locus_tag="Tb927.8.2510"
FT                   /transcript_id="XM_841991.1"
FT   CDS_pept        742192..742920
FT                   /locus_tag="Tb927.8.2510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392567"
FT                   /db_xref="GeneID:3659234"
FT                   /translation="MSISCSLAVFLVVYALGCWADGTQTRDRPFMYADSVPALAPGEVR
FT                   RNEAMRFPSTLETEVRQRYVLTNMQRDVYYIAHLSYLGSPSIMYNLHLTRLPRATVGEL
FT                   QQKNQAGPGQRHLSDVNRMYVKARKDVLLFDFLGGEGEVDNGDHDPANDDSFVPVLEVR
FT                   GYRNGFPHEPEKWKDFRYNIRLDVVGRADGLTMAIMWNVVTVIVMGVFVIGFAAPWVIS
FT                   TAAGDTTNQRSRRDFLIFFW"
FT                   /protein_id="XP_847084.1"
FT   gene            <743395..>745416
FT                   /note="synonym: Tb08.26A17.430; acetyl-CoA synthetase,
FT                   putative"
FT                   /db_xref="GeneID:3659232"
FT                   /locus_tag="Tb927.8.2520"
FT   mRNA            <743395..>745416
FT                   /db_xref="GI:72392568"
FT                   /db_xref="GeneID:3659232"
FT                   /locus_tag="Tb927.8.2520"
FT                   /transcript_id="XM_841992.1"
FT   CDS_pept        743395..745416
FT                   /locus_tag="Tb927.8.2520"
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyl-CoA synthetase, putative"
FT                   /EC_number="6.2.1.1"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: catalytic activity [goid 0003824]; go_process:
FT                   metabolism [goid 0008152]"
FT                   /db_xref="GI:72392569"
FT                   /db_xref="GeneID:3659232"
FT                   /translation="MRDTGRCSGHNDDVVDPVTSNGAMSHVGPDLAHRQALYEESVRDP
FT                   VAFWEQAAADFHWERTWPKDKSPLEYNFHKSNGSIFVKWFDGAESNMCYNALDRHLPKH
FT                   KDRVCYHWEGNDEGESRDVTYGEMFEEVVRIAAVLKHRYNVKKGDVVTIYLPMIPFAAQ
FT                   VMLAVARLGAVTSVVFAGFSSQAVASRLTDARSKLIITADSFWRGTKTLLLKELSDAAL
FT                   AICEAEGHNVQCLVYDRSKRENVPMTEGRDAWYSDVVETLTASELADCPIVWIGAEDPL
FT                   FLLYTSGSTGKPKAILHTLGGYMVYAGVTFKYSFDYHESDVSFCTADIGWITGHSYALY
FT                   GPMLNAATSVLFEGMPTHPTPSRWWDLVDKYRVTIFYTAPTAIRALMQCGDEHLQSTTR
FT                   GTLRILGSVGEPINAEAWQWFYEVVGKRRADVIDTWWQTETGGHLITPLPGCTPMKAGS
FT                   ATLPFFGIVPALLHPTTNAVVEGEGEGLLAMQTPWPGIARTIFGDHNRYEQAYFAVDGF
FT                   YLTGDGARRDKDGYYWITGRVDDVLNVSGHRIGTSEVEEAVNSHPDVAESAAVGIPHDV
FT                   KGECIYVFVTFNNNVTVDATLLKRVRETVRRVIGPFAAPDYVQAAQCGLPKTRSGKIMR
FT                   RILRKIASGLHEELGDTSTLLDPSVVQNLIEGRKQTVG"
FT                   /protein_id="XP_847085.1"
FT   repeat_region   745995..746032
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    746264..746313
FT                   /note="GA-rich"
FT   repeat_region   746702..746724
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    746873..746972
FT                   /note="T-rich"
FT   repeat_region   747712..747757
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <748419..>748763
FT                   /note="synonym: Tb08.26A17.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659233"
FT                   /locus_tag="Tb927.8.2530"
FT   mRNA            <748419..>748763
FT                   /db_xref="GI:72392570"
FT                   /db_xref="GeneID:3659233"
FT                   /locus_tag="Tb927.8.2530"
FT                   /transcript_id="XM_841993.1"
FT   CDS_pept        748419..748763
FT                   /locus_tag="Tb927.8.2530"
FT                   /gene_family="HOG000257458" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392571"
FT                   /db_xref="GeneID:3659233"
FT                   /translation="MGIETWKVFPSILTEYPKHGVPLPCSDQNPRLKCPETRWARDFCL
FT                   AQGGNCEYKIEAHFDCLEQYYPPEKVMQLRKAFKPNTLDYPTSDTYIRYRHFYIGAGWM
FT                   GGKRGWEGTA"
FT                   /protein_id="XP_847086.1"
FT   gene            <749535..>750851
FT                   /note="synonym: Tb08.26A17.500; 3-ketoacyl-CoA thiolase,
FT                   putative"
FT                   /db_xref="GeneID:3659239"
FT                   /locus_tag="Tb927.8.2540"
FT   mRNA            <749535..>750851
FT                   /db_xref="GI:72392572"
FT                   /db_xref="GeneID:3659239"
FT                   /locus_tag="Tb927.8.2540"
FT                   /transcript_id="XM_841994.1"
FT   CDS_pept        749535..750851
FT                   /locus_tag="Tb927.8.2540"
FT                   /gene_family="HOG000221739" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-ketoacyl-CoA thiolase, putative"
FT                   /EC_number="2.3.1.16"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: acetyl-CoA C-acyltransferase activity [goid
FT                   0003988]"
FT                   /db_xref="GI:72392573"
FT                   /db_xref="GeneID:3659239"
FT                   /translation="MLRRTSSTFSAKRVFVVGGHITTFVGKGSPLFIDKKHPDFGKKEN
FT                   KTLEELLAESINGALQNTGLHDGRAALVDKLVVGNFLGELFSSQGHLGPAAVGSLSGSN
FT                   SSAFLNKPAVRVEGACASGGLAVQSAWEALLAGTSQIALAVGVEVQTTVSARVGGDYLA
FT                   RAAHYKRQRQLDDFTFPCLFARRMKAIQEAGHFTMEDAAYVAAKAYASGNRNPLAHMHA
FT                   RKVTLDFCTQASDKNPNFLGNEIYKPFLRTTDCSQVSDGGAAVILASEEGLQKLGLSPN
FT                   DNRLVEIKSLASAAGNLYEDSPDLTRMTTSMVAARTALSMAGVKPEQLQVAEVHDCFTI
FT                   AELLMYEALGIAEYGGAGALIRSGATALDGRIPVNTGGGLLSFGHPVGATGVKQVLEVY
FT                   RQMKGQCGEYQMKNIPGIGATLNMGGDDKTAVSMVLTNI"
FT                   /protein_id="XP_847087.1"
FT   gene            <751686..>753575
FT                   /note="synonym: Tb08.26A17.510; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659240"
FT                   /locus_tag="Tb927.8.2550"
FT   mRNA            <751686..>753575
FT                   /db_xref="GI:72392574"
FT                   /db_xref="GeneID:3659240"
FT                   /locus_tag="Tb927.8.2550"
FT                   /transcript_id="XM_841995.1"
FT   CDS_pept        751686..753575
FT                   /locus_tag="Tb927.8.2550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392575"
FT                   /db_xref="GeneID:3659240"
FT                   /translation="MLRITLPSQQVSKRLVAKLASMSGVKGATATNAKGNDAASQAMEA
FT                   PAVVPPSRETPKSTLPRVGARAAVPVGGAGVHSDALRQGTLRAATPIKPSVAAAAASVY
FT                   ETRINAPAPNIRNGEADGQQLPQKKTLRRRKRLIRVSTRRRVRQNTAKVPEDMEEEPIV
FT                   EDVEDPFVDQEEHEEEPVAAAPREKRQQPRPERVKGRPEAKTVDRQPEIKKTEPSPAAS
FT                   YAAYEHDRISGTSLHGKTPMIKAFRIEDVLAACTPSDGVFARRLPQGGCQFFAWPGTPL
FT                   AVASSAVANMPETIRTVHAIFGREKTPMDLVLDIDCPVPQEHWSMSKVRPFQKKVLDDV
FT                   MNVIVEEIEAIGEEIESQVVLQSPNLKKVSFHVHTKLKDAAFEDYNSLHGFLHQFHKRI
FT                   PAVDLQIYRSNGMLRMHRCMKENHTSAIVVFEDKDWNIGFPDGIVPDAKAALHSACIRE
FT                   EGTYSRLLHFDPPRNFPTAFENSGANGSGAAEDKKIKVLLPRTEREAVENASRWLREGT
FT                   READVDEWRSWIRLGINAYRVAYHFRDAMTLQRPALEELLDAWVEASKKCPAKFKPGVC
FT                   EARWATFDINRLSKFDDNEWWPSYQRIGRTAMLNEAADAANRGGANGIPPQGA"
FT                   /protein_id="XP_847088.1"
FT   misc_feature    753631..753679
FT                   /note="A-rich"
FT   misc_feature    753632..753680
FT                   /note="A-rich"
FT   repeat_region   754274..754302
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   754275..754303
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    754538..754576
FT                   /note="GA-rich"
FT   misc_feature    754539..754577
FT                   /note="GA-rich"
FT   misc_feature    754827..754953
FT                   /note="T-rich"
FT   misc_feature    754828..754954
FT                   /note="T-rich"
FT   repeat_region   755087..755119
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   755088..755120
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    755563..755590
FT                   /note="AT_rich"
FT   misc_feature    755564..755591
FT                   /note="AT_rich"
FT   gene            <755590..>756057
FT                   /note="synonym: Tb08.26A17.540; spliceosomal U5
FT                   snRNP-specific protein, putative"
FT                   /db_xref="GeneID:3659241"
FT                   /locus_tag="Tb927.8.2560"
FT   mRNA            <755590..>756057
FT                   /db_xref="GI:72392576"
FT                   /db_xref="GeneID:3659241"
FT                   /locus_tag="Tb927.8.2560"
FT                   /transcript_id="XM_841996.1"
FT   CDS_pept        755590..756057
FT                   /locus_tag="Tb927.8.2560"
FT                   /gene_family="HOG000198385" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="spliceosomal U5 snRNP-specific protein, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_component:
FT                   spliceosome complex [goid 0005681]; go_function: pre-mRNA
FT                   splicing factor activity [goid 0008248]"
FT                   /db_xref="GI:72392577"
FT                   /db_xref="GeneID:3659241"
FT                   /translation="MTELTRLHSAWDVDRHIVLEGEKLVLIRFSHYGEATEQEEDMAHT
FT                   LSTRQIDEVLVALAPKVRKYCTIYVVSTLEVPEFNVMYELGHSREPFAVMFFYRNAHIR
FT                   VDVGTGNNNKINFVVSEDELLSIADAAYRAGRSGKTIAYSEKKFTTAAVRR"
FT                   /protein_id="XP_847089.1"
FT   misc_feature    756402..756446
FT                   /note="A-rich"
FT   misc_feature    756403..756447
FT                   /note="A-rich"
FT   gene            <756526..>757827
FT                   /note="synonym: Tb08.26A17.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659242"
FT                   /locus_tag="Tb927.8.2570"
FT   mRNA            <756526..>757827
FT                   /db_xref="GI:72392578"
FT                   /db_xref="GeneID:3659242"
FT                   /locus_tag="Tb927.8.2570"
FT                   /transcript_id="XM_841997.1"
FT   CDS_pept        756526..757827
FT                   /locus_tag="Tb927.8.2570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392579"
FT                   /db_xref="GeneID:3659242"
FT                   /translation="MARFQSSVVSRAPAFTFVMFSLVAAGVPRVIPGADGSVATETKGK
FT                   GGAVRENREGKCASRIVSYLRRAVTQRAELTQRELRARANLNEARSVALEEEDGQREPK
FT                   NDTHQRIMEAWGVVGAVNDDIIRFNERTIKQHGDVPCVCINEVFGGPDIRAAGAATSWK
FT                   EIVLLQMDLLFMYWKLYWETLHGVWLFTFEEYAPYEKLYGDTVGHYQRKVQELRTELER
FT                   TSTLSADKDVNPLVGFAHLALTHTKIWTYSAVPWVTQITVVLFVLLFLPFIMSATVLSN
FT                   FVWRLWLQLFVAHHVYGLTADGILDSLREYISLVTSQKWKELQGRLITGLSALAFGGSC
FT                   GTFFSLLPAMIFIFATVVFMVTLMCVWTRLPLMLLLFCEEAEAERSVKLAPADVKNKQS
FT                   DVKSKNGGGSEKTTATKGKRNLKKGPNDTEKCKS"
FT                   /protein_id="XP_847090.1"
FT   repeat_region   758494..758520
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   758495..758521
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   gene            <758502..>761843
FT                   /note="synonym: Tb08.26A17.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659246"
FT                   /locus_tag="Tb927.8.2580"
FT   mRNA            <758502..>761843
FT                   /db_xref="GI:72392580"
FT                   /db_xref="GeneID:3659246"
FT                   /locus_tag="Tb927.8.2580"
FT                   /transcript_id="XM_841998.1"
FT   CDS_pept        758502..761843
FT                   /locus_tag="Tb927.8.2580"
FT                   /gene_family="HOG000257453" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392581"
FT                   /db_xref="GeneID:3659246"
FT                   /translation="MHIYMHILVVKVLRLMPNHGKSKAKGTEEKKARRRNSAVAKDDSA
FT                   NNVRSDRKVNDSVKSAPAPEQRLQLSLDRSVFSSSQFSAPTFVNNITNRVLFPLLMSRG
FT                   WKEETAGGMKRFTENGVVGSTTTRADAEAGQAHGEEGSTGSDRGAVATSLTTTIAAALR
FT                   EIEKMQETEEQSLQLHEVRCRRLEIREKRKLATVRLGLEDTTARLHDYESRVCNAAAAI
FT                   AGIEQHLAQSNARVLRGRSVSVLLNHFRMLTAIQKKDLTSALKGLKKARAEQREKITAQ
FT                   WKTCSVLPAETVYFDWDIDASARRGDGVGICSDYENGVKDRTMRDTYEGESRLSSRRHH
FT                   TSISSRVHGQSGGTSREGLHHLEEAAIAAGLDRAFVVRSSTEAQVEWCQRLLHLRGELD
FT                   GIVKNTANVDVYVNWLREELMNDIFHLVECFNGVHGELAEIAAQDPYGRTLLRTMEFVS
FT                   RLYTTITTSHDALLLDFYSHTISQMCSSLFKDYSPEPLRVVPTFEKAKKGSSSSKASQE
FT                   PVNQANTAMQHYRTSLEGCLRGAFSFFVSRARRDVIIVEAIFGTTYTARHHLLTQMTKG
FT                   VVEPFLVNQMKLAEDHEREIREAESRLSPRSRNRAAAQMVDAITYKHTVQTELFVLFQE
FT                   YVQEIRRTFTCGEADFLDKYVDSLFGTSRASYSEAELLRRHYSLLEESYAPKLRNVSGE
FT                   VFDLRSEHMQMTKELVQCFVELSNRIRIYARPEDVRERMVELVETTLQQLGRVLEAELR
FT                   KTVDFMRNSRDTWRSKPKNEEDILRNIDSEPQQCGLRMLLFAQSTMISLDDAIAASCDH
FT                   LLQHEPQFVTTIEAKKVAAFQALDERAELLLNFCAHAIVVRSLSILLHFQHRNDYVPKV
FT                   AKGGEGEVIAPPCTGACSLFCKYVAQEFERAKEFIKMSGGLASHRNTSPQAPAAEQLPP
FT                   SSQFFSSGSMPSGQHMWSQNYCLYSSGVCSSGNMGSALGPTAQIDSPDGARQRARQMNL
FT                   QQLLYGDGGASSFVRTVGVCLYRGISIHLKGFSVSDRGALVYKRDVTAYVEAMAPLTRV
FT                   PGLDGAVIDVLFRLLKETASLLIMPPDHIKGVWDTGLLRLLSHDEKVQFVKMRVDLHDK
FT                   FRDVVK"
FT                   /protein_id="XP_847091.1"
FT   repeat_region   762341..762365
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   762342..762366
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <762449..>764086
FT                   /note="synonym: Tb08.26A17.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659245"
FT                   /locus_tag="Tb927.8.2590"
FT   mRNA            <762449..>764086
FT                   /db_xref="GI:72392582"
FT                   /db_xref="GeneID:3659245"
FT                   /locus_tag="Tb927.8.2590"
FT                   /transcript_id="XM_841999.1"
FT   CDS_pept        762449..764086
FT                   /locus_tag="Tb927.8.2590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392583"
FT                   /db_xref="GeneID:3659245"
FT                   /translation="MAVSGSESGTSEGKLSISSGTSSHNSFSSSSSPSTEGGIQADEPA
FT                   AETGTSSKSSAAGVSPAADCTNGLEAEYALRRISVGSHKKIDAGEAEMHGKGENQVGGS
FT                   NQLLKDSPCVHVSRRAEEPKVQGGQPRGRREKQQGPTNENTNSGPGSADAASRLRFLEE
FT                   MLLHMTALNKELEMDLTKTKKELREYKQAFQRSHSRTAYETPTQSVNARNVDSEWGEIR
FT                   SRDALYPVARTREAQRRQCHVDPHSDIRGSRAASSRPSAHRRAGADGRLEKRISSSAFG
FT                   TCPPKGVGSTRVTKEAVSGRELSRGRSGAVNGLLRHPSAQRRYSTAPTVEARPSGVMSR
FT                   GEHSRQCGQVRDYSQDCRDAHGRKSEPRRENSGPCAGRRKSRSPQPIQRDPSNHRKAPR
FT                   RSPGSAPQPPSGTQTVKLRGARPTGSVAGPCSRSRSAPKQSTEVVSIPAPLPRNHRNAS
FT                   ATATVAPGRGRSSRNFSHAVATAGKPTSKHAASGRAVPRSVESTLTQTQTVTPAPEGNI
FT                   EDVAALQRRYWQQSRDILEQLNRLLEED"
FT                   /protein_id="XP_847092.1"
FT   gene            <764947..>766887
FT                   /note="synonym: Tb08.26A17.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659250"
FT                   /locus_tag="Tb927.8.2600"
FT   mRNA            <764947..>766887
FT                   /db_xref="GI:72392584"
FT                   /db_xref="GeneID:3659250"
FT                   /locus_tag="Tb927.8.2600"
FT                   /transcript_id="XM_842000.1"
FT   CDS_pept        764947..766887
FT                   /locus_tag="Tb927.8.2600"
FT                   /gene_family="HOG000257452" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392585"
FT                   /db_xref="GeneID:3659250"
FT                   /translation="MGMKLQQPHQARSGGEKSMGRNEELRKKTEELVRQRTAELREART
FT                   REEKQQLRGRWVTDADALGNAEARKREQFQRSAPKRAARVNLFGKLENTNTGLELEERE
FT                   VSDRVTQDDVVAAVDLQSKSKKYELVLDKLGPYKLDFSANGTHLLLAGLRGHMANIRWK
FT                   DFALNGETQLKDRIDDAKFLIDHTITAVAQKKFVYMYTKEGAEMHVLPSMANMNRLAYL
FT                   PRHLLLCAASTQYSVMQYMDISTGQELGTKVPSVVRDPTSCMAVNPSNGVVATCDLRGL
FT                   VKLWSPSVVDPLVQLKGHKGVIDDICFHPNGRFFVTLGGDHKFKVWDCRTLRALEEYAV
FT                   TYAFNTIDVSSSGYVAMGGGTNVQIWKDLFTASRPNSPYLKFGLGYGNIAQQLRFCPFE
FT                   DVIGVGHSRGFHSLLIPGAGDANPDFFYANPHETERHRKERVVSTLLDKLPPDMISLDI
FT                   QVPGVNTARLAEYNENIRLNKKARAIREKKERRADKSLGDAAPTGLLVGNDEEVDEDLG
FT                   YKERPVTKELKSKKEVAKERKMQKWDKKDSADKVRSKQTMRTSKIVQQRRARMQRLSGA
FT                   MGSDDEEEKKAEQNRLKRHRREEEDAADDVRELYGRRDEGSSKAVNRGKSEMTVMTPSV
FT                   KKNAALRRLMG"
FT                   /protein_id="XP_847093.1"
FT   gene            <767681..>770026
FT                   /note="synonym: Tb08.26A17.600;
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase, putative"
FT                   /db_xref="GeneID:3659243"
FT                   /locus_tag="Tb927.8.2610"
FT   mRNA            <767681..>770026
FT                   /db_xref="GI:72392586"
FT                   /db_xref="GeneID:3659243"
FT                   /locus_tag="Tb927.8.2610"
FT                   /transcript_id="XM_842001.1"
FT   CDS_pept        767681..770026
FT                   /locus_tag="Tb927.8.2610"
FT                   /gene_family="HOG000246221" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-methyltetrahydropteroyltriglutamate--
FT                   homocysteine S-methyltransferase, putative"
FT                   /EC_number="2.1.1.14"
FT                   /note="go_function:
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   S-methyltransferase activity [goid 0003871]; go_process:
FT                   methionine biosynthesis [goid 0009086]"
FT                   /db_xref="GI:72392587"
FT                   /db_xref="GeneID:3659243"
FT                   /translation="MMTTATRRAKIITHTLGFPRFGVQRELKGALESYWSGAVTEDNLR
FT                   ETAREVRFRHWRQQMERGVDMIPVGDFHWYDHVLSTSLMLDNVPPRHRTRNGSINIDTL
FT                   FRVARGYTSSGKSVDASEMTKWFNTNYHYIVPEFTCPTQTFSFAWNQLIEEVEELLSLW
FT                   GPSRTKPVILGPVSYVWLGKVKGCEWFDRRSLLPRIVPVYAEVLRKLAKSGIQWVQLDE
FT                   PALVLDLEQDWLDAFEATYKELRRQAGNVPKLLLTTYFDSVGHNMDVINCLAVDGLHVD
FT                   AVAGDDDLVEVEKRLPASWVLSAGVIDGRNVWKANLHQIYERLAALRNAAPARALWIGT
FT                   SCSLLHSPIDVGCEVGMDEEIRNLLAFALQKCDEMNLLADALKTEEGGSHLVEYSSLLH
FT                   QREVPGGAINEEARKLASELNAKDTERSLPYSKRVEVQRSLIKLPLIPTTTIGSFPRTS
FT                   EIRSQRLSFKTGLVDEATYKQQMKDNIKHIVAEQEAIGLDVLVHGEPERNDMVEYFAEL
FT                   LSGFVSTANGWIQSYGSRCVKPPIIYGNVSRPTAMTLEWLTYAQSLTQKPVKGILTGPV
FT                   TILSWSFVREDLPRREVARQVALALREEVDDLQNAGIRLIQVDEPALREGLPLQRRKQQ
FT                   EYLKWATEVFKLVVAVARPEIQIHTHICYSEIHDIAGAIAAMDADVIYFEATRSDMELL
FT                   RVFDSFTYLNGVGLGVYDVHSPNVPSVETIVQRLEASAERIPLERLWVNPDCGLKTRGW
FT                   KETGVALRNMVEATRQFRERVKRHFTVH"
FT                   /protein_id="XP_847094.1"
FT   gene            <770953..>773457
FT                   /note="synonym: Tb08.26A17.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659244"
FT                   /locus_tag="Tb927.8.2620"
FT   mRNA            <770953..>773457
FT                   /db_xref="GI:72392588"
FT                   /db_xref="GeneID:3659244"
FT                   /locus_tag="Tb927.8.2620"
FT                   /transcript_id="XM_842002.1"
FT   CDS_pept        770953..773457
FT                   /locus_tag="Tb927.8.2620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392589"
FT                   /db_xref="GeneID:3659244"
FT                   /translation="MAHPVPPVNPYDPRDLQSKALQRWEEQQRVWANMEKNIRRRVPGK
FT                   GRAAQLGGRNMEFAMYKKRLNIEKQFLLEGAVPPPELGGHNLWESTLRIHPGENAVRYV
FT                   RMDKTEYPYPLYCKVADNRRNDADNQTNMRIVHPKERQLGVVKEQPQQPKSKDESISII
FT                   FPGKEYYSKQVARNISAIERQMPHFLVPRAYLEVCGKPPPWTFNTEEAAAAKKRAPPVA
FT                   YHPPPASPSVTVSRTFSQQCGSQKKCSSLGEDDAATAVTRPDVNSCTVDVTEEAVGGPS
FT                   LVISTTRILFFAEPGELSHGSVKIKNNGTTTVYYTWAPIQPVTELDDAITGNETRDEES
FT                   GGDDGEISGTKNERSQTESDEGGATSARTSCDTVQVTAVPQWRSKERGEERGIRVDGEA
FT                   VEQQTPRGEAKLSLRALATKSKESKTFFYLSAPLDGVILPDDEIIFPFSVRAAFAGRFT
FT                   RHYELLMFPTMSRPLVVELCAFIRSPLPTLNALSDPVGEAFDAREGVNMQRQLLNTLVA
FT                   RESMYDASEIAKATKACIAASQAEEEAREAEITRWRLAWNDSTYMALRVPFNRDIYQRL
FT                   NAMYGNIMRTMDECGRPLQHREWNGSVQTLQTKICGVRDAVCRNTLREAFNCLLRASVV
FT                   CEQEREPLGLLLRRAAGVTAFSVLAHRVEQLDDSISYALGIRSRPVPLQSTVLPVIAMN
FT                   QKSINNTNNQGALSGRANARQGSRARSGFTIQDNSAVLSVLTEEQGNEAEAASQEAAIE
FT                   PSVQEEYRARLFTGMRRLVGDAVEQLCAILDASRNSIEAACDLPLMGITVCTRAQDVRI
FT                   IQCAEDLEVDTAVEAIVPKKRK"
FT                   /protein_id="XP_847095.1"
FT   misc_feature    774148..774174
FT                   /note="AT_rich"
FT   misc_feature    774149..774175
FT                   /note="AT_rich"
FT   gene            <774364..>776616
FT                   /note="synonym: Tb08.26A17.630; kinesin, putative"
FT                   /db_xref="GeneID:3659247"
FT                   /locus_tag="Tb927.8.2630"
FT   mRNA            <774364..>776616
FT                   /db_xref="GI:72392590"
FT                   /db_xref="GeneID:3659247"
FT                   /locus_tag="Tb927.8.2630"
FT                   /transcript_id="XM_842003.1"
FT   CDS_pept        774364..776616
FT                   /locus_tag="Tb927.8.2630"
FT                   /gene_family="HOG000257447" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin, putative"
FT                   /note="go_component: microtubule associated complex [goid
FT                   0005875]; go_function: motor activity [goid 0003774];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   microtubule-based process [goid 0007017]"
FT                   /db_xref="GI:72392591"
FT                   /db_xref="GeneID:3659247"
FT                   /translation="MRTNEERDDKGGFIAEPKLLAGPAQKKGAPSPAKKRATSPFKTVP
FT                   NHLNPNKQHGDSMNGHNTSMENADENSAAFRSRATEIMRFRVYARVRPFIPEELADMEG
FT                   QERRSVVEMTENKTVILDPKDGWAPKAQFEFDASLWSIPPEHRIVHTFNDTRHSTYATQ
FT                   RNVYDVIAKDLVPHVFDGFNSCVLTYGLTGSGKTYTMMGKYDPRATCGGDGEEGIIPRV
FT                   SNDLFTILDKKRKEEEKPNIRFRIEVTFVEIYMERVRDLLDPALKNSKGSEKLQDARIR
FT                   QDPYSGPFVEGVTKYQAENWAQCCLLLERGSTHRTTCATAVHNQSSRSHAIFQLTVIQE
FT                   ETIPAKDRYSRPTVRCQAGRINLVDLAGSERGGFQDYVKESAAINTSLLALRRVIDNLT
FT                   ERQNVLMEQAKAEVTGGYFQERTLPQVPFRDSVLTWLLSDSIGGNARTTMVATLSPLAK
FT                   NYGDTLATLQWSSKARNLVTLVKVNDAQTTVTDGMTSKAGELHNAVRIQRQNMDTLLES
FT                   LRSKQAIAENLEKEMGSMTRQMTSIDTETNKMIRKRQAVTVQRTLLRKVWAKQIKTLEE
FT                   RLQASQKRLAQKNATVANSNRQRDDALERENAVKRKLQNLKAREEELHKLVAKNDATDE
FT                   AFREELASAELRYQTEMEAAGADNVVSRLTESIENRTRMERRKLDDLREKVKAAERKAI
FT                   SMEAKVNESKQEEWKEQVRRDGEEVVQLRSKLGELQARWDAVREENDSLKAMVKRK"
FT                   /protein_id="XP_847096.1"
FT   misc_feature    776651..776699
FT                   /note="A-rich"
FT   misc_feature    776652..776700
FT                   /note="A-rich"
FT   repeat_region   776807..776852
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   776808..776853
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   777576..777597
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   777577..777598
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   777963..777987
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   777964..777988
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    778063..778092
FT                   /note="AT_rich"
FT   misc_feature    778064..778093
FT                   /note="AT_rich"
FT   repeat_region   778392..778423
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   778393..778424
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    778743..778785
FT                   /note="CT-rich"
FT   misc_feature    778744..778786
FT                   /note="CT-rich"
FT   gene            <779218..>782385
FT                   /note="synonym: Tb08.26A17.680; ubiquitin-activating enzyme
FT                   E1, putative"
FT                   /db_xref="GeneID:3659248"
FT                   /locus_tag="Tb927.8.2640"
FT   mRNA            <779218..>782385
FT                   /db_xref="GI:72392592"
FT                   /db_xref="GeneID:3659248"
FT                   /locus_tag="Tb927.8.2640"
FT                   /transcript_id="XM_842004.1"
FT   CDS_pept        779218..782385
FT                   /locus_tag="Tb927.8.2640"
FT                   /gene_family="HOG000167329" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-activating enzyme E1, putative"
FT                   /EC_number="6.3.2.19"
FT                   /note="go_function: ubiquitin activating enzyme activity
FT                   [goid 0004839]; go_process: protein modification [goid
FT                   0006464]; go_process: ubiquitin cycle [goid 0006512]"
FT                   /db_xref="GI:72392593"
FT                   /db_xref="GeneID:3659248"
FT                   /translation="MTSEEQRRQLYNRQEYVVGTETQAKYGCTDVLVVGACGLGAEIIK
FT                   NLTLTGVRSIKVLDNGLATLQDLGTNFFLTPADMGKPRAEVVAARAQELNRFVSVTAVD
FT                   VPLHEVIPAVHVVVFVNQRTTLLLAENAMARKHNVKFVACESRGVAGCVFVDAGPSFTV
FT                   LDPDGEETVVCVVTNISRDGVVSLHEDKKHECEVGGRVFLTGLVSPESLNSTVDPFALH
FT                   NGRATTECAQGDNSPTGASSSLRLFEVSEVVSPFHLRLKDFGAIVGDSPIETGYACYLH
FT                   TTKRKVLVGFKDLQLSVMQPEFVTLFDSEKKMMAPMTLHALFRAVHSHGKLPTTPIEVR
FT                   DVLKAAEAYFSSGNDQVHNGFDVETAESILSVMHGRLNPMDCFIGGLASQEVLKVCSGK
FT                   FTPLRQWLYYDARELLVARGEMSETGCVSTAPGGSRYDGQIAVLGSSFQSFLSRQRVFI
FT                   VGAGALGCELIKNVACMGFGAVSITDMDTIEMSNLSRQFLFRNSHIGQQKSKVAGEAAR
FT                   AINGDLKVSAYLEKVAQETENVFDEKFWESHSLVLNALDNVESRKYVDARCLFFRKPLF
FT                   ESGTLGPKCNVQCVIPYCTESYSSSYDPPEKSIPLCTLKNFPNVIEHTIQWARDNFDAV
FT                   FFSTPSDVNGYLEDPTTFASNLERDPGTKSIVLKAVRDALVQWPKDAADCVRMARSLFH
FT                   EYFNSSFRQLLHNLPLDKRNDNGDLFWSGAKKPPKPQEFSVDSELNVSFVYHCAKLLAQ
FT                   VYNLSAFTLSVKEVAELAMQVAVPGFVPREARFETNEAENKEGAAAQLVGDLTMQDLPP
FT                   VSQFNSRRMNPLVFEKDDPNNSHMDYITACSNLRATAYSIPPADVHYTKRIAGRIIPAM
FT                   VTTTALVTGLVGIEALKYLLLAHRENGAQGLAKANPITEKVQEEYLSLYRNAFVNVALP
FT                   FMAFSDPIAAPAKTVPMPDGSSVRWGIWDRIDINEGRDITVKELVSILEKRHQLEIFII
FT                   ALPCGKMVYSQFGNVKDRDKPVSVVVREKTKGEEKDELSCICFVATGSIGDNDVDIPLI
FT                   YYRYKDF"
FT                   /protein_id="XP_847097.1"
FT   misc_feature    782621..782670
FT                   /note="GA-rich"
FT   misc_feature    782622..782671
FT                   /note="GA-rich"
FT   gene            <783572..>784633
FT                   /note="synonym: Tb08.26A17.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659254"
FT                   /locus_tag="Tb927.8.2650"
FT   mRNA            <783572..>784633
FT                   /db_xref="GI:72392594"
FT                   /db_xref="GeneID:3659254"
FT                   /locus_tag="Tb927.8.2650"
FT                   /transcript_id="XM_842005.1"
FT   CDS_pept        783572..784633
FT                   /locus_tag="Tb927.8.2650"
FT                   /gene_family="HOG000257244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: catalytic activity [goid 0003824]; go_process:
FT                   metabolism [goid 0008152]"
FT                   /db_xref="GI:72392595"
FT                   /db_xref="GeneID:3659254"
FT                   /translation="MRHFRLNRCSYTPNLTSLTNQVNRSERLRKWGSVGVPPGFPRIPR
FT                   LEAKGIAILHESPKVILAGRSRCNNFDSNQYMLINKATKRCLLVDASDDWPDDWAAFIG
FT                   ASDLTLTHVFLTHCHIDNIINLNAFLTICGSRQKQRVQVDSQDNDNREDDNGSDEIGVM
FT                   WCPAEECWVQNFKRSCERYGRFEEMHQVLPMMCRSLYTPQHLVDPVIAGFSRRNARHLR
FT                   RNDVLLSAATNRATSFIDFGNGVLLYYIFSPGHSPGHMMLHIPTERILFSGDLLFFNKV
FT                   GRVDLPWATGVRLAESLRLLEALPDNTVVVPGHGRMTTLGRERRENEALQQCYQRQEIG
FT                   KQEVSVGFNEGYL"
FT                   /protein_id="XP_847098.1"
FT   gene            <785065..>790824
FT                   /note="synonym: Tb08.26A17.710; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659249"
FT                   /locus_tag="Tb927.8.2660"
FT   mRNA            <785065..>790824
FT                   /db_xref="GI:72392596"
FT                   /db_xref="GeneID:3659249"
FT                   /locus_tag="Tb927.8.2660"
FT                   /transcript_id="XM_842006.1"
FT   CDS_pept        785065..790824
FT                   /locus_tag="Tb927.8.2660"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392597"
FT                   /db_xref="GeneID:3659249"
FT                   /translation="MSVTVNAVRESAEAVSLTILSCEPAQQKIAVRFGGSHGGWRWIDV
FT                   PTNTPVILERMRPEAGAESSEGPTSNGAAMEGCEEYELAVTPSPPVDGRDESVCSLVGV
FT                   DTRQVVQKPVLLSGADEGGRVFELLLKWTLLDATPTPRESTPDKAPEDHSGTETETRNE
FT                   EEVIVDTANKDDEKGEEAPPPPPIVAQPDESKEKEISENPSGHDSPKDKRVERHVNPVK
FT                   ELEEPKQQEAEREPQQEQAPQPRCNQSEWKWKSSVIPTLPADVSAARHVLIATIVSVQQ
FT                   PAVLPNRHVVVKLGIEAPNERMSLLPLLRTRAVTQYDAVKVAQMGPPVLFPLSENVSVY
FT                   CAVADKRADHPSDSGGIGRRVYRRGRPAPTKSPGRSLARIPKAELDKHAAEKASKPHTA
FT                   TSGECTFSLPQRIEGTGNSDNAGGGRNGGASVFHWEKHSHMEHAYIAHGTVQCGNNEVE
FT                   LAFLRMTVGAYRDACRGHGAARRNGFGTVEVRVEDIELNETTEKQRPEHDNTLVEVWLT
FT                   QPEVDAVSGTHSDRTGAAAAASTSTKNSSGCRHLVLLSSSNCIQPLHFPVSEPFAYLSW
FT                   AVVPAQQKQGVQENVLHGAAPICLVRPGVWTPITIKLRDRNKSASFIKLWYCFTSDGRS
FT                   GMDDPSRPYHPASKSTDDGNCYSLRVYLDSCTNLYPLVQLYSRDGNAKAFRLLIMDPED
FT                   EVAVSASRPMDLNDMQLYCNYKGGEDRTPPAIKLLFTRVFPSHALYRSSDYTVSNTGEQ
FT                   AGTCSVTFLCRLFAFASVAEAHAMNNAHCIGEGRVVVFPGNVVNGKDGTNLDIDVHVAV
FT                   DGMFTPGPVAVKPTAVTSPPPCTVLRMRGEVERAPCGEGDAVICVRSVQLFHRQQQQKR
FT                   RGRVVWTDGGLSAVYACFWLCRGLSGGGVKEWKEALKGCQVLTLTPKQQRHHHHQQQQE
FT                   VSLQCNEFVLSTGGEKLVLCAVFIPKTTETVDDEAKVRNTASNLLRKLVRKVNKKKQES
FT                   ESGLRHVQGTMRALNYLEVDLTLSAAAQGAVVGTAHINDELLLQLKAAWVKVPSGVGAA
FT                   TVPRGSATQPVDQPSPHLWALRLTFPTQPARSHVNVHVKSWPVAYDDLSHEQQQTFNSN
FT                   LVKAHRGGGAATKVDSTMSSAFYIVRPLRLEPAEGEWTLFIFGDACTTRTRLAASVGET
FT                   VLEHVVVDYLLPQSLSLAKGVIVDCFHGSLHADEAGELKRRAEGEQRWRRKLREDPSIQ
FT                   QPCQLFVPFTSLAISADGSDPVTLRYHTLTRCTDDGALLIGAATSNGKGAIFHYNINEN
FT                   TWSVLPIRAPQDGKDKKRREQGKRDNNGAEDADNSQQASHFSTRCITSRHGHTTVCSST
FT                   EKCAYVYGGIGIGGTDPEAATAAVAESNRSDKSAALSPKLGSTSSPKWPVGFMRDIWCI
FT                   NYAEGTATCLCSGENQTVSAPISRWRHAAAFHNDSVIIIGGRTAPALQQEGAKETNEEK
FT                   LLTEEETQKKQEDGQTFYQSHGGEEEDLLLRRDGLCSCCSLLVFDLNRRAWGTQTTSGA
FT                   TPAPRYGHASAVLGTCVYIFGGMTQRNHLLDDLHELDIATNTWRRVEYNGAVAPPPSHL
FT                   AAMEAITVSNTPCLVLTVGAAGNGEEREAGDAAERGVDALRLYLFSHASQFWRRLRFNC
FT                   APLPAPVGVAMCDATPASMRQHGRRQQPLRHRSLPLNKAVLFRMLVVGGMKAGSPNKGS
FT                   AYIADYGLERESTIRPVVPTLLNVARDVIAERRQDERREPPHSADLRNINLERSPIRKG
FT                   IGQRTASSLCTTPRGARSGRKPYKSGPLKIAYRSSSAGPLTQDQQRGLIHRLYYNQCHA
FT                   QEERKKGELQEQPRSGKMPISGRKYNPHPPMQRKAWGAPAAPRADCMRPRKPATAGPYR
FT                   NHRHLDSSGDTQIKPQNDSRGEELTATAPPTPVVAAGRRLSDPEN"
FT                   /protein_id="XP_847099.1"
FT   repeat_region   791766..791790
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   791767..791791
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            793455..793527
FT                   /db_xref="GeneID:3659251"
FT                   /locus_tag="Tb927.8.2663"
FT   tRNA            793455..793527
FT                   /db_xref="GeneID:3659251"
FT                   /locus_tag="Tb927.8.2663"
FT                   /product="tRNA-Asn"
FT   gene            complement(793613..793684)
FT                   /db_xref="GeneID:3659253"
FT                   /locus_tag="Tb927.8.2666"
FT   tRNA            complement(793613..793684)
FT                   /db_xref="GeneID:3659253"
FT                   /locus_tag="Tb927.8.2666"
FT                   /product="tRNA-Trp"
FT   gene            <794590..>795876
FT                   /note="synonym: Tb08.26A17.730; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659252"
FT                   /locus_tag="Tb927.8.2670"
FT   mRNA            <794590..>795876
FT                   /db_xref="GI:72392598"
FT                   /db_xref="GeneID:3659252"
FT                   /locus_tag="Tb927.8.2670"
FT                   /transcript_id="XM_842007.1"
FT   CDS_pept        794590..795876
FT                   /locus_tag="Tb927.8.2670"
FT                   /gene_family="HOG000257474" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392599"
FT                   /db_xref="GeneID:3659252"
FT                   /translation="MLRRAVPRFFSRTRPALVNLHASELSTPDRSTVNSTNRKELKTPL
FT                   CVELISKMSSQGYFPMSQFVKECLTHPQHGYYSTKKNVIGSEKADFITAAEIPFFADIV
FT                   SAWIMDVWQKMGTPRVLHLVELGPGRGTLMKNILKQIKYSNPHLLHFLQIHLVEVGAAR
FT                   TDEQRSALSEFQTAQKKIKWWMGLESIPLTLEPTVYIANEYFDALPVAQFRYTERGWVE
FT                   TCLEVDEDPAHEAHFRMVHAPSGSFSAYLIPNDVRANGKIGDCIEINAVGMQTMELIMK
FT                   KMVECQKSACLIVDYGKDEHMHSTLRGIRGHRFVDPLLSPGEVDLSSWVSFKQLRWSME
FT                   RLETARRHLKWFPVISQSEFLQWGGIDVRLAHVIKDEETKSAMKILQNYRRLMDKNEMG
FT                   ESYKVFALQTRNFPNVSPFFQEAELPSSL"
FT                   /protein_id="XP_847100.1"
FT   gene            <796181..>798142
FT                   /note="synonym: Tb08.26A17.740; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659257"
FT                   /locus_tag="Tb927.8.2680"
FT   mRNA            <796181..>798142
FT                   /db_xref="GI:72392600"
FT                   /db_xref="GeneID:3659257"
FT                   /locus_tag="Tb927.8.2680"
FT                   /transcript_id="XM_842008.1"
FT   CDS_pept        796181..798142
FT                   /locus_tag="Tb927.8.2680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392601"
FT                   /db_xref="GeneID:3659257"
FT                   /translation="MRWIPAVPHVALTTVRSVSNAECVLAINGAGLGLSKRGCISSRSP
FT                   MFSQRCFYTVGRDGAVKYRNVVENTLADTPSGYIQDPANYPPQMVTYNKVTPEAQATLD
FT                   EMERERELMNREELMYKGCTTKAIQEAKAIIFKGDATQKEIELACVTLQKSLEELVGLL
FT                   GNTVNKGCSDGVVFLVPVSKSEEGERSSEEHVVNIDDCNHVRYVIALGKRRLGDFDGSE
FT                   RMCMDILSIDHGSCDALECLLEIYTGTAQPVKIRGLLDQLVRWKTEKNTEEQSMEGNAA
FT                   KITTKLKNNQLELVEVALVLLSDIIVEAASLYYLEHKEGSTSRYFYEAILPISRALGRQ
FT                   YTSLLLGSLFRCLDEQHLASLLRGATLHESEHTMGLVISFLKMLMACKLFQEVDDPSRF
FT                   EFQILSKLHAALRLSGRKHESYKICERLIHLYRANSLKYRFSIGNNASEDNVDLLDDLE
FT                   SEYKTALFQYVEDRALDSLVVGKRLCIQAIEEYPAESAPWETLALIIHKEQPVSGLDDA
FT                   IVAARKAFSLDPLNLRIILTLANFYRAQGRHTLCQAMIDRYKLLKYFIEINASEEDIKA
FT                   TLDDIEKLETDYPIEREPNHVVTQFADMKEHMERMEMSHTYSMPIDKEPRVFGAQPVTV
FT                   PILDPSINVDQPERPRDM"
FT                   /protein_id="XP_847101.1"
FT   gene            <800799..>801998
FT                   /note="synonym: Tb08.26A17.760; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659256"
FT                   /locus_tag="Tb927.8.2690"
FT   mRNA            <800799..>801998
FT                   /db_xref="GI:72392602"
FT                   /db_xref="GeneID:3659256"
FT                   /locus_tag="Tb927.8.2690"
FT                   /transcript_id="XM_842009.1"
FT   CDS_pept        800799..801998
FT                   /locus_tag="Tb927.8.2690"
FT                   /gene_family="HOG000257469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392603"
FT                   /db_xref="GeneID:3659256"
FT                   /translation="MLQQLSAHMCINVPRSSSAFAFILILLIGIMDPSQEGAEYLTAVF
FT                   AKLGVPCRVANTVEKGKHILATADMPAQYSVFEEAPVVSWPSQGYLTLGVPFCLFCLRQ
FT                   RNNADIADEGEHNWNSCAGCGSLFCSESCLASAEMPHRVLCGVLQELRKRECTDGCCRP
FT                   ITKESLANCVAWVVGRIAGAIKQRQFSGKLLEENHRENANSISRQLFHVVTAPFNRFLD
FT                   APKNAEFADVDANSWYEEIDKLLREPCRAVLLQSAAAPPSIGADWALEIVDGLLRHDTL
FT                   ERFLGILTLNSQGLNGFVAVPGAAGDMDSPSLPITWVLKGGGIYSLQSAFNHSCVPNVA
FT                   VLAEGGTHDITLRTLRAIKNGEELTITYIPVENTTRAERQMKLEGYFFTCRCPLCEEEE
FT                   "
FT                   /protein_id="XP_847102.1"
FT   gene            <803369..>804088
FT                   /note="synonym: Tb08.26A17.770; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659258"
FT                   /locus_tag="Tb927.8.2700"
FT   mRNA            <803369..>804088
FT                   /db_xref="GI:72392604"
FT                   /db_xref="GeneID:3659258"
FT                   /locus_tag="Tb927.8.2700"
FT                   /transcript_id="XM_842010.1"
FT   CDS_pept        803369..804088
FT                   /locus_tag="Tb927.8.2700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392605"
FT                   /db_xref="GeneID:3659258"
FT                   /translation="MIRLHRNLEGPFQCRCFRRSATTHRVGTGGNVEGVVASSYSSHAR
FT                   DITASPTVPTLCGDRGHDGNEPEEPGGGKRQRQPEHGAAAASSATYKTTRKRTAEIKVR
FT                   KRAPWGMQQLRDSWSVDAMTKGDRENMSERIHREYRYHPEEFRRNHIKVAALLTIPALL
FT                   IGAFSGYFYQTGRPLWEADPQYLLNMIRQMDASPRSTLHPYKLEETEVLPAHVKAYREK
FT                   NWEKRLLLEGYPLATER"
FT                   /protein_id="XP_847103.1"
FT   gene            <804397..>806538
FT                   /note="synonym: Tb08.26A17.790; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659260"
FT                   /locus_tag="Tb927.8.2710"
FT   mRNA            <804397..>806538
FT                   /db_xref="GI:72392606"
FT                   /db_xref="GeneID:3659260"
FT                   /locus_tag="Tb927.8.2710"
FT                   /transcript_id="XM_842011.1"
FT   CDS_pept        804397..806538
FT                   /locus_tag="Tb927.8.2710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392607"
FT                   /db_xref="GeneID:3659260"
FT                   /translation="MATVTEAPLKSPQDRLVERVCSSEEDDSGRYVIAKDDISPGEIVL
FT                   LAAPYAVALNPNEAVSAMYVAANVEEWEDASMGELAGRRVGQRVKKSGNIPTDGGEYVA
FT                   LSPCVTFCSCCLRRIPTGTPFLNCETIEVLSHLIAVEHVESENAKWEKERESHQRTGSD
FT                   AGDAADLGDRMHIKKEKKLQKPARSAKMRSKGYLSLKQRLLEAATAQRESAMYEAQKFG
FT                   GALGDSSRNISWPERVVEKHVLEEDLLVRGACGCAGCGVAIYCSKSCWQSFNELHRATG
FT                   ACRVLRDVYSPLMRIFLSRITKGNKGGSAEIFCIDSWSPKHWLRRTTDEKAWEMLQLLL
FT                   AALLVGRCAKEGYANNMREEEKERQHPAENVDDYYSEEEDRVWGTMGDEESASPRDCDH
FT                   LQVSNTPTTGTKIEEDGGRDVSITVNSAIPREAEVIRLVRSRMGTAVEVLDSRVNECGK
FT                   CPPSVGRIPMSLCVSIKDHIVLGIRADGSETHAIQCPQWPEAAALVTNLSVLRKESRSV
FT                   FRRYYRRFCLSVLPWLNCSEGTDEPLSVSSSFFDRLCGAVQCNNFGLFDPKEDCIGVSV
FT                   IPEASYFNHSCLPNLCRVMCDGGIAAFYALREIRKGEPLTICYVDVQEVSTAERRRTLL
FT                   TSYRFFCQCKRCNGSSVVDDKTDADAAKLRLCGACAARGYLRPLPPTDAAILCRWTMDS
FT                   IATGECTVCHNRAPWGGTS"
FT                   /protein_id="XP_847104.1"
FT   gene            <806882..>808123
FT                   /note="synonym: Tb08.26A17.800; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659261"
FT                   /locus_tag="Tb927.8.2720"
FT   mRNA            <806882..>808123
FT                   /db_xref="GI:72392608"
FT                   /db_xref="GeneID:3659261"
FT                   /locus_tag="Tb927.8.2720"
FT                   /transcript_id="XM_842012.1"
FT   CDS_pept        806882..808123
FT                   /locus_tag="Tb927.8.2720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392609"
FT                   /db_xref="GeneID:3659261"
FT                   /translation="MKTVIRDPCIQNGCRRFVLMQHGLWAGAWDFNAIAAELYCQTGSQ
FT                   DGRSRRGGGGTVNQLGNIMPSDVVRTKSSCGGSLFARGNLTCFSSGANALIGSLRSTSV
FT                   CAHKLLQEFLPVFTEWLDTVENNSAEKLSFSCVGHSFGGIILREALYLLLVSDDAGEYS
FT                   EGLFDSVKAVRDRLATAGVVLQHFVTIATPHCGAAECLPTLVYRAAWGIAKLFAPSISE
FT                   ILLNDEEALLSERLLDKGHIEALRMFHKRILFANTQKDVLVGFATSSLMFDGVGEDKVR
FT                   IIGRPQSDLPCAPEFENDEAAYSRVIHLKRLRVNGDLSDQGADQVGVGSGEEKARSQRH
FT                   QQTLRSQGTGSSKVHRSPREIAAVLRSELDWDLIALRYNNPLPVAHIACIGWCQQLEPT
FT                   PELVQRIAAEILNA"
FT                   /protein_id="XP_847105.1"
FT   gene            <808373..>809521
FT                   /note="synonym: Tb08.26A17.810; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659262"
FT                   /locus_tag="Tb927.8.2730"
FT   mRNA            <808373..>809521
FT                   /db_xref="GI:72392610"
FT                   /db_xref="GeneID:3659262"
FT                   /locus_tag="Tb927.8.2730"
FT                   /transcript_id="XM_842013.1"
FT   CDS_pept        808373..809521
FT                   /locus_tag="Tb927.8.2730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392611"
FT                   /db_xref="GeneID:3659262"
FT                   /translation="MLGAVPPIVVLPSNPAYELRPVPVVSRSVGLYGPPQNETHGSDRG
FT                   PGAGRSNVWRGDNVSVPPSNATSRTNEVALHEGQEKRTSESGPLEAFPNNHSHCLDRVT
FT                   DKEVDVLLDVLSARYQKYVGLKQRSTERYLARVESHVDRFLREKYRSGTSLFAGGVASF
FT                   IKSKLPSPFHSPKPTFNSENGKDTHREFPTGSATDIHASSVSRSLPALEQCSYTPQCIP
FT                   FNYLDVRPENMEAIAANLAVLQHCLAERVSQGSSGRKELLEPIIRDVWEKELDPLLREA
FT                   TELLRVAQCNVWPPLEYFLSRNVGRVSGERRLRYDCVVRGLRGDLHYLETIRKMEHLVI
FT                   DGQSNGAGEESLDYVPVGGLALSRLYRLENEHRTVLEFWRSR"
FT                   /protein_id="XP_847106.1"
FT   gene            <810553..>811569
FT                   /note="synonym: Tb08.26A17.830; mitochondrial RNA binding
FT                   protein"
FT                   /db_xref="GeneID:3659259"
FT                   /locus_tag="Tb927.8.2740"
FT   mRNA            <810553..>811569
FT                   /db_xref="GI:72392612"
FT                   /db_xref="GeneID:3659259"
FT                   /locus_tag="Tb927.8.2740"
FT                   /transcript_id="XM_842014.1"
FT   CDS_pept        810553..811569
FT                   /locus_tag="Tb927.8.2740"
FT                   /gene_family="HOG000257463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial RNA binding protein"
FT                   /note="similar to GP:28396150: mitochondrial RNA-binding
FT                   protein RBP38 {Trypanosoma brucei}(PMID:12796301); 100%
FT                   similar to GP:28396150: mitochondrial RNA-binding protein
FT                   RBP38 {Trypanosoma brucei}(PMID:12796301); go_component:
FT                   mitochondrion [goid 0005739]; go_function: RNA binding
FT                   [goid 0003723]; go_process: mRNA stabilization [goid
FT                   0048255]"
FT                   /db_xref="GI:72392613"
FT                   /db_xref="GeneID:3659259"
FT                   /translation="MFRRLTQYTGVVGAVRTIVVFSQQHHILESNQKARSSPSNVWIED
FT                   WEAESYGLTPEPGAVSTQLLLDKPLELYNFDQLLSPPEVMEAPKHSSYSSRKVYGEKLQ
FT                   FELNDRAQKHGFHSKWWLTRTQAVKNALTFKNNARSSIILSKSSLRLYHSSQLVGGEAL
FT                   MTHPVSGGSRKLYSRKGDAYQVLCEHIRQNAFNSGLYFTRRQLEFFKLAVQPSQAPVMM
FT                   DVSSGERFLIFNVEQLEDPEVALRTLDRSPVSIPTFLLSGEPMQHEGVKRLPRFKSNYW
FT                   LSGRDAELYQWPIKESEKKRGVTLKNEGSASLQVELFNVEQLANPEEAFAKAGLFVQ"
FT                   /protein_id="XP_847107.1"
FT   gene            <813493..>814827
FT                   /note="synonym: Tb08.26A17.860; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659255"
FT                   /locus_tag="Tb927.8.2750"
FT   mRNA            <813493..>814827
FT                   /db_xref="GI:72392614"
FT                   /db_xref="GeneID:3659255"
FT                   /locus_tag="Tb927.8.2750"
FT                   /transcript_id="XM_842015.1"
FT   CDS_pept        813493..814827
FT                   /locus_tag="Tb927.8.2750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392615"
FT                   /db_xref="GeneID:3659255"
FT                   /translation="MRCSARLAAVFTPAMPHLDAFLRRHTRPDHRLRHHPLWLSEEDLQ
FT                   HLGNISIDRTNHCGSSLCKADGPLPTVLVEAPRTVFLYNMDQLPPECEVRWQFPPVDVP
FT                   SSVSSMTGYKLKSRELLEKARHEMGYESNWWGTKAAWAKKGVMVDMNLLPTPVPSLHVS
FT                   QFLHISFLVNGDHVLKNSYISGKTGSLKSWTSHEGVPSAYEDFQRLVKEHMQAHSFASP
FT                   LYFSESSLRNAGISIRPGVQPLDFSDVQHTNSYIGNRKLALQELTTTYQQYYHLSQLVF
FT                   PAGYRIPRSVVEVERQNPGVPIHGMTGRLLSVPELHPEAIVNSSAPELAPFVMRGSNET
FT                   GSNEPNNVSSVVDLESPCAAYGRNLWYLPQDVLEAGGVVDPNAMPVEAAVGSHSDKRRR
FT                   KLYNVEQLVIPLEGYKAVGCIATMNRFVQSDKPPCAGTLAGDELG"
FT                   /protein_id="XP_847108.1"
FT   gene            <815551..>816984
FT                   /note="synonym: Tb08.26A17.870; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659265"
FT                   /locus_tag="Tb927.8.2760"
FT   mRNA            <815551..>816984
FT                   /db_xref="GI:72392616"
FT                   /db_xref="GeneID:3659265"
FT                   /locus_tag="Tb927.8.2760"
FT                   /transcript_id="XM_842016.1"
FT   CDS_pept        815551..816984
FT                   /locus_tag="Tb927.8.2760"
FT                   /gene_family="HOG000257461" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392617"
FT                   /db_xref="GeneID:3659265"
FT                   /translation="MTSKHVVGNVFAATAVLRCGRFVSGTRLGCSSGKIIIPTLPTSGV
FT                   VERNLGSFSSTSALGRGSSEYYENKRMDPAVGQFLGGDASATLRRQQQLEHFRNATEDA
FT                   AVRIWRDSKSHIRRQEKLVQDIGVEGAVRELLQPTQISFRQELRQRPLDRGILEEIYKG
FT                   LHGRRIERQLKRGVSWEHWITKGDGTAPVFTASRKAQQTFAFGGNIKLVAKATHPKQFP
FT                   VMAMGGGYESSNGVFAMGESQRLVPEVAFVGRTSSGKSSLVNAIVNAMVAPYGHLQGTT
FT                   SSVNFYNIADKIVLVDCPGYGYYNPMETPHLDAENAVASMRAYLTSCSRCVDEKQAVAG
FT                   TGRINIAERAAKDKAAKHGNRSRIRAPGVPRPIKRVFVCVSARGMQHSDLAYLDHLETL
FT                   SLPFSVVLTKTDAAPIRFLARLADHTRCQLVHYKNCKELLLTSSLRLAGIDKMQSLIGS
FT                   MALGEDKLHGATTDFSAIV"
FT                   /protein_id="XP_847109.1"
FT   gene            <817353..>826652
FT                   /note="synonym: Tb08.26A17.880; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659267"
FT                   /locus_tag="Tb927.8.2770"
FT   mRNA            <817353..>826652
FT                   /db_xref="GI:72392618"
FT                   /db_xref="GeneID:3659267"
FT                   /locus_tag="Tb927.8.2770"
FT                   /transcript_id="XM_842017.1"
FT   CDS_pept        817353..826652
FT                   /locus_tag="Tb927.8.2770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392619"
FT                   /db_xref="GeneID:3659267"
FT                   /translation="MSQSRVPIRYGAFIHLSCDEGYVTAGGLGNEGLFIRNKNELSDDA
FT                   EPLPLFGFETSVFQILPPTVAKVAAEEGLSKGNRAPNSNPLSDGVSNIYSTQQVTFGQL
FT                   FVLVHAVSRLHVAALPSEPSERDPDCARLVLAPPGEIEQTFCQFIFTPRYTTHGEGDVV
FT                   CRGDEVLVQLSSIPIFLQTTVVSPTRPVKHETFGSASFPYEPTDGCGRGNSWSAGTRMA
FT                   LSAVLGAPEVNLSEAKALVFVVERYDIDRDKAEHQRILHRIPRPCVSAGVPVIFYHLEH
FT                   KRVLATSVAMPPCQGGGKIGVSGVAPRGNEGGGERDHLLKTRQTHSVMGNVTVICHASG
FT                   RFAAAGSSKSQGSDSHSAGATSLDSDPCSTKGKAPDDRKRVNGVGGAALPLFAVDKGVA
FT                   DGTFSEEGALSGLQCSCTALWILENEQPTVGGAVNMNSGVYRLRQACSNLYVAVEGSAV
FT                   DTILEGDGSPEGSVVSQRSCCNLTGDIVNEEGGDVVRPTTLSMIPPPRTPKDLQRTLFR
FT                   LSPMFNTDCGYLIENDCLLLQNVATDMYLCTSEGSETLSLSWKPSNIDLIVVRRAATDV
FT                   QDSVLFLWSQCETLSGYRDAFQVLTTEGTATHQQQTETDGEHGQGRYPSAEGSTSPTLM
FT                   EGRMAIVSDYNHIPESFVRPSKTCPKGSNVGTGYASLLPVICACQRTLAELIIFCSISP
FT                   ERNVLRRDGIPIPNHQHMLVELCVHRLVIDVILAPFSKFGVRADRSVGKHAQCCGQWGC
FT                   SSWLPPLPLSGGVVDVNDLLLKMHREIHIVCRLGFRLLRQMVRQAPELKAGFENYIPYF
FT                   LAFDGYKLEVVDSLTRLFSENPAVRNSSLELVVNHYIAGLHLTRSGRYLQLLCSMCSVG
FT                   THGVTERQRLVCQKLLVENANALYSFVLDSGGEWAVKTDKDEPPIPCNILFSGQQQDGG
FT                   EEEGTKLREYVQSELELLGALCLDGCPPLCREEVAKVFPSPVLLMALRNFSPKWPEVSD
FT                   RSRVCDVVRSHLIRLAMHCYILPYIDDPAVQLREGAVLLGSSKLHLKVDEKTAFSGKPD
FT                   SELTQAVKEGTLHVIRSNTHFVRSDTGRSILIRAALAAWLRFVSAHQVSATETACLVPL
FT                   LLELLDSRDDEAHDGSSKIAEYTWTRLEVSEAGLLVVRAREMICQILLQILETATYRAA
FT                   NEINLLLHGILVTDHGASLAHQHDYCSLLRRADVSSTGDPFVTSPTERDALLWHKGKAN
FT                   DGNGNRCFGLNRRKGPSDYQSTVAGSAVTTQLSGSTKDVAAFLDYVKGICSCIVRPLRV
FT                   DQLVPRLVDLAHHDGSQLAPYAMELLVRICTVRRSVARLVLQVHPFPSSEVIQCFDNMY
FT                   FAAVQVRSSYIRGSVEEAIDVALQGIDGLSTQTQNEVTGTTNEGRVDDGGTDEYYNDLT
FT                   EDDEEIEEIGICEEQEVEASSSSAPEDQHEVGGESKARRLWSKAAGAARIVVYRNAIIA
FT                   RRRSVGLSETSRVPLRVVVRAETVRHWQVHITMLEMYPFIGPSSPAFSKWMRFFYVFTL
FT                   SQSNAESLKAYIDIFMGAFNLSSNCVVMGLHIVLSILATIKDPTPHLTDAFLRESARYI
FT                   DGEIAALHPDGEFATKLGLHVFTKTTVGGIPRRRMLQLLRDYDAFRCLPSPGVTEKHGR
FT                   GRFTACIVEMVCRICGTSMGAVALGRSALPVTHLLEITLSYGTSYTPLVEVPRPRALWE
FT                   SNSFHLLGAYLLALVSLYIAAGDAGGDGGRRQRQMEWMANRDWWSVVLLLSRQLKELTR
FT                   LMQSRTETVLWRGRRILQRYRRLWLVNLPLALLTFMTECFNEAGFYRYRDVVGATFHEM
FT                   CMSVAGFSEVLLASADAIRLQAREMVGYRRLVALLQVQTGNLVGHELLSGTMLTTRRNL
FT                   RHGVICYYKKINEAEEEARGLHPDALLLAETGPQAENDGIQGGLIATADVPTHTQNDAD
FT                   DSSPMGLLISGAATKCLDAERLRGALRSLVNRDQLITMEDSTDLGEPAGIMNALLLSCR
FT                   ERSNVLDFVSTTLGCMRERSFGSITLIGMLNIFSNALHTALREQERERLKHVSAENSSV
FT                   ITDIFTVRSFETDYAKENAGRLLQTTFSDLGATRAIASLCAVDDQVVAYSAVQLCVGLL
FT                   EGGNEHAQKALLAYFQEHQERFFHNIRDMLHKAVDWVQCTNAEHQIVVLERGGVVPNVS
FT                   NAHEFTRMLLTNALTTPPSLYSSLKVRVGRGTAVARRRLSAWDRAGGSLNQRFVCTLFR
FT                   MLQLFCEGHNLSMQNYIRSQYDNLHSVNAVHEVMNLITEIAAVVHPATVRMLQSAFALL
FT                   TELCQGPCHENQEALLGYGVCVVISKLLSRLNLPDVTGTPSTGTGITNWGGGDSNSTDN
FT                   KASVDCCTLNETDSEGNAFLRLQGGFLLSKDDAGNLRIALTQCLLSLIEGCRSRDVFHQ
FT                   LLEQIPVEVIERELTTVDPGAYDSILENEELASDPGVEALFNWLIFLKTVRPYAEADYL
FT                   KRIDAMLQHTNKLCTRLGFIEIQRADGMLEKVLFRIPHVWRGLMRRNRKQMLAEINCSS
FT                   RAAKLGDFMYHSDNVIFEVERSYAFQCWVERRTRWRLDNRSSGWRGKECDAGKVDTSVD
FT                   AGKPRWTPKWKQCSDAPKYFWNHFIAPVLFCTHLGFYEYSSLLVAVVLNIALINGEGRH
FT                   RNLEESQLWANIISGLCVLQLVLSLIAITVDTIVFFPVSLYVHYRQKQQRFSGRAKFNE
FT                   TLQGVLRGLSAKEISLLLVTRFSFQYRLLLVVMAVLSIFVSYYFAAAHLTLMVYTFPTL
FT                   RTFVSAITHNGRQLLLTALLGVMGLYLFAIAGRIMFPEQFGSNGEVDENSGKKNDENGN
FT                   CDTLLRCFTFILWQGLRQGGGVGDVMDEVSWNSSTLVPRVSYDLIFFALVNVVFLNIMF
FT                   GIIIDTFGELRDDRRERENELRSTCFICGLDADTLEKGQVGGFRAHVEDAHNMWMYLYF
FT                   IHYLRHKDPNEFTGQESYVHEKIQRNDLSFFPEEDCLALQECREGNGKRTGDDEADSDD
FT                   ELASSVVVGGSAPRGPKPESAHPDTGVKLVLKELAAVREAVSALAREATMEGERTRGLA
FT                   QQLELINRSSQSSSLRKFPGGGSAASVAETSTSKGTWLRHSEPEH"
FT                   /protein_id="XP_847110.1"
FT   misc_feature    826757..826777
FT                   /note="AT_rich"
FT   misc_feature    826758..826778
FT                   /note="AT_rich"
FT   repeat_region   complement(827309..828078)
FT                   /note="RNaseH domain"
FT   misc_feature    828537..936061
FT                   /note="sequence corresponds to BAC RPCI93-28F14"
FT   gene            <828598..>829518
FT                   /note="synonym: Tb08.28F14.40; RNA-binding protein RBP10,
FT                   putative"
FT                   /db_xref="GeneID:3659268"
FT                   /locus_tag="Tb927.8.2780"
FT   mRNA            <828598..>829518
FT                   /db_xref="GI:72392620"
FT                   /db_xref="GeneID:3659268"
FT                   /locus_tag="Tb927.8.2780"
FT                   /transcript_id="XM_842018.1"
FT   CDS_pept        828598..829518
FT                   /locus_tag="Tb927.8.2780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein RBP10, putative"
FT                   /note="TbRBP10: pers. comm. C. Clayton, University of
FT                   Heidelberg; go_function: RNA binding [goid 0003723];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72392621"
FT                   /db_xref="GeneID:3659268"
FT                   /translation="MGDSISPSELLPGHAGEEHFLSLEEGTTPQVHRQEVTTDAMTNLQ
FT                   RRNVYVSGLPETYRASEFRDLCQSFGRVEASKLCVDSKCRPAKGYGFALFFEEEDALKC
FT                   IEGLNGRVLMGGRPLQARIADAAAAPAPLDPSIAHPPISRTRQGMKSHHRQLGASISSG
FT                   SGPLDSSIVLGRSMSFSSRDDLTGSQLGLATALIPGTGTPSAPTALHAPMQAPIHGAGV
FT                   TQPPGAVGYSLAPFPVPGGYMPVGHSFIPQQTVGMPLFVTMPQTAPVSTTVAQQVVVPT
FT                   TAIVAPNGYTPQLCSSLVYPPVRME"
FT                   /protein_id="XP_847111.1"
FT   misc_feature    830156..830184
FT                   /note="AT_rich"
FT   repeat_region   830671..830718
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   830804..830863
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    830878..830942
FT                   /note="T-rich"
FT   repeat_region   830977..831112
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   831889..831928
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="aaatg"
FT                   /rpt_type="tandem"
FT   misc_feature    831990..832039
FT                   /note="T-rich"
FT   misc_feature    832187..832303
FT                   /note="T-rich"
FT   misc_feature    832328..832356
FT                   /note="AT_rich"
FT   repeat_region   832387..832406
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tgaa"
FT                   /rpt_type="tandem"
FT   repeat_region   832633..832669
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   832833..832871
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taatg"
FT                   /rpt_type="tandem"
FT   misc_feature    833186..833234
FT                   /note="A-rich"
FT   repeat_region   833333..833370
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   833453..833522
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    833624..833690
FT                   /note="A-rich"
FT   misc_feature    833809..833836
FT                   /note="AT_rich"
FT   repeat_region   833837..833863
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   repeat_region   834227..834265
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    834291..834312
FT                   /note="AT_rich"
FT   repeat_region   834586..834635
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    835127..835172
FT                   /note="AT_rich"
FT   repeat_region   835198..835247
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="actg"
FT                   /rpt_type="tandem"
FT   repeat_region   835434..835466
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   835855..835876
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    836641..836732
FT                   /note="T-rich"
FT   misc_feature    836775..836823
FT                   /note="A-rich"
FT   misc_feature    836931..836976
FT                   /note="T-rich"
FT   misc_feature    837006..837034
FT                   /note="AT_rich"
FT   repeat_region   837330..837361
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            837661..837978
FT                   /note="synonym: Tb08.28F14.130; acetyl-CoA synthetase
FT                   (pseudogene), putative"
FT                   /db_xref="GeneID:3659266"
FT                   /locus_tag="Tb927.8.2790"
FT                   /pseudo
FT   gene            <838362..>839459
FT                   /note="synonym: Tb08.28F14.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659263"
FT                   /locus_tag="Tb927.8.2800"
FT   mRNA            <838362..>839459
FT                   /db_xref="GI:72392622"
FT                   /db_xref="GeneID:3659263"
FT                   /locus_tag="Tb927.8.2800"
FT                   /transcript_id="XM_842019.1"
FT   CDS_pept        838362..839459
FT                   /locus_tag="Tb927.8.2800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:72392623"
FT                   /db_xref="GeneID:3659263"
FT                   /translation="MGCLPPDDLGPFVSDHVDVNEAEPVPLSDEDLDLLVRYSLLPTDV
FT                   VREAWAVFNHYRVVECLRAQQRHYAMTGHLPQKSTVSMSARPFPVAECGGKLFTTPVRA
FT                   ASGDCNAVKEEEKAPVSPRDCVTGENSECRKEEVEVAVLGAEGLRQFFEDTGAPIPTLE
FT                   VTSFLRRMSQPPVEYLLYQRALEEKLTGAAAAAAPPREESPGVGQRKKSPQTDQSKHNK
FT                   GQSVGRGQRPNNNTKSLNILVDDHIDLLEEQRGSGGETVTFPLFLYILSNAELGKNFTA
FT                   DVRESEINTLFRTLDVDGDGVVSVDDIQRLLEERCSLGDTLYEDRDIRYLRGMNLTELK
FT                   AALRECDVDEDGAVRLNDFRSVLSS"
FT                   /protein_id="XP_847112.1"
FT   gene            <839871..>842477
FT                   /note="synonym: Tb08.28F14.150; 5'-3' exonuclease XRNC,
FT                   putative"
FT                   /db_xref="GeneID:3659264"
FT                   /locus_tag="Tb927.8.2810"
FT   mRNA            <839871..>842477
FT                   /db_xref="GI:72392624"
FT                   /db_xref="GeneID:3659264"
FT                   /locus_tag="Tb927.8.2810"
FT                   /transcript_id="XM_842020.1"
FT   CDS_pept        839871..842477
FT                   /locus_tag="Tb927.8.2810"
FT                   /gene_family="HOG000257235" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5'-3' exonuclease XRNC, putative"
FT                   /note="XRNC: pers. comm. C. Clayton, University of
FT                   Heidelberg; go_component: nucleus [goid 0005634];
FT                   go_function: exonuclease activity [goid 0004527];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:72392625"
FT                   /db_xref="GeneID:3659264"
FT                   /translation="MGVPLLLTWLRRRFAACFLPSNSNVSADCLYIDVNGLVYQAATLA
FT                   TSGGGDPADIEAAILRRLFDLLDDIVLRLVRPRSLVYLAVDGISPMGKLAQQRSRRRRR
FT                   RRQDPHSHVRTTEWDSNSISVGTSFMSSLTDALHFYCASRAERINVERLREYKQRDVGK
FT                   DVASAGFPANEKAAPSLITFVSDNVWRPGEGESKIADAIRRFRSQPSYDPNTAHVICSS
FT                   DTDVTVCSLILHEPNIHVLRYEHVSASTAKGGNNNWQTYAGDSWASTFFSIYAFREELR
FT                   LRLRIEQTRSNTMSAEELEKLNKQFEAALHDVVFVLLLFGNDFLPSVGCRIEEGFLDSL
FT                   LEMLATDFVTRGRSIVDPVTNTIQFDAARYALESLAEMRNERSSGLQVDNGAEGAADWG
FT                   FVNEQFLQRKAAEEAEKAPWCYAYWTMLQWSLQNSAGVVEHWGCYYPYSTAPPLHLLQK
FT                   YCGTLSYDALMELAEKRSRRKVGHHNRAHDGTNSGSGERGVRLRGPGPTDVLVQLLVLL
FT                   PTRSIALLPTAVRKGYSEIEPIVVAPVEEIDFAAVQTWCATKRGLFTEEERVRFDAYAL
FT                   AASDHLVAGDVHAKCVRGNEMLFVADWNAEELAAELRELEEIVQGGGGTRSDGSSSSKK
FT                   QTDTLNSATGVFTSFFSARNAGKTSAAVAALLSAPKFSRNIGEGGTGNADTVTTSSGIP
FT                   NINGTSNNTDRDVLQQSIDVDVLSAANFTFHTVSTSALKGESMVRRVGNITGDTFECGS
FT                   YSVGPLSRNQKTMRVRLRWRVASRPPRDAAPFLPYLLSGLKPRQKSAEGDGTAGKEGVK
FT                   RPRSEVAKSAGDDDAKKNVFDDFTQQTMLHDTLQEKKEALRRRLEALQGGNATLGT"
FT                   /protein_id="XP_847113.1"
FT   gene            <842913..>846791
FT                   /note="synonym: Tb08.28F14.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659273"
FT                   /locus_tag="Tb927.8.2820"
FT   mRNA            <842913..>846791
FT                   /db_xref="GI:72392626"
FT                   /db_xref="GeneID:3659273"
FT                   /locus_tag="Tb927.8.2820"
FT                   /transcript_id="XM_842021.1"
FT   CDS_pept        842913..846791
FT                   /locus_tag="Tb927.8.2820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Repetitive protein. Number of repetitive motif
FT                   uncertain."
FT                   /db_xref="GI:72392627"
FT                   /db_xref="GeneID:3659273"
FT                   /translation="MPLYNITIHPLKLAAHFCKQGCSYVVVVNRKGVELATKPAMCTVA
FT                   DEVAFSTPAELNQTRTFQLAFDSPKDRRMIQFAMYDVTNPKHSIRITGFEIPLAGMCSV
FT                   LAGESICERKAVSFRISGRPGRLDVIFRMHPTTSPVPPLTLYAGPATGSGGSSSPVETV
FT                   RLPARTVEVLKKVGVLPKDVEEVEVDAVIAQEVVVRTSMLFPSEAELRERVMTLEREVA
FT                   QQEYSVRYASKDSVSSGSAACVALRSELQYWKDTVERVNLQSAQETGIALLLKAGEEGE
FT                   HDDGSRALIADVEGQLEEARRELKTIERSQNDEELNTKLIPLLGQVEQLEELLEHLRKE
FT                   VHVPPKTAGSSEKADVVDQWEQLARELFDKELMVEQLMHTVLTLNQLQFEPYPAAIEMG
FT                   AVGDTPCELQFVRDNKRQLKNLPQVPTPKQATDLAAASGGPTSDNLLNDLFGCPSPPKP
FT                   VPQPTVQADEVTSQPHFERENGGLPGAPSVFSSGVAPIWGQKPVGAPPQDDAMQPAATA
FT                   NTLDTTDGKVGDSMAFEKKTTEPQIMVSAGLAAAAASPPDTQNGQQLSFPFDSKQQGPT
FT                   QGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPLGSQQQGPTQGQQQPFP
FT                   FDSKQQGPTQGQQQPFPLGSQQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGP
FT                   TQGQQQPFPFDSKQQGPTQGQQQPFPLGSQQQGPTQGQQQPFPLGSQQQGPTQGQQQPF
FT                   PFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPLGSQQQG
FT                   PTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQP
FT                   FPLGSQQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPLGSQQQ
FT                   GPTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPLGSQQQGPTQGQQQ
FT                   PFPFDSKQQGPTQGQQQPFPLGSQQQGPTQGQQQPFPLGSQQQGPTQGQQQSFPFDSKQ
FT                   QGPTQGQQQPFPFDSKQQGPTQGQQQPFPFDSKQQGPTQGQQQPFPLGSQQQGPTQGQQ
FT                   QPFPLGSQQQGPTQGQQQPFPFDSKQQGVPQTPSVPGQQQQYMAPPETPVPRYVRRPLA
FT                   SGVSPFAPFINIPLVARACPLDIYLDGQTPTRGTEITIQNNGGFDITIGGVELRQEDMT
FT                   STSPHAGQTVPIRRWPQQMHVPRGGGRATCIIALHPSYARGSSLILLVVVYVLNEGRYT
FT                   PFAARFPV"
FT                   /protein_id="XP_847114.1"
FT   misc_feature    844593..846317
FT                   /note="Repetitive protein. Number of repetitive motif
FT                   uncertain."
FT   gene            <848100..>848813
FT                   /note="synonym: Tb08.28F14.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659271"
FT                   /locus_tag="Tb927.8.2830"
FT   mRNA            <848100..>848813
FT                   /db_xref="GI:72392628"
FT                   /db_xref="GeneID:3659271"
FT                   /locus_tag="Tb927.8.2830"
FT                   /transcript_id="XM_842022.1"
FT   CDS_pept        848100..848813
FT                   /locus_tag="Tb927.8.2830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392629"
FT                   /db_xref="GeneID:3659271"
FT                   /translation="MEAVVAVDGKRPSPATLFIHENTNYNGREAGAACVPMRVNDSITV
FT                   QQLADEYCITSVVECDATGSVQPRAVALDSPLDVLHGGKYYIARRDVKHFAREPRVTFR
FT                   GKVTVREFNATHGVIGREGETNANRGQAVAADPVGVAPSRKRPEREEDLFDSGTRTEIY
FT                   AKEYEFVPFVGDLYNDGRNGMIHLKDVKKLCESVDLDEVEFRARHVQAEKILTHAKQLL
FT                   LSYADGNGGRTSPEY"
FT                   /protein_id="XP_847115.1"
FT   gene            <850288..>851700
FT                   /note="synonym: Tb08.28F14.220; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659272"
FT                   /locus_tag="Tb927.8.2840"
FT   mRNA            <850288..>851700
FT                   /db_xref="GI:72392630"
FT                   /db_xref="GeneID:3659272"
FT                   /locus_tag="Tb927.8.2840"
FT                   /transcript_id="XM_842023.1"
FT   CDS_pept        850288..851700
FT                   /locus_tag="Tb927.8.2840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392631"
FT                   /db_xref="GeneID:3659272"
FT                   /translation="MDILRRTTSVELTRLPVSAADTLSDVVFPWQSLCFRLAMVFNNEG
FT                   GKYDKDGRALMVAVGESNFVLMWRKLFNALCIAPVVVDGSDTQHKLNAESGSLHTSTSS
FT                   SWCTYDPTRTGTLGKIAGKLFVVTAKCVSEGATLETTAPTSGEVEESGQGKETPIPRRI
FT                   ECVYDFHYTLPDFDIWGNDVTIGFLVMSHYSGNGNVDFVRSLDPTASRVKNLFKSPTVV
FT                   LGTCHYRAVASRLLRCTSVARQISSTSVMICVNVANVAHVPVRVQEVSFDIYSTQMGEG
FT                   DNDIGGVQLTHEQRFGPCGTDLKAIKLLQRTVTVTPLLLHGRCLEETLQPGESACFQFA
FT                   IGVQPHLCHLLETHPRQEPHSRYANNTASVAVEAENAPYSMRNDVSPILPHSPVAPQTV
FT                   WRPSPIGTVECVPCSELKQVLFSKFVSQAYVSYNPIVSAGGEITDQRVASPACLTIRHS
FT                   VPWSMLATRLAT"
FT                   /protein_id="XP_847116.1"
FT   repeat_region   851771..851801
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <852053..>853813
FT                   /note="synonym: Tb08.28F14.230; ribonuclease, putative"
FT                   /db_xref="GeneID:3659269"
FT                   /locus_tag="Tb927.8.2850"
FT   mRNA            <852053..>853813
FT                   /db_xref="GI:72392632"
FT                   /db_xref="GeneID:3659269"
FT                   /locus_tag="Tb927.8.2850"
FT                   /transcript_id="XM_842024.1"
FT   CDS_pept        852053..853813
FT                   /locus_tag="Tb927.8.2850"
FT                   /gene_family="HOG000257241" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   nuclease activity [goid 0004518]; go_function:
FT                   transcriptional repressor activity [goid 0016564];
FT                   go_process: negative regulation of transcription [goid
FT                   0016481]"
FT                   /db_xref="GI:72392633"
FT                   /db_xref="GeneID:3659269"
FT                   /translation="MQVTRDNLPTVLPKFVQLLKTCDFYAFDEEMTGINVPELPESVTD
FT                   TPQETYNAKRAAASRYNIIQVGICLFHKNSENGPSTPASYVARPFNFVIFPNHEDDSPS
FT                   LGRGDDVVLNPSSLAFLRRHDMNFQSWVYRGMGYCDAAREVVLRQNHEEKYHPNLNDST
FT                   EQRRRHAQSMELLTQEERSWFDGAVAAAQSLCERARAAVERAQAQCAEKGSPGAIELDA
FT                   AMDLQRSGGREVVIQPQRNKNARECLQRHIAQHFQDISLTFRRSGSTYHGTFKVLFPGE
FT                   QARILEKECALRERELVDMLGFRLVFKALVESSKPCVGHNCLADVLFLLASLDGELPAA
FT                   LPEFKHRVVQLFPKVFDTKYIASRQDLFPAGRFGSRYLAGYFDECGFCSANVRVSLPLG
FT                   FEEYDPLKLSSVGRSAGGNGAPVHEAGYDALLTGTLLLNLLAEIGGGDVTTAPAGLTNR
FT                   LALFRSLFAINLNPDGEDEYLPQSGALTLQHEKHIKSHHIDSCFSAFSLQHVALYPIDD
FT                   MRTLAVLPLSWTKACNLDVEDVSGLSVQMTSRFPQYFQASPFTFPAGTKGAFRATPVSL
FT                   ARTVCKALRR"
FT                   /protein_id="XP_847117.1"
FT   gene            complement(854289..854362)
FT                   /note="synonym: Tb927.8.tRNA.Ile.01"
FT                   /db_xref="GeneID:3659275"
FT                   /locus_tag="Tb927.8.2851"
FT   tRNA            complement(854289..854362)
FT                   /db_xref="GeneID:3659275"
FT                   /locus_tag="Tb927.8.2851"
FT                   /product="tRNA-Ile"
FT   gene            854457..854528
FT                   /note="synonym: Tb927.8.tRNA.Gln.01"
FT                   /db_xref="GeneID:3659270"
FT                   /locus_tag="Tb927.8.2852"
FT   tRNA            854457..854528
FT                   /db_xref="GeneID:3659270"
FT                   /locus_tag="Tb927.8.2852"
FT                   /product="tRNA-Gln"
FT   gene            854585..854657
FT                   /note="synonym: Tb927.8.tRNA.Val.01"
FT                   /db_xref="GeneID:3659274"
FT                   /locus_tag="Tb927.8.2853"
FT   tRNA            854585..854657
FT                   /db_xref="GeneID:3659274"
FT                   /locus_tag="Tb927.8.2853"
FT                   /product="tRNA-Val"
FT   gene            854728..854800
FT                   /note="synonym: Tb927.8.tRNA.Lys.01"
FT                   /db_xref="GeneID:3659276"
FT                   /locus_tag="Tb927.8.2854"
FT   tRNA            854728..854800
FT                   /db_xref="GeneID:3659276"
FT                   /locus_tag="Tb927.8.2854"
FT                   /product="tRNA-Lys"
FT   gene            complement(857771..857845)
FT                   /db_xref="GeneID:3659279"
FT                   /locus_tag="Tb927.8.2855"
FT   snRNA           complement(857771..857845)
FT                   /db_xref="GeneID:3659279"
FT                   /locus_tag="Tb927.8.2855"
FT                   /product="snRNA U1"
FT   gene            858106..858177
FT                   /note="synonym: Tb927.8.tRNA.Gly.01"
FT                   /db_xref="GeneID:3659281"
FT                   /locus_tag="Tb927.8.2856"
FT   tRNA            858106..858177
FT                   /db_xref="GeneID:3659281"
FT                   /locus_tag="Tb927.8.2856"
FT                   /product="tRNA-Gly"
FT   gene            858265..858346
FT                   /note="synonym: Tb927.8.tRNA.Leu.01"
FT                   /db_xref="GeneID:3659280"
FT                   /locus_tag="Tb927.8.2857"
FT   tRNA            858265..858346
FT                   /db_xref="GeneID:3659280"
FT                   /locus_tag="Tb927.8.2857"
FT                   /product="tRNA-Leu"
FT   gene            complement(858430..858501)
FT                   /note="synonym: Tb927.8.tRNA.Thr.01"
FT                   /db_xref="GeneID:3659277"
FT                   /locus_tag="Tb927.8.2858"
FT   tRNA            complement(858430..858501)
FT                   /db_xref="GeneID:3659277"
FT                   /locus_tag="Tb927.8.2858"
FT                   /product="tRNA-Thr"
FT   gene            858599..858670
FT                   /note="synonym: Tb927.8.tRNA.Arg.01"
FT                   /db_xref="GeneID:3659278"
FT                   /locus_tag="Tb927.8.2859"
FT   tRNA            858599..858670
FT                   /db_xref="GeneID:3659278"
FT                   /locus_tag="Tb927.8.2859"
FT                   /product="tRNA-Arg"
FT   gene            complement(860996..861256)
FT                   /db_xref="GeneID:4443251"
FT                   /locus_tag="Tb927.8.2861"
FT   misc_RNA        complement(860996..861256)
FT                   /db_xref="GeneID:4443251"
FT                   /locus_tag="Tb927.8.2861"
FT                   /product="SRP RNA, 7SL"
FT   gene            861366..861438
FT                   /note="synonym: Tb927.8.tRNA.Lys.02"
FT                   /db_xref="GeneID:3659286"
FT                   /locus_tag="Tb927.8.2862"
FT   tRNA            861366..861438
FT                   /db_xref="GeneID:3659286"
FT                   /locus_tag="Tb927.8.2862"
FT                   /product="tRNA-Lys"
FT   gene            complement(861528..861599)
FT                   /note="synonym: Tb927.8.tRNA.Arg.02"
FT                   /db_xref="GeneID:3659287"
FT                   /locus_tag="Tb927.8.2863"
FT   tRNA            complement(861528..861599)
FT                   /db_xref="GeneID:3659287"
FT                   /locus_tag="Tb927.8.2863"
FT                   /product="tRNA-Arg"
FT   gene            861696..861839
FT                   /db_xref="GeneID:4443252"
FT                   /locus_tag="Tb927.8.2864"
FT   snRNA           861696..861839
FT                   /db_xref="GeneID:4443252"
FT                   /locus_tag="Tb927.8.2864"
FT                   /product="snRNA U3"
FT   repeat_region   complement(862641..862896)
FT                   /transposon="RIME-B"
FT   repeat_region   complement(862897..863144)
FT                   /transposon="RIME-A"
FT   gene            complement(<865608..>868304)
FT                   /note="synonym: Tb08.28F14.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659290"
FT                   /locus_tag="Tb927.8.2860"
FT   mRNA            complement(<865608..>868304)
FT                   /db_xref="GI:72392634"
FT                   /db_xref="GeneID:3659290"
FT                   /locus_tag="Tb927.8.2860"
FT                   /transcript_id="XM_842025.1"
FT   CDS_pept        complement(865608..868304)
FT                   /locus_tag="Tb927.8.2860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392635"
FT                   /db_xref="GeneID:3659290"
FT                   /translation="MSVSAPTISAASREELVAYVKQLQQHLKEGEVKLMQIDKLEEEVE
FT                   TLKQKLEEKNGAVAALTEQSKMLSEMLVADEETKRILLLQMEESCVGGKTRECDSSITV
FT                   SRASSALRAENNAQITPTGLKRAEANADKERTGMGEASLNPTALRSRNDEIAELEQKVR
FT                   ELTEVNSFYTAIVEHHDEEERVRADEGCCSTAIKAKVEGSVNLERLHERIGNLESERDN
FT                   LRRLLRHNEREKENLNKELRDLREELSRLEIDVVAVEKWKVEECFAQCPAPVSLAIPGC
FT                   GGSPVQGGDAVTSRTFAKVVTPIRYKGDGGKRIPKHLKRGPSVNAANEQYPLLTSPRQS
FT                   RSLLQFDSLPEIHLLNPTRQEQMLLERVELYRRHVEEMSAHEVDRQRSFDEIEQARAEL
FT                   FTEMNFKLDEQRREIQRLNKEIALVTEGYSESRIQAKRSYHAEGTPKSAEVESLCSSET
FT                   IFVPKGRAAELEVVPVGNEKNARSDSKNSIENKGVPSTGQSETAKIKHSGTLENKLFAP
FT                   FEEGCPLSGSEWTWYHMDMVEKYERVDIAYKEQETFAGILMWNQIAVLSIASELMTRAR
FT                   GAQSEVSSLQTRLAEVQALVSSLEHQKESLVEELGRLREAHVNEPEDGGEGSTSFDVLK
FT                   TNQQVFTQAVPLTEAWGPLLCVCDAYSEIVEGQIAVLRTLSEGEDATRIKGSEIKMNTA
FT                   SAAPPYRDVHLQGPETDANKPSGLVDTDGDEEFQMRLRGGNWLAFPPDSDVFPSDNTTK
FT                   LHEATDDGTTGLGRGNAEALPKAPLATGPSQETYLSDNAHPPYRAKREIGCGVCAEAHG
FT                   APEGHVTQAPVTHQHLQSGPLSWGSFSNAITSEGCGDDGTGSRNTGQLKNALENLFCDA
FT                   NASQPATYQETREDNSCTFAAEFDPFA"
FT                   /protein_id="XP_847118.1"
FT   gene            complement(<868587..>871391)
FT                   /note="synonym: Tb08.28F14.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659288"
FT                   /locus_tag="Tb927.8.2870"
FT   mRNA            complement(<868587..>871391)
FT                   /db_xref="GI:72392636"
FT                   /db_xref="GeneID:3659288"
FT                   /locus_tag="Tb927.8.2870"
FT                   /transcript_id="XM_842026.1"
FT   CDS_pept        complement(868587..871391)
FT                   /locus_tag="Tb927.8.2870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392637"
FT                   /db_xref="GeneID:3659288"
FT                   /translation="MELVGRVGKHRWTSIGNFALQPSHLRHRDEVLGACNLLKLLRHWW
FT                   RRVSRRRQVQDENVRTGVKQRMIGWMPTARLCLSLHNTGFCSLREPKGFCFGGTYRTFH
FT                   PQSVSHTGTLLRFRTEELLPWLIIYKQLFRRRPSLTAFSINFSRRLFVTTVFSVLVQCL
FT                   TSISKPFVYNVRQCFSAFQIVSKMADHSVKEISERFVQDEGQDGDQCTTSPGERYSTNP
FT                   MAPLTVWREVEKGATRAEQGQCAHRNKEGTTCFATAGKGGVSSSWSKHSEEILMDTVVD
FT                   ANQPLETVVEAPNRVESTRAQGDSIHCTDAQSKCSVIREALLSGEPVTRAELEEIQKEI
FT                   AMQERVVRALDEDNEKLHTEKKALLLKVRELTSALSGRGAHTPVSDGQPNSKQTLRSGD
FT                   LTTRMETRQGTHHSTDELLMETNQQRMRVRELELELELLRRERGDLNIHRSSVDMKRLE
FT                   ELELENRNLRVDLKRRETEHEEVVKEMARKIAWYVNNQEFNDSQQQLLKEQQDTIRCLR
FT                   AKLRGSGKAEDISKGTKAKEDTRVQHLTRRIIELEETLGQKHPNSIAQLIRSCQPPVQD
FT                   TKIFKQLNHRIKELEDALVEKDRCAEAAVTRLRVEVDRMRMQYQEKIEKLEEQLKFKLL
FT                   QAQSRRVHDLEKQLTEAKQSLRDKEQVNPPSSVVGANNLTSGRYPRGNGNEQCVTQGAT
FT                   KDTVLSEAPAASGPPKETSIALLRENGAPEPQLSQLEREPKAGIALTSPSYDAFIIPPP
FT                   MQVISTMQAQIASLTSQLEVAKRLLEESQQSLGEAHARLDERLRSARREYQAQLQCIQQ
FT                   SYRDDIEHIKDSHKKELMSITELKQVCEGNSWICKDISRLPLNRSRIQAFLQSVSERLS
FT                   YLEKRQAQKEKEALHRIEEIRRVADFEIVLTKQKAEMIVEEKNQQIQGFRLQLDHLLET
FT                   LALL"
FT                   /protein_id="XP_847119.1"
FT   gene            complement(<872795..>876190)
FT                   /note="synonym: Tb08.28F14.260; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659289"
FT                   /locus_tag="Tb927.8.2880"
FT   mRNA            complement(<872795..>876190)
FT                   /db_xref="GI:72392638"
FT                   /db_xref="GeneID:3659289"
FT                   /locus_tag="Tb927.8.2880"
FT                   /transcript_id="XM_842027.1"
FT   CDS_pept        complement(872795..876190)
FT                   /locus_tag="Tb927.8.2880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392639"
FT                   /db_xref="GeneID:3659289"
FT                   /translation="MYSRALPTYIYMLPQQRLRLILTRSVGVLAEISSVQPRKPPFDEQ
FT                   QQAFHSHVQHLPAKDIFSDLLVSASALGVGSREDWLRLKKVYLARLPELPCPTVVMLLR
FT                   QLVKNDACGLVECVSIQDRLAESHFLTTLKTEEQMEALSSIVIVGSRLSPKFIPYAQEA
FT                   LRVIISGAQVELLPELSYVVGCLVTSEDNGISAEAQSSILKELLERVRRVDYTLLTQEK
FT                   LVYLFWSLSTFCSSIIPVRLVYIEVCEAIVANGIRTGGVESASPRNDLLLLCGLCQIVS
FT                   VSGSGDRVVPIQSEGVINNVSWPENDCLGCLSPSFTVKLLAILDSVVLTFVHRVVKGEI
FT                   QNRFIISTVLESLTYCGLTKLQKNAQILFHILLRMLMYNGIDFWLRPLGDAAAVTRAEA
FT                   IGPLVNVYSVAADVAFLDRLMYRLNFCVFPPVSQCALEKATVKQVRIILEALAYGNLTV
FT                   NSRKFYLGECFKTVPGIVRNASRWELPRIINAVMKLSIKDNFIWCAIRERSRELGYQHG
FT                   CRGGGYPQTDTKRHEVSGKCSEEDTNSSDVALQICEKALMLSESEGVPLERLTHSLETL
FT                   CTCKGMKSSTMTQCAAIVGSLSKLRIPSRGFKPYTAVSTPIFLRLEVLQYPDWGLSLIL
FT                   DGAAAGVSRTVLLNSLSAVGTRLLQNDLGRNRYESAVFYLIAAHELDARYSVLHPHIVG
FT                   TIRDQQRLQTLPFHILVRLVGALCAFGIDEKCVLERALHGVDSLCVHVVEREKWVEADW
FT                   RAALVLVNAMWTSAAKAVWKSLIHVTRKLVIVMIKRIRDGEVGVYPLQAALAIATVIIN
FT                   DLDNSSMGYADGKVNDDIVTAFLNIVAPLFSEDGVSFSLPRAEALLRSESGALFPPQCN
FT                   SLTCSLVVSHALQRLIQMNNDSAKRFTPHAIGLWRFCLKHIEKAPLTDRTLMNTVTFCV
FT                   RFGGSSQTFDRFMASLVDSGDEVSMLDVCLIAEGLLKNGKRRPIATQFIAHFSQKLPLD
FT                   NLPAAALCSLLLFFARDAEKVALGLSKVEMLLSLVWASLVLKMDRLAGSGELLKLVETV
FT                   PANAANPLLRLICDTKAIDDTPTVELVRPLNIVLGWKTNTVSPATVLCFLQKVGASIEL
FT                   REKTDPAECLATEEMKRMIHCYSQ"
FT                   /protein_id="XP_847120.1"
FT   gene            <878180..>879448
FT                   /note="synonym: Tb08.28F14.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659282"
FT                   /locus_tag="Tb927.8.2890"
FT   mRNA            <878180..>879448
FT                   /db_xref="GI:72392640"
FT                   /db_xref="GeneID:3659282"
FT                   /locus_tag="Tb927.8.2890"
FT                   /transcript_id="XM_842028.1"
FT   CDS_pept        878180..879448
FT                   /locus_tag="Tb927.8.2890"
FT                   /gene_family="HOG000257497" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392641"
FT                   /db_xref="GeneID:3659282"
FT                   /translation="MMSSLLADTQFSGRAGLLSWINKMCSAQYPSVVSLRDGAAYCSVV
FT                   DATANRVAENCAAFGVPELTVYQKRAKRSSQLLARVSWGATLATCANQDPSLDSIKERN
FT                   QCERNMQTLQIMLYECLPPEFSLEIDVPRLACGKLQDHVQLLKRMHIIVGKLLTLFSKQ
FT                   SLELRIRSSSNFGCVEGVRITRAMMLHRKASQKYINDHSPSRLKREDAGIFGDTRGHLS
FT                   LSTNQKSAPRCGNDNVMPVTPGRYTVLSKGQKGPPNSRGTHSAEGTELRSSLFSTAGSD
FT                   GCGSLESRCSSTTGMSKPFFTVPQRYCHLLGDLRQEVESYEALVQASQGRHQRGLLAGE
FT                   CGSNDDAQMVERSGISTFHGDAPVVCLESLGTLSGKRDKLWQTLSVIHGTAAHRATELG
FT                   IGGNGKASAPPLLGDILSALTLQ"
FT                   /protein_id="XP_847121.1"
FT   misc_feature    881428..881451
FT                   /note="AT_rich"
FT   misc_feature    881678..890063
FT                   /note="Repeat region, may contain misassembly."
FT   gene            881678..882493
FT                   /note="synonym: Tb08.28F14.290; mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase IB (pseudogene), putative Gene within
FT                   a repeat region that may contain misassembly."
FT                   /db_xref="GeneID:3659283"
FT                   /locus_tag="Tb927.8.2900"
FT                   /pseudo
FT   gene            <882717..>884483
FT                   /note="synonym: Tb08.28F14.300; mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase IB, putative"
FT                   /db_xref="GeneID:3659284"
FT                   /locus_tag="Tb927.8.2910"
FT   mRNA            <882717..>884483
FT                   /db_xref="GI:72392642"
FT                   /db_xref="GeneID:3659284"
FT                   /locus_tag="Tb927.8.2910"
FT                   /transcript_id="XM_842029.1"
FT   CDS_pept        882717..884483
FT                   /locus_tag="Tb927.8.2910"
FT                   /gene_family="HOG000137425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   IB, putative"
FT                   /note="Gene within a repeat region that may contain
FT                   misassembly; go_component: membrane [goid 0016020];
FT                   go_function: mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity [goid 0004571]; go_function: calcium ion binding
FT                   [goid 0005509]; go_process: N-linked glycosylation [goid
FT                   0006487]"
FT                   /db_xref="GI:72392643"
FT                   /db_xref="GeneID:3659284"
FT                   /translation="MPWVRALLVLVTVFFVRLPSVMREERFHQYGNGESRKLHNVSDMH
FT                   PIQAEMLPYVRDMIDHAFGSYIKYAFPKDELCPVSGTGKNTMGGYGWTLIDSLDTLAIA
FT                   GFHKEFRRHAKWVEEHLTFDIDESVSVFETTIRALGGLLAAHFMYEEGIVPIIPSEHDY
FT                   NGGFLRLAVDLADRLMPCFDTPTGIPYGAINLRRGVSGGESQLANTAGAGTLLMEMTVL
FT                   SRITGDEKYERAARRASEALFAARDSQTELMGNHIHTHTGIWRHGESSVGGNIDSVIEY
FT                   FIKSHSMSGDIGDWERFERTARAVNRYVRKGGMLLAASMYSGRRLQTSQESLSSFFPGN
FT                   LVLGGHLHEAVESSWPIHTFFKHFGVLPEIFSLESGEPSWMSHDYVGRPEHIESLYMLY
FT                   RATRDPTYLLMGKELALAINLRMRTPYGFSSVSDVRYPHHDGVHRDSMESFMIAETLKY
FT                   LYLLFDECNAVHMQGRMGGRASPHCVMDSGSGSSVSHVGWVFNTEAHLFPNSAEWWAPT
FT                   SLETLDKEAEDPAAALRRQRLEVIDGLLASFEEVDGEVVGANDKGGAALYQFHCANHAL
FT                   SDIGRLSKSVFR"
FT                   /protein_id="XP_847122.1"
FT   gene            <884710..>886503
FT                   /note="synonym: Tb08.28F14.310; mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase IB, putative"
FT                   /db_xref="GeneID:3659285"
FT                   /locus_tag="Tb927.8.2920"
FT   mRNA            <884710..>886503
FT                   /db_xref="GI:72392644"
FT                   /db_xref="GeneID:3659285"
FT                   /locus_tag="Tb927.8.2920"
FT                   /transcript_id="XM_842030.1"
FT   CDS_pept        884710..886503
FT                   /locus_tag="Tb927.8.2920"
FT                   /gene_family="HOG000137425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   IB, putative"
FT                   /note="Gene within a repeat region that may contain
FT                   misassembly; go_component: membrane [goid 0016020];
FT                   go_function: mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity [goid 0004571]; go_function: calcium ion binding
FT                   [goid 0005509]; go_process: N-linked glycosylation [goid
FT                   0006487]"
FT                   /db_xref="GI:72392645"
FT                   /db_xref="GeneID:3659285"
FT                   /translation="MKGAQFLKMPCVRVLLVLVRVFFVHLPSFAFGDAFPVNGARGGNS
FT                   QGYNTDGMHPIQAEMLPYVRDMIDHAFGSYIKYAFPKDELCPVSGTGKNTMGGYGWTLI
FT                   DSLDTLAIAGFHKEFRRHAKWVEEHLTFDIDESVSVFETTIRALGGLLAAHFMYEEGIV
FT                   PIIPSEHDYNGGFLRLAVDLADRLMPCFDTPTGIPYGKVNLRRGVSGGESQLANTAGSG
FT                   TLLVEMTVLSRITGDGKYERAARRASEALFAARDSQTELMGTYVSVSSGGFSSSESSVG
FT                   SGLDSAIEYFIKSHSMSGDIGDWERFERTARAVNRYVRKGGMLLAASMYSGRRLQTSQE
FT                   SLSSFFPGNLVLGGHLHEAVESSWPIHTFFKHFGVLPEIFSLESGEPSWRSHDYIGRPE
FT                   HIESLYMLYRATRDPTYLLMGKELALAINLRMRTPYGFSSVSDVRYPHHDGVHRDSMES
FT                   FMIAETLKYLYLLFDECNAVHVQGRMGGRASPHCVMDSGSGSSVSHVGWVFNTEAHLFP
FT                   NSAEWWAPTSLETLDKEAEDPAAALRRQRLEVIDGLLASFEEVDGEVVGANDKGGAALY
FT                   QFHCANHALSDVGRLSKSVFR"
FT                   /protein_id="XP_847123.1"
FT   gene            <886730..>888523
FT                   /note="synonym: Tb08.28F14.320; mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase IB, putative"
FT                   /db_xref="GeneID:3659292"
FT                   /locus_tag="Tb927.8.2930"
FT   mRNA            <886730..>888523
FT                   /db_xref="GI:72392646"
FT                   /db_xref="GeneID:3659292"
FT                   /locus_tag="Tb927.8.2930"
FT                   /transcript_id="XM_842031.1"
FT   CDS_pept        886730..888523
FT                   /locus_tag="Tb927.8.2930"
FT                   /gene_family="HOG000137425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   IB, putative"
FT                   /note="Gene within a repeat region that may contain
FT                   misassembly; go_component: membrane [goid 0016020];
FT                   go_function: mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity [goid 0004571]; go_function: calcium ion binding
FT                   [goid 0005509]; go_process: N-linked glycosylation [goid
FT                   0006487]"
FT                   /db_xref="GI:72392647"
FT                   /db_xref="GeneID:3659292"
FT                   /translation="MKGAQFLKMPCVRVLLVLVRVFFVHLPSFAFGDAFPVNGARGGNS
FT                   QGYNTDGMHPIQAEMLPYVRDMIDHAFGSYIKYAFPKDELCPVSGTGKNTMGGYGWTLI
FT                   DSLDTLAIAGFHKEFRRHAKWVEEHLTFDIDESVSVFETTIRALGGLLAAHFMYEEGIV
FT                   PIIPSEHDYNGGFLRLAVDLADRLMPCFDTPTGIPYGKVNLRSKSKEMWISRSNTAEVG
FT                   TMLMEMTVLSRITGDEKYERAARRASEALFAARDSQTELMGTYVSVSSGGFSSSESSVA
FT                   GNIDSAIEYFIKSHSMSGDIGDWERFERTARAVNRYVRKGGMLLAASMYSGRRLQTSQE
FT                   SLSSFFPGNLVLGGHLHEAVESSWPIHTFFKHFGVLPEIFSLESGEPSWISHDYIGRPE
FT                   HIESLYMLYRATRDPTYLLMGKELALAINLRMRTPYGFSSVSDVRYPHHDGVHRDSMES
FT                   FMIAETLKYLYLLFDECNAVHMQGRMGGRASPHCVMDSGSGSSVSHVGWVFNTEAHLFP
FT                   NSAEWWAPTSLETLDKEAEDPAAALRRQRLEVIDGLLASFEEVDGEVVGANDKGGAALY
FT                   QFHCANHALSDVGRLSKSVFR"
FT                   /protein_id="XP_847124.1"
FT   gene            <888750..>890063
FT                   /note="synonym: Tb08.28F14.330; mannosyl-oligosaccharide
FT                   1,2-alpha-mannosidase IB, putative"
FT                   /db_xref="GeneID:3659293"
FT                   /locus_tag="Tb927.8.2940"
FT   mRNA            <888750..>890063
FT                   /db_xref="GI:72392648"
FT                   /db_xref="GeneID:3659293"
FT                   /locus_tag="Tb927.8.2940"
FT                   /transcript_id="XM_842032.1"
FT   CDS_pept        888750..890063
FT                   /locus_tag="Tb927.8.2940"
FT                   /gene_family="HOG000137425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   IB, putative"
FT                   /note="Gene within a repeat region that may contain
FT                   misassembly; go_component: membrane [goid 0016020];
FT                   go_function: mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity [goid 0004571]; go_process: N-linked glycosylation
FT                   [goid 0006487]"
FT                   /db_xref="GI:72392649"
FT                   /db_xref="GeneID:3659293"
FT                   /translation="MKGAQFLKMPCVRVLLVLVRVFFVHLPSFAFGDAFPVNGARGGNS
FT                   QGYNTDGMHPIQAEMLPYVRDMIDHAFGSYIKYAFPKDELCPVSGTGKNTMGGYGWTLI
FT                   DSLDTLAIAGFHKEFRRHAKWVEEHLTFDIDESVSVFETTIRALGGLLAAHFMYEEGIV
FT                   PIIPSEHDYNGGFLRLAVDLADRLMPCFDTPTGIPYGKVNLRSKSKEMWISRSNTAEVG
FT                   TMLMEMTVLSRITGDEKYERAARRASEALFAARDSQTELMGTYVSVSSGGFSSSESSVA
FT                   GNIDSVIEYFIKSHSMSGDIGDWERFERTARAVNRYVRKGGMLLAASMYSGRRLQTSQE
FT                   SLSSFFPGNLVLGGHLHEAVESSWPIHTFFKHFGVLPEIFSLESGEPSWISHDYIGRPE
FT                   HIESLYMLYRATRDPTYLLMGKELALAINLPALSCFFF"
FT                   /protein_id="XP_847125.1"
FT   misc_feature    890433..890546
FT                   /note="T-rich"
FT   gene            <890666..>892135
FT                   /note="synonym: Tb08.28F14.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659291"
FT                   /locus_tag="Tb927.8.2950"
FT   mRNA            <890666..>892135
FT                   /db_xref="GI:72392650"
FT                   /db_xref="GeneID:3659291"
FT                   /locus_tag="Tb927.8.2950"
FT                   /transcript_id="XM_842033.1"
FT   CDS_pept        890666..892135
FT                   /locus_tag="Tb927.8.2950"
FT                   /gene_family="HOG000257495" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="similar toGP:12581504: GU1 {Trypanosoma brucei}; 42%
FT                   similar toGP:12581504: GU1 {Trypanosoma brucei}"
FT                   /db_xref="GI:72392651"
FT                   /db_xref="GeneID:3659291"
FT                   /translation="MLSRSSQDPFTGELDSLAMVHEVMKFVPYNRRTLCTMRCVSKPYR
FT                   RAVQHPKGPWSCHEDMMISRYGQCIIFNAMDDEDGRSSFRLCSVSPVGRKFETFSANML
FT                   SRYHQRVADGLTRLVLHHSPVEVEFFEALAALTNLRALELVACRNIKSISGASHAANLE
FT                   SLEVHLCPLEADGVVGLCLPRLRRLKLRSCYKLTFVNGIPPETAASLEELYLENCNVYD
FT                   GSVNELFGNLTSKLRVLHLPSTHVDAALTAIPEEVRSAGLMSLHLRETPLRFETLCELA
FT                   PSLQDKLEFLSLEGCTGLESFEPLGRLQQLRFLDVSGSFHGEGLHFLTCCTKLELFRMG
FT                   DSQIENIMFLSSLQFLRVLDAPKSVLSDPSLMFLEALPMLDTVVLTGCILITNVNVLST
FT                   CPRIRRIFCARTSVTNEGVTLLSDCPELEELDLRMTAVTDVNFLADCSSLKSINVGSAV
FT                   TSIDGLQLLLNKKGLEVIHDSFDMETDLTDM"
FT                   /protein_id="XP_847126.1"
FT   gene            <893585..>895249
FT                   /note="synonym: Tb08.28F14.350; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659294"
FT                   /locus_tag="Tb927.8.2960"
FT   mRNA            <893585..>895249
FT                   /db_xref="GI:72392652"
FT                   /db_xref="GeneID:3659294"
FT                   /locus_tag="Tb927.8.2960"
FT                   /transcript_id="XM_842034.1"
FT   CDS_pept        893585..895249
FT                   /locus_tag="Tb927.8.2960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392653"
FT                   /db_xref="GeneID:3659294"
FT                   /translation="MGGNRRHMGSIPGKSDVGEPGADLPPAPPVDLCDDQLRMASTIKS
FT                   FHYKLQQRMTTAGDRTCTQETEEERWFRLIAEESEQMKSYTAAMHGIATQYWDPQEDKL
FT                   RDGGQTKSCVTCPPITTRVIPSNDAICVTKRVRDTETVVVGSACERQRAACLRHNDRIK
FT                   YSLQCVTEYFLGICRVPPLIASGDTNRSTCSEVADVLSCSAVAGAVYYEKLPLLASSSV
FT                   KRWRRTYYDTHGRQAYPYEIDAEAYRVLLASERTVRDGNTAAPVCPLSSSGLVTTGTAG
FT                   GTAANYMTMSRTEACRRINLDCPHPRLLGQQRVPPLLVLDIGSCYGPFGGRIVTNGVLQ
FT                   VPLAVTALDLSPYEGSGVIKADWLAIRFHDSDGATGRCSCDDEGCISGTTFDDHGHADC
FT                   GVSLVRWCDEESGKYEGTGSARRILSLARGAFDVVFFCLLLSFLPHPRLRYRACLHAYL
FT                   ALKDGGLLVIVSTRTQGARRSLWVDEWIKCIEGIGFKRVHKNVMKQIVGLSFSKQPASE
FT                   VSGDDSVLCGAEAWVERMMNRADALGGLRTIGDESPW"
FT                   /protein_id="XP_847127.1"
FT   gene            <895734..>896648
FT                   /note="synonym: Tb08.28F14.360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659296"
FT                   /locus_tag="Tb927.8.2970"
FT   mRNA            <895734..>896648
FT                   /db_xref="GI:72392654"
FT                   /db_xref="GeneID:3659296"
FT                   /locus_tag="Tb927.8.2970"
FT                   /transcript_id="XM_842035.1"
FT   CDS_pept        895734..896648
FT                   /locus_tag="Tb927.8.2970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392655"
FT                   /db_xref="GeneID:3659296"
FT                   /translation="MELHIFDFDGTIFNSPTPSARLKTTQGSRVYGQLMRPLQDNGLGW
FT                   FQSLSTLSPPAVPEKPEEEKWYIAPVLARIRQLNERRRDDKLRGDPESVQVYVLTGRDE
FT                   KYRRRITALLDNVGLLGIMNGVFLKPSETYGTVKYKLETMYTLLAKHQPTQAFYYEDRM
FT                   EQGQKLLGGIRRLSDVVNKKSSGTGFVSTLMLHPDGSLCRLEPDPLNSDEANIENCNAA
FT                   KRWWNDVCRRIDPYPLSSVNPFWFTLVFLDPELPSCSDRMLTAKEEDLLVSELRYEGEA
FT                   YRAANPTKARSTSDGPRGLRKRS"
FT                   /protein_id="XP_847128.1"
FT   gene            <898041..>899291
FT                   /note="synonym: Tb08.28F14.380;
FT                   Bis(5'-adenosyl)-triphosphatase, putative"
FT                   /db_xref="GeneID:3659298"
FT                   /locus_tag="Tb927.8.2980"
FT   mRNA            <898041..>899291
FT                   /db_xref="GI:72392656"
FT                   /db_xref="GeneID:3659298"
FT                   /locus_tag="Tb927.8.2980"
FT                   /transcript_id="XM_842036.1"
FT   CDS_pept        898041..899291
FT                   /locus_tag="Tb927.8.2980"
FT                   /gene_family="HOG000257492" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Bis(5'-adenosyl)-triphosphatase, putative"
FT                   /EC_number="3.6.1.29"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   catalytic activity [goid 0003824]; go_process: nucleotide
FT                   metabolism [goid 0009117]"
FT                   /db_xref="GI:72392657"
FT                   /db_xref="GeneID:3659298"
FT                   /translation="MRSAQLPSKLSSAAGSCKHWVVSVPNSSESYRCFCSLIDRALQPG
FT                   TCHPYSVRFRLEHLLPADWSLLLGWCRRLTSCGGSFTYTSPGDISEQTESVGAVDDSEG
FT                   HPAVVNAAFMHVVERCHGDFVPNNMIYHELQRRYTVYAPASPPPPEGPEDFTSFLGALQ
FT                   DSVCDGCLASLSEGDGNVGEDPLASQVPSLEATKHNQKVLGVGAAASMESEAHRQQGEL
FT                   LFNFFPHRVVVSDGIPCHSTHFVVMVNLKPVVPWHLMVVPIRCVGTLSALSAAEMEDLG
FT                   HMIHLTISVLSHVLVKPAVTGTGDTSSNGGSRVERGCSPHSIGSPVPASVVGGGGFSIA
FT                   IQQGELAGQTVPHLHVHVIPFDPRGKLAGEPEDEEQQRRQPPRTGAQMRKETEFLRPHF
FT                   VRLANEKNMRGICATCG"
FT                   /protein_id="XP_847129.1"
FT   gene            <899592..>900554
FT                   /note="synonym: Tb08.28F14.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659297"
FT                   /locus_tag="Tb927.8.2990"
FT   mRNA            <899592..>900554
FT                   /db_xref="GI:72392658"
FT                   /db_xref="GeneID:3659297"
FT                   /locus_tag="Tb927.8.2990"
FT                   /transcript_id="XM_842037.1"
FT   CDS_pept        899592..900554
FT                   /locus_tag="Tb927.8.2990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392659"
FT                   /db_xref="GeneID:3659297"
FT                   /translation="MYPLSAISDAKKVLRLTHMRRLRAMARSDPSALKLESIRICEVLY
FT                   ERICVLRRKHLGVEGAMLPPLLLCAYLPLFYEVDLRPLLSRLWRERPNEHLRCVSVFVP
FT                   TVLAQFKNVNSCTGTSVPVPLRSFPPQTVAERLMSAMLFVEVLGEGDLLRSFDVRGCYG
FT                   LMELKEGILHRDIFRSGESVTCGVSPSSRRVIACDWWHSLFPHCPRPAGLIESGDHPRG
FT                   GVQRGPLLSLTPGVLFDRTGGRLGKGGGYYDRFLQFQRCASGDPAEETTLAWGVAREMQ
FT                   LLSGEGDKLPVYRDSLPSHGMKDALMDAVVTSTEFVKCS"
FT                   /protein_id="XP_847130.1"
FT   gene            <900940..>902472
FT                   /note="synonym: Tb08.28F14.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659295"
FT                   /locus_tag="Tb927.8.3000"
FT   mRNA            <900940..>902472
FT                   /db_xref="GI:72392660"
FT                   /db_xref="GeneID:3659295"
FT                   /locus_tag="Tb927.8.3000"
FT                   /transcript_id="XM_842038.1"
FT   CDS_pept        900940..902472
FT                   /locus_tag="Tb927.8.3000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392661"
FT                   /db_xref="GeneID:3659295"
FT                   /translation="MCAMEYSDYTVGLSHLWHMHHLAAVRLQSGKGITGLPYIDFRNPE
FT                   TMDHPQLATDAIVRRLHRRIAADEQHIVKANYHLRDVICNAGDPTYRRRRNMNNLPTEE
FT                   EVATCLNSAKHTAALERARLNRVKNIQRENYILLEHLKNTKCSVTSAKELNRWYNNEYK
FT                   KRSRMTRHFKPREPFCGARVLTAECKFTPGTNPDYVTSQALVETPSLWMHRREPTVVEV
FT                   LAKGPVLPSLQEAANQYIEGCCYTDAKTGVPHLLSRSKGGKRGKAEWKGISKLDVKLMN
FT                   YANDLKLVRGGNLPIVRRGEENGITSLWRGELEKRSPTRCQGPPWRWLGATEKSNEEKA
FT                   GGQHQSVNTIVPGRWDPHRSIMGRVRKLALLKDKRHQYAKDAKDGNARRENRRPPYGVP
FT                   VIPPAAAGGFPFNGSTDAQIPYGMQRLQNRLSTEVPYAQNGHYAEGMPGPVAFPSNAYG
FT                   ESTKTVDSSGPHGFHDFSQLKNYRLGSQGTPASSISRNFGDADAEAPQYVSG"
FT                   /protein_id="XP_847131.1"
FT   gene            <903463..>905676
FT                   /note="synonym: Tb08.28F14.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659302"
FT                   /locus_tag="Tb927.8.3010"
FT   mRNA            <903463..>905676
FT                   /db_xref="GI:72392662"
FT                   /db_xref="GeneID:3659302"
FT                   /locus_tag="Tb927.8.3010"
FT                   /transcript_id="XM_842039.1"
FT   CDS_pept        903463..905676
FT                   /locus_tag="Tb927.8.3010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392663"
FT                   /db_xref="GeneID:3659302"
FT                   /translation="MKYSGDTPVADDEAVDKLRGELVDLQKRFILLFKASGQSLEQIRS
FT                   TVESSLKSRANEPTQGGRLSDRDSMLQDLVRIVERTQRYVQLAGKPPLGSVSADALQIE
FT                   YQSWASNMPTASSHRSHGDHATTEQRVKSLQLERDDVKRKLQEAEENNAKLQRKLKAAV
FT                   QKYNHLAKNTKEMGEPSHTTRARTLSPSAHNGNSSKSSEAVSKRFTGHSYRDSAGQRSC
FT                   RQNSCNDVVGDSAFNSQHTSARGGSSEFLDAVRQDNASLRREVTKLKEELRQTQRGAIA
FT                   RTKQGDEDVGSLLMKITGLKQELVLEERQRMDALLHLGEAKRENQRLVTQVEELKQQLV
FT                   HVQQSDGRVPDVISVESKETNIMNSLGKELGHTQQVAAMQVLQAKELTRVLERMQDFLH
FT                   SSFLKQRKLVTELEKAGKGWSTTPLQLEAAQTHEGCTPANKVKIEDANVSSPGVESSGG
FT                   KSRTILKASDDSGSSDLNTFCDRVLTVDDVDPLTLGKNDGDTHLRSQNSELVKENQQLH
FT                   DALSKLSMMYRSTKEKPKSGERSVMEREALPPGVKQPDRSAEVASAKRVVKEHVRKDNA
FT                   KAHRDAKKEKAQSSLREQVPPKQLPVQPHQLPKAPKPQAQRDLPPKSPVRRHDSHLQRS
FT                   RTTTPRREAHAQYDQKQRHNLSSSLQAETGYTQSPSASQSRDDRSSSHSSTSTARFLRR
FT                   LAEFRFPKEGAASVPDSGERNTDSGKDDVRNFSPPRLSYMKST"
FT                   /protein_id="XP_847132.1"
FT   misc_feature    906351..906390
FT                   /note="T-rich"
FT   gene            <907053..>909089
FT                   /note="synonym: Tb08.28F14.440; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659301"
FT                   /locus_tag="Tb927.8.3020"
FT   mRNA            <907053..>909089
FT                   /db_xref="GI:72392664"
FT                   /db_xref="GeneID:3659301"
FT                   /locus_tag="Tb927.8.3020"
FT                   /transcript_id="XM_842040.1"
FT   CDS_pept        907053..909089
FT                   /locus_tag="Tb927.8.3020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392665"
FT                   /db_xref="GeneID:3659301"
FT                   /translation="MPLSAGSGHRNVVYFRCCVNSPSDKVSSCSDIFFSPPPPFPPFCC
FT                   ELLITPHSGCCVFPNFCVFFFVLLNVLSKRMETKRSFDSLGIHPTLVEALRRAGVRPTP
FT                   FQARVLENTTTDLADIIVDARAVSGESSSGVSAAEGATNAQPTVSERNNLMMIFVAHCV
FT                   LSSRDSARHIGLVLANNKENAGRLQKCVANLAARCGITVETMTNEGQKPQLPSAEGDER
FT                   ECSSNGGKQTDGEGEYRIIIATMRALHSWDKALFAPVVTFAVEDASRSFDPPLDDVLRL
FT                   LTQPNKTGQGQSNRTGSPLPSPGAPAFVPNIFLMCLASPVSLKQSIRYRLNRKNRRYYH
FT                   IQTPSESHPPSPSPSAGVGDATQDPASEQLHVPPSTTPPASTQVLYLLYIDENDRMELL
FT                   QRVLKMYAGRRTLLLTHHKEIRQLHQKVIKWDMYNTTGEAGGNGGGSIKATEYVHCMQR
FT                   TDTPERQESTVMAFIRESTSGNRGGAGNKKSVPPTLLIGWDTFTAIDLVDVDVVIQYYP
FT                   PQKSITRQECVGFVQVLHTTTDPKVGGRCHRTTLITFLSTSDFTLAAFFMEQYGLRGHI
FT                   LNVTPSHHHFERCLRNSAGVLEYKLRKQCESLHDEGSESNGTAQCSIPFSRPRSRRRGN
FT                   GNRNAGSNNGVGTNASTQANMNAAPSTSNSDTETRRPLGRHRG"
FT                   /protein_id="XP_847133.1"
FT   misc_feature    909447..909506
FT                   /note="A-rich"
FT   misc_feature    909999..910109
FT                   /note="T-rich"
FT   repeat_region   912015..912076
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    913378..913440
FT                   /note="A-rich"
FT   gene            <913496..>914203
FT                   /note="synonym: Tb08.28F14.500; hypothetical protein"
FT                   /db_xref="GeneID:3659300"
FT                   /locus_tag="Tb927.8.3030"
FT   mRNA            <913496..>914203
FT                   /db_xref="GI:72392666"
FT                   /db_xref="GeneID:3659300"
FT                   /locus_tag="Tb927.8.3030"
FT                   /transcript_id="XM_842041.1"
FT   CDS_pept        913496..914203
FT                   /locus_tag="Tb927.8.3030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392667"
FT                   /db_xref="GeneID:3659300"
FT                   /translation="MFSKYGGRVSIAHSLPFFYLSYDHCVLPSFHPNAQLGAKEEEETL
FT                   ARISPLRMSAIYIYIYIYICLFACFFVPSSNFCFPHHAHVFFFPFSLFLAICPLTVLEA
FT                   VRTSNEEKFSAGDKTKASTTQQYVSVYVFSRICVLTYCSTPIQLMHLFPVFLYSLCCIA
FT                   VKFTLTMPAVMIFFFFSPLLSSSSSPFLSLVFAVASFLTAMRITILYRPHGHALTLPPL
FT                   LLQMSPADTPVSP"
FT                   /protein_id="XP_847134.1"
FT   repeat_region   913660..913686
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <915645..>916253
FT                   /note="synonym: Tb08.28F14.510; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659307"
FT                   /locus_tag="Tb927.8.3040"
FT   mRNA            <915645..>916253
FT                   /db_xref="GI:72392668"
FT                   /db_xref="GeneID:3659307"
FT                   /locus_tag="Tb927.8.3040"
FT                   /transcript_id="XM_842042.1"
FT   CDS_pept        915645..916253
FT                   /locus_tag="Tb927.8.3040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392669"
FT                   /db_xref="GeneID:3659307"
FT                   /translation="MFRISSCFHSFFLNAVRCTFIADVLYGCRYSPHIGMCHHPYVYVK
FT                   TVLFCVSSRPEQRLEREYMRGLIEHLVACDAKHDTQTKLELMRFVDVVPAAASLGGSGH
FT                   SEVLSAGKMGGESGMSSFFTGTLFPAVLGHVLLYDAVCVCMSGGLYDDAARDCVAQVAA
FT                   RLGVSQHGREMIEKAAIREHQLAAMKRQLLLLPETPPLR"
FT                   /protein_id="XP_847135.1"
FT   gene            <917139..>918842
FT                   /note="synonym: Tb08.28F14.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659303"
FT                   /locus_tag="Tb927.8.3050"
FT   mRNA            <917139..>918842
FT                   /db_xref="GI:72392670"
FT                   /db_xref="GeneID:3659303"
FT                   /locus_tag="Tb927.8.3050"
FT                   /transcript_id="XM_842043.1"
FT   CDS_pept        917139..918842
FT                   /locus_tag="Tb927.8.3050"
FT                   /gene_family="HOG000257477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392671"
FT                   /db_xref="GeneID:3659303"
FT                   /translation="MTTATVKPEIVIAVLSMCGLLTVVVIILLVCSWWSRRKAGAYAGS
FT                   ALYRGFKRRHQFELVCTPGPGAHAAPLEVQLRTSHVDPCDILVDVQYTPPGFLKECDRT
FT                   AVSPARLLGADEHYGEQYLLYSHPFVFRGPGRYTVNAHTVSPSMRYVGAVHNFCFDVLP
FT                   GDTPSGSGDTEMEASCQHANDFSRHDFSTQRDVATKCSITPIRHPLPPRIIPNEGEVTT
FT                   FTPIIITTNNESTTADQIRYSVDGRYPSLLYTGPFTLSVPPFSNACNGSSVPVVVRAVA
FT                   VSGSDTGLTSEVVTANFTVYRAGHSFFDPQVPAPVARVHAVNAKLYFDESRRPPNTNIL
FT                   YQLVYVSEARQKPKFSRRRGFVYTGEFVPLREDVAFIYAWTFVGDGNGDGTGVDLDEVN
FT                   GGGRRHIRSSAAVYDCRRGTSWNREARDEGGLHPHNNDRTHRGDLSPPVICVSCSEMEV
FT                   FFEDPPAGGVVCYTLDRTEPAAPGGATAPEQAVRVGLGTGAQQLARFGPGPNLSTYVYK
FT                   SNQPIHVTLLQTEQVFVTARTFIPVADGAAGDAVTCYRFSDRFFRGFAIQ"
FT                   /protein_id="XP_847136.1"
FT   misc_feature    919194..919214
FT                   /note="AT_rich"
FT   gene            <919954..>921969
FT                   /note="synonym: Tb08.28F14.550; cytosolic leucyl
FT                   aminopeptidase, putative"
FT                   /db_xref="GeneID:3659299"
FT                   /locus_tag="Tb927.8.3060"
FT   mRNA            <919954..>921969
FT                   /db_xref="GI:72392672"
FT                   /db_xref="GeneID:3659299"
FT                   /locus_tag="Tb927.8.3060"
FT                   /transcript_id="XM_842044.1"
FT   CDS_pept        919954..921969
FT                   /locus_tag="Tb927.8.3060"
FT                   /gene_family="HOG000243129" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytosolic leucyl aminopeptidase, putative"
FT                   /EC_number="3.4.11.1"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_function: aminopeptidase activity [goid 0004177];
FT                   go_process: proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:72392673"
FT                   /db_xref="GeneID:3659299"
FT                   /translation="MLKRVIARASLPKSLDVLPLFSFSKKGKGGIEKVAGDSQVKSLVS
FT                   HPKCVSAHFCNPKDHSEALREDDDGGDVDKHDAVDVPFGFRDAPGNILLDPERRRLFAG
FT                   IGEKPTVRDYRLAVTAAVREASKLKASALVMRSLPNVLYSVGDLFQPASALPAEDVAEK
FT                   TVTYAVAAAYRYDRFLSKAKGGLPPPSRGRRNKAVAEGSHEQLNLIIDCGDKTSIASGN
FT                   IIGHCINDARNLGNLREDEGTPQFYCEWIHQELAPLGIKVQNVLHGEQLEKAGLNLIYN
FT                   VGKGSKHTPYLVVFEYVGDKRSNKATALVGKGVTFDCGGLNIKPFGSMETMHMDMMGAA
FT                   TVMATMKAIAELQLPVNVVAAVGLAENAIGPSSYHPSCILTSRKGLSVEVLNTDAEGRL
FT                   VLADTLTYLQKDAKLVKKADTIIDIATLTGAIVVGLGSRRAGLFGNDIALVQQLMASGR
FT                   SSGEEVWPMPIGDEHQRAIKGNIADLVNVPSVREGGSCTAAAFLSNFVEKDVKWAHLDI
FT                   AGSGMGTDKPRGFQPAGAPGFGVELLVDYFRQHVMASSKGVSTGKDGSHGDAEESTQEE
FT                   GANAEVSEENTKRSKTSAGGKKLTKNAEPKEGKGKEAKPNVKGTKGGRKVGEKGTEGKG
FT                   KAASPAEKKRVKKAPAAKQGRRAVKGNPKGKKRSGN"
FT                   /protein_id="XP_847137.1"
FT   gene            <923210..>923647
FT                   /note="synonym: Tb08.28F14.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659308"
FT                   /locus_tag="Tb927.8.3070"
FT   mRNA            <923210..>923647
FT                   /db_xref="GI:72392674"
FT                   /db_xref="GeneID:3659308"
FT                   /locus_tag="Tb927.8.3070"
FT                   /transcript_id="XM_842045.1"
FT   CDS_pept        923210..923647
FT                   /locus_tag="Tb927.8.3070"
FT                   /gene_family="HOG000257476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392675"
FT                   /db_xref="GeneID:3659308"
FT                   /translation="MAYVSPARVKWATFVFWNFLDPTFRLHFRYYQRKLAVDRYLERLG
FT                   VVANVGIGVTFGLMFYNLLIARFLLPRSVSSGHSMEENANEVLRVLKYDTTKELPAFLL
FT                   MRAKREVISKLHVAADKAEVKRQREEVRRLLDSIDQQRLPK"
FT                   /protein_id="XP_847138.1"
FT   gene            <924095..>928009
FT                   /note="synonym: Tb08.28F14.590; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659304"
FT                   /locus_tag="Tb927.8.3080"
FT   mRNA            <924095..>928009
FT                   /db_xref="GI:72392676"
FT                   /db_xref="GeneID:3659304"
FT                   /locus_tag="Tb927.8.3080"
FT                   /transcript_id="XM_842046.1"
FT   CDS_pept        924095..928009
FT                   /locus_tag="Tb927.8.3080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392677"
FT                   /db_xref="GeneID:3659304"
FT                   /translation="MLRNLQAPPDLEPPAPQLLAVRGCSLITSRWLQVLSYILAEVCSS
FT                   ATLLDDYVRATLNVSHHLLSAWHSIAVAAHRPREQRTSGSSSGWRSVSRDGTVPQTDRV
FT                   RWEKEATAARHVELVRHLVVMALLQQFLSVPVSGSSDTVLRDLLLRHRRWRQRRAGKGR
FT                   FTELGDAEGGLVGDDDNNCDGGGPRAPRGRDREESKNNKRPRPHSVDRFGCSSSWSTLP
FT                   SMGQRPDDDCSICDEERCDDNTCSSVDLRLFMRAAVAMNPTACALQLISRCIVCIQSDW
FT                   SCDCKDGAPPTSPVGFRGPDAGDGGVAGNRYFVFVASRDVAACEHSGPCFGNRKFIFVH
FT                   CERPSCEDVEPSRCSRHCPVVIPPPETAAGTVAPIALVASRRGGGPLLGDGGVWGHVMR
FT                   SMRQLRLELGRGGLGVPARSGVVACLPSVARPACNAQGRPSFSREGAGRFLLPPLAPNR
FT                   RCSTEHCMGCGPLPTDARSQRGIDSGEDGSVGESDEGRSSWFLMYSDRCSATGAFFSGA
FT                   VPSVGRLIAFPSPLTGSSSEPVPVVQPTSNLESVDVPLEQAIFLPPAAGHEVRHTGRPS
FT                   TEVDEYSKSVMAGHVAFAEEVAARLEFWCARGSPRRCYYDPVVLNSAGDNGDGASGGTD
FT                   VGARRGSNDTNGCVSEGENAGDWMEETMPLMLLFTQVGTVRFQLLGDTVYCNPRSRGLL
FT                   ITAISEATELVICGTRESRVHRGWHKRCDNGRSDGRAGNGVGRRRTRGESVSGVCGASD
FT                   LTLSAGVSGGASLHVYYDVAVEVCVCWAQGEVLGDGEKDCQTALEGTSVGNAKGSPYGS
FT                   RCGQLLSRREQNQRRSERLKTEFRLAHSDRLDALLVDGRNAKPIASVTLVPSTAPGWPT
FT                   QSATRAVQDTRFIVQSFSHYVAPLLNHLREDKVLMVDMDRTLVDNAIISRNRLAHGFLD
FT                   NPLWRAQFHMGSSQEEGQADEREALERHCEASGMVSYFVSEDPRCGMRTETVYVRRGVR
FT                   NLLRRFAVEWGIPLLLVTKSSRSRAEAILRQLLDPEGELFPIDRGRVYTAEFLVNSVPH
FT                   SGFSSQSMGSCPTSIDGVTDVGAMDAESWREYRRRLCDSRKSTTDVLRVWDQLFSSTEG
FT                   VAPVRRARSVAVLDDMPQLWSESDWPRTVAVAPYTLDRVDPDEYFSAGGLIASLLLSVL
FT                   YSKNSVVCPLRMRRFVAGGSGSYGCGTVYGEEATCDFRGGVQGYGPGGERDTVYGEVEV
FT                   QHEDSTCHTCMSDDTDSLDYCGRSSPPPTPCFVTLEGGGGVSVAGEEGVGDIVVVEEGG
FT                   LDLPEVSVWNTADVEDVAPL"
FT                   /protein_id="XP_847139.1"
FT   gene            <928399..>928806
FT                   /note="synonym: Tb08.28F14.600; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659306"
FT                   /locus_tag="Tb927.8.3090"
FT   mRNA            <928399..>928806
FT                   /db_xref="GI:72392678"
FT                   /db_xref="GeneID:3659306"
FT                   /locus_tag="Tb927.8.3090"
FT                   /transcript_id="XM_842047.1"
FT   CDS_pept        928399..928806
FT                   /locus_tag="Tb927.8.3090"
FT                   /gene_family="HOG000257503" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392679"
FT                   /db_xref="GeneID:3659306"
FT                   /translation="MQVSPRVPKVKAKTPYDLPERVRWYHILWEMRKGEFRRSYISMQR
FT                   RHWRIFLKYESHLIYERAVMGLLAATVIYALSNLNIVKAVVRLPTEDINELLKEDVWQG
FT                   YRNEVNQRKEHANKMLEESAFIRDKNKPFSS"
FT                   /protein_id="XP_847140.1"
FT   gene            <929015..>930586
FT                   /note="synonym: Tb08.28F14.610; coronin, putative"
FT                   /db_xref="GeneID:3659309"
FT                   /locus_tag="Tb927.8.3100"
FT   mRNA            <929015..>930586
FT                   /db_xref="GI:72392680"
FT                   /db_xref="GeneID:3659309"
FT                   /locus_tag="Tb927.8.3100"
FT                   /transcript_id="XM_842048.1"
FT   CDS_pept        929015..930586
FT                   /locus_tag="Tb927.8.3100"
FT                   /gene_family="HOG000257504" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="coronin, putative"
FT                   /note="go_component: cell surface [goid 0009986];
FT                   go_function: actin binding [goid 0003779]; go_process:
FT                   microtubule-based process [goid 0007017]"
FT                   /db_xref="GI:72392681"
FT                   /db_xref="GeneID:3659309"
FT                   /translation="MVRIKSRAHVSNSTQASSPLRSTPMDVSRFRHTQAVPARQDQQFL
FT                   NLTPSAARWECSNLIACNDRFIAIPWLQLGSTAVLRHTDCGKLASNPPILLGQEGDIID
FT                   VAFNPFDSSKLFTASEDGTIMGWNIPEEGLTQNCSDNIVHLQGHSKKVGLLSFHPSAAN
FT                   VLASAGADMVVNVWDVQKGVAKEVVKCHAEQISSLDWNLDGSLLCTTSKDKKLNIVDPR
FT                   SQKIVCSSGASESTKTQRALWARRADLVITIGVNTMQMRQAMVWDIRKLAAPASTVDVD
FT                   QSCAVSMPFFDEDTSLFYIGSRGEGGIRSFELRNSRLINCSSYSSSEIHRGLCMVPKWM
FT                   LDTHKCEIARFYALTQKSMYNVQMLLPRKTADEELQTDVYPPTFANEPAITADEYFSGV
FT                   NKEPLVMSMQAVFDGKSLEATKAAETKRRGVPRPSEVESDDDDSSADEAVTSSRQKHAD
FT                   PNAVRGPAHSEGISSQTSSQLLALASLLGQQQAEVQRCREDLQKKESLVMETIAKIKAL
FT                   ASGSQA"
FT                   /protein_id="XP_847141.1"
FT   repeat_region   931312..931335
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <932090..>933421
FT                   /note="synonym: Tb08.28F14.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659311"
FT                   /locus_tag="Tb927.8.3110"
FT   mRNA            <932090..>933421
FT                   /db_xref="GI:72392682"
FT                   /db_xref="GeneID:3659311"
FT                   /locus_tag="Tb927.8.3110"
FT                   /transcript_id="XM_842049.1"
FT   CDS_pept        932090..933421
FT                   /locus_tag="Tb927.8.3110"
FT                   /gene_family="HOG000257505" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392683"
FT                   /db_xref="GeneID:3659311"
FT                   /translation="MQKLLSPRTARHARLFRLAGKLADSGSPGVPKSDGERLVWVNSHV
FT                   RRDKDISLSQEEERIRELMMPLEVGENSFAANGQATHGNLFYFREYPMYPGEYVPAEHN
FT                   TLSSLRDELRLDLTAQSLKEAWMRVSGGVYFQSVDEYYASVDGLDAEQIGEVLAALFPE
FT                   LNCYEAQALVQRTLECISRPVSAASRQLSRTITAEAVGLDNAPGHYTNFLEWMGRLTET
FT                   RAFKTEHALFEFSRRKFNRDDVRVMFENYRLMSKATLLADSADSYSHFYTVLKDFARKV
FT                   AGEDSRHQIGVRIDEAEVDPETGIAVGRGCADGEKYHFTALLRENRDHNGIITVMGKPL
FT                   SLVLDNKAWLMEMVLMPFDEANLDYRDFDVHIVSEGHAMPSIANEIAAFALRMAVANAL
FT                   VKLIPLTRIPLKKSGLLSVDRRRERGQFPGYLDGKKVKRRFAKR"
FT                   /protein_id="XP_847142.1"
FT   gene            <933683..>934045
FT                   /note="synonym: Tb08.28F14.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659305"
FT                   /locus_tag="Tb927.8.3120"
FT   mRNA            <933683..>934045
FT                   /db_xref="GI:72392684"
FT                   /db_xref="GeneID:3659305"
FT                   /locus_tag="Tb927.8.3120"
FT                   /transcript_id="XM_842050.1"
FT   CDS_pept        933683..934045
FT                   /locus_tag="Tb927.8.3120"
FT                   /gene_family="HOG000230612" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392685"
FT                   /db_xref="GeneID:3659305"
FT                   /translation="MYFLLLAGIIWGITNPLLKRYSGGMSVDSSSFLEDLRFLASRPKY
FT                   LAAQLANLSGSVFFFAGLPSADVAVGSIVANSLAFVITVLVSVLVLREGTLKPRTLVGC
FT                   SLVVVGTSLCGIASSS"
FT                   /protein_id="XP_847143.1"
FT   gene            <934437..>935861
FT                   /note="synonym: Tb08.28F14.650;
FT                   S-adenosyl-methyltransferase mraW-like protein, putative"
FT                   /db_xref="GeneID:3659313"
FT                   /locus_tag="Tb927.8.3130"
FT   mRNA            <934437..>935861
FT                   /db_xref="GI:72392686"
FT                   /db_xref="GeneID:3659313"
FT                   /locus_tag="Tb927.8.3130"
FT                   /transcript_id="XM_842051.1"
FT   CDS_pept        934437..935861
FT                   /locus_tag="Tb927.8.3130"
FT                   /gene_family="HOG000257507" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="S-adenosyl-methyltransferase mraW-like protein,
FT                   putative"
FT                   /EC_number="2.1.1.-"
FT                   /note="go_function: methyltransferase activity [goid
FT                   0008168]"
FT                   /db_xref="GI:72392687"
FT                   /db_xref="GeneID:3659313"
FT                   /translation="MKRIVVPHRWSEMNRVEHPPLMMKQLFQGVCGGLRWLETKSLAQY
FT                   LAVRAIEEGYPSTPGVRKALHVKRPPLQKRRVVQRSTKSATAACSLPTTAAPAQLPLTS
FT                   SGDALTVTGGLSLQVTKQKRLVSYDVLDCTLGSGYHAGAVLENGGPYTRVVALDCDHDA
FT                   MHAARDLVEEFGGDRLRFYCCKMSEAKAMFGERSFDAIMIDGGVSDTQLEDPERGFLLD
FT                   DEGGHRLDMRFGPQMGVGALEYLNTVSQHTLVSSLLAYGLLEYGQAMKMSRAITRRKPF
FT                   VDSREVLTCIEQAGDELPEGGWRSQGSRRKSPMSWKFLTSLRCIINNEMYELRQGIENA
FT                   LLMLRDDGRLVVFSRLPWEERLVRGTVDDHPHALLSYVEDISIDDVQIYGFTRHAKMWV
FT                   ITRAASSAYALKNTTTLTEEKFRESSVRWLTGMYAGQTHGFPANNFTFENFERKEWVTL
FT                   RRNGKPPPVDVGLDDK"
FT                   /protein_id="XP_847144.1"
FT   misc_feature    936062..1060981
FT                   /note="sequence corresponds to BAC RPCI93-28L1"
FT   gene            <936260..>937180
FT                   /note="synonym: Tb08.28L1.80; NAD dependent deacetylase,
FT                   putative"
FT                   /db_xref="GeneID:3659310"
FT                   /locus_tag="Tb927.8.3140"
FT   mRNA            <936260..>937180
FT                   /db_xref="GI:72392688"
FT                   /db_xref="GeneID:3659310"
FT                   /locus_tag="Tb927.8.3140"
FT                   /transcript_id="XM_842052.1"
FT   CDS_pept        936260..937180
FT                   /locus_tag="Tb927.8.3140"
FT                   /gene_family="HOG000085953" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD dependent deacetylase, putative"
FT                   /EC_number="3.5.1.-"
FT                   /note="go_component: chromatin silencing complex [goid
FT                   0005677]; go_function: DNA binding [goid 0003677];
FT                   go_process: chromatin silencing [goid 0006342]; go_process:
FT                   regulation of transcription, DNA-dependent [goid 0006355]"
FT                   /db_xref="GI:72392689"
FT                   /db_xref="GeneID:3659310"
FT                   /translation="MADRLAIFIKQCGLQRCVILTGAGCSTESGVPDYRGPNGLYRRPN
FT                   FVPLTRQVFLSGSEHRKRYWARSMFGYNTVSGASCNDTHMGLYELYRAGVVNRLLTQNV
FT                   DGLHHLAAHGGTGSKTVEAYAKYTSSNSGVLELHGNIHQVCCMQCGDVSPRRRLQQRLC
FT                   EANYQLCRDYEAEFSEVRPDGDYEVPDRVVQAMQLVCCEHCGGLLKPHVVLFGENVPKE
FT                   CVREAYTAVRAASCLICLGTSLQVFSALRFVLAARESGVPIAIVTAGRTRADGLEELKV
FT                   DTNSTAATMRGVVKQLLGFELGGTK"
FT                   /protein_id="XP_847145.1"
FT   gene            <937606..>939276
FT                   /note="synonym: Tb08.28L1.90; t-complex protein 1 gamma
FT                   subunit, putative"
FT                   /db_xref="GeneID:3659312"
FT                   /locus_tag="Tb927.8.3150"
FT   mRNA            <937606..>939276
FT                   /db_xref="GI:72392690"
FT                   /db_xref="GeneID:3659312"
FT                   /locus_tag="Tb927.8.3150"
FT                   /transcript_id="XM_842053.1"
FT   CDS_pept        937606..939276
FT                   /locus_tag="Tb927.8.3150"
FT                   /gene_family="HOG000226732" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="t-complex protein 1 gamma subunit, putative"
FT                   /note="go_component: chaperonin-containing T-complex [goid
FT                   0005832]; go_function: unfolded protein binding [goid
FT                   0051082]; go_process: regulation of cell cycle [goid
FT                   0000074]; go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:72392691"
FT                   /db_xref="GeneID:3659312"
FT                   /translation="MQQQQPVIVLNQKMERQTGRKAQLNNIEAARVVSGLISSTLGPCA
FT                   MLKMILDPMGGTVLTNDGNCILREIDVVHPAAKHMLELARAQDEEVGDGTTSVIILTGE
FT                   ILSLSKPLLERGIHPLKIVKGFSLALTDALAAIEKIATSIDPNDIKQLEEVVRACLGTK
FT                   YNSHEDDLMCKMAVEATLRVVVENKVTGQKEVDIKRYAKIEKIPGGSVSDSVVLDGVMF
FT                   NKDHIHPKMRRYIEKPRILLLDCPLEYKKPETTINVEVGQATDWELLLKQEEDYVRGLC
FT                   QTIISFKPDVVITEKGASDLAAHFLHKAQITCIRRLRKTDNNRIARATGATIISRVAEL
FT                   TEDHIGHAGLMEIKKIGDEYFTFITGCTSGKACSVVLRGASKDTINEMERNLHDAMCVA
FT                   RNIILEPRVVYGASALEMYVSSYLMNRSKSITGVQQAAYQAVAMALEVVPRILTSNCGA
FT                   NVIRTVTELRARHAMPDGDYWGVDGTTGDIVDVRSLRVVEPAAVKVQALKTAIEAASMI
FT                   LRVDDVVSGTKLRHEKENKPAPAAAQGAADDEQGEAEAA"
FT                   /protein_id="XP_847146.1"
FT   misc_feature    939986..940085
FT                   /note="A-rich"
FT   gene            <941510..>942022
FT                   /note="synonym: Tb08.28L1.120; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659314"
FT                   /locus_tag="Tb927.8.3160"
FT   mRNA            <941510..>942022
FT                   /db_xref="GI:72392692"
FT                   /db_xref="GeneID:3659314"
FT                   /locus_tag="Tb927.8.3160"
FT                   /transcript_id="XM_842054.1"
FT   CDS_pept        941510..942022
FT                   /locus_tag="Tb927.8.3160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392693"
FT                   /db_xref="GeneID:3659314"
FT                   /translation="MFRISFTSLAGGLMRKAGRSAKGMSVVDPSAVESLSEMDSADIIK
FT                   PSSSGSRKGRRSRRAGTEAGEEGKGESAFAESTGFVPVDNASMGIVGYKGKHSEAKVLE
FT                   LAERMQRRDITGEVPVASFAYEILKSHPSVRQMGLRERMSFLCDRWERLSDRQRKAYLD
FT                   NPLKGLL"
FT                   /protein_id="XP_847147.1"
FT   repeat_region   942256..942329
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <942936..>945326
FT                   /note="synonym: Tb08.28L1.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659315"
FT                   /locus_tag="Tb927.8.3170"
FT   mRNA            <942936..>945326
FT                   /db_xref="GI:72392694"
FT                   /db_xref="GeneID:3659315"
FT                   /locus_tag="Tb927.8.3170"
FT                   /transcript_id="XM_842055.1"
FT   CDS_pept        942936..945326
FT                   /locus_tag="Tb927.8.3170"
FT                   /gene_family="HOG000257508" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: mitochondrion [goid 0005739]"
FT                   /db_xref="GI:72392695"
FT                   /db_xref="GeneID:3659315"
FT                   /translation="MQDKAVQKALMEKRARLLLGVRMNYAPFSFMRRRRITAAALPVAE
FT                   RSDPLSICYRCVHERPFVEPPPEGDNNSDGEAYETARDALLQLNMMVRRGIEPDALMYT
FT                   SLIATMGRARLEWQAYKLFSRMLESGIRPLPETYVALHDATSPRRHHLRCDLQQKIEES
FT                   LETFPEELAEAELQLQRERDRLCVQKFEEYMSGVLPPAPPPPPSEQEAISVRDKEREGD
FT                   RSSSFGGGSNAAGLGKSDAKPIATMHIRNPTDAWSTARMMDEQQKLGNQRAQGSTAISL
FT                   CEQLDKLHEEELRIFLSAQRQLRHGNKTDLVKRVLHCVSEKSIRDMLERRKHYFQSVAH
FT                   ILENDLNSLRRDGIMAENKADESVNNEGTDAIPSAANSGGSQPVIISYACGVDQTITAE
FT                   EKESVAPDFLHTPWGILRKPVRHTSTGEKSRSIDRLQRLSLNVDELQLVRSKASTGDLD
FT                   ELPESLLRRYAYQFSLTWKRRHPLSLLEAVQWHSTTLLPQQLNEEGGASPTPALRRQQE
FT                   DEGVHKTLENYEAFRIISQRTNNLQVVDNKEINLHLKAIRREALRKERRAEETLRREHS
FT                   LLEAAALAASAKSFTPPEEDMVPSSRVLGVDAEHNNDNESSGRLLPTSSDWEKGESQED
FT                   EPKELPPWAIFNGEEEFNMTTGRFGDPRIGRYQELSDGRFKILPSREAQSRWTVNRQLL
FT                   PGALQDTLQRAELQQKTRVEAVEKVHQEKLKFKRYRKWDAFLRKAQDKQKGKPQTDDKE
FT                   GDGDGKKSAGPLPAKKRLSLLLRKGKDKAPIDDAVKAKYCKTL"
FT                   /protein_id="XP_847148.1"
FT   gene            <946308..>949778
FT                   /note="synonym: Tb08.28L1.140; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659316"
FT                   /locus_tag="Tb927.8.3180"
FT   mRNA            <946308..>949778
FT                   /db_xref="GI:72392696"
FT                   /db_xref="GeneID:3659316"
FT                   /locus_tag="Tb927.8.3180"
FT                   /transcript_id="XM_842056.1"
FT   CDS_pept        946308..949778
FT                   /locus_tag="Tb927.8.3180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392697"
FT                   /db_xref="GeneID:3659316"
FT                   /translation="MSGRRGTVRSAEEWRDAFYNLDERHRQLQRKLNEQEREMKLLKVS
FT                   QRRRSAPAAAALPGDANRSTPAVAQAQSGGVREVPSGVKSRLEDPVGLSTENSRGRNPE
FT                   RSVQFVGVPSAARREDAAAAAAEIANIYSGAPPPDPSMVWGMENSIQNYVTANALYHAN
FT                   EEMRQRLEDCVAVVKSLQHELAASRVLSKNTQSRLDEATQQIQQLVRERDIACQKLSVA
FT                   QNATAELERQQKQTSVEEERIRFSLESQVTELRNRLVVGADSNELLSRDVRTLLAEVQE
FT                   KTTTIQGLRSKLSLAETALASQRHTNENLLAEFRSLNSQLVEERKRLLAMTQEVHLANM
FT                   RAGDIRDAEARLAAVVNDRTALEREHARLMESLVTVTEGALAMARAEVKQDLDEFRGSA
FT                   AHWEEVAQLLYKDIAQRTQAHIHCREECEEAKRARDEAAVALRVANDELRSHRLKLDIV
FT                   WPTHRADTDGLTHEQMLSIFGRYNVGARRGSQMQQQQQSEQHRLSPAEPTLPDGKPQLY
FT                   DDNVALYGRDFVTALQGAPLDEQVRELQEANSALVAELQRLQVTNELQKERLRSLESQL
FT                   QRRQEAVETATAELKEREMAGQTFLQSQLDRVSFLEAQVRSLRGYSISPTKSLCEVEGN
FT                   ETVFELFVGQILSTETPAGVELRNTFPPVFCSIDFLLHETVTTPVVAGLNAFLDTSVSF
FT                   CVAMDALLLCYLQTRQLLLQLHCVRSQEELGETMVDNDETGKLCIGERLYTTVAEGSVS
FT                   LSALVADPKQLEADRPSIRGHVPLRDGFGHHIASVEFAVTVRTPFSEAFRALAAEGTRS
FT                   WSLAKHEEQQQMVQDPVSTVLAASSSRSSPLVAVVQRDSPICEQVEGGSEVRSVRAVST
FT                   PRHERRMVLVPTPHRSNATGPISSTSSSNTLLERSSSFTLVPRAAAIAAASAPNTVQAL
FT                   VVDVCKLKLPHDLYPVPRLSCYYALEPLGCNLYLHAPPTARYEYEYLQEGGFNGKRFPI
FT                   GSLRELLAVTREPFILFFFDESAVSTTIDMASAEGKVERHRGQYWATARTEWRLALEKP
FT                   EEFVSLELPLINKQGLPIKGATVRVRLLATCKGEGPQGENPAQREPQSLLGVAARLPEH
FT                   RTRGFEGAATAVEARVVGIATNLDVQGCECPEDSIDMEIMRHQLGSFIP"
FT                   /protein_id="XP_847149.1"
FT   gene            <950350..>951294
FT                   /note="synonym: Tb08.28L1.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659321"
FT                   /locus_tag="Tb927.8.3190"
FT   mRNA            <950350..>951294
FT                   /db_xref="GI:72392698"
FT                   /db_xref="GeneID:3659321"
FT                   /locus_tag="Tb927.8.3190"
FT                   /transcript_id="XM_842057.1"
FT   CDS_pept        950350..951294
FT                   /locus_tag="Tb927.8.3190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392699"
FT                   /db_xref="GeneID:3659321"
FT                   /translation="MPPPPFSGSNVVDAKEATKLTVGPPEDLCVRSQGPASGAKLQHKP
FT                   ATLPGSTSGSRWGRPPQKTLSRPALTSKPGTTVKPRPRPLPLQSSEGTSTPAIATELNK
FT                   EKRAKEQGAPPAPRPVVGAGKKVTVAVAPTEKTEEANPPAPASSFLDDMPVEACLEYLT
FT                   RPHRSWESATRIRELQKQRAENSSRAARRRSASNSLSSSMQFSASSSVGNMSAHSAPPA
FT                   FGRFGTGSTRAESRGGIVPRARFGALPGAKPEPEGLMVGGTSVVVSGGQLPLRLQPPLS
FT                   FGECRSATAGSVGFRPHGERCGGGPQGFSFSMQ"
FT                   /protein_id="XP_847150.1"
FT   gene            <952569..>956786
FT                   /note="synonym: Tb08.28L1.170; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659319"
FT                   /locus_tag="Tb927.8.3200"
FT   mRNA            <952569..>956786
FT                   /db_xref="GI:72392700"
FT                   /db_xref="GeneID:3659319"
FT                   /locus_tag="Tb927.8.3200"
FT                   /transcript_id="XM_842058.1"
FT   CDS_pept        952569..956786
FT                   /locus_tag="Tb927.8.3200"
FT                   /gene_family="HOG000257510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392701"
FT                   /db_xref="GeneID:3659319"
FT                   /translation="MVTTGLSPGALSLLQNAGINLKDFSRAQASYEKLCVELSKGASAA
FT                   GEGDATAASSMEDLQRLCDAWGEYTVVAQAYFRKVSLAALEQLVSRPRGESSATERAEK
FT                   LNELCAIGEKWHVGRETMFKLDHPEKLAAVVVEALDSSSCIMRLLALRLARIFAADTEF
FT                   LRCLFSKGGAGLIGMCFDHENTTELEYVLSLCRRLIELHKASAEPYHELPFGWVYRIAA
FT                   LLDLQDPVPNLLLKRRSQALCVAVMLLRQFPQMATTASLHITLLRYCIEKGAATRDEVQ
FT                   SVLEVILDMFDSPETRQYLGYNDLDVLYAPFLYSTNMCSTEDLTLMNGAKEVLVMLMRN
FT                   WVGVLWVCSETKGLRAVIDILHLPCDLDRKMVLLTLFNKLLYQLAPHRGITLVEPWRGF
FT                   KEKQELFPATPNEPADSEGSFVLNTPLGRGHNSSESMISEHVFGDWCDEPDEFVPTTKA
FT                   IGYHVLDPILGRVLLMLSHHGLPIALVSVIQDPNSSSVLTHAALSLLQDMLTLMDTVLP
FT                   EKPVKRLHTALNKAVGRLALEGCLSLEGVLSSRIPQRGKTAKGIATTATVAVGNVVGSG
FT                   WVSALSTASVATYGLGALEQDDADFKRMLKDTNVEGGNSFLSWNYDLLLLLFQGPLKSI
FT                   RRFRWVLNETLFFRNLIAFYLPVINTSTRTFLTLQPREATPQVCMLGMVMLDLFLSTRE
FT                   GTAALDSFGFSGAMAACLEEVIRGTPYVLNKQRVGKRVGQTLLRMVGRYSMTANGLVVL
FT                   KDSNMFSTINRMFVELSGERVSAPYPDDTLQEVCLQLLRCMNLGAVPNYGVCEWIRQMF
FT                   RSALCNESDEIRLCAVKQLRDALWRDFSTSMRWGIETLVQALHDDHSRVVECAFKLLLN
FT                   VCFCSDEALDYLISLSPTVLMESDTIRENAKQLDLNTLLYCIVGRPSGFRFLQCYGWVE
FT                   QELRRWEETESANHVTTVENMQSGRALGSGADFREGMSALFRHRHNRTYSDTGLTFQKP
FT                   ITATAGPDSQVTLPSGIFPSHFAAVLCKSNEGCTLFKHSNLWQRSVRRILEQPMLPDIV
FT                   YECGTFGERDNIDDDDVDMDGTTADDDDANALIEEDPSFVGRWGTEAAKTSTAKQDEKH
FT                   ALRLSREGHLPSSHSVKLLSASRGYQAAGQTYTIECVGDVSELKDAILCVCHAASSDAG
FT                   FSLMRSVPMLQNQLMALSRFADTASVSSICIVGKCLLARSRRAAEKLTEISHYVVNESN
FT                   AYMSADGVPYSVAFADNRPSNWTAIGRRDNPSRVSCSPPYFAHMRYDGEMVDGNSKNDE
FT                   ETTDSVGSTPSPVDSRDSSTFCDVIKGLSATSTRILHHIFALSNPVRRDAARQMLSQTL
FT                   KHQPHIFVNPQMRWLLRHCAQAFRMRYDDRKFIASILEEAPLTKPTPLVRKTVVFVPEP
FT                   QRG"
FT                   /protein_id="XP_847151.1"
FT   misc_feature    957076..957097
FT                   /note="AT_rich"
FT   gene            <957731..>958249
FT                   /note="synonym: Tb08.28L1.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659320"
FT                   /locus_tag="Tb927.8.3210"
FT   mRNA            <957731..>958249
FT                   /db_xref="GI:72392702"
FT                   /db_xref="GeneID:3659320"
FT                   /locus_tag="Tb927.8.3210"
FT                   /transcript_id="XM_842059.1"
FT   CDS_pept        957731..958249
FT                   /locus_tag="Tb927.8.3210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392703"
FT                   /db_xref="GeneID:3659320"
FT                   /translation="MTDTTKGALKRSNTLFLSDAEQFVFDFGGSAGGRAVSPGSSHGSG
FT                   GQPGEGDGEKGIEETDLANGRTGVVTPFSERERTAPVAPLDAEEVQRYFDKALKGGRRI
FT                   LLENVPLDEAIEKFQLGLRRYEEWLCNQANSRNRGDSSKSRGDPLNEGYRGKPGDVARD
FT                   AKDRKRPRL"
FT                   /protein_id="XP_847152.1"
FT   gene            <959090..>961483
FT                   /note="synonym: Tb08.28L1.200; exonuclease, putative"
FT                   /db_xref="GeneID:3659317"
FT                   /locus_tag="Tb927.8.3220"
FT   mRNA            <959090..>961483
FT                   /db_xref="GI:72392704"
FT                   /db_xref="GeneID:3659317"
FT                   /locus_tag="Tb927.8.3220"
FT                   /transcript_id="XM_842060.1"
FT   CDS_pept        959090..961483
FT                   /locus_tag="Tb927.8.3220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exonuclease, putative"
FT                   /note="go_function: nuclease activity [goid 0004518];
FT                   go_process: DNA repair [goid 0006281]"
FT                   /db_xref="GI:72392705"
FT                   /db_xref="GeneID:3659317"
FT                   /translation="MGIKGLWGEVKPVCRDAHLEKFRGSRVGVDMYVWLHRAVSGSVDL
FT                   STEANVEMLRAHVESLSDPSVTVSAHPIPLNTKFLHWVMSQVELLLRYGVKPVLVFDGR
FT                   ELPMKREEEEERRRNRIKHLSEALDLLRRNSRPTPSERKDIAGLVERGMDITTELAHAV
FT                   IMMLQERQLECIVAPYEADAQLAYLCQQRYVDAVITEDSDLLVYWCPRLIAKLDHKGSC
FT                   QVIEVESVLHCPLFKGLSYNSFLVGCILSGCDYLPNLRHIGVKKAFGIMSEARSVPDVI
FT                   RLLEENYGFPREQLRKYEAGLQRAIYCFLHHIVFDPVKRALVTRTPLPNGVAFKQSILG
FT                   ELVGDDLAQSMCCQCLYDPTTRSLYKGIYQYCLDNYRKTSRAGQSTLTAFNGFKELRSP
FT                   RMTLRLASSNSQASATSVSNTPLTPPTKTFFSAPLEKVREAEGYCGPKVVRSKYFVNGQ
FT                   WKVDNWEESSSQGGDSNTKNGNGDDSQSPSGAVTDECDAAGGVRSDGGKCCVKSEPPTP
FT                   PDRVSCATLSCKASSVCQVAGASDSATADADRAVDPSHGEFRGTELTCSDVCGLTEVPC
FT                   SNVEGSASALLQECGADAPNDPVGADRASVQDVNEGAEMLCPFGYIQCRRKHSLFEQCF
FT                   VGKGWTKKANNPNDQNNGSGAQVVPQGDTDGDGGTSPWRTRGSAKRRWSEIESVQPSQS
FT                   PPLVSSSSSFLHSIASTTASPLTVREANDAKTGGSCGGSVSVPCRMQSNSPKTLTEQCA
FT                   NGLATEDASDEGVNADFSASTSQSSVAAAPKAAALFELLSYTRR"
FT                   /protein_id="XP_847153.1"
FT   misc_feature    961588..961720
FT                   /note="T-rich"
FT   repeat_region   961890..961931
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   gene            <962916..>964670
FT                   /note="synonym: Tb08.28L1.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659326"
FT                   /locus_tag="Tb927.8.3230"
FT   mRNA            <962916..>964670
FT                   /db_xref="GI:72392706"
FT                   /db_xref="GeneID:3659326"
FT                   /locus_tag="Tb927.8.3230"
FT                   /transcript_id="XM_842061.1"
FT   CDS_pept        962916..964670
FT                   /locus_tag="Tb927.8.3230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392707"
FT                   /db_xref="GeneID:3659326"
FT                   /translation="MNRKKRSVAQRALQQCLRRLPVGHSVIYLNELSAHNQLSFLTQCF
FT                   GQGSGSECGGDAGCLGDIHIGFEGSTFHPPPRPMQQQTLAEAGKESRPPRHVTTPLSGG
FT                   VVSRLLLPKMTCGQLSAYRAPHLDLLPRPQLFLLLVPRRLFTSVGSCFSTEALLRRHLV
FT                   DVRGVLHWREHVRTLPNADTTGHRRETESGSVMLLPTWGCSAAQARQAVAMAAIGDFRV
FT                   FLLGRGRQRLLSSQALSVQELGRWCPAAFRSFQLDILSVEQTPVSSRSFTLSLLDEARR
FT                   GFREWGRSVNKLVDGSDSLKEGKRDTGRGKCAISLSVAEAVLDVRCDAAVPWASVADSY
FT                   LSAKLFEALHDRRHWCALDAMIHASQYVVLPFLVGELSANGTYGANEKCCSSKLTRLLR
FT                   WSDLQSMFRWRHFEPVFGPLSQLVRPEDVTAIGGGRDPFILPLHDTFVRLFLLPRMRIY
FT                   YAERHSAARGTFGHLASHNKGDRAREPKVGMEGGGGEEEATVDILDCFNELTREVGMNR
FT                   ACDSLSRGCGKGVDRLSMPKEERPGTSRAPSFTVMDLPALVKYLFYFPECFEVSRSGMD
FT                   VTFRLRGS"
FT                   /protein_id="XP_847154.1"
FT   gene            <965642..>966454
FT                   /note="synonym: Tb08.28L1.250; lathosterol oxidase,
FT                   putative"
FT                   /db_xref="GeneID:3659318"
FT                   /locus_tag="Tb927.8.3240"
FT   mRNA            <965642..>966454
FT                   /db_xref="GI:72392708"
FT                   /db_xref="GeneID:3659318"
FT                   /locus_tag="Tb927.8.3240"
FT                   /transcript_id="XM_842062.1"
FT   CDS_pept        965642..966454
FT                   /locus_tag="Tb927.8.3240"
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lathosterol oxidase, putative"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: C-5 sterol desaturase activity [goid 0000248];
FT                   go_process: lipid metabolism [goid 0006629]"
FT                   /db_xref="GI:72392709"
FT                   /db_xref="GeneID:3659318"
FT                   /translation="MEVAFDVYASLLPVDRNSLRDQMFVYWLLLTTGGIVMYLLCASFS
FT                   TYLFFFEFAETYFPRTIAKGGLHDQIIHEIFIAVASVPFMAILMTPAAVLSHRGYSKLY
FT                   YNVDDYGWPYLFFSAALFFVFTDFMVYWFHRGLHHPTLYRHLHKLHHTYKYTTPFSSHA
FT                   FNPCDGFGQGVPYYAFIFIFPVHHYLFVLLFMAVNLWTVSIHDQVDFGGHIINTTGHHT
FT                   IHHEKFSYDYGQYFTFWDRIGGTYKAAKQTHSLSLFGRGGRVSAQKQE"
FT                   /protein_id="XP_847155.1"
FT   gene            <967385..>981409
FT                   /note="synonym: Tb08.28L1.260; dynein heavy chain,
FT                   putative"
FT                   /db_xref="GeneID:3659325"
FT                   /locus_tag="Tb927.8.3250"
FT   mRNA            <967385..>981409
FT                   /db_xref="GI:72392710"
FT                   /db_xref="GeneID:3659325"
FT                   /locus_tag="Tb927.8.3250"
FT                   /transcript_id="XM_842063.1"
FT   CDS_pept        967385..981409
FT                   /locus_tag="Tb927.8.3250"
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein heavy chain, putative"
FT                   /note="go_component: dynein complex [goid 0030286];
FT                   go_function: microtubule motor activity [goid 0003777];
FT                   go_process: microtubule-based movement [goid 0007018]"
FT                   /db_xref="GI:72392711"
FT                   /db_xref="GeneID:3659325"
FT                   /translation="MTSRVKFEVAEEGVIPECHPECTVWMLQRIQAELQCKDEEFTNKH
FT                   IRLINDFLVGDEDLHALFCYYSSVLVDVVSEDGEPSSESRSQQEMIAELRIVDGLPAVS
FT                   RRDTMKGMCLDVVWFARLDPEKLIVPESVDTCIAWGVCRGGNLLEGFLRQLQYSIAPTL
FT                   LQNRWPDSLEKDVRSALHRFMAAVTENVNRLKGQTVLYVPSDLFSKVDLAEAHQNRELV
FT                   QGFEAVVIHWTRQIKEVVGDKDAGLTGDGAGPLQEIAYWRSRARDLGNIRTQLNRSDVG
FT                   GIVQVLKNAKSFYYLEPFLNLRADVEKGTDEAFDSLRFLNTLLEPCTRLSRAGPKEIPS
FT                   LIPDVLIHAQLILLYSKSYKKDRFFRLLRLISNEIIFRCSQEIDVPAILNGDVERSMVA
FT                   LRHSVAAGNAWIQECHKMLAATRKRFKMERGEKLDVDDSFLNEIDGFVRHRCQNLCEIC
FT                   KAQLQFGFKSVFQDSQISTDRTGGSRHTRGVRNAAAVEKRQIAGGVAAYGAPLEVKDLV
FT                   KTKGKEKDVFRGQLPIFSGNKGPEIETQLLDIQRAFKAKIDTLRRLDYDILDVKSTRWV
FT                   DDFRALKSDIDNLSMMLQQIITAAFDSFTTTEMGAEYIEAFFLVAETEELQLQLDRSKD
FT                   RVFRMVHDRAMVVQGKLQRCFNKPPPIFYLHPPLAGHGMWAENNAHLLQMTTETLNHCY
FT                   YLRESPESTETIQLVDRLDRSLRDTMRQKFCEWRANLPQNPGEYLERFLISKRPNPRKH
FT                   SLALYDVNFASELLLLFAEARYWHSLGELLPVHIMDIVSKEERLRIYRESVAQAVRARN
FT                   SIALSLTREECRLFSVRMNFLESKYMPGMTRLLWNSQGIVEYFVRECRQHVERVQHIVN
FT                   EFKHGSEYVDHHCKAIADTIVVIFEKKKVYSIESFVEKQEAHRAATLEKLQAIHRRLVD
FT                   KLFELLSYFRDDYAEDDVVRTEWHRLISKVELKVEEALRTMVKRTLQVVERMLPIEPSE
FT                   DRLEEKVFKLDVVVTVADDTRPHIEPVPSVRKLSHDVNGVCKAIIGIVKSIPRLEESLQ
FT                   ARVAQDQTDDADAGKRQPFQYSSSNTDSLALRGSYFEYMTSEQDAIYSLRHVRESFDAI
FT                   EEKVRDKLTQTWQLHQSDTTDSLWTTQKQVRRIKQGWKLEDYRIHMDHVAQRREGINKQ
FT                   ETFSDVLFLQLDFTKMKESFRKQCQLVITHYHSLLYADAKSEVDAIYKNFVLTIQALTK
FT                   EPQSLDELGDQIKRCAAATEALPEISAKFGPIADTFALITHDMYNFGSVRPEDVRRCEG
FT                   LQEKFEVYSEQLVKAQQQLAKYKEQFRHDVETDIRALSSNSYALRQKVAEEGPRSHTLS
FT                   TEDAFAKLSSLGLRAKELRTMESRLQQGIEIFNLEKPQLDDLVAAEKELEILRKIWNLC
FT                   DEWRRENSLWRTMYFIKLNSESMLDVCERIRKDTLRLRNELQMTDVWVNLKEEVELMKR
FT                   LLPIVDDLRTPAIRPRHWEFLKVQLDATFNIDDESFCLNDLMEARVETQAEFVVNLATS
FT                   AREEMKIETDLERIRTFWEDSELMIEPYQGYHKISGVDDINNALAEHLAQLSSMKMSRF
FT                   VDSFRPKVIQWEQTLSIATDTIEALLTVQTKWMYLENIFIGSDDIKRKLAAESKKFDGV
FT                   HSQWLAIITRFINDPNVVRGTRRDGLIDQLQNMNNSLEFIQKSLEGFLEDRRRVFPRFY
FT                   FLSNDDLLEILGHTKDPSKVQPHLRKCFEGLYQLSLKTVRQRTVADAMLSSDGETVAFT
FT                   PAVQVGGLPVESWLRRVEVKMREMMQKRINATVDDLQKSVFETKKSISRDSLKAWAERN
FT                   EGQSIITASCINWTLMTESAITEYGELHSGGLGLQRRKASPLYKVYKRWKGMIKKYCQL
FT                   VRQPQNRVQRSKLVALITIEVHSRDILRQVLAARVHQDDDFEWSRQLRFYREEDESTDR
FT                   PQEGHKICLVRQTSATVRYDYEYLGNSGRLVVTGLTDRAYMTLTTALQLHRGGLPQGPA
FT                   GTGKTETVKDLGKAIGKYVMVFNCSDGLDYKSVGRMLSGIAQTGSWSCFDEFNRIEVEV
FT                   LSVVAQQILSILTAVSERKDHFLFEGSDIPLNMNCGLFVTMNPGYAGRSELPDNLKALL
FT                   RPISMMVPDFALICEITLLSEGFEESETLSKKVSILYELMEKQLSKQDHYDFSLRNIKA
FT                   VLVQAGNLKREGFPGTESQLCLKAMNDMNLPKFVKDDVPLFVGMLNDLFPGVEPGDSGL
FT                   GALQEAAEKELDAEGLEVNAHIVVKTLQLWDTLRTRHGVMVVGQTGSGKTVTWRNLSGA
FT                   LRLLKEQNLEPGLYEPVRVSLLNPKSVTMDELYGSYNQATREWKDGILSDLMRQICRDI
FT                   TDTAYKWMLFDGPVDTLWIESMNTVLDDNKMLTLNSGERITLNSTVRMMFEVQDLSQAS
FT                   PATVSRCGMVYFNVEDLGWMPFFKTWLKSRWKFEITMGAPRPDDTISELQEYVKNTVTR
FT                   VLEYRAHECVELVPTTTLNVVRSFTRMLDALASVDAEPFVPEAAHYATSHAGENYLPQL
FT                   RILATFCLMWSAGGSLTTESRQKLDAFIRELDSSFPSTETIFEYFPDLGGLQWKNWNEH
FT                   VDLQKTYMPATGTPYHKLIVPTVDTVRYEYIVSQLVRSQVQLVLVGTTGTGKSLIARQV
FT                   LANLSNDVYVTTQLNFSAQTTAGNVQDIIEGRMEHKSKKVCCPPGGRRMICLVEDLNMP
FT                   AKEKFGAQPPLELLRQWLDNGYWYDRNTRGRRTVNDLQLLCCMTYGRPDITPRLMSKLN
FT                   VFNITFPSESVITKIFTSILMYRLEPYPELHKLVNSVVKATLQTYQKVSADLLPTPSKS
FT                   HYLFNLRDLSKVFQGIYGCHMEYLQCKEHMVALWAHECFRVFSDRMNDPNDKAWFKNLI
FT                   CEKLADIFQTKWNNIIRARSRDSRNQAVDEKENPLFVDFWDGEYDEMAKYRLVPSLEAL
FT                   RDKVEEYLDAYNSEPGARQMNLVFFTDALEHLCRIHRIVRQPRGNALLVGLGGSGRYSL
FT                   TRLATYLAGYSIFSIETHKKYDLDRFHEDLRSLYKGCGLKGQQRVFYFSDNQIMQPAFL
FT                   EDLNNMLSTGEVPNLFPKDELQNIRDTVCKQAIASGYRDTPDEMYNFFIDRARTNLHLV
FT                   VAMSPAHKLFRARLRQFPALVSCTSIDWFVEWPSEALREVGLRYLQETRENKEDDEHLG
FT                   IISDFFVYMHYTTSTLSREMLEQVHRYNYVTPSSYLDMVRGFRRMLTQKRDEIIEQRDK
FT                   LANGMAKLEETKLAVSKMTEELKVQDAKLQEKTEEVNRATESIKVQQQNAEEQQSLLAS
FT                   EKVKIEQTKRSALADQAEAQADLDRAMPTLLEAQNALDKLEKNDINEIKSYKTPAAMIR
FT                   TVMYAVQTTLRRKLEWDEAKKSLSEPKFIDMLKHYHENNDMTDQRLLDKIEKYVKRPDF
FT                   TPAAASAVSKAAGGLCQWVIAIHKYGNIYKEVHPKIVKNENAQQKVRAQEEMLRQKEEK
FT                   LQRIMSEVKQLELALQQNVDEKMRLMQEAKETQMKLDRARIIVDGLEGEQDRWIESIAR
FT                   YEAALGTLVGDALLVCGFLCYAGAFTADYRQKLWLNWIKEIKRLQIAISKNFDFVEFLA
FT                   DPTEVRDWQQAGLPGDDFSKENGAVVMRGTRWPLMIDPQLQAIKWIKRMEKDKGLKVID
FT                   QKQPDFHKTVEYAVQFGCPLLLQDILEEIDPLLDSVLSKAIVRKGAKPILKIGDNYVEY
FT                   NDNFKLYITTRLPNPHYTPEICSKVCLLNFAVRETGLEEQLLKIVVEKEKPELEQDNEQ
FT                   LILDTAEARKETKRLEDEILNLLSTSQVSLLENKKLVDTLQSARVIAANIKQQLKEAEI
FT                   TAEKIHSAREQYRECARRASILFFALADLGSIDAMYQFALDSYIVLFQGSIQRSAQKIA
FT                   THTLEERVRTLNDWHTSAVYANTCRGLFEKHKLLFTFHMTIRILQAEGLVNIEEYVFLM
FT                   RGGQVLDKQGRLPNPAPSWLSERAWSHILELDKLTNFHGVAASFEQAQESWKHWFLQEN
FT                   PEDAELPDDWQTRTADNYIQRMIFVRCLRPDRVIFMVYEFIEKQLGPQFVDPPPFNLKD
FT                   TFEESTNVVPLVFVLSPGVDPTTQLAALAQREGRPLKTLALGQGQGENAKRAVQECSQV
FT                   GGWVFLANCHLMVSWLVELEKIIEDLVEQRPHKEFRLWLSSVPTTQFPIGILQRAIKMT
FT                   TEPPTGIKANMLRLYNQFSEEQFAEHTGSNPQIYCSLLFALCFFHSILLERRKFGNLGY
FT                   NVVYDFTTSDFEVSENIIALYIGNMATDRVEDIPFVTIRYLIAEASYGGRVTDDWDRRV
FT                   INTYISQFMCPAILTEERYPLSAAEEYYIPSGISTLQAYKDECSLLPITDPPEAFGQHT
FT                   NADIASRVAESTMLLDNLISVNKTLARGGGSSGGASKGMSEEARCLEILASLEEPSKTA
FT                   IPNPIDYDAVYESVKEDTNNALNTCLLQEIQRYNVLLRKIIVQKRELRRAVKGEVLMTD
FT                   ELEAVFNALLLSRVPPPWTSAYPSMKPLASWAVDLVERIEQMKQWGQRVPNVFWLSGFT
FT                   YPTGFLKGLQQQQARHDRISIDQYTWEFVVLPSEERTIVNRAKKGAYVRGIFLEGAGWN
FT                   EEMNTLCEPRPLELIVPMPIIHFKPKIRDTKPRPPTIYECPLYMYPLRTGTRERPSFVV
FT                   AVDLESGEAVPEHYTKRGTALLLSTDE"
FT                   /protein_id="XP_847156.1"
FT   repeat_region   982290..982325
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <982395..>982982
FT                   /note="synonym: Tb08.28L1.270; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659322"
FT                   /locus_tag="Tb927.8.3260"
FT   mRNA            <982395..>982982
FT                   /db_xref="GI:72392712"
FT                   /db_xref="GeneID:3659322"
FT                   /locus_tag="Tb927.8.3260"
FT                   /transcript_id="XM_842064.1"
FT   CDS_pept        982395..982982
FT                   /locus_tag="Tb927.8.3260"
FT                   /gene_family="HOG000257517" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392713"
FT                   /db_xref="GeneID:3659322"
FT                   /translation="MGWGSSEERLSSTSSELRGVDMFVYTLPSGVLGRFIGRALRFRVD
FT                   RFNFSTGPSADGNDKRRSLKSVEVEANSLSPLCEVDKFQFERLPLTVSEIVRLERRTRD
FT                   YVLDVTRYPRILYTVEEETPTEVKGTLELRGERKAITCTKSVEGPELIVRCPIDTREFN
FT                   IPSYSLMYGVFGVSPHVQVETRIPLRAVQLQG"
FT                   /protein_id="XP_847157.1"
FT   repeat_region   983365..983388
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttcc"
FT                   /rpt_type="tandem"
FT   gene            <983522..>984127
FT                   /note="synonym: Tb08.28L1.280; hypothetical protein"
FT                   /db_xref="GeneID:3659323"
FT                   /locus_tag="Tb927.8.3270"
FT   mRNA            <983522..>984127
FT                   /db_xref="GI:72392714"
FT                   /db_xref="GeneID:3659323"
FT                   /locus_tag="Tb927.8.3270"
FT                   /transcript_id="XM_842065.1"
FT   CDS_pept        983522..984127
FT                   /locus_tag="Tb927.8.3270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392715"
FT                   /db_xref="GeneID:3659323"
FT                   /translation="MESLVRDTDLTVSAHTCEESNTHGLSKLLLTHLKLDNIILESVSC
FT                   VGRGHNGDARSQWWSLSAGHLGKWCHNQHGTLHGGLCLAILCALSKAHVAMYIKLHCAN
FT                   GSVTTGRNEGITTGGSSTPSVLGVHIQYLLPVVTTHSLKVLTKVKCEEDAVVRVDAVLF
FT                   RAVDVEKQQHGGHLLGGCSPLCKATINMKRQQKRICSL"
FT                   /protein_id="XP_847158.1"
FT   gene            <984655..>985758
FT                   /note="synonym: Tb08.28L1.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659330"
FT                   /locus_tag="Tb927.8.3280"
FT   mRNA            <984655..>985758
FT                   /db_xref="GI:72392716"
FT                   /db_xref="GeneID:3659330"
FT                   /locus_tag="Tb927.8.3280"
FT                   /transcript_id="XM_842066.1"
FT   CDS_pept        984655..985758
FT                   /locus_tag="Tb927.8.3280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392717"
FT                   /db_xref="GeneID:3659330"
FT                   /translation="MKGGVGRSTAAPQMEFVRAVIVGSGSSSSTPMLSCALSGSPCPNC
FT                   EEALRCSGSKNHRLNPSFLIQLYHPTDRTVHNILIDCGKTFRESALKVFPSFLVRDFSA
FT                   VLLTHDHADASYGIDDLREFSRKDVPIGVYADETTLAAMRGVYPYLFAEDMRSRGAGEP
FT                   AKKEVKKNKFVATINWELFTRVERMDVVFSPRPKGVTTGNEGDIADGCETGAPAVWSFV
FT                   PVGVPHGENYRANAFLVPMHDKSESPRLLLYVSDISELEDRFFTDLARSKVLLGVDPAV
FT                   PIEVLVLDMLSRRPYVAHLHVEASIAAAKRINAAKTYYVGMSHRINYDEMMQELQQLGL
FT                   GATMEMGYDGCVVSVGDSGLQHLSGRL"
FT                   /protein_id="XP_847159.1"
FT   misc_feature    986096..986138
FT                   /note="T-rich"
FT   gene            <986241..>992117
FT                   /note="synonym: Tb08.28L1.310; DNA polymerase zeta
FT                   catalytic subunit, putative"
FT                   /db_xref="GeneID:3659324"
FT                   /locus_tag="Tb927.8.3290"
FT   mRNA            <986241..>992117
FT                   /db_xref="GI:72392718"
FT                   /db_xref="GeneID:3659324"
FT                   /locus_tag="Tb927.8.3290"
FT                   /transcript_id="XM_842067.1"
FT   CDS_pept        986241..992117
FT                   /locus_tag="Tb927.8.3290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase zeta catalytic subunit, putative"
FT                   /EC_number="2.7.7.7"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA-directed DNA polymerase activity [goid 0003887];
FT                   go_process: DNA replication [goid 0006260]"
FT                   /db_xref="GI:72392719"
FT                   /db_xref="GeneID:3659324"
FT                   /translation="MNLYVVSIEYTLQRPNAALGDAVMSPMFRRVSSRCPILHIFGYTT
FT                   TEGNDRAAGEKSYVPREAAISESKLDSIQRYSVCAHIHGVYPYFFVQRSNSRISAMQFG
FT                   TQLESVAMEALSSGHNKSAAAPRPHDRQQLIHHVDVVWLLPFYGYHGKKQPFFKVYVVD
FT                   PAMVSRFLHLLYCTKHMGGRQWLVYEAHSPFHFQFMADYGAKGMGAFFIPSCTARSKLP
FT                   DSVQPEQLNIAAVRPEGEPARLSCAQIEVDVSASSLRFRDGAVQPGENLLTARRNVRQY
FT                   FADLGVDDAVLRGCTSGLLARRFTVSDQQRCDLGAVLLRKRFNESLKAKFTDPVVEEQE
FT                   KVDSPVGVTQQLMEDMQGIVGEVLLPDSSPGCFSAPQHSLHNDQGEVGTSQDPLVPPGV
FT                   TSEQGGCDERERPLPRCRSSDTPLPGNDYVEGMSPRGEDEPSVLFPSTLSSDGPGSSSN
FT                   TNACGCSVESSKGGNEVALDARLRNDCGDSDRNWRESLSVGDTVAIASEESHDTTTAKS
FT                   CLFAKIVCLGTSSVRLRWYVALSETHLADCQDELEKRGCWLGKGTKLGGCTPVAQGYQE
FT                   ELLLGDVEDINSISVLRQGPPIVVHHSYHSFIHDRNCGKIIGDGDCFISIALLCRYNYH
FT                   VRERRLSAIEPRGDDNYVAMPALLLQSTPCASSDDESSLLAEVADEDEELFSSLSLSPP
FT                   PDGCELCTFPHQRAPSRPSGSDHRVSGNNFKLPEGLRRSVSKTMQCAVQSQLSLLQSFS
FT                   VCCSLSPRIREPVSPSVVAISSGVTRPSCALSSSSVECVDPQREALLVEFKREGSCVRC
FT                   SNLIGDIPRNFIWRFDPIQRRVVISGATWPRVVALAPKLPPPTKCVSSLLKRPSVQLLT
FT                   RIAHSQDLTPPEGAHTVAAKQEWCPHGSSSGSRSQRHSTRLICALRVMLVEVFLHRRDG
FT                   VQHVAQERLLAVGLGRTTSIDERVKVRLFCVTGLSQKVPVGQPRVSPFSGAVEVVQLPS
FT                   EEHLLRHVMWEIRAYDPDVIISWEVGRSGIGLLALRYKIALRRSLARDLSRLTPDSALF
FT                   NQRSENIHLNPEEKPSNSSDENISEVECVSPSSDSSHSSCSESTLFSTGSGATAATTRG
FT                   SVAHVRGGSTNAHPNLGDLTKQLSRRFGGSPQVAGRIIVDLSKYLRKYLQLPSTTLQMV
FT                   YKKLFNSSLPFFTDVALTRMYCAGEAGMQRVFMSILLTRVVAPHRIAQHLHFFTRTAEF
FT                   ARMFGILFSEVLTRGSQYRVEATLHRMAKPMGFALLSPPLEVVHRQPRLQSMPLIMQPR
FT                   SGFYKDDPVVVLDFRSLYPSIVIAYNICYTTCLGSVGKGVYGRLGVLKSYKRDDMLLSS
FT                   LLSGLADTKNDHNGKNDDNENSNTLHGVTFTPNGCMFLTPENREGVLPQMLRVLLDTRV
FT                   DLQAALKHVAHPFGDIYMQQILQEQQMAIKMLANTTYGYTAASFTGRMPCADVADAIVM
FT                   LGRQTLERAMWLINSHPVWKAEVVYGDTDSLFVRLPGRTKEEAFAVGEEMAKEVTAVNP
FT                   APVRLQFEKVLFPCLLLVKKRYVGYAYFKPEQQEPQFLAKGIETVRRDQCPATAHLAAK
FT                   MIHLLFSGAGTETLRQCFYEEVSKLQRGDCSPVDCIFRKAVKFGRYKPNGRLPAAARLA
FT                   ALLVEKDAMRTPYWGERIPFVVIRRPESTRLSDRVVHPQQLLSDEDHLMLDSEYYITRH
FT                   IVPTLDRMFYLVGVSCGRWYAEMPRGRTYQNYFELGLSIAATKAAKRARGVATPPTLCA
FT                   DVINVNISNANHGNERFKRKGRGKGKGGSGLLGNQSARGAKNRTLDSYYQQTLCAVCLT
FT                   NSTATSPTDPPVCKGCLENLSTTAQRVTSRRYRVERHLQLMKMACLRCIGTCGEVGGPG
FT                   FLSSRKRDMEDMNFCIPHSLAAAPDRGVHDAGVVVRRWGKRQQKLQGEEDIRCVSVDCH
FT                   LSFEKKRLSSLYLQLLVLEDYVTTR"
FT                   /protein_id="XP_847160.1"
FT   gene            <992479..>994554
FT                   /note="synonym: Tb08.28L1.320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659328"
FT                   /locus_tag="Tb927.8.3300"
FT   mRNA            <992479..>994554
FT                   /db_xref="GI:72392720"
FT                   /db_xref="GeneID:3659328"
FT                   /locus_tag="Tb927.8.3300"
FT                   /transcript_id="XM_842068.1"
FT   CDS_pept        992479..994554
FT                   /locus_tag="Tb927.8.3300"
FT                   /gene_family="HOG000257518" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392721"
FT                   /db_xref="GeneID:3659328"
FT                   /translation="MRRLFVTTASTLCRSLHCTDTRTGGAGKESTPAEVQCEMTLQCSD
FT                   ESGCSPFLSSLLSPVETVPLHDVTRTYSTMDVVDPPARYNPMVPNVEPSSSSAGHMEQM
FT                   LENEEEEGPVACAHKNGKLWGVFEGSEDNKPPAWFYRLCKDLFYRTNSEDNMDDAALVS
FT                   DIEPSHYISSTENLHIDGCDTTQRSAEAGTDVRDGVDPYVWIPFNLLDEADYHVGPYRF
FT                   PSTATYTHEQRTLLCLGDTRREYVHFCDSYAFPGRAQIPTSVGTCPSKLYVNPKQQQPV
FT                   VYIQLSNDIPPAMWLPVKGTAASVRRVLAEFASMAALHRDWHHDEFMERHATAVRMLEL
FT                   QRLPAGEGDILRYMAYDARNAQFAFAPIREFPNQQEFFLGEHDDPEKLMEHVDLCPLLF
FT                   AIPHMRTVVDLHAEHMIPTIAGPGVATSLYRCIYSKALLFVQVHLSSEVKLPPQDPEAF
FT                   KFMWKDSQVLPKMRIPVFVRVVWPTNERMSGGGGLLRRFNRLFGTEFASDIPVDAAMAL
FT                   LYVMQWSGHIKDFLGVRGMRQRLADLLLASQQPEPTKLYPGTREIPNPEYTVAERLGMH
FT                   VQYLAQLHDPDISLTIQRLLPVASAPVRMGCAKAALIAGDRELFRHIVSSEPPGRMQTY
FT                   MTKLVRKRKTRDLVDAEPRLLEDQYEFAAPLWTKRGKRLDSNTLEGVVEAQSRLSG"
FT                   /protein_id="XP_847161.1"
FT   gene            <994965..>996965
FT                   /note="synonym: Tb08.28L1.330; acetyltransferase, putative"
FT                   /db_xref="GeneID:3659329"
FT                   /locus_tag="Tb927.8.3310"
FT   mRNA            <994965..>996965
FT                   /db_xref="GI:72392722"
FT                   /db_xref="GeneID:3659329"
FT                   /locus_tag="Tb927.8.3310"
FT                   /transcript_id="XM_842069.1"
FT   CDS_pept        994965..996965
FT                   /locus_tag="Tb927.8.3310"
FT                   /gene_family="HOG000227514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetyltransferase, putative"
FT                   /EC_number="2.3.1.48"
FT                   /note="go_function: N-acetyltransferase activity [goid
FT                   0008080]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:72392723"
FT                   /db_xref="GeneID:3659329"
FT                   /translation="MSLKRPRDEGGHDDLNTGREENAQRNFDSMEEQDQHTPHLSLREA
FT                   RFSGRSMQEGFHLQLGEYEEPDEAKEVEELMNGHEDFGDLPKERQKALLDAVRVLVRKA
FT                   AGITNKNQLEHLRVKASRLVGFKDTARKSELTAAYRQLVRAGEVQESAAVEELLLRKRG
FT                   KSHSGVLVVTVFMGPGQFSCPKDCHYCPNQPGIARSYLLKEPGVLRGYRNGWDPIRQFY
FT                   DRASALENNGHVVDKIELIILGGTFSFYPKKYVEEFITGNFYAANTYYDSTPLRPIGTL
FT                   EQEITANEDARCRIIGVTIETRPDYINLSELRRFRSLGVTRVQVGIQHLDDDILTIVNR
FT                   DCPTSKTIVAIKRLLDAGFKVDAHWMPDLPGSSYSKDHEMFEYLFSEDNENFQVDQWKV
FT                   YPTATVPYTKIEDWYRTGKYKPYAELDGGSWMVKLLVYIMENCPRRIRLNRIIRDIPTT
FT                   YIMGGERRCNLRQVIEAEMKAKGIRCKDIRERECKGAPVDRNQTKVFVNEFRASGGTEF
FT                   YLSVENMEQTILYGHLRLRLRDDSGESNSLVKALEGCALIRELHTYGKLIAVSRPNSGN
FT                   EAQHMGVGTQLMREAERIAIERGFMKIAVIAGVGVRRYYAKLGYKLEDTYMVKQLTADK
FT                   GSTITEEQVEQDDDNDNGGFISMLKGFMFGK"
FT                   /protein_id="XP_847162.1"
FT   gene            <997288..>998697
FT                   /note="synonym: Tb08.28L1.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659335"
FT                   /locus_tag="Tb927.8.3320"
FT   mRNA            <997288..>998697
FT                   /db_xref="GI:72392724"
FT                   /db_xref="GeneID:3659335"
FT                   /locus_tag="Tb927.8.3320"
FT                   /transcript_id="XM_842070.1"
FT   CDS_pept        997288..998697
FT                   /locus_tag="Tb927.8.3320"
FT                   /gene_family="HOG000257519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392725"
FT                   /db_xref="GeneID:3659335"
FT                   /translation="MLPTRHINFAFISPLLGVLYLYTTNISIRIGQYSTGRTLRASQCF
FT                   GYTRYSSVTQKKKKRSLGSLEVMWRFGASSTGLKAGSPLVGSASRRCGSTATPSRRRSG
FT                   FFKMGDMYKPGRYTSKDLPKGPSGSNQPWDPVYANYAFQLVTGPLKRKQNTTPDDHLTV
FT                   DELDKWMDAKGAAKVLGIKEEELPTLTAPAVEEYWAKAYGQRNNAHQQETVIAAEVLLE
FT                   YIDSTVHRKKSRQYYRRYMDNARQAIDHETEMRRSEHRQKFIHLFGVAMFTGSAIVVII
FT                   AFFRGYFTRQDVEKIGTDAAAYLNMVFSQPPNLEPPPDYSTRYRDTPPAMELAKQQGVY
FT                   GVVDPARLSNLSKDVKQYRADEEMEMLRMLNDENDKARQRRKGDQVRESRVVVYRAGDF
FT                   DDAGELKDLAKEKEAVKPLSAFSQQSFRDFAALMASQFGGGSRFQRITQDSVRRAEEME
FT                   RMQKRMNEIEE"
FT                   /protein_id="XP_847163.1"
FT   gene            <998974..>999996
FT                   /note="synonym: Tb08.28L1.350; mitochondrial carrier
FT                   protein, putative"
FT                   /db_xref="GeneID:3659331"
FT                   /locus_tag="Tb927.8.3330"
FT   mRNA            <998974..>999996
FT                   /db_xref="GI:72392726"
FT                   /db_xref="GeneID:3659331"
FT                   /locus_tag="Tb927.8.3330"
FT                   /transcript_id="XM_842071.1"
FT   CDS_pept        998974..999996
FT                   /locus_tag="Tb927.8.3330"
FT                   /gene_family="HOG000257520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /note="go_component: mitochondrial inner membrane [goid
FT                   0005743]; go_component: integral to membrane [goid
FT                   0016021]; go_function: binding [goid 0005488]; go_process:
FT                   transport [goid 0006810]"
FT                   /db_xref="GI:72392727"
FT                   /db_xref="GeneID:3659331"
FT                   /translation="MRKLRNLFLLFLVTAPRFIQHESGLTFLFGSAQMSRTIKKEKDTK
FT                   PTHTSVALASSCATFATKSLLHPIDTTKCRIQHSVGKTLRSLHREYRGKWGPRYLYGGL
FT                   PVKLLFSVPYQSLYMTTYAAASGALLPDGTASPHSYWVFLGGTIGAACAAELAGCVLRV
FT                   PMETMKMRLQAGVVLNTAAAFRQMRMHGLHGFRRMVLSQTLLHDIPYSATQWIVYESLR
FT                   PWTTQLLKNQKSDEQSASGVGPMSRWYSYAQTFLRTVLSGGFSALIASTVTVPLDVMRT
FT                   RTVVAAAADPNITISAVARDAYRRGGARAFVRGSATRVLWVTSNMAVYFPLFELFTTCM
FT                   "
FT                   /protein_id="XP_847164.1"
FT   repeat_region   1001024..1001049
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            <1001110..>1002162
FT                   /note="synonym: Tb08.28L1.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659334"
FT                   /locus_tag="Tb927.8.3340"
FT   mRNA            <1001110..>1002162
FT                   /db_xref="GI:72392728"
FT                   /db_xref="GeneID:3659334"
FT                   /locus_tag="Tb927.8.3340"
FT                   /transcript_id="XM_842072.1"
FT   CDS_pept        1001110..1002162
FT                   /locus_tag="Tb927.8.3340"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392729"
FT                   /db_xref="GeneID:3659334"
FT                   /translation="MEGHGIDVKSAWVEFTAELCDELNDARCLGVAAATPEEASGICAL
FT                   VDEACASLVSAKDETEFLFPLNSLMHTTRVCFTNENNIKKLEECTAVYGRVPMVMLLEM
FT                   KENRSFVLDFTPGTSVADVEEFLSGVARGTVAKALQGAAPPSDDHFQPVEGITLRHGLC
FT                   AVTSTIERLKHQQPGGALCIFWSHRCSMCPHMMLLLDASVGALRRELQRHGTEQTFTYM
FT                   CCDVDENDLPEEVFPRAQEGEEVTVPQIVAFNSAGERFVYDGRRTAPSIMSFAWEHCVP
FT                   KEVRDATDIKRSVMKAVESVCIEELLNSDVSARVSGDVATAEVGNGLSHGGEMEEKLKD
FT                   RKRPRCVGSE"
FT                   /protein_id="XP_847165.1"
FT   gene            <1003838..>1007011
FT                   /note="synonym: Tb08.28L1.410; DNA polymerase theta
FT                   (helicase domain only), putative"
FT                   /db_xref="GeneID:3659332"
FT                   /locus_tag="Tb927.8.3350"
FT   mRNA            <1003838..>1007011
FT                   /db_xref="GI:72392730"
FT                   /db_xref="GeneID:3659332"
FT                   /locus_tag="Tb927.8.3350"
FT                   /transcript_id="XM_842073.1"
FT   CDS_pept        1003838..1007011
FT                   /locus_tag="Tb927.8.3350"
FT                   /gene_family="HOG000204920" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase theta (helicase domain only),
FT                   putative"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_process: nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism [goid 0006139]"
FT                   /db_xref="GI:72392731"
FT                   /db_xref="GeneID:3659332"
FT                   /translation="MRKTVVRLKTFNPPQQLQGGNSSSVQLTRTNANIVTGNDNDKSRA
FT                   SSRAVTSVPERTLQSAAAPALQRVKRGREELPQNNSASGLSGVGAVIMPSSQFSEVGPW
FT                   SQFMREGAADLTAHPHAVPTSTEGDAPPRDFCDGDEDDMPPVSQEELQREAEEDMRLST
FT                   DVILTPGTPNGNTCEPFSSVSAVPTCTLTVPSLNSEVSQISTGLDYGNVYGHVPFGTPV
FT                   INDNVPSGTSASALPRPSVDDPDFFYDLPVSVKDFYATRRGIKKLYNWQHEVLMRDDIR
FT                   AGGSLVYSLPTSGGKTLVAEISLLRCLINRGQSCLFVLPFVSLAEEKTDAMIPLGDVLG
FT                   FTVDGHYSTRGRFPLPVSKAVFVCTIEKANSLVNHMLEENTIGRIGTIVVDELHMLGET
FT                   SRGATLELLLTKLLCLRHKVQIIGMSATIPNLPDIARWLRASCYIGNYRPVPLRQYAVV
FT                   GGEVLEDGREVCRSLVAAGHTSESSQLVFLTTEVKGASVLVFCASRQQTVSTARLIARS
FT                   RKEEVDKEGGVRYNASSLALVADLRALDSEESSLLSQLVPYGVAFHHGGLVAEERTLIE
FT                   TAFRRRSIGVLCCTSTLAAGVNLPARRVIFKTPFVAVDFLTKSRYLQMCGRAGRAGLDE
FT                   FGESFLFLSRKDRNRGCELMQQEVEACVSQLLEEKSTVERALLEFVAIGLIRSLSDARK
FT                   WGENILFHHAPGPIDKGLNAGSVAVPEMLEGIIQSALSKLVERGLMQRLSRPAADASRE
FT                   DSDVLGDSDVTNAKNGDAKNNGTGDGDAILSSSPFGSCSVRSCFGVEDALIVRLELEKL
FT                   QQSGLILADDLHMCYFVTPLRDPIDVDWSIYRDILSQLNETRQRIASMIGVDEFYVNQR
FT                   AMGLGDAGGNGGGRAFATRRFYAALALADLLNEVPIGEVEQRYRCNRGQLQNLLRSASM
FT                   FSSSITSFCRAMEWYSLEAVLASFVKRLGFGVKPDIIPLMEIKGVQPGRARALWRAGFK
FT                   DPAAVAACTPAELLKRVKEANPPDSKVVKYFSIRSAVVVLREANAWVQQNIREKKGDLA
FT                   DLTLQSSTY"
FT                   /protein_id="XP_847166.1"
FT   gene            <1007953..>1008351
FT                   /note="synonym: Tb08.28L1.420; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659333"
FT                   /locus_tag="Tb927.8.3360"
FT   mRNA            <1007953..>1008351
FT                   /db_xref="GI:72392732"
FT                   /db_xref="GeneID:3659333"
FT                   /locus_tag="Tb927.8.3360"
FT                   /transcript_id="XM_842074.1"
FT   CDS_pept        1007953..1008351
FT                   /locus_tag="Tb927.8.3360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392733"
FT                   /db_xref="GeneID:3659333"
FT                   /translation="MLWGAVTLLFPAVVMSLLFITAGVPDIRRCCIHSCVAAALVPLAV
FT                   LVAIGISIALDQCILYLHEAARSAIPQPPPLRHALLQLKPDSLMTLSFLDVQIVAIFLF
FT                   VSYGLQILLYHLVDIVRYLKISRRRLVM"
FT                   /protein_id="XP_847167.1"
FT   repeat_region   1008836..1008870
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   gene            <1008978..>1009598
FT                   /note="synonym: Tb08.28L1.430; Ran-binding protein,
FT                   putative"
FT                   /db_xref="GeneID:3659327"
FT                   /locus_tag="Tb927.8.3370"
FT   mRNA            <1008978..>1009598
FT                   /db_xref="GI:72392734"
FT                   /db_xref="GeneID:3659327"
FT                   /locus_tag="Tb927.8.3370"
FT                   /transcript_id="XM_842075.1"
FT   CDS_pept        1008978..1009598
FT                   /locus_tag="Tb927.8.3370"
FT                   /gene_family="HOG000247047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ran-binding protein, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   Ran GTPase binding [goid 0008536]; go_process:
FT                   protein-nucleus import [goid 0006606]"
FT                   /db_xref="GI:72392735"
FT                   /db_xref="GeneID:3659327"
FT                   /translation="MQEKEVQLYGGAITSSFPATMVDVSDMRQVPDTQEVYTEVETGMC
FT                   IIIELLAREHEVSNDNCGNYFFIDLAKANGCNTEGYNLKPQHQLHPTDYPLVSQPPSGS
FT                   VAASGRYCTFGCVISGHQHISKYTNEKGKENDILVVMSVLRFEPPISTDVLISISAPQW
FT                   IHPESSEARVVQKLRSEEEVTAVMRRILLSFNIRDWGLFVPEE"
FT                   /protein_id="XP_847168.1"
FT   repeat_region   1009635..1009667
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <1010209..>1010937
FT                   /note="synonym: Tb08.28L1.450; electron transfer protein,
FT                   putative"
FT                   /db_xref="GeneID:3659336"
FT                   /locus_tag="Tb927.8.3380"
FT   mRNA            <1010209..>1010937
FT                   /db_xref="GI:72392736"
FT                   /db_xref="GeneID:3659336"
FT                   /locus_tag="Tb927.8.3380"
FT                   /transcript_id="XM_842076.1"
FT   CDS_pept        1010209..1010937
FT                   /locus_tag="Tb927.8.3380"
FT                   /gene_family="HOG000257525" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="electron transfer protein, putative"
FT                   /note="go_function: electron carrier activity [goid
FT                   0009055]; go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:72392737"
FT                   /db_xref="GeneID:3659336"
FT                   /translation="MLRKVTSPYKVSIRRTAASVTAADSKKAILRLIRFDPETNKQRVE
FT                   SYEYDKHHDYMVLDLITAVKAHQDPTLAFRASCCEGVCGSCAMNINGVNSLACITFSQQ
FT                   VTTVGPLPNFPVIKDFVVDLRHFFRQYAYIRPFVRNVNLDRSRLDNIVERYKTITKVIH
FT                   GVPSDDEAQLAQLESKSGAQTDVMALLQLLDAVCESGNVTHLIRTLEALQERGMQLDQG
FT                   KVKALIEETLQNYKKRKLGA"
FT                   /protein_id="XP_847169.1"
FT   misc_feature    1012067..1012087
FT                   /note="AT_rich"
FT   gene            <1012210..>1012992
FT                   /note="synonym: Tb08.28L1.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659337"
FT                   /locus_tag="Tb927.8.3390"
FT   mRNA            <1012210..>1012992
FT                   /db_xref="GI:72392738"
FT                   /db_xref="GeneID:3659337"
FT                   /locus_tag="Tb927.8.3390"
FT                   /transcript_id="XM_842077.1"
FT   CDS_pept        1012210..1012992
FT                   /locus_tag="Tb927.8.3390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392739"
FT                   /db_xref="GeneID:3659337"
FT                   /translation="MVKMPSTLSDLFPLAKCSVASAVELTLLIGAVAASTYLAVANSVW
FT                   RVYCGLTLVLFAVYCLRLWRLLPGEKEYLEMEAHKLADHMMVKQREATATQQTLVGQRG
FT                   HATNPAQTPALQHSHFQGVNPILGSHQLQQLASSLALSQSQQFMSSMMLPHHQQLMSSV
FT                   ALPPLQISNSLPIPLPLQQLANSMALSQMHQPQFHAGNHMVAPQQHQRELITPRITVAS
FT                   PLPTPSVLRQFPPTALRENDGEEPPQKCQMPYGDGHLG"
FT                   /protein_id="XP_847170.1"
FT   misc_feature    1013089..1013114
FT                   /note="AT_rich"
FT   misc_feature    1013419..1013447
FT                   /note="AT_rich"
FT   repeat_region   1013834..1013954
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <1013993..>1014886
FT                   /note="synonym: Tb08.28L1.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659338"
FT                   /locus_tag="Tb927.8.3400"
FT   mRNA            <1013993..>1014886
FT                   /db_xref="GI:72392740"
FT                   /db_xref="GeneID:3659338"
FT                   /locus_tag="Tb927.8.3400"
FT                   /transcript_id="XM_842078.1"
FT   CDS_pept        1013993..1014886
FT                   /locus_tag="Tb927.8.3400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: metal ion binding [goid 0046872]"
FT                   /db_xref="GI:72392741"
FT                   /db_xref="GeneID:3659338"
FT                   /translation="MQQNIHSFTPTNGKDRCKLCLSYCGPIYLVVVILSFLGAYAAFFI
FT                   GLCLRYPTSWKLAVCISCLFTGAVLAGILIFTLLRAVFTPAGYVPQSPWQYPPRYIGEC
FT                   PGFVPPSGEGVGENPNTVRQLDRHNQLRYCTACKQFKPDRAYHCESCERCTFDFDHHCP
FT                   VLNNCIGRGNYKMFVLFLCYVPIVGCVLGGLMFVGFFVVDEAEPAVAWMVFAMIMMIFC
FT                   AVIGIFGCVHLCWLCRGESTMGRHVSSFNKQRGRSKEERAREREEHCNAVCGVRRVWWR
FT                   LVMPVLPLREEAASLV"
FT                   /protein_id="XP_847171.1"
FT   gene            <1016368..>1020924
FT                   /note="synonym: Tb08.28L1.520; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659340"
FT                   /locus_tag="Tb927.8.3410"
FT   mRNA            <1016368..>1020924
FT                   /db_xref="GI:72392742"
FT                   /db_xref="GeneID:3659340"
FT                   /locus_tag="Tb927.8.3410"
FT                   /transcript_id="XM_842079.1"
FT   CDS_pept        1016368..1020924
FT                   /locus_tag="Tb927.8.3410"
FT                   /gene_family="HOG000257529" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392743"
FT                   /db_xref="GeneID:3659340"
FT                   /translation="MKQKETASDINGARSLQGSAGTVASPRPPTVYKTYGGSSHLPLIG
FT                   RLQRAVRRPGSRSRLTLTTSGSSEELTNLKQLLQTQKDRLSRRCQMIDDSLEDCSANRE
FT                   NGTAGIVEGGEEGGKEGVTCPAIRRLAERMLGHVNPETNDLEEYEDEEEEEDSEVRALE
FT                   DDLCRREARLNIIKDKMKRLWVEKQISPAAAVPPPEPTVLAATTDQEVIDVAEMMYKFA
FT                   SGTSRDNENGKEKMEGSSSIIVGDQQVFDDGISDATAISITDSPATVRPSGAIKSEERA
FT                   CLVPLRSSSLGRLTSGARVFMDLLPNMRDIIVLSPGEVGVARRGDILSENHILKVDSQE
FT                   ALRSRKGAMGIISGAPYFRMVPKLNVAGVGQPRASAVRTIVNELRRVMDGLVVWVNLRE
FT                   EPLVYINNEAHIVRQRSDPTTPIIIPHVTGKSIALIDDKLKKEVIREASENSGNVSVHM
FT                   EGKDGHMEDQWESVEKDQVFTLEEVFRPLRTNIVYHRLPITQNVGPQPGDFDFVFDLCS
FT                   DDPRKMIIFNCQTGRGKTSAMMTIASIVRFYQLFAHDAVLDASLLRTEGRCFSFRTIKT
FT                   IVSLIPNGKLHERRLLVLLDLSDKVYSIADHINNAFTSGTTPAEEAIMHLKQYAYFLVF
FT                   SYYCEQRIWSFSTKQPFSQWLLGNNEIKLLLERIETMEEEFKEERIAAPVSEAGDFDTD
FT                   PVRKRRGTVLSANRILCSFPFFASGKEETIGSLRQLAPGVPIFTCGRLTEEGRQCVVKD
FT                   MRHYFPGKIMWLSLRAEPMVFINEMGYTLVDYDVTTYGKGGEGITMHTSLHAIEQMEER
FT                   LRRDVLLEAQEHKGYILLHNFDETGKRKAMQIKACSVRTPRSIMTDFAATYDVSYFRIP
FT                   IPLSGEMLPSDVDPLLEHLSKNTKDTTVFIINDTQGSVRTTVALNILTMYRVSRTCNLR
FT                   SMSNPARIAAALRTGNSDVVLPQVDIIAYQGRVTDSATRNYKELQVASTICQMLRAGSL
FT                   LCVTDALIDVGGCGKRWNIVHTIHHYANAITAGTIERTKGIREAVAMVRVYLFVLLSTI
FT                   YIDAQGDYDAREPFNLWLERRVEVANILSGLEQRAEKAFKYITPSSVGIPSVVHRRGDV
FT                   LTANYALKADHFPGCQKKGIRPEVCGAPNFRKVRDVNVYGVAIPTILGIRNILSLLGAS
FT                   FESLETYEGEQNDMDLHLGFAAPRLFDPRFQTETLSKPLRGHVVWVNLREEPILYVGDK
FT                   PFVLRNLETPYVNVELTGIAADEVERVERQLRQDVLKEAEENEGLFLIHDEETPGELVG
FT                   VCKPVTTEMVKTLRDVYDDFVSNGCRVTLLRLPVTDEQSPTEGNFDALVEALLPHITAH
FT                   MDRRETLSFVFNCQMGRGRTTTGMVVCCLLIGLVMPEYYKELDSIYDPLYKEEDSKLAC
FT                   GEYRCISDLKRTLTGGREAKHRVDLVIEACSTMQNLRTAIEFFALQVQSPDVTEEQRGR
FT                   AHHHGVHYLRRYFNLIAFAAYLEEEYDAMKKRVRCSFSRWLAQRRDVTTLCDSAALK"
FT                   /protein_id="XP_847172.1"
FT   misc_feature    1021335..1021373
FT                   /note="T-rich"
FT   repeat_region   1021506..1021553
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   misc_feature    1021667..1021725
FT                   /note="A-rich"
FT   repeat_region   1021748..1021773
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1021868..1021934
FT                   /note="T-rich"
FT   misc_feature    1022195..1022232
FT                   /note="AT_rich"
FT   repeat_region   1022306..1022345
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   1022387..1022413
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   1022869..1022905
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   gene            <1023636..>1024247
FT                   /note="synonym: Tb08.28L1.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659341"
FT                   /locus_tag="Tb927.8.3420"
FT   mRNA            <1023636..>1024247
FT                   /db_xref="GI:72392744"
FT                   /db_xref="GeneID:3659341"
FT                   /locus_tag="Tb927.8.3420"
FT                   /transcript_id="XM_842080.1"
FT   CDS_pept        1023636..1024247
FT                   /locus_tag="Tb927.8.3420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392745"
FT                   /db_xref="GeneID:3659341"
FT                   /translation="MHELELPFQWDDGTCISPFVATSNNTLVALSKWLHDVVLQHGENN
FT                   SLRLTDLGCGDGAALLQLCCELFLLQTKSCPLHLIAVGVDIDESLITDARRAAADAVAK
FT                   VPSPHQLQHDFAVADLRGVAVDEYFPLSETDSHVLFLYLLPEALNIIRDKLLEVIQRVR
FT                   FVVSNRWDIPFFSNWKIGQLHTLNVYSYRGENINLSKCSR"
FT                   /protein_id="XP_847173.1"
FT   repeat_region   1024710..1024737
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            <1024803..>1026308
FT                   /note="synonym: Tb08.28L1.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659339"
FT                   /locus_tag="Tb927.8.3430"
FT   mRNA            <1024803..>1026308
FT                   /db_xref="GI:72392746"
FT                   /db_xref="GeneID:3659339"
FT                   /locus_tag="Tb927.8.3430"
FT                   /transcript_id="XM_842081.1"
FT   CDS_pept        1024803..1026308
FT                   /locus_tag="Tb927.8.3430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392747"
FT                   /db_xref="GeneID:3659339"
FT                   /translation="MDFLQFCSSERYVSRVPVHNLSFRITLWRAPLVGERQLEQLCTLT
FT                   VPWGGKVFSPAERLQKIRTGVAMTTPDSNASTREIHTVVPGRRETDGDAAAAADDVEKL
FT                   REDIAKFSCTFFTRPPSEDYVSEAKENLLVDPPQAASPHVQIILREHQNQHQEGNRMYF
FT                   MWASGEILGPSEGKFDDAQWKGQERVICTITAERNSLCFTAKPSLNKTHTLLVDSLYVY
FT                   SFVITPLQACEPRPDEPTSTDFVEQIHEMVARIKDDLKSPHFDRRGILHQILLQQLHTA
FT                   PSDELPPRLDSPSSPCFPQSAIRDSRVRYYLFGVVERCTCVAADTLYLHCQWQRGGDNE
FT                   DEDDKRNLWNEGTLDGFTTQLSFASSMIMDQFIPVSMHTFNTPFDYHFDGWGPSPLRLL
FT                   ITAYDDEGLSVGGPQSPIGYAAVTVPHFLPGCHPLRAPLWRPRPTGREFVRSALMGGGP
FT                   ALVDVRDTAPRGGGGISVKCGLVSEPTGTVELRVTVFHQVGPL"
FT                   /protein_id="XP_847174.1"
FT   gene            <1026825..>1027160
FT                   /note="synonym: Tb08.28L1.550; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659342"
FT                   /locus_tag="Tb927.8.3440"
FT   mRNA            <1026825..>1027160
FT                   /db_xref="GI:72392748"
FT                   /db_xref="GeneID:3659342"
FT                   /locus_tag="Tb927.8.3440"
FT                   /transcript_id="XM_842082.1"
FT   CDS_pept        1026825..1027160
FT                   /locus_tag="Tb927.8.3440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392749"
FT                   /db_xref="GeneID:3659342"
FT                   /translation="MSVGKFKRSNGEPAFAQVCAVPSIPALLRPQFEVIREENIEALNR
FT                   RMGRTEASRMEAEKIKERCAQAREQRSRRLQERIETIQKRSVRLASAAALREERRLKAE
FT                   WRQMCRW"
FT                   /protein_id="XP_847175.1"
FT   gene            <1027791..>1028213
FT                   /note="synonym: Tb08.28L1.570; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659345"
FT                   /locus_tag="Tb927.8.3450"
FT   mRNA            <1027791..>1028213
FT                   /db_xref="GI:72392750"
FT                   /db_xref="GeneID:3659345"
FT                   /locus_tag="Tb927.8.3450"
FT                   /transcript_id="XM_842083.1"
FT   CDS_pept        1027791..1028213
FT                   /locus_tag="Tb927.8.3450"
FT                   /gene_family="HOG000257534" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392751"
FT                   /db_xref="GeneID:3659345"
FT                   /translation="MRGSTDPANVDQYDSRTYTRKGLATRVVVREKPYVKSRSQRLVDF
FT                   LRPSMRTGYNVVQGFELAKVMFCVIFPVFMLIYWKSVQRKLPDQWESQLSGLQHRQLKE
FT                   EAVPEHDTDYFSIIETFQERREKALQKKQREVVGTS"
FT                   /protein_id="XP_847176.1"
FT   gene            <1028723..>1029610
FT                   /note="synonym: Tb08.28L1.580; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659343"
FT                   /locus_tag="Tb927.8.3460"
FT   mRNA            <1028723..>1029610
FT                   /db_xref="GI:72392752"
FT                   /db_xref="GeneID:3659343"
FT                   /locus_tag="Tb927.8.3460"
FT                   /transcript_id="XM_842084.1"
FT   CDS_pept        1028723..1029610
FT                   /locus_tag="Tb927.8.3460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:72392753"
FT                   /db_xref="GeneID:3659343"
FT                   /translation="MDGRNGSKRARSEPANGPNQSNVGTSGVEEPHVEEVPARDPELER
FT                   QLDRLNIDDNLKESLRGLSPSTRGEVMNDIIRSETIERASSLMEQANLLSLIELRRLPE
FT                   LMEEGMSSQHYRADVDDDSELHEFGQALEDMQADGQSPSPQRGRPHGMLHTPGPLILEF
FT                   LRAFAAGTHAAFADAAGVSEHLNILSELAAQRAMGVTEDVDNMSYEELLELEDKIGYVS
FT                   RGVKPEDVQKCVKDVPTPHEGNCVVCQCEWSDNAETAPAVVELNRCKHVFHRTCIREWL
FT                   LKNKKCPVCTQEVV"
FT                   /protein_id="XP_847177.1"
FT   repeat_region   1029836..1029876
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   repeat_region   1031021..1031047
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1031661..1031683
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <1032469..>1033173
FT                   /note="synonym: Tb08.28L1.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659344"
FT                   /locus_tag="Tb927.8.3470"
FT   mRNA            <1032469..>1033173
FT                   /db_xref="GI:72392754"
FT                   /db_xref="GeneID:3659344"
FT                   /locus_tag="Tb927.8.3470"
FT                   /transcript_id="XM_842085.1"
FT   CDS_pept        1032469..1033173
FT                   /locus_tag="Tb927.8.3470"
FT                   /gene_family="HOG000257536" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392755"
FT                   /db_xref="GeneID:3659344"
FT                   /translation="MSSDLLREYENDFNETLKEANDVASRLQESLQRSGVSYQAPPAAG
FT                   PQSRSQQCHSLQQSLTRLRELITNMSYESNEVEPASAKEEVKRRLEDYRGKLVALEKQL
FT                   SRLRQESREADRTDLLGNGREMGDDGGSMEEHARMLGTTTKLKEGTGALQKAEALLHGT
FT                   NELGLETLSVVRGQTETMKHIHGVVIDVDDDVTESRRIVHRMQQVARKQKLIMAGVIGM
FT                   LVFTFLIIVFWK"
FT                   /protein_id="XP_847178.1"
FT   gene            <1033756..>1035582
FT                   /note="synonym: Tb08.28L1.640; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659346"
FT                   /locus_tag="Tb927.8.3480"
FT   mRNA            <1033756..>1035582
FT                   /db_xref="GI:72392756"
FT                   /db_xref="GeneID:3659346"
FT                   /locus_tag="Tb927.8.3480"
FT                   /transcript_id="XM_842086.1"
FT   CDS_pept        1033756..1035582
FT                   /locus_tag="Tb927.8.3480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392757"
FT                   /db_xref="GeneID:3659346"
FT                   /translation="MTEGMDRRNDKLVGRSAELTAPPAISQLYEELSSELEGVTAAYNL
FT                   LMDFLREPVQDDDPSGRTGDVLKRLAALLKFISQRLYCRLRDASIGFVRESGAGEVKRY
FT                   SKELSNLRGVIRSGAEQRRVSDEHGTPQVGKNSRFFFAISSLYNREERDRTSKLVSRGL
FT                   KKKVLMLPSPNAEEEESEAETALKMGCNVLVSPQIEKATWAARIVTMESLSEFVYRKCG
FT                   DEGEWDSARQLEDGECDIDEELDELLNQLEDTSRNQVSQFVVEFPEAEEASHSEVVPRD
FT                   LLRGFNGLSSQSVYADVDSQIAVPACGLDSGRRPVLLPARRTYSDSQMGLLLGNSVDFD
FT                   GDMPSQVIRYKREPSPISSPEGSFSEESLETLSPSKWCFQVSHLVEEREEVISAIGKLG
FT                   ARVVTRGTYCKETTHLVIAGGATERTAAFLGCCAALKHVVTPRYVFESRARGRWIVGRL
FT                   HEYERNPLLRDWVIPTRAVFGGWRVALFTTSIEVEQGITNVLEAGGCKSITPFRIGHES
FT                   TAAVDPSTIQKFSHILVECFQSVKELSYFIPPPKFPEQLMHMNVEIYALELLHQVLCLA
FT                   TSPIFDATGRLMDGQKLPEWCYVMKAGGSVQK"
FT                   /protein_id="XP_847179.1"
FT   repeat_region   1036195..1036469
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            <1036869..>1040120
FT                   /note="synonym: Tb08.28L1.660; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659347"
FT                   /locus_tag="Tb927.8.3490"
FT   mRNA            <1036869..>1040120
FT                   /db_xref="GI:72392758"
FT                   /db_xref="GeneID:3659347"
FT                   /locus_tag="Tb927.8.3490"
FT                   /transcript_id="XM_842087.1"
FT   CDS_pept        1036869..1040120
FT                   /locus_tag="Tb927.8.3490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392759"
FT                   /db_xref="GeneID:3659347"
FT                   /translation="MNFLSQIYTDSCYKSYLDNEPPFLVAVVSGKRLCISEGLSRMSNQ
FT                   SSLFHIKYFPDLRSLPTKQKAAGAPLPSALGVLKSDWCTRHLHSRFSCVIFSLDWETVS
FT                   DVAMDEIGNSSMWDQLLAWTRTLRSKIIVALATEKCSNEGEDVKEKLETLQRVLKQRLG
FT                   DDFNELIILFKLGMERESAERLYHMLKKTSTAYHMEELARIRNKPPEPNYRAVRLGFKA
FT                   GWHSLVVRDLGAAVKHFTNAYNCLRDVAPPQSPMELRMCGTVIIMHLLNAAKALSDVSF
FT                   EDLYYGMCEDHIVWLGQITPSTGENFTMVQFLKPLLIAECHYWLAKNTCHAVPVASMGH
FT                   LCACMFAYEDALKVNRSLETSAQQTVAPVLIGVECCSEAHVNICSLSGTSDALTKRVGE
FT                   LLSECASLTVPTVELLYTSARLNVMLRRTDEALYSLEMLWEHGVKSYEGAKVIHGLLIE
FT                   LSKSVPDELVEKCSREVTLSYASLSFGPGAEESQRRFRDSFAKMMSSFSLDSFLSYPHK
FT                   GYYAPFNIFCGFSEVHGDDSMHELVMVFRTHSIDNVNVDSLCVNLSRMRDNKLDSWAKQ
FT                   TSVDRSVELCSCNSSSVSALFDLREPGVYYCSRVQGRVKCGDICLNVEWSFDDTSVENY
FT                   FLQHGQFKKWGVSCSQCTPWVCVAEPICHIEVHAPDYIVGVEGEVVEVDVVIDTNSDLR
FT                   DDTSFVLTHLPAVYEFVGCDAGNCSLKERCDGGKGYVSLLLNNLPPILCGSPSRLTMRY
FT                   KCNRAGKYVIPITFCALSNTSAKVEITKNVQAHISCPFIPSYTLFKSIPWTMEAQNTND
FT                   GGTSLVTLEVPEVSSPFVRSGSYTLLRPQDYINEDLSTLHGNRSVTLYGAFTNREKCGD
FT                   INFSKGETIVVVMTMECRAFQGLTLSSFDAVVSDNVVLLSLTAGTLPFQVDYMESFTVT
FT                   AKLRVLRTGRVSLGFVRMLISPGSSTQRIVSDVSLPEVETDDHVLELTLECPSTVASGS
FT                   YVTLVCNVVNKTAIPQSCQLTLERNGEFFLVGGIEQWNFPIGPLAVYSTRIVLKPLAVG
FT                   VLQLPSLHLRHSSGVSFGTVSSFQFDSQKICVLTP"
FT                   /protein_id="XP_847180.1"
FT   gene            <1040450..>1043293
FT                   /note="synonym: Tb08.28L1.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659351"
FT                   /locus_tag="Tb927.8.3500"
FT   mRNA            <1040450..>1043293
FT                   /db_xref="GI:72392760"
FT                   /db_xref="GeneID:3659351"
FT                   /locus_tag="Tb927.8.3500"
FT                   /transcript_id="XM_842088.1"
FT   CDS_pept        1040450..1043293
FT                   /locus_tag="Tb927.8.3500"
FT                   /gene_family="HOG000137459" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392761"
FT                   /db_xref="GeneID:3659351"
FT                   /translation="MSVEEVDTLLQGVVTCGTNADEVALEKLREIPLLQLSRMMGKYLT
FT                   GEEHVVNAVRVLGLATVNRRDRTIEEVDVMLRFFSRKLSSMQTIAVAVESTALLVRELS
FT                   SEGPCTSDVFNVLHTEFLQSFSLQALPTNVRSWGYDVLRFTVTKETATWFTTPFLQVVL
FT                   KSMDEENEPELLMRALELHHIIASYAREDAMQPLLEEYFDSISSYFPVVFSQPPGCKVS
FT                   KEDLRRVLSACMTHPLYLNICVPFLLSRMASPSSVVKQESTNALLNIFSLDSSHTTESL
FT                   CPHVVSVTNHIRNEVVRAVSLGSGECEPYVKDCVHVLKFISKRAQDVSLSIVRSWLEPM
FT                   TSGALASLRSGPAVCSAYATMFYHLVSSSTCCGAATVQCFLLQLLSNTREDSFEVDDAV
FT                   LIISAILSGIFDAGNGGECGKRPPPQRDVKEGLETVSEKLFQLVEKLTLSLQKADASSV
FT                   HVRCELLASLVTLAAWLPHWMPDDTVLLIYKRLIALCLCGDEEVGNRVVKHISRIGSVE
FT                   GNLLNVALLDMPADINPTAAGILTLYKGLLGSQASLSLAATKSLLECPEGLFGFTLTER
FT                   DVFSLCRSSLSAHADYSTEDIRCLLLLTKKRNSVASFDYLCDLLLLLPIAFVPSVLQEV
FT                   GGEQWGVLTASLVSCFDMDVLGASDHIEHWMCEVLDAMRSTPTDVLTMQSVSLLCARVP
FT                   GVAGRFLEAAKRLNPTTQLAARAAVARGLLACGVAEGGIIELIIEEITNSLRSGYVQDC
FT                   YVDILTGVFVFCYQGCRKTTTLILPLVHAATRGSKPVSLELLRVVAKLLQDVSPTCGLE
FT                   WGDIVEFSRRVSKPLNEEFVNELVELLDLALSQMDPKNVLVEALLGTDDLLPLVLSGVR
FT                   SPLLKVRCTSLRLLSEAALFVMQFSSENGDSGNSYMSSALQVRDEVLHVSQVALNDHKR
FT                   MVRRSAAQCRHQWYKLK"
FT                   /protein_id="XP_847181.1"
FT   gene            <1043455..>1044492
FT                   /note="synonym: Tb08.28L1.680; thymidylate kinase,
FT                   putative"
FT                   /db_xref="GeneID:3659350"
FT                   /locus_tag="Tb927.8.3510"
FT   mRNA            <1043455..>1044492
FT                   /db_xref="GI:72392762"
FT                   /db_xref="GeneID:3659350"
FT                   /locus_tag="Tb927.8.3510"
FT                   /transcript_id="XM_842089.1"
FT   CDS_pept        1043455..1044492
FT                   /locus_tag="Tb927.8.3510"
FT                   /gene_family="HOG000255708" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thymidylate kinase, putative"
FT                   /EC_number="2.7.4.9"
FT                   /note="go_function: thymidylate kinase activity [goid
FT                   0004798]; go_process: TTP biosynthesis [goid 0006234];
FT                   go_process: pyrimidine salvage [goid 0008655]"
FT                   /db_xref="GI:72392763"
FT                   /db_xref="GeneID:3659350"
FT                   /translation="MVAVNRKIVVFTDVEDKQVLEVIREVAGDAETIQLEKSFAYEFMW
FT                   RGKHTPYRVGTPMCFITEKTVEDADVVFAVYSKRVPVLSLTTGGETTNLLQTISSLGIE
FT                   CKQNTSETWADAVRAFLPNNDSESAVIVFGGGDGAGKATQTEYMRKRLDKEGKAHASLD
FT                   FPSDKHRYGKLIRKVLSGERGALHGLDPKLFSLLFSLNRFDTLPELRYWLTHGKKILLD
FT                   RYYTSNFGHQASKLEESERSDFIRHLEQLELEWLKLPPPDVALYLDLPPAAALVAMQRD
FT                   EKRESLDIHETAGLSYKENVRQTYVWCCQNQRNWVQIECCNDEGERYSREKVHEMIYNA
FT                   VAKHI"
FT                   /protein_id="XP_847182.1"
FT   gene            <1046956..>1048728
FT                   /note="synonym: Tb08.28L1.700; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659349"
FT                   /locus_tag="Tb927.8.3520"
FT   mRNA            <1046956..>1048728
FT                   /db_xref="GI:72392764"
FT                   /db_xref="GeneID:3659349"
FT                   /locus_tag="Tb927.8.3520"
FT                   /transcript_id="XM_842090.1"
FT   CDS_pept        1046956..1048728
FT                   /locus_tag="Tb927.8.3520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392765"
FT                   /db_xref="GeneID:3659349"
FT                   /translation="MNFSGGNKEGLDKQSYTSVPPGTREEEIQNSGNLAVKQPTVPTLS
FT                   SATASPANTAAGELNDPRPHNTVASSGAAGSVGHLQVERKQECDDQQPMKSPTPLEETL
FT                   NTVTQYLVQRDDLPTIPLLQQQALLLGEVPDLKEVPEPSQTVFTPPKEYGDETGPWGSF
FT                   LSLKKATGETVFGMMSFYDQVMKLQVTHEKEAASYREAAEHTVSQQRQTIEALTSECRI
FT                   LRSRNDRMRTIIDKTNQQLKQWESENSELNKKLREVEQRCAHVEDRAVVAECGRKMLEL
FT                   RLREVEMSLNYSTDAVNKLRKSLNEANRDRDHALQEQYNVYEANRRDMIEFYDRREREL
FT                   VHEFNETVTKLQDIMYNAMKAHEDKLRECWNDMQRLQQEKHEESIKELNILREKEERDY
FT                   NARISRVEQDNQRRYEQYRSEMALLEQRQREREEHLLMDISQRERELSEREQRLRVQRT
FT                   QDEQDTKIALMAKETEVKTYYERLMENMRSAFDKEREKMCTFFREQVQEISQLHLENER
FT                   QLERTHRDKEREMAQRYRIAGYEAEDRRGNVELRDVSMATQSALLSKFDAIEARQRERA
FT                   EKARAVFQNQPESK"
FT                   /protein_id="XP_847183.1"
FT   gene            complement(1053326..1053397)
FT                   /note="synonym: Tb927.8.tRNA.Cys.01"
FT                   /db_xref="GeneID:3659348"
FT                   /locus_tag="Tb927.8.3523"
FT   tRNA            complement(1053326..1053397)
FT                   /db_xref="GeneID:3659348"
FT                   /locus_tag="Tb927.8.3523"
FT                   /product="tRNA-Cys"
FT   gene            1053540..1053611
FT                   /note="synonym: Tb927.8.tRNA.Cys.02"
FT                   /db_xref="GeneID:3659352"
FT                   /locus_tag="Tb927.8.3526"
FT   tRNA            1053540..1053611
FT                   /db_xref="GeneID:3659352"
FT                   /locus_tag="Tb927.8.3526"
FT                   /product="tRNA-Cys"
FT   gene            complement(<1057497..>1058561)
FT                   /note="synonym: Tb08.28L1.740; glycerol-3-phosphate
FT                   dehydrogenase [NAD+], glycosomal"
FT                   /db_xref="GeneID:3659353"
FT                   /locus_tag="Tb927.8.3530"
FT   mRNA            complement(<1057497..>1058561)
FT                   /db_xref="GI:72392766"
FT                   /db_xref="GeneID:3659353"
FT                   /locus_tag="Tb927.8.3530"
FT                   /transcript_id="XM_842091.1"
FT   CDS_pept        complement(1057497..1058561)
FT                   /locus_tag="Tb927.8.3530"
FT                   /gene_family="HOG000246853" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD+],
FT                   glycosomal"
FT                   /EC_number="1.1.1.8"
FT                   /note="similar to SP:Q26756: Glycerol-3-phosphate
FT                   dehydrogenase [NAD+], glycosomal{Trypanosoma brucei
FT                   rhodesiense}(PMID:8920003)  similar to SP:P90593:
FT                   Glycerol-3-phosphate dehydrogenase [NAD+], glycosomal (EC
FT                   1.1.1.8). {Trypanosoma brucei brucei}(PMID:8920004) similar
FT                   to GP:1806121: glycerol-3-phosphate dehydrogenase (NAD+)
FT                   {Leishmania mexicana} (PMID:10743613); 100% similar to
FT                   SP:Q26756: Glycerol-3-phosphate dehydrogenase [NAD+],
FT                   glycosomal{Trypanosoma brucei rhodesiense}(PMID:8920003)
FT                   99% similar to SP:P90593: Glycerol-3-phosphate
FT                   dehydrogenase [NAD+], glycosomal (EC 1.1.1.8). {Trypanosoma
FT                   brucei brucei}(PMID:8920004) 77% similar to GP:1806121:
FT                   glycerol-3-phosphate dehydrogenase (NAD+) {Leishmania
FT                   mexicana} (PMID:10743613); go_component:
FT                   glycerol-3-phosphate dehydrogenase complex [goid 0009331];
FT                   go_component: glycosome [goid 0020015]; go_function:
FT                   glycerol-3-phosphate dehydrogenase (NAD+) activity [goid
FT                   0004367]; go_process: glycerol-3-phosphate metabolism [goid
FT                   0006072]"
FT                   /db_xref="GI:72392767"
FT                   /db_xref="GeneID:3659353"
FT                   /translation="MVSGVTYLKRGAVFGSGAFGTALACVLAKKCESVSVWHMNANEAR
FT                   VVNQKHENVYFLPGAPLPANLTFTADAEECAKGAEIVLFVIPTQFLRGFLQKNSHILRN
FT                   HVVSRNVPVVMCSKGIERSSLLFPAQILEEFLPNYPIGVIAGPSFAIEVAKGMLTNVCT
FT                   AAADINMARKIQKIMTTSDGSFRCWATTDVIGCEIASAMKNVLAIASGALKGLGTENNA
FT                   RAALISRGLLEIRDLTLALGGTGEAVFGLPGLGDLLLTCSSELSRNFTVGMKLGQGISL
FT                   EEIKRTSKAVAEGVATAEPLERLAKKHNVHLPICHEVYNVLYANGCAKRSFKKLNSCKL
FT                   ADEGLPALPRTSKM"
FT                   /protein_id="XP_847184.1"
FT   gene            complement(<1059272..>1062178)
FT                   /note="synonym: Tb08.10J17.970"
FT                   /db_xref="GeneID:4443253"
FT                   /locus_tag="Tb927.8.3540"
FT   mRNA            complement(<1059272..>1062178)
FT                   /db_xref="GI:72392768"
FT                   /db_xref="GeneID:4443253"
FT                   /locus_tag="Tb927.8.3540"
FT                   /transcript_id="XM_842092.1"
FT   CDS_pept        complement(1059272..1062178)
FT                   /locus_tag="Tb927.8.3540"
FT                   /gene_family="HOG000202092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392769"
FT                   /db_xref="GeneID:4443253"
FT                   /translation="MSYTNQCVRHGRLNLSTLLAVILLVIVGKAMATVEFKLTDAVQLS
FT                   LHQTAQVEFSKGSSDGNDDMKFSSTDMFYFVRQENAKNCNSKPIPDDIFNVSTVDHDGG
FT                   NAKGAFTVRSSIFTVGDKYGVCYVSGNKTFPAKRVDSGGDGSQLDVWPSLYRDFSLSVE
FT                   PSPHGLDLFRLTVEETAQKGRPVNSGFGGNRTIFLFPCGNVEECSDASHVSELCAKASE
FT                   DTIELNELEGVGTGRITGTFSLQPSSTKKTFAICVSYCGAGAEACSNPSHQERSYTAVE
FT                   DGKKDNTGAIITFEATNTNTYSTIPVRPQAREEGYLQLHGGSTPTEGDKIIIVQKDSAC
FT                   SDKAPLLYGLQVGKISVENAMARVNFSTKMLIDDKMEGNVCYYNHSSNEWSKLRRIGDG
FT                   DESQESYFTIEVLQPTSFTVVSPAVVIGQRVEIELNGTGLDATRDSAFVSLDTCGDHEK
FT                   DGVTRFNCSLRNGNTPRCRVVVDPDSNGGGMLRVCYRKSGSLNAAEVNGRITINDRNPS
FT                   FELAPYPLRGGQTGSMTFHGHDLSAADTVYFVSVDTECTHGMQSNKFRAENGFEVEKGT
FT                   VYRYDVVGEAHQCLKVCYYIRSLGVWSVARPQGTMEPTNGNCGKNHLYVSEYDLRFELP
FT                   DGKLTLKETATVTLSSGIMPSDMKLVRSWERCVFHFCLINNRYTSACELPQNEDDYVSA
FT                   RFENSVSIFGASTNVEYILCAKNGAETYIPVLHKGRELSAANIVFEAEDQVVKHSGHSP
FT                   DVWRVGEVSLNSTFRGRGLNASEDTVLVFKDDVMLGTKTKVCPPLSNKPNTVLNSTALS
FT                   GNDSTSSVAFRYRGSHALYTGAVVHLCYVWGGGKHVTYTESIQFSESQPSSMSDTPAGD
FT                   DAKRAGLRVTLKFHSNTSVLRLGSESVHFYRFVNSSGPRTKCYCDDDCPENDRVTYRDV
FT                   ALVAGEDDNTTAWENPSGFDNHGYGAIYVVCYASIESK"
FT                   /protein_id="XP_847185.1"
FT   gene            complement(<1059272..>1060981)
FT                   /note="synonyms: Tb08.28L1.745, Tb08.10J17.970;
FT                   hypothetical protein, conserved"
FT                   /db_xref="GeneID:3659356"
FT                   /locus_tag="Tb927.8.3540a"
FT   mRNA            complement(<1059272..>1060981)
FT                   /db_xref="GI:71752720"
FT                   /db_xref="GeneID:3659356"
FT                   /locus_tag="Tb927.8.3540a"
FT                   /transcript_id="XM_820682.1"
FT   CDS_pept        complement(1059272..>1060981)
FT                   /locus_tag="Tb927.8.3540a"
FT                   /gene_family="HOG000202092" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Should be merged with annotated gene Tb08.10J17.970
FT                   on overlapping BAC to construct the complete gene."
FT                   /db_xref="GI:71752721"
FT                   /db_xref="GeneID:3659356"
FT                   /translation="DESQESYFTIEVLQPTSFTVVSPAVVIGQRVEIELNGTGLDATRD
FT                   SAFVSLDTCGDHEKDGVTRFNCSLRNGNTPRCRVVVDPDSNGGGMLRVCYRKSGSLNAA
FT                   EVNGRITINDRNPSFELAPYPLRGGQTGSMTFHGHDLSAADTVYFVSVDTECTHGMQSN
FT                   KFRAENGFEVEKGTVYRYDVVGEAHQCLKVCYYIRSLGVWSVARPQGTMEPTNGNCGKN
FT                   HLYVSEYDLRFELPDGKLTLKETATVTLSSGIMPSDMKLVRSWERCVFHFCLINNRYTS
FT                   ACELPQNEDDYVSARFENSVSIFGASTNVEYILCAKNGAETYIPVLHKGRELSAANIVF
FT                   EAEDQVVKHSGHSPDVWRVGEVSLNSTFRGRGLNASEDTVLVFKDDVMLGTKTKVCPPL
FT                   SNKPNTVLNSTALSGNDSTSSVAFRYRGSHALYTGAVVHLCYVWGGGKHVTYTESIQFS
FT                   ESQPSSMSDTPAGDDAKRAGLRVTLKFHSNTSVLRLGSESVHFYRFVNSSGPRTKCYCD
FT                   DDCPENDRVTYRDVALVAGEDDNTTAWENPSGFDNHGYGAIYVVCYASIESK"
FT                   /protein_id="XP_825775.1"
FT   misc_feature    1060982..1222766
FT                   /note="sequence corresponds to BAC RPCI93-10J17"
FT   gene            complement(<1060982..>1062178)
FT                   /note="synonyms: Tb08.10J17.970, Tb08.28L1.745;
FT                   hypothetical protein, conserved"
FT                   /db_xref="GeneID:3659357"
FT                   /locus_tag="Tb927.8.3540b"
FT   mRNA            complement(<1060982..>1062178)
FT                   /db_xref="GI:71902664"
FT                   /db_xref="GeneID:3659357"
FT                   /locus_tag="Tb927.8.3540b"
FT                   /transcript_id="XM_824936.1"
FT   CDS_pept        complement(<1060982..1062178)
FT                   /locus_tag="Tb927.8.3540b"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="Should be merged with annotated gene Tb08.28L1.745
FT                   on overlapping BAC to construct the complete gene."
FT                   /db_xref="GI:71902665"
FT                   /db_xref="GeneID:3659357"
FT                   /translation="MSYTNQCVRHGRLNLSTLLAVILLVIVGKAMATVEFKLTDAVQLS
FT                   LHQTAQVEFSKGSSDGNDDMKFSSTDMFYFVRQENAKNCNSKPIPDDIFNVSTVDHDGG
FT                   NAKGAFTVRSSIFTVGDKYGVCYVSGNKTFPAKRVDSGGDGSQLDVWPSLYRDFSLSVE
FT                   PSPHGLDLFRLTVEETAQKGRPVNSGFGGNRTIFLFPCGNVEECSDASHVSELCAKASE
FT                   DTIELNELEGVGTGRITGTFSLQPSSTKKTFAICVSYCGAGAEACSNPSHQERSYTAVE
FT                   DGKKDNTGAIITFEATNTNTYSTIPVRPQAREEGYLQLHGGSTPTEGDKIIIVQKDSAC
FT                   SDKAPLLYGLQVGKISVENAMARVNFSTKMLIDDKMEGNVCYYNHSSNEWSKLRRIGDG
FT                   "
FT                   /protein_id="XP_830029.1"
FT   misc_feature    1062717..1062739
FT                   /note="AT_rich"
FT   misc_feature    complement(1062717..1062739)
FT                   /note="AT_rich"
FT   repeat_region   1062951..1062985
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1062951..1062985)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   misc_feature    1063302..1063367
FT                   /note="A-rich"
FT   misc_feature    complement(1063302..1063367)
FT                   /note="T-rich"
FT   repeat_region   1063743..1063776
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1063743..1063776)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1064013..1064053
FT                   /note="A-rich"
FT   misc_feature    complement(1064013..1064053)
FT                   /note="T-rich"
FT   repeat_region   1064278..1064306
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1064278..1064306)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   1064344..1064368
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1064344..1064368)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tgaa"
FT                   /rpt_type="tandem"
FT   misc_feature    1064486..1064543
FT                   /note="GA-rich"
FT   misc_feature    complement(1064486..1064543)
FT                   /note="CT-rich"
FT   misc_feature    1064696..1064749
FT                   /note="GA-rich"
FT   misc_feature    complement(1064696..1064749)
FT                   /note="CT-rich"
FT   repeat_region   1064842..1064874
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1064842..1064874)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1064975..1065033
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1064975..1065033)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   gene            complement(<1065070..>1066185)
FT                   /note="synonym: Tb08.10J17.940; mitogen-activated protein
FT                   kinase 3, putative"
FT                   /db_xref="GeneID:3659358"
FT                   /locus_tag="Tb927.8.3550"
FT   mRNA            complement(<1065070..>1066185)
FT                   /db_xref="GI:72392770"
FT                   /db_xref="GeneID:3659358"
FT                   /locus_tag="Tb927.8.3550"
FT                   /transcript_id="XM_842093.1"
FT   CDS_pept        complement(1065070..1066185)
FT                   /locus_tag="Tb927.8.3550"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitogen-activated protein kinase 3, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:72392771"
FT                   /db_xref="GeneID:3659358"
FT                   /translation="MHKSNQELCEPTIVGGFKVYNVGGSEFEVPRKYTLLKILGMGAYG
FT                   IACSCLNEETQEKVSIKKCREVFRDLDDGRRVLREVAMMRFFRHENLLHVMDILPPMKG
FT                   YNEFRDVYIVTPLKDVDMNVVLRSRQVLEETHVRYFIYQILRGLKYLHSAGVAHRDLKP
FT                   ANLVTDISCELKIIDFGLSRSVTIPHHDLTDYVITRWYRPPELLLENSYYDTAVDIWSV
FT                   GCIMAEMYNRKPVLPGRNTIDQLRLICTHIGKPPRDMVESAEALEKLNQLPDGELDMGK
FT                   LVPGLTSADGIDFLSQMWELDPRKRPSAAELLRHPFMAPLHDEVDEPVCPTSFAWPYEM
FT                   QEMSLDSLRRAFWDEICSFNPHLASQIPKGA"
FT                   /protein_id="XP_847186.1"
FT   repeat_region   1066858..1066913
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1066858..1066913)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1067527..1067574
FT                   /note="T-rich"
FT   misc_feature    complement(1067527..1067574)
FT                   /note="A-rich"
FT   misc_feature    1067586..1067678
FT                   /note="A-rich"
FT   misc_feature    complement(1067586..1067678)
FT                   /note="T-rich"
FT   repeat_region   1067756..1067787
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1067756..1067787)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    1068035..1068174
FT                   /note="A-rich"
FT   misc_feature    complement(1068035..1068174)
FT                   /note="T-rich"
FT   gene            complement(<1068931..>1071717)
FT                   /note="synonym: Tb08.10J17.920; DNA repair and
FT                   recombination helicase protein PIF1, putative"
FT                   /db_xref="GeneID:3659361"
FT                   /locus_tag="Tb927.8.3560"
FT   mRNA            complement(<1068931..>1071717)
FT                   /db_xref="GI:72392772"
FT                   /db_xref="GeneID:3659361"
FT                   /locus_tag="Tb927.8.3560"
FT                   /transcript_id="XM_842094.1"
FT   CDS_pept        complement(1068931..1071717)
FT                   /locus_tag="Tb927.8.3560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair and recombination helicase protein
FT                   PIF1, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_component:
FT                   mitochondrion [goid 0005739]; go_function: DNA helicase
FT                   activity [goid 0003678]; go_process: telomere maintenance
FT                   [goid 0000723]; go_process: DNA recombination [goid
FT                   0006310]; go_process: chromosome organization and
FT                   biogenesis (sensu Eukaryota) [goid 0007001]"
FT                   /db_xref="GI:72392773"
FT                   /db_xref="GeneID:3659361"
FT                   /translation="MLSRLSAVWRPSRVALRIQRVDFTTCGNRLNRSTQPNEPPLVSGI
FT                   AARSRTAKAEPVEKRGRAAIKIDSPPPPLEPPRISEEHMTRRRKVGGGKTKAAAVTKSK
FT                   QRRSGRTVGASAFNTARRANGIEGSAPGKGGASDVAIDDDDDEKLVDEESKQLMQLLKE
FT                   EALRREEEKKKRLRAKAAAEPTEVTDDKEYLSKLGVAERTQPVGTEAKISAQGKAEGAS
FT                   EGQTHFSDADADSQLPILTSLSPEQQRALRLALKGRNLFITGGAGSGKSLLIREIVYQL
FT                   RHNKRRCVYVTATTGVAALNVRGSTVNSFAGVKFGDGDARQLLKWVRRSRRAAGRWRYC
FT                   QTLIIDEISMMDPLLLDKLDVIARAIRRRNEPFGGIQVILCGDFLQLPPIPPRNKPQQK
FT                   TEENAEAQEGGDPTDGTPAPSKLQYCFETSTWTSLNLITVILHKKFRQHDDLAFQQVLD
FT                   ELRVGSLSPESYELLLSRTVASKSSAKSRKKKDEDAGNDGVLPLTDAETTPAAAEKDRH
FT                   VRLCATNKEVEMRNAKYFAALEPKGLPIYPSPNDGSSQQTGSSNGANSVTEEDTMRPLQ
FT                   VYRAYDAYSTHETEPETTEETTTGTQPSQPWVRFEDSTLPTDLALKVGTRVMVLQNISL
FT                   RLGLVNGSVGEVVGFLHPLELVELVLRAPRERHFPSARGQELLERAGLPTLQDAFRCVD
FT                   TALGQSLFYYLRERGIRRPEDASYGCVYGNTHCRDILRLVGLGKTESANAVHPLEMYLG
FT                   GIAPQHVRLTRLPIVRLDLREGNHTSSDSGAVEDGGFANGSKRLPKHVYAFISPSSHQW
FT                   YMGDQPVATRTQLPLRQAWAMTVHKAQGLTISHVEVAIHRFFSPGQAYVALSRSTRLDN
FT                   IRLLDFNNASVHACPRAKEFYTVLEEEELDNEIEDDGTEGDEEALEGDGEYEGEVEE"
FT                   /protein_id="XP_847187.1"
FT   misc_feature    1071772..1071799
FT                   /note="AT_rich"
FT   misc_feature    complement(1071772..1071799)
FT                   /note="AT_rich"
FT   misc_feature    1072388..1072463
FT                   /note="A-rich"
FT   misc_feature    complement(1072388..1072463)
FT                   /note="T-rich"
FT   misc_feature    1072586..1072651
FT                   /note="A-rich"
FT   misc_feature    complement(1072586..1072651)
FT                   /note="T-rich"
FT   misc_feature    1073073..1073093
FT                   /note="AT_rich"
FT   misc_feature    complement(1073073..1073093)
FT                   /note="AT_rich"
FT   misc_feature    1073165..1073354
FT                   /note="A-rich"
FT   misc_feature    complement(1073165..1073354)
FT                   /note="T-rich"
FT   repeat_region   1074321..1074345
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1074321..1074345)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   1074394..1074482
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1074394..1074482)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1074485..1074511
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1074485..1074511)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   repeat_region   1074849..1074874
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1074849..1074874)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<1075177..>1075887)
FT                   /note="synonym: Tb08.10J17.880; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659354"
FT                   /locus_tag="Tb927.8.3570"
FT   mRNA            complement(<1075177..>1075887)
FT                   /db_xref="GI:72392774"
FT                   /db_xref="GeneID:3659354"
FT                   /locus_tag="Tb927.8.3570"
FT                   /transcript_id="XM_842095.1"
FT   CDS_pept        complement(1075177..1075887)
FT                   /locus_tag="Tb927.8.3570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392775"
FT                   /db_xref="GeneID:3659354"
FT                   /translation="MTTNLVLPAGGGNGRTLFSSNRRHRLQLLKITTGIQPVFLGGHLL
FT                   FQPNSSEMPHTARHPDNRHQNRQPQPQLRWRRSFRGELAVQEVLPPLTSPRPQQRQQQN
FT                   DGHQQSDIRLVLPPPFTSPRGNTNNYIRQEYHVAQRDAENEQAAHTAPPHAGQTNSDRF
FT                   PNISTMAPASYVSNRAQETNNGQCCICLERQSLVLFLPCRHLCTCDGCLRQLQKKACPY
FT                   CNQPYRKTTRVFIP"
FT                   /protein_id="XP_847188.1"
FT   gene            complement(<1076641..>1078083)
FT                   /note="synonym: Tb08.10J17.870; ATP-dependent chaperone,
FT                   putative"
FT                   /db_xref="GeneID:3659359"
FT                   /locus_tag="Tb927.8.3580"
FT   mRNA            complement(<1076641..>1078083)
FT                   /db_xref="GI:72392776"
FT                   /db_xref="GeneID:3659359"
FT                   /locus_tag="Tb927.8.3580"
FT                   /transcript_id="XM_842096.1"
FT   CDS_pept        complement(1076641..1078083)
FT                   /locus_tag="Tb927.8.3580"
FT                   /gene_family="HOG000198799" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent chaperone, putative"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   aerobic respiration [goid 0009060]"
FT                   /db_xref="GI:72392777"
FT                   /db_xref="GeneID:3659359"
FT                   /translation="MNLAALADGSNPAVCGSSSSTAVSADVALAELAALVPERWRGEGG
FT                   VLSRTLGNLLQNPFFSAGVGLYLLTFTGAATRSVSTMFKSVMRRRFVISMEVTSQDESY
FT                   GWMVRWLSSKPAFQVQQVNVTTRNTTIYSNDESSHECMYAPCTNIRHWFWYKHRPIVLQ
FT                   RRRVETQAMGTDVLETMELTTLGLSSTFMREILEEARELTSMRNSDHTVIYQNAGGRWV
FT                   RQEPRRRRPLNSVVLNDGIGDMLLEDAKLFLQSSRYYEDLGVPYRRGYLLHGPPGCGKS
FT                   SVVMALAGELRLSICPLSLSGRGLSDDTLVQLLNTAPIRSIVLLEDIDRAFSADSHITM
FT                   SGLLNALDGVAAQEGRIVFMTTNHVERLDEALIRPGRCDLKVEIGLISREQARKLFCKF
FT                   FPEAPESLHEAFALQLLPGKLSVAQIQSHLFLHRDRADVAVRELPNFLSTVKSFEQRVH
FT                   RARQQEEVAARLKRAPMLHSLQ"
FT                   /protein_id="XP_847189.1"
FT   gene            complement(<1078979..>1080937)
FT                   /note="synonym: Tb08.10J17.850; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659355"
FT                   /locus_tag="Tb927.8.3590"
FT   mRNA            complement(<1078979..>1080937)
FT                   /db_xref="GI:72392778"
FT                   /db_xref="GeneID:3659355"
FT                   /locus_tag="Tb927.8.3590"
FT                   /transcript_id="XM_842097.1"
FT   CDS_pept        complement(1078979..1080937)
FT                   /locus_tag="Tb927.8.3590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392779"
FT                   /db_xref="GeneID:3659355"
FT                   /translation="MSSVGVSDALEGSRQSKGRTGSIFSGEKMSTTTFGTRSATSLSMD
FT                   AKASTARMSSTAERVVASNISPCPNVERLRNTAVEDRVLWHVRRRESLQQTKEREQRKI
FT                   MMERRISMTDYYKTLFRLPPPNSRFNEQQGKAVALPVLQGPMTKAKEKMILESLPKFAH
FT                   RRVVQDINDYFIAAYYKQNPEALVRKLEEEERQSRVAAATAAAAARNSPTRTGARSQSL
FT                   GTPSRKNRGGKKKKKKQEVVEEGKPAPNLRLLQSALLTVADSSGIVTLDAFLDMLRQAP
FT                   FEVRDDEAAENFFSVAHPSSSMSESGVNAVGRLETSHNTAAASSGVRSLSPLKAAQLHH
FT                   ASLHRTIEGSGAGQTSSSNMSVAKMSPVLAGNRGNQTFPIPGVNIPAPVVNETSQREKS
FT                   PEAHVRELLAGFDALVNGAELKDVIRKLCFSVLETDDYIHKSALTQLRRDGRESCEEPE
FT                   SVLSPSIVKALRDSLDVLHQEEEQAYIRSQLKGRKNRKSVKAASLLPHQKTVIPLNMMR
FT                   RSHISYEEFCRFFDTMPFLVAAFAHMWLPAFFAPTWPRRKRAASYGLYSDDQDMDDDYT
FT                   APTCQEGNEDGTTEEHRGVRDEVDWEKVATPPLRDVLLSALKRRHMASNIVANRLAFMN
FT                   TTVESPSRASEASPVPS"
FT                   /protein_id="XP_847190.1"
FT   gene            complement(<1081477..>1081743)
FT                   /note="synonym: Tb08.10J17.840; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659360"
FT                   /locus_tag="Tb927.8.3600"
FT   mRNA            complement(<1081477..>1081743)
FT                   /db_xref="GI:72392780"
FT                   /db_xref="GeneID:3659360"
FT                   /locus_tag="Tb927.8.3600"
FT                   /transcript_id="XM_842098.1"
FT   CDS_pept        complement(1081477..1081743)
FT                   /locus_tag="Tb927.8.3600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392781"
FT                   /db_xref="GeneID:3659360"
FT                   /translation="MAMRRHLETTDFSGYTRVLARRRSVIPLQLVKKMGESKSDTTGGR
FT                   GNGRRLRKATLTCMRCRLSMLDWPYCGMTGEPHRMEEVAPICG"
FT                   /protein_id="XP_847191.1"
FT   gene            complement(<1082670..>1084010)
FT                   /note="synonym: Tb08.10J17.830; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659362"
FT                   /locus_tag="Tb927.8.3610"
FT   mRNA            complement(<1082670..>1084010)
FT                   /db_xref="GI:72392782"
FT                   /db_xref="GeneID:3659362"
FT                   /locus_tag="Tb927.8.3610"
FT                   /transcript_id="XM_842099.1"
FT   CDS_pept        complement(1082670..1084010)
FT                   /locus_tag="Tb927.8.3610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392783"
FT                   /db_xref="GeneID:3659362"
FT                   /translation="MSWRALSSISTDVTERAAAVEWVHREKALDNMARNRLAARYGSNE
FT                   STNKRNEKECNGKRSCKCLTNGCGWTCNSCGKVSYDARLICGYCLAVSPSVMASVGASV
FT                   DKKNVSGTSGMHVVPVHNCRDDGISHDSSIRVVRFPQNRCYRIFATEGHARGNESASAE
FT                   VVDSAPDSREVVGEGSASKRKYAVETHESGEKNVGSTFGGRVGKHFYKKPYTHFIALPI
FT                   GKVKVFGERAEALLWEMKQCCVDPANGVTEEIFTSAPRTHLTLLMLSLPTCEDVALAVE
FT                   CMQVLQDQIYGWKQQQHLHKGKAGPDDSVGIPIRLGGLHVMTSRGQHVQKANVLYMGLA
FT                   DEESTATVRALQDIVHSSFGELICDDPRVSESKLLHVTLMNTKWRTGEGKQQSGGKNLP
FT                   FNASEVLRRFANVSLCESPVFIDKVELCALGYDSVNECYPCEAVVYL"
FT                   /protein_id="XP_847192.1"
FT   repeat_region   1085281..1085303
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1085281..1085303)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<1085476..>1087374)
FT                   /note="synonym: Tb08.10J17.820; folate transporter,
FT                   putative"
FT                   /db_xref="GeneID:3659363"
FT                   /locus_tag="Tb927.8.3620"
FT   mRNA            complement(<1085476..>1087374)
FT                   /db_xref="GI:72392784"
FT                   /db_xref="GeneID:3659363"
FT                   /locus_tag="Tb927.8.3620"
FT                   /transcript_id="XM_842100.1"
FT   CDS_pept        complement(1085476..1087374)
FT                   /locus_tag="Tb927.8.3620"
FT                   /gene_family="HOG000255245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="folate transporter, putative"
FT                   /note="Tandemly repeated. This gene is not in a VSG
FT                   expression site but its gene product is   similar to
FT                   GP:311494: expression site associated gene {Trypanosoma
FT                   brucei}.; Tandemly repeated. This gene is not in a VSG
FT                   expression site but its gene product is  93% similar to
FT                   GP:311494: expression site associated gene {Trypanosoma
FT                   brucei}; go_component: integral to membrane [goid 0016021];
FT                   go_function: biopterin transporter activity [goid 0015224];
FT                   go_process: biopterin transport [goid 0015877]"
FT                   /db_xref="GI:72392785"
FT                   /db_xref="GeneID:3659363"
FT                   /translation="MTTSPNACQDQPPQHSAPQAHEAECTTHKLSAEETMDARPVHPDA
FT                   RALFRKLPCVWSIPVLGTAVEAFGPKFVFALGFCELFGKGIADNIIRSSLFPMFTYTFG
FT                   ADAKLYQLMGGMSSLGYAVKPFAAMFSDLFALFGYTKRWYLALSCVVGSTLAIVYGSLP
FT                   GELSYVPVAGFLVFVITFTVANLDILTQGHYSRLIRRVPLAGPSLVSWVWWCLLVGSLV
FT                   ASSIVGPLTDKRLQRVAVFISAGMQLVPTIFFILNWYGERKNREERAYDLKIIREKKLE
FT                   HEADAVRLQGSEATSGSLDNPSDTEEVGEGGARILPCCCGAFEVNREVFARNKKVVFYC
FT                   MLLTLGAIGMVLVTVLGTRLQLLITSVVASFTLCGLGFVALPLVIAKANMFTFISRVTY
FT                   IQLRGAMDNVFMATPDCFPGGPNFSYFYYNTVGNVIGTMGGVIGVTLFRYVFSKRSYRL
FT                   TFIVTTLIEIVSSIFDIIIVERWNRPYVSDHVVFVLGDQIIQQVCYMMHFMPTVMLISR
FT                   LCPRGSESMVYAVLAGCAHFGRSVSNTLGWLLMEYVWNVQSDITVGPCDFSNVKWLLLL
FT                   GHFGTPLISIPLVFLLIPAARICDVLDENGKAITKKAEDVHAPSNDSPRRREPTAN"
FT                   /protein_id="XP_847193.1"
FT   gene            complement(<1088840..>1090738)
FT                   /note="synonym: Tb08.10J17.810; folate transporter,
FT                   putative"
FT                   /db_xref="GeneID:3659366"
FT                   /locus_tag="Tb927.8.3630"
FT   mRNA            complement(<1088840..>1090738)
FT                   /db_xref="GI:72392786"
FT                   /db_xref="GeneID:3659366"
FT                   /locus_tag="Tb927.8.3630"
FT                   /transcript_id="XM_842101.1"
FT   CDS_pept        complement(1088840..1090738)
FT                   /locus_tag="Tb927.8.3630"
FT                   /gene_family="HOG000255245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="folate transporter, putative"
FT                   /note="Tandemly repeated. This gene is not in a VSG
FT                   expression site but its gene product is   similar to
FT                   GP:311494: expression site associated gene {Trypanosoma
FT                   brucei}.; Tandemly repeated. This gene is not in a VSG
FT                   expression site but its gene product is  94% similar to
FT                   GP:311494: expression site associated gene {Trypanosoma
FT                   brucei}; go_component: integral to membrane [goid 0016021];
FT                   go_function: biopterin transporter activity [goid 0015224];
FT                   go_process: biopterin transport [goid 0015877]"
FT                   /db_xref="GI:72392787"
FT                   /db_xref="GeneID:3659366"
FT                   /translation="MTTSPNACQDQPPQHSAPQAHEAECTTHKLSAEETMDARPVHPDA
FT                   RALFRKLPCVWSIPVFGTAVEAFGPRCVLALGLSELFGKGIADNIIRTTLFPMFTYTFG
FT                   ADAKLYQRMSSLVTFGYAVKPFAAMFSDLFALFGYTKRWYLALSCVVGSTLAIVYGSLP
FT                   GELSYVPVAGILVFVTSFTKANLDILTQGHYSRLIRRVPLAGPSLVSWVWWCVLTGSLV
FT                   ASSIVGPLTDKRLQRVAVFISAGMQLVPTIFFMLNWYGERKNREERAYDLKIIREEQLE
FT                   READAARLQGSEATSGSLDNPSDTEEVGEGGARILPCCCGAFEVNREVFARNKKVVFYC
FT                   MLLTLGAIGMVLVTVLGTRLQLLITSVVASFTLCGLGFVALPLVIAKANMFTFISRVAY
FT                   IQLPGAIDNVFMATPDCFPGGPNFSYFYYSTVGNMIGAVGGVIGVTLFRYVFSKRSYRL
FT                   TFIVTTLIEIVSSIFDIIIVERWNRPYVSDHVVFVLGDQIIHQVCYMMHFMPTVMLISR
FT                   LCPRGSESMVYALLAGFANFGRSLSNTLGWLLMEYVWNVQSDITVGPCDFSNVKWLLLL
FT                   GHFGTPLINIPLVFLLIPAARICDVLDENGKAITKKAEDVHAPSNDSPRRREPTAN"
FT                   /protein_id="XP_847194.1"
FT   gene            complement(<1091084..>1092190)
FT                   /note="synonym: Tb08.10J17.800; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659365"
FT                   /locus_tag="Tb927.8.3640"
FT   mRNA            complement(<1091084..>1092190)
FT                   /db_xref="GI:72392788"
FT                   /db_xref="GeneID:3659365"
FT                   /locus_tag="Tb927.8.3640"
FT                   /transcript_id="XM_842102.1"
FT   CDS_pept        complement(1091084..1092190)
FT                   /locus_tag="Tb927.8.3640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392789"
FT                   /db_xref="GeneID:3659365"
FT                   /translation="MMAARRGELCAVSTYVHVHPQVVLSITKHAARVRRGMREVDGVRL
FT                   SRRYAAGILLGSVSDVYECEVTTSFEAVDSCSSQSGAVSALDWPAMKRKREQVANVLPG
FT                   LHVVGWYAVGCNLSDAARWCAVFDTGIREIIEDHPSTVLLALIVDTSESVGFASSRMYA
FT                   LKVRQFHLTDSQCQDAPTTTPESTTRFLGGVSPLIPIGALNYGNHVTIRLPQKPQLAVE
FT                   LVRVRHVCETDDITRVGLDASSAGICAVPTGSVDVSGNSTAWERLLRVQRSLRLLRRQV
FT                   LVVIKYLTASQQGSCIPIDSEVLRHVGKICDVLPSIASPVAPPTRCEDNSVTHNLRESC
FT                   ALMLTLLSLHTKCATALRVMAKRDRRIV"
FT                   /protein_id="XP_847195.1"
FT   repeat_region   1093025..1093052
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1093025..1093052)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<1093216..>1095114)
FT                   /note="synonym: Tb08.10J17.790; folate transporter,
FT                   putative"
FT                   /db_xref="GeneID:3659369"
FT                   /locus_tag="Tb927.8.3650"
FT   mRNA            complement(<1093216..>1095114)
FT                   /db_xref="GI:72392790"
FT                   /db_xref="GeneID:3659369"
FT                   /locus_tag="Tb927.8.3650"
FT                   /transcript_id="XM_842103.1"
FT   CDS_pept        complement(1093216..1095114)
FT                   /locus_tag="Tb927.8.3650"
FT                   /gene_family="HOG000255245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="folate transporter, putative"
FT                   /note="Tandemly repeated. This gene is not in a VSG
FT                   expression site but its gene product is   similar to
FT                   GP:311494: expression site associated gene {Trypanosoma
FT                   brucei}.; Tandemly repeated. This gene is not in a VSG
FT                   expression site but its gene product is  94% similar to
FT                   GP:311494: expression site associated gene {Trypanosoma
FT                   brucei}; go_component: integral to membrane [goid 0016021];
FT                   go_function: biopterin transporter activity [goid 0015224];
FT                   go_process: biopterin transport [goid 0015877]"
FT                   /db_xref="GI:72392791"
FT                   /db_xref="GeneID:3659369"
FT                   /translation="MTTSPNACQDQPPQHSAPQAHEAECTTHKLSAEETMDARPVHPDA
FT                   RALFRKLPCVWSIPVFGTAVEAFGPKFVFALGFCELFGKGIADNIIRSSLFPMFTYTFG
FT                   ADAKLYQRMSSLVTFGYAVKPFAAMFSDLFALFGYTRRWYLALSCVVGSTLAIVYGSLP
FT                   GELSYVPVAGILVFVTSFTKANLDILTQGHYSRLIRRVPLAGPSLVSWVWWCLLVGSLV
FT                   ASSIVGPLTDKRLQRVAVFISAGMQLVPTIFFMLNWYGERKNREERAYDLKIIREKKLE
FT                   HEADAVRLQGSEATSGSLDNPSDTEEVGEGGARILPCCCGAFEVNREVFARNKKVVFYC
FT                   MLLTLGAIGMVLVTVLGTRLQLLITSVVASFTLCGLGFVALPLVIAKANMFTFISRVAY
FT                   IQLPGAIDNVFMATPDCFPGGPNFSYFYYSTVGNMIGAVGGVIGVTLFRYVFSKRSYRL
FT                   TFIVTTLIEIVSSIFDIIIVERWNRPYVSDHVVFVLGDQIIHQVCYMMHFMPTVMLISR
FT                   LCPRGSESMVYALLAGFANFGRSLSNTLGWLLMEYVWNVQSDITVGPCDFSNVKWLLLL
FT                   GHFGTPLINIPLVFLLIPAARICDVLDENGKAITKKAEDVHAPSNDSPRRREPTAN"
FT                   /protein_id="XP_847196.1"
FT   gene            complement(<1096057..>1098966)
FT                   /note="synonym: Tb08.10J17.780; protein transport protein
FT                   Sec23, putative"
FT                   /db_xref="GeneID:3659370"
FT                   /locus_tag="Tb927.8.3660"
FT   mRNA            complement(<1096057..>1098966)
FT                   /db_xref="GI:72392792"
FT                   /db_xref="GeneID:3659370"
FT                   /locus_tag="Tb927.8.3660"
FT                   /transcript_id="XM_842104.1"
FT   CDS_pept        complement(1096057..1098966)
FT                   /locus_tag="Tb927.8.3660"
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein transport protein Sec23, putative"
FT                   /note="go_component: COPII vesicle coat [goid 0030127];
FT                   go_function: GTPase activator activity [goid 0005096];
FT                   go_function: protein binding [goid 0005515]; go_process: ER
FT                   to Golgi transport [goid 0006888]"
FT                   /db_xref="GI:72392793"
FT                   /db_xref="GeneID:3659370"
FT                   /translation="MQGHVPQQSYGGYPRQADYQGLYPTQDVKQGYVSYQDPATLMEGH
FT                   NAQYGGGTAEGTYSNQYTQLQQQMNNYNYNANQTPWQQQYAPQQGIHNPANTNDTNMFA
FT                   PPTAVGAAAASHVGGAVAPTGSGASATTASHVPPPPPAAECTDENGLRWTWSTYPNHTR
FT                   DGKQEAPSAAALTLPEMVIPLACMYTPLFPIDASRMVIGDPTACGQQCQNCGAFWSHHC
FT                   YREEGKFWVCFSCQRRNQLPPHYRPEHPALHNDTVEYILPLEQPTTAQATRGVGFSPTF
FT                   VFIIDTCIAVEELEALKCNIQRCLNWLPPQSLIGLVSFGARVSVWDLSGSSLSRCYSIR
FT                   GDRAYTTAELGNMLQLNDGLPARGRFLVPLEECEFTLTTSIEGLQCHDGVTPVNKRPLR
FT                   ATGTAVSAAVRLLEALPEVPVKKEMSGAAPAGVAPVRKAGRVLLFTGGPCTRGPGTVVS
FT                   IEKESMMRFHRDIIEGETPYYEAAFKFYNEIQLRLLDVNASLSVFAESFDQIGILEMRQ
FT                   AVDQTGGTFICGDTFDHQMFTISLQRYFDLCDLRPPGVESSGISSAGDIDGSAPGALVA
FT                   NSGFGVKLHVHTSADTLVSGVLGPCVAAEKTSGTKAHRASISPIEIGVGGTTDWRVSTI
FT                   DQGTTYTVVFDTATLNKVDGMPQQQQNRFIQFVTHFTTPLGESRIRVTSVALPIAPVTI
FT                   TADGVSTANPQYFSEYDTFDQTCAATVLARMTVSILEKHPSKWNDAKRWLDTVLVRFVR
FT                   RYGSFTPGSPESLRLRPCFTLFPSFVFNLRRSEYFMVLNISPDESTFKRHWLMRESVDN
FT                   CVLMIQPTLHSYDMETPTATAVPLDSCSLRPDNILLMDAFFNIHIMWGTVIFAWIQARY
FT                   QDNPEYAHFAQLLETVENEATMLLDMRYPYPRFSRTDANGSEARHIKTRMNPTTTHHSG
FT                   ARGGNGVSDLSDVIYTDDASIVKFMESLKQAVVTPESKK"
FT                   /protein_id="XP_847197.1"
FT   gene            complement(<1099837..>1100325)
FT                   /note="synonym: Tb08.10J17.760; hypothetical protein"
FT                   /db_xref="GeneID:3659368"
FT                   /locus_tag="Tb927.8.3670"
FT   mRNA            complement(<1099837..>1100325)
FT                   /db_xref="GI:72392794"
FT                   /db_xref="GeneID:3659368"
FT                   /locus_tag="Tb927.8.3670"
FT                   /transcript_id="XM_842105.1"
FT   CDS_pept        complement(1099837..1100325)
FT                   /locus_tag="Tb927.8.3670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392795"
FT                   /db_xref="GeneID:3659368"
FT                   /translation="MLVLFPVFLLLFRTFSCVSYLPSIFSCFQFPLALRRAPSSSPLSF
FT                   SPFPPSLTLCPCSHFRQKMHLFVHVCVLKTLCTGPMFLFFFPPPFCLLYFALLSLVREG
FT                   RCRYHFHTQRQDGEGKGKRNKIASAGNERSRCSCRWCLMLLYYFSAPPSCAVPLAHEN"
FT                   /protein_id="XP_847198.1"
FT   gene            complement(<1100892..>1102829)
FT                   /note="synonym: Tb08.10J17.750; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659364"
FT                   /locus_tag="Tb927.8.3680"
FT   mRNA            complement(<1100892..>1102829)
FT                   /db_xref="GI:72392796"
FT                   /db_xref="GeneID:3659364"
FT                   /locus_tag="Tb927.8.3680"
FT                   /transcript_id="XM_842106.1"
FT   CDS_pept        complement(1100892..1102829)
FT                   /locus_tag="Tb927.8.3680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392797"
FT                   /db_xref="GeneID:3659364"
FT                   /translation="MGDNPLSVLQQLASNPQLITQMQGILALLSPGHGDGATGARPGGV
FT                   GLEQIAALCPQPRTLQNTATTDMGAASSLMAGGLNVEPPRQQTRWPSPVATASESSNLQ
FT                   SRGDSKSDVGKYGVVSVERYERLMARYKELEKQSHRRQGKRSEPVVDTQRVLDLEEEVA
FT                   RLKRTIGHLQGVVEEKESALEKHATQHNLEVHEMKKNYELKIKSLTQTHEAAVRKLVSA
FT                   QELVTAARNYQTAVCANNVGGGNSVSTTSGQPLSNTVNHTRGLTTTSSGSGPNQPYTLP
FT                   HPDGNAWMSATTSDDRSAPVTTKNSHSVKREREGTVSTTPTRPLKKRNPRTPSYTVADR
FT                   ISETDEYVKKGSPVVKKELNSPTAEAQQTCLDGMGYQPAVGSNILRAQTSYTSAACTLV
FT                   EAVSNSRQQFQQQRSESVQMQPRSGAVALRQRTGGLSPVASSSGSALMATPSSRGLRRP
FT                   FRPVSGASSAVGGSTRSPSPVDPKRGAVQPRYFITTSLTEKERNSVMEAIQKLGQRAVL
FT                   VDNKVDEILPLNTTHIVLRGPPRSVKALCGVVSSKWLVQPSYVFDSLGAGFWLDEEVEG
FT                   GLRYFPPPLRCQRFLLTMPEGVVKTMLQRVVEFGGGEVVGTKRNGSSNDQDVVVVSSGD
FT                   ELLRFAISRD"
FT                   /protein_id="XP_847199.1"
FT   repeat_region   1103239..1103264
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1103239..1103264)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1103909..1103956
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1103909..1103956)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   1104820..1104850
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cata"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1104820..1104850)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatg"
FT                   /rpt_type="tandem"
FT   gene            complement(<1104950..>1106263)
FT                   /note="synonym: Tb08.10J17.710; isocitrate dehydrogenase
FT                   [NADP], mitochondrial precursor, putative"
FT                   /db_xref="GeneID:3659371"
FT                   /locus_tag="Tb927.8.3690"
FT   mRNA            complement(<1104950..>1106263)
FT                   /db_xref="GI:72392798"
FT                   /db_xref="GeneID:3659371"
FT                   /locus_tag="Tb927.8.3690"
FT                   /transcript_id="XM_842107.1"
FT   CDS_pept        complement(1104950..1106263)
FT                   /locus_tag="Tb927.8.3690"
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isocitrate dehydrogenase [NADP], mitochondrial
FT                   precursor, putative"
FT                   /EC_number="1.1.1.42"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: isocitrate dehydrogenase (NADP+) activity
FT                   [goid 0004450]; go_process: tricarboxylic acid cycle [goid
FT                   0006099]; go_process: isocitrate metabolism [goid 0006102]"
FT                   /db_xref="GI:72392799"
FT                   /db_xref="GeneID:3659371"
FT                   /translation="MFRRVACAASSVNAGALTPRFVSTTRPSLGRIKVSGTVVDMDGDE
FT                   MTRIIWALIKEKLILPHVDVPIEYYDLSITSRDASNDKVTEQAAEAIQRHNVGIKCATI
FT                   TPDEARVKEFNLKKMWKSPNGTIRNILGGTVFREPIIVKNVPRVVPQWSEPIIVGRHAY
FT                   GDQYKATESLFPPGRLELVHTPANGGSPQVLEVFNFKGEGVGLAMYNTRESVEAFAESC
FT                   FEYAIMRRYPLVLSTKNTILKKYDGLFLETFQRMYDTKYREQFERLNLTYVHRLIDDQV
FT                   AQMIKGNGGFVWACKNYDGDVQSDIVAQGFGSLGLMTSVLLCPDGKTIESEAAHGTVTR
FT                   HYREHQKGKETSTNSVASIFAWTRGLAHRGKLDGNAPLVEFASSLERATIKTIEGGHMT
FT                   KDLALCVHGAAALQRSHYETTEVFIDSVAEELARSVKG"
FT                   /protein_id="XP_847200.1"
FT   repeat_region   1106624..1106644
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1106624..1106644)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(<1107346..>1111806)
FT                   /note="synonym: Tb08.10J17.680; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659372"
FT                   /locus_tag="Tb927.8.3700"
FT   mRNA            complement(<1107346..>1111806)
FT                   /db_xref="GI:72392800"
FT                   /db_xref="GeneID:3659372"
FT                   /locus_tag="Tb927.8.3700"
FT                   /transcript_id="XM_842108.1"
FT   CDS_pept        complement(1107346..1111806)
FT                   /locus_tag="Tb927.8.3700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392801"
FT                   /db_xref="GeneID:3659372"
FT                   /translation="MSESVGTDEHVCLEYIQQLCKRVEDTGRIANQVSKGYEHSLMGTL
FT                   DGEVLLYGISDSDERIMQVDALVNARRKLTRRSTATCVVLSGNVLTLAIMSSHLAMHRW
FT                   RVLEAQTSFEASEALRQEALEAERILREAQHSAASVKPQTKSQKVSSEEGNITSKDTTF
FT                   AFSRDIDSDVCELSTDNTGETSKSTSNIETASASLSSEVIPYLVIIDAYTHEVLPDIIC
FT                   QLRSLESQFNMMLTITVMMHAGYQSRLPGMVVFPKHAPTLKEVYNAGCDLALCRCFDHK
FT                   VVAFFTEMFTSAVGRWQADMGQQLSGGNYAIMKTAFGSTLDQYDDEEPSDDFLMLDKRQ
FT                   QGSRIGCTSPRGRADGAATLRSPLRGCKVAFNESVCSSRMGGCRKRPGIPKDFVGSVMR
FT                   PALRSKRLDKTASHAKPKRLESSFGDTIRTFSSVWDDDEVYEDTLLDETEELESAAIAA
FT                   YQRELSELLTKQEEYEQTLTALTEENERLHAAQELVRSPWECSSSASSDQGNSPDTPNY
FT                   LKKEQQIHMLKERLMEVAREHGGTHGVMFDRPRPRRKLGKKSPNGKQGALSKSRLRKPT
FT                   LAMTSPNRRRLNHVQLLESALMSYHDVPAAEDDADDFLLESATESATSQFDALGAAKAD
FT                   ALQSEISAIETLLQGARNNGESLCNEKYEALLKSTSKVSWGVGQLSDKCARLQRELHRA
FT                   RESVLEKSFVDRRGEKDVGGASTKGVPEGKKALSRKSSFASGGLCGTRGSEPLHRSRTS
FT                   SAAHGLGERRKSWAEAPKRIAMSARSRPTHFAESSSAAKGDKQIMPLRRVNSIRFREHD
FT                   SEAQSTHQTGFRVPSNLKLAESGQLTLSDGLTSPCEGKGQSMTSGTVNSGDWSRPVSQS
FT                   GSRLQRPCSKGSLVVDGTSLSGLGRISPSWQVSIASLRGSGASERSKRLSPIGPGTLHA
FT                   GDANGSQDFGTRLPTPAEHLWQRQQRHSQREHVFADDRPFCGTGSTTDSGGDQSCANYL
FT                   SHHEALGDFLRALCCCYPALQPMLQSEVAALESLARHGSAGSVEAGQESRVAGHEGQPA
FT                   MALDTKLLLRLSERLLSSMSGLADNNAGSPLTNTMYRATGGAVGNDTRGRGLFSAKSTG
FT                   IDLYEGAVSEGPVARLGRNLRDRVTLPPLHRLPSCGGDRSEIPFSGGCGQQLNDGEAPG
FT                   SALKEKLQALVGAESASFDRSSLFKPRQSVQNVAHLSDTESTAPVSPPPWGQSVSSKKS
FT                   SVRYGRNLQPFRWTQRQGHTEPGEGLDDGQGPTGDDYTGAPGTAVAESLVNIYRNFWRF
FT                   SMHCENLRKELFDINCEGMPREWRDGCISSPQFILSGSGHGLKDDRSLHGRSLFALPVA
FT                   SANLRRRNRSPRRPNALRRLSRAWNFGEFCARTRSALMRYSLLVEHLNTTSSPRGGGVQ
FT                   DGRVGLCRRAGSLTPRRHVGTRRGTGTTGCPTLRTNKNLNSSPLVIVGKNPPSLPTGRS
FT                   PSITPRTPPHGGMRQGGDKEKMSPR"
FT                   /protein_id="XP_847201.1"
FT   repeat_region   complement(1111827..1111866)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1111827..1111866
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<1112356..>1114725)
FT                   /note="synonym: Tb08.10J17.670; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659373"
FT                   /locus_tag="Tb927.8.3710"
FT   mRNA            complement(<1112356..>1114725)
FT                   /db_xref="GI:72392802"
FT                   /db_xref="GeneID:3659373"
FT                   /locus_tag="Tb927.8.3710"
FT                   /transcript_id="XM_842109.1"
FT   CDS_pept        complement(1112356..1114725)
FT                   /locus_tag="Tb927.8.3710"
FT                   /gene_family="HOG000255735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_function: exonuclease activity [goid 0004527]"
FT                   /db_xref="GI:72392803"
FT                   /db_xref="GeneID:3659373"
FT                   /translation="MGRRKCSASTVKRPGGPDATTGSNEGAREAPVEGVMNAAGEPNTS
FT                   EAQPLQSQEGEKDGEKGVAAAITEHFSTVEIYFQPAAEKRRGGCFYPRDIGTLLLWSVP
FT                   SPVPLVEGPRVIFVKNRSKLRDVVVLYVNGWTHDEMLLGATAAPAIQNTANGAQGNKSS
FT                   LKGKNGKRPREGNDEKGATQRNTVERQCSESIGRAMLCPIRQQQCWARPECGVQFAPMI
FT                   VQEGNSRVERDIFWRGGKPATPVGGQHSQEGEQQSNGARAAATKGENRSSGTDSSAPRG
FT                   VGALFNRALTIANGTSNTSSAQSDDKLPTPLESLKVLSSPPGGGPSLWDDRDLLLKYAL
FT                   SLERDKATLEALGFAVGVPDHDEPSTWESFDAVGSAADANCADKTKNSLPNVFALDCEM
FT                   VLVKNNVSALARVTLVDVRASSVVVDTLVKPDEEVVDYVTRFSGIDSGMLEGVTTTLKD
FT                   CQQKLKRYVTKDAFLVGHSLENDLRACKMLPNCWLLDTAHLFPHPSGLPCKNSLRYLAL
FT                   RYLKKSIQQGSHDSEIDACTSAELVYLKMQHGPDFGLHTRVNVLKLMEEVSVTGEASDE
FT                   RQGGPPTVNSPISVELNLFDDACVLSDIVPNNRGKGGVAVNAVPVRHDGDAVRKAVRCL
FT                   EKRRNAPKDAGDDVAVSYALTWVQLTQTVVPKNAEVANEETPSWEELQRERVDETNRHV
FT                   MQVVQAAPHNSLIVVVVAGSSNDTNKSKKCGEDAASAPAGGAAPRGACFAFVKDDNAVG
FT                   PLAAWLNKGLTDNGDGAKDETNASDGLRSIPACEQQ"
FT                   /protein_id="XP_847202.1"
FT   gene            complement(<1115380..>1116474)
FT                   /note="synonym: Tb08.10J17.650; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659367"
FT                   /locus_tag="Tb927.8.3720"
FT   mRNA            complement(<1115380..>1116474)
FT                   /db_xref="GI:72392804"
FT                   /db_xref="GeneID:3659367"
FT                   /locus_tag="Tb927.8.3720"
FT                   /transcript_id="XM_842110.1"
FT   CDS_pept        complement(1115380..1116474)
FT                   /locus_tag="Tb927.8.3720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392805"
FT                   /db_xref="GeneID:3659367"
FT                   /translation="MKACCGGKRLQICFVVQAICMVCLVGFVFSPPRPYAQPTCDCHYG
FT                   VVERENPRCQCVCFGDYLLPNCLYTAIDVVDVELWLTTKSGKKRGNTYPLSSGDIERGL
FT                   DRLFGHKNSSGLFKFRRGTSSFSSEGLVNSSIRSGKFYVAAVVSMPGWAAQHLLAYVAQ
FT                   KAGKGGEMTNSASGVSYTLYAAYDMAKGPPLPVMYYYESMAFFTGIDSNIFITAADCGW
FT                   MFGAIVLVLLMTRIEQLWMYSIVAGLGAISRRRRGDEKGSLFLNEDAAGSSNVSRHDSL
FT                   RRSSSKGSSSMKSSSKDKKKNKKADKEKKRNNSKRSRASGKRAASKSERRAPDSEAPQL
FT                   GERRSKSPAGENPGGAQWRNPLTI"
FT                   /protein_id="XP_847203.1"
FT   repeat_region   1116897..1116932
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1116897..1116932)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    1117275..1117315
FT                   /note="AT_rich"
FT   misc_feature    complement(1117275..1117315)
FT                   /note="AT_rich"
FT   gene            complement(<1117903..>1118289)
FT                   /note="synonym: Tb08.10J17.630; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659375"
FT                   /locus_tag="Tb927.8.3730"
FT   mRNA            complement(<1117903..>1118289)
FT                   /db_xref="GI:72392806"
FT                   /db_xref="GeneID:3659375"
FT                   /locus_tag="Tb927.8.3730"
FT                   /transcript_id="XM_842111.1"
FT   CDS_pept        complement(1117903..1118289)
FT                   /locus_tag="Tb927.8.3730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392807"
FT                   /db_xref="GeneID:3659375"
FT                   /translation="MSDLQPMSGKNSFQLALMIMGIVGAAASGTMTLYKVMWYTVENID
FT                   AARVFIARLYVTFFAVIMPSAELGMMEHNEMVKFLLSYVGRAFLYLFMGGLLLGEEVAS
FT                   CIIGVFMIVLSIMNIVGQVIANKS"
FT                   /protein_id="XP_847204.1"
FT   misc_feature    1118358..1118407
FT                   /note="T-rich"
FT   misc_feature    complement(1118358..1118407)
FT                   /note="A-rich"
FT   repeat_region   1118468..1118501
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1118468..1118501)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1118510..1118533
FT                   /note="AT_rich"
FT   misc_feature    complement(1118510..1118533)
FT                   /note="AT_rich"
FT   gene            complement(<1118881..>1119690)
FT                   /note="synonym: Tb08.10J17.620; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659377"
FT                   /locus_tag="Tb927.8.3740"
FT   mRNA            complement(<1118881..>1119690)
FT                   /db_xref="GI:72392808"
FT                   /db_xref="GeneID:3659377"
FT                   /locus_tag="Tb927.8.3740"
FT                   /transcript_id="XM_842112.1"
FT   CDS_pept        complement(1118881..1119690)
FT                   /locus_tag="Tb927.8.3740"
FT                   /gene_family="HOG000255733" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392809"
FT                   /db_xref="GeneID:3659377"
FT                   /translation="MNVLTSHTHLHMRRSCCMATARGCLGNIRTSDVSTRRCKGDYGFN
FT                   IFHNSNPQHGASYARHERRMREDEVEDFLKSVKGWVPVDECFPCVDADADAEGADARKE
FT                   EKEEMGPAPLTIFTGEGALKRDFDFANFRDAYLFMGRLWAFCYGSDKYPNVTWEGTRIT
FT                   VYIYSPSFRGLSKREARLAAFLNDQYNMFKKSKRQQKVIIDGVVKRSVIEDMMGECVAE
FT                   ALKRREEERQKPLAETVEGIATSWEAVLSKDGNNNNNDGTPSSCTSP"
FT                   /protein_id="XP_847205.1"
FT   repeat_region   1119835..1119857
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1119835..1119857)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<1120813..>1122264)
FT                   /note="synonym: Tb08.10J17.600; nucleolar protein,
FT                   putative"
FT                   /db_xref="GeneID:3659374"
FT                   /locus_tag="Tb927.8.3750"
FT   mRNA            complement(<1120813..>1122264)
FT                   /db_xref="GI:72392810"
FT                   /db_xref="GeneID:3659374"
FT                   /locus_tag="Tb927.8.3750"
FT                   /transcript_id="XM_842113.1"
FT   CDS_pept        complement(1120813..1122264)
FT                   /locus_tag="Tb927.8.3750"
FT                   /gene_family="HOG000196309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleolar protein, putative"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   snoRNA binding [goid 0030515]; go_process: nuclear mRNA
FT                   splicing, via spliceosome [goid 0000398]"
FT                   /db_xref="GI:72392811"
FT                   /db_xref="GeneID:3659374"
FT                   /translation="MSKTLYLLYEGPTGYALFKVLTTEEIGAGDVALQKDLQTFATFSP
FT                   WVKLLSFAPYQSPENALEDAVCINESIVSPFLNNFLTSVLSKKATKGEANWELGVSDPK
FT                   LGSAIHDELKFAVLCNENVVEMCRCLRLHAEKLLPEHQEKDILRAQCGLGHAFSRNKVK
FT                   FNVHRSDNMIIQSSALTEHMDKGVNLLGMRVKEWYGWHFPELAKEVPEPLKYSKVALLI
FT                   GSRSTLEERDTEEVTQQIAEILEGDEALAARVYEKAVTSMGGDMAEVDWSNIRRFMKRV
FT                   VSLGDYRESLQQYLVDKMMLVAPNLTELMGQNIGAKLISKAGSLTNLAKSPASTIQILG
FT                   AEKALFRALKKRKGNTPKYGLIFHSTFIQRAAKEHRGKISRYLANKAALACRIDCFMDA
FT                   PPQVFGEKLREQVEARLNFFDTGNKPPSNRVAMEEALEQYKKIIRRRAKKQRTAQSAEA
FT                   EGEREEVSETPKQKRSRREVPQESA"
FT                   /protein_id="XP_847206.1"
FT   misc_feature    1122277..1122369
FT                   /note="T-rich"
FT   misc_feature    complement(1122277..1122369)
FT                   /note="A-rich"
FT   gene            complement(<1122396..>1122890)
FT                   /note="synonym: Tb08.10J17.590; hypothetical protein"
FT                   /db_xref="GeneID:3659380"
FT                   /locus_tag="Tb927.8.3760"
FT   mRNA            complement(<1122396..>1122890)
FT                   /db_xref="GI:72392812"
FT                   /db_xref="GeneID:3659380"
FT                   /locus_tag="Tb927.8.3760"
FT                   /transcript_id="XM_842114.1"
FT   CDS_pept        complement(1122396..1122890)
FT                   /locus_tag="Tb927.8.3760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:72392813"
FT                   /db_xref="GeneID:3659380"
FT                   /translation="MRYHIFRGPCVRCFVVLFCFLTNIIMSGLFIPSPPPPPPLLLLLP
FT                   SKFFNICLVFCDCAVKIRKSLQWQGMGVCGVPFMIEKEKKRIKEEEKEWIMSYDIFSTC
FT                   TYSFAYFFIYLNSHSHILPFCVFFFWPCIRLVGCASLPLLHCTFPLVLQLWLVEPYDTK
FT                   Q"
FT                   /protein_id="XP_847207.1"
FT   repeat_region   1122547..1122579
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1122547..1122579)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   misc_feature    1123555..1123600
FT                   /note="A-rich"
FT   misc_feature    complement(1123555..1123600)
FT                   /note="T-rich"
FT   repeat_region   1123980..1124000
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1123980..1124000)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1124038..1124058
FT                   /note="AT_rich"
FT   misc_feature    complement(1124038..1124058)
FT                   /note="AT_rich"
FT   misc_feature    1124257..1124338
FT                   /note="T-rich"
FT   misc_feature    complement(1124257..1124338)
FT                   /note="A-rich"
FT   gene            complement(<1124408..>1125637)
FT                   /note="synonym: Tb08.10J17.560; mitogen-activated protein
FT                   kinase, putative"
FT                   /db_xref="GeneID:3659376"
FT                   /locus_tag="Tb927.8.3770"
FT   mRNA            complement(<1124408..>1125637)
FT                   /db_xref="GI:72392814"
FT                   /db_xref="GeneID:3659376"
FT                   /locus_tag="Tb927.8.3770"
FT                   /transcript_id="XM_842115.1"
FT   CDS_pept        complement(1124408..1125637)
FT                   /locus_tag="Tb927.8.3770"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitogen-activated protein kinase, putative"
FT                   /EC_number="2.7.1.-"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:72392815"
FT                   /db_xref="GeneID:3659376"
FT                   /translation="MGSKGEELMQELIVELREMNSRYTVHRFLSSGSYGAVFAGVDESD
FT                   LPVAIKRVFNTISEGRTINILSDPFLCKRVLREIMLLNHFHHPNILGLKNMFIHLQPPG
FT                   QHKLYLVTDLMRTDLAQVIHDKRIDISPQHIRFFMYHIILGLHVLHEAGVVHRDLHPGN
FT                   VLVSENNDITICDFNLAREDTQDPNKTHYVTHRWYRAPELVMQFKGFTKLVDMWSAGCV
FT                   MGELFNRRALFRGSTFYNQLDKIVEVVGAPTEEDHLDMFSSSQARNYLRNALSHCKPRP
FT                   WCDVVPTADAEAIDLLSRMLEFNPARRISAEQALQHPYFASLYDPLDLTEACSGPFHFP
FT                   EVSDIFSMHQMFLAEVRGFEARRLKRENIIQQRLALSNGTTNAKEVLGCDHMLRTHSLM
FT                   EVSDLPTSMP"
FT                   /protein_id="XP_847208.1"
FT   gene            complement(<1126727..>1127227)
FT                   /note="synonym: Tb08.10J17.540; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659383"
FT                   /locus_tag="Tb927.8.3780"
FT   mRNA            complement(<1126727..>1127227)
FT                   /db_xref="GI:72392816"
FT                   /db_xref="GeneID:3659383"
FT                   /locus_tag="Tb927.8.3780"
FT                   /transcript_id="XM_842116.1"
FT   CDS_pept        complement(1126727..1127227)
FT                   /locus_tag="Tb927.8.3780"
FT                   /gene_family="HOG000255725" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392817"
FT                   /db_xref="GeneID:3659383"
FT                   /translation="MPPKKKVERKEEQVFVEENGSYVHQREMARYTGGVRRLTDSNFCC
FT                   RHGQGTYSSPLIHYEGNWSEDEMHGNGTLRFLVSGDSYTGQFVHGVMEGCGTYIWASGA
FT                   MYDGGWRGNRMHGLGTYTDVGGKVWSGKFYNGSGPGLTPCVTTGGGVAAADKRDVLKDE
FT                   KEG"
FT                   /protein_id="XP_847209.1"
FT   repeat_region   1127763..1127795
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1127763..1127795)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(<1127842..>1128513)
FT                   /note="synonym: Tb08.10J17.530; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659381"
FT                   /locus_tag="Tb927.8.3790"
FT   mRNA            complement(<1127842..>1128513)
FT                   /db_xref="GI:72392818"
FT                   /db_xref="GeneID:3659381"
FT                   /locus_tag="Tb927.8.3790"
FT                   /transcript_id="XM_842117.1"
FT   CDS_pept        complement(1127842..1128513)
FT                   /locus_tag="Tb927.8.3790"
FT                   /gene_family="HOG000255723" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392819"
FT                   /db_xref="GeneID:3659381"
FT                   /translation="MDAEENFLNAIQQAFDENATTLHFSYQEGTTAVPPEIRALRGTLE
FT                   ILHIDNNYSLGSLPSAIGELGRLRWLNASYCRLTTVPREMGRLSHLERLHLGNNLLQEL
FT                   PMEMWQLKSLQELRVENNQLRVLPGGLLFLPRLEVLLLENNPLLLPEEVNGAAPITIAP
FT                   RLYSVDCSNCCVRMRDHEVLVTVNNKSGHRDIPFVHCVCSDACKQHLQTRLQGYDAANS
FT                   A"
FT                   /protein_id="XP_847210.1"
FT   gene            complement(<1129045..>1130856)
FT                   /note="synonym: Tb08.10J17.520; nucleoside phosphatase,
FT                   putative"
FT                   /db_xref="GeneID:3659384"
FT                   /locus_tag="Tb927.8.3800"
FT   mRNA            complement(<1129045..>1130856)
FT                   /db_xref="GI:72392820"
FT                   /db_xref="GeneID:3659384"
FT                   /locus_tag="Tb927.8.3800"
FT                   /transcript_id="XM_842118.1"
FT   CDS_pept        complement(1129045..1130856)
FT                   /locus_tag="Tb927.8.3800"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside phosphatase, putative"
FT                   /EC_number="3.6.1.-"
FT                   /note="go_component: extracellular region [goid 0005576];
FT                   go_function: nucleoside-diphosphatase activity [goid
FT                   0017110]; go_process: nucleoside metabolism [goid 0009116]"
FT                   /db_xref="GI:72392821"
FT                   /db_xref="GeneID:3659384"
FT                   /translation="MLHSDHPKQSRFLTPFVIFPLFTLLTLVLLYAAGYFIGLSRYHSL
FT                   TRDEHALDADGRDSRCVSQQEMLRNTHKVAAGTLKRLKEDRDELKKKLKLLEEGKGRTG
FT                   EPAASCGGKDATSNNGEGPSVNDGGGNMTGSAAVSLQRAANLIDSLTHQTESWLKKAAD
FT                   TTPSLAACNKSPRRYSVVFDAGSTGSRVHVYRYNLTSNPYDNIDSAPNGAHASLLPYLK
FT                   LEDELFIENHEPLSGFSDPRGAAASLVPLLDAAKARVPTDMHACVGIELKATAGLRRIG
FT                   AEQAGRVLDAVRREFQKGPFWVHSELGSVRILEGREEGPLAWLTVNFLIGSLSGTKETA
FT                   TILDLGGGSTQVVMRPNDPEVLEGHEEFTDTFAINGKSIKLYQHSYEGNGLNAAREQLL
FT                   ASVATSVATGGTTTAAKSGPLRAFPCFPQGYAHEKSGVSNGVGGGGVTPSMEECVALFR
FT                   KHVVRSGGECSSKSCGFNGVFQPDVRTAVSGPVYAFSFYHDLLRPHMTAGTTVIRLQDI
FT                   IGIASQVCKSMKSVEQLRRENKGKVSVHPSLRPELECLHLSYVVALLRDGFHYPLDQEL
FT                   HIAKKIDGYETAWTLGASLVSLEEHCV"
FT                   /protein_id="XP_847211.1"
FT   gene            complement(<1132715..>1133887)
FT                   /note="synonym: Tb08.10J17.490; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659382"
FT                   /locus_tag="Tb927.8.3810"
FT   mRNA            complement(<1132715..>1133887)
FT                   /db_xref="GI:72392822"
FT                   /db_xref="GeneID:3659382"
FT                   /locus_tag="Tb927.8.3810"
FT                   /transcript_id="XM_842119.1"
FT   CDS_pept        complement(1132715..1133887)
FT                   /locus_tag="Tb927.8.3810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392823"
FT                   /db_xref="GeneID:3659382"
FT                   /translation="MRASMNCSGSISPVRNPSLLGTISNSASAVPTSARPSRHLHSSLL
FT                   HTPTRRSAHSSMTGTSVETGAPILLSLLDIHTLPLSGRRGERRNNCGSGRQTGGTRSDE
FT                   ETSSLVDFEHMTAEAEAAALTMSRAELCDAVLDLRTRIRKLRSTIIREREDVAKLHEGM
FT                   RETYKAAEREGESITNQLMRRVDKVRRQKAQLEVRLHREEALKSEQAQKLMDLKASSLS
FT                   LERRLQREEEVTLASMNEQLVRLQSQRQHLDSLLSEHSSLQQMQEFVDRLQTQSTSCGG
FT                   SFRHSLVHSSADAGTGPCVDSSLVTTPDITGSSAVSSVGTHSQLHRRVDSGDHQEILQY
FT                   LRHEVSVVEAIQREAYEQGERYIEKRNELERRIMRAEAERESGRRTFGDP"
FT                   /protein_id="XP_847212.1"
FT   misc_feature    1134513..1134546
FT                   /note="AT_rich"
FT   misc_feature    complement(1134513..1134546)
FT                   /note="AT_rich"
FT   repeat_region   1135132..1135151
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1135132..1135151)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1135240..1135292
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1135240..1135292)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   1135387..1135439
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cattt"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1135387..1135439)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="aaatg"
FT                   /rpt_type="tandem"
FT   misc_feature    1135459..1135481
FT                   /note="AT_rich"
FT   misc_feature    complement(1135459..1135481)
FT                   /note="AT_rich"
FT   misc_feature    1135708..1135748
FT                   /note="AT_rich"
FT   misc_feature    complement(1135708..1135748)
FT                   /note="AT_rich"
FT   misc_feature    1136250..1136272
FT                   /note="AT_rich"
FT   misc_feature    complement(1136250..1136272)
FT                   /note="AT_rich"
FT   repeat_region   1136290..1136309
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1136290..1136309)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1137299..1137330
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1137299..1137330)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1137375..1137397
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1137375..1137397)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<1137477..>1138496)
FT                   /note="synonym: Tb08.10J17.470; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659386"
FT                   /locus_tag="Tb927.8.3820"
FT   mRNA            complement(<1137477..>1138496)
FT                   /db_xref="GI:72392824"
FT                   /db_xref="GeneID:3659386"
FT                   /locus_tag="Tb927.8.3820"
FT                   /transcript_id="XM_842120.1"
FT   CDS_pept        complement(1137477..1138496)
FT                   /locus_tag="Tb927.8.3820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392825"
FT                   /db_xref="GeneID:3659386"
FT                   /translation="MNRSSDAEWNPASFNSPDLSPETEISAARLVEDDVSPSTLPGFGT
FT                   SPFVGSGQPPETADEKAVYMRIINDMEQECGSDDDEEACSANNLLPPSAISGANADNSD
FT                   GKGAGASGIVGGFTVEESHGLSSRGYVPPPVYGSSPQPANSPYSYTTTPHNGHPPPSFA
FT                   VAIATTPPLSGMPVDMSPLGSRFAPQMPAAQHDPILVRNQYGVFMLQPVTKPTPPYTPP
FT                   VAVTTPMTPMTGCALPPATLPPLCTAVQQAGEDLGAATKVPGAYNTPLASGAGVGGSHI
FT                   LSCGVAGVAGTEGVRGGGTYTFMSACMKSPAAPVHVQPPPPYPYEDAVESNYQRNRGK"
FT                   /protein_id="XP_847213.1"
FT   gene            complement(<1139792..>1142029)
FT                   /note="synonym: Tb08.10J17.450; ATP-dependent DEAD/H RNA
FT                   helicase, putative"
FT                   /db_xref="GeneID:3659378"
FT                   /locus_tag="Tb927.8.3830"
FT   mRNA            complement(<1139792..>1142029)
FT                   /db_xref="GI:72392826"
FT                   /db_xref="GeneID:3659378"
FT                   /locus_tag="Tb927.8.3830"
FT                   /transcript_id="XM_842121.1"
FT   CDS_pept        complement(1139792..1142029)
FT                   /locus_tag="Tb927.8.3830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAD/H RNA helicase, putative"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: ATP binding [goid 0005524]; go_function:
FT                   ATP-dependent helicase activity [goid 0008026]; go_process:
FT                   nucleobase, nucleoside, nucleotide and nucleic acid
FT                   metabolism [goid 0006139]"
FT                   /db_xref="GI:72392827"
FT                   /db_xref="GeneID:3659378"
FT                   /translation="MRHWTFHCLRTVRQCSVKVGSAYWGPRSVQFRHAKLPPHDAGNAH
FT                   ATSGMATVQEVESGAPRKYGVVGMPHAPPVESHESNASSDTHSFVTDGIVSVSCRGLHA
FT                   NNDFHTELRCEDPHQPTNSEDRVFDTSTMKSDVPAAVAKVATCGENGISVEGGTQLGVR
FT                   DTNPHPLLASGSNDSETSLEVKRAMGPSPSKIPSLCQGNCQHSDTRTTGLPMRSVSGQG
FT                   SPTDADRGEASTFSTEEKTTDHGSLSDVGSEKENFVVRDHMRNTVPVQRLLSFEDLANK
FT                   LPPWLRHGLMRSGYIAPSLVQSVAIPLFMAKHDVVGVAPTGSGKTVAFALPALAALARR
FT                   LESDHVENSASTEASGDPSEESGRVRAVPHVLVLCPTRELVQQTRRVFSLLSENAVRIA
FT                   GMYGGQDREQQLEYVRHMGGCDVLVATPGRLCDFVEAREVSLKAVSFLIMDEADRMLEL
FT                   GFAPQLEFLMSDIKRYRRSRQTTMWTATWNATVGGLATRFMQPERLLLEVDREHKVNSN
FT                   VTQRMYALSDPSQRLQAIVKLYDDGVINRRQQVLIFANRKEEVEWLASELSRALRAPPN
FT                   MLQFLHGGMRQKRREAMIRGFSCNEVRVLCATDVAARGIDVPGLSHVINYDLPAHVDAY
FT                   VHRIGRTGRAGRTGTAHTFVTAGDPNAPIIARFIVQQQQGAALPDDVLSIVQDVERCGT
FT                   APSRQRYKFHSTVAGKDWRVPANEKQTQTQGSRYVRGVGLVTTLKRPATRK"
FT                   /protein_id="XP_847214.1"
FT   misc_feature    1142806..1142833
FT                   /note="AT_rich"
FT   misc_feature    complement(1142806..1142833)
FT                   /note="AT_rich"
FT   gene            complement(<1143111..>1145336)
FT                   /note="synonym: Tb08.10J17.430; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659379"
FT                   /locus_tag="Tb927.8.3840"
FT   mRNA            complement(<1143111..>1145336)
FT                   /db_xref="GI:72392828"
FT                   /db_xref="GeneID:3659379"
FT                   /locus_tag="Tb927.8.3840"
FT                   /transcript_id="XM_842122.1"
FT   CDS_pept        complement(1143111..1145336)
FT                   /locus_tag="Tb927.8.3840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392829"
FT                   /db_xref="GeneID:3659379"
FT                   /translation="MPEAHIVRFKVLRIDCTALTKGQQYTITYRRGETFRSTPCYVADN
FT                   NYVDFSPMPEGSAVVHFKSGGLRFLPKWINIRVEEYIRGRARKAVGETRVDCAGVLGAS
FT                   SKTAATTVSVSFSLHGSPAKMTVALLVYPEKHAPLSFNNIIPQPSGGNRDGRGVDQTAT
FT                   GSRGHVKRMATDDVVTLLLALEGLAERRRANIAQGIDKDSPLKARIAELEEKRRAFSGV
FT                   EGMAQGVVQSRTVDLISAQYLALSQTHRANFTGHVAAYLRQLAASTGVPVTLDISRYTG
FT                   ATIGRGGSSSTVDATQERLQRMQSRIEMLSQQIKKLEGEKTCLDIEQSLSRSQGSAEEL
FT                   KAITAKIESLTSQRQLLQRSCATIEGAGVKPSGSYDHTPVVHEVIGIRARILALSKEEE
FT                   QLREKVLRMSNVTVGHVLKWARSKDPPMEEVRKDDTGLSGVAQGYHMRKENQSAHPLPQ
FT                   NPVPTQTPQKTEEPEKAAHNSSTQQSSENDSDTDSDGDTAKVAGDGKSSGKSSTRASRI
FT                   TKRFPDWGKIRKSDMYGATGLPSANDFEGGAGSEQQVVSKGSYGDPLAPDLGSSMFSTR
FT                   RQERAAPQKQEQERKNSSLVVGSDLPQLNFDAPLEDTTTSGHGGFFSSSFADGPTGSIP
FT                   AIQIVSVDDDAFTYDVGETEGNNFVADDSITYNTFQMEGSSTNEPAFSITPSGLPTYSF
FT                   ESGGENTFSTGGNEGGLPVYNFGSDHLSVSKDKRESGNHTLTFNFGS"
FT                   /protein_id="XP_847215.1"
FT   repeat_region   1147894..1147931
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1147894..1147931)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1148311..1148339
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1148311..1148339)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttg"
FT                   /rpt_type="tandem"
FT   repeat_region   1148599..1148644
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1148599..1148644)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(<1148943..>1150103)
FT                   /note="synonym: Tb08.10J17.400; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659385"
FT                   /locus_tag="Tb927.8.3850"
FT   mRNA            complement(<1148943..>1150103)
FT                   /db_xref="GI:72392830"
FT                   /db_xref="GeneID:3659385"
FT                   /locus_tag="Tb927.8.3850"
FT                   /transcript_id="XM_842123.1"
FT   CDS_pept        complement(1148943..1150103)
FT                   /locus_tag="Tb927.8.3850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392831"
FT                   /db_xref="GeneID:3659385"
FT                   /translation="MIVRTPLADCTVGTFQEENVANGVSGCAKRLMKRTYTHNPYRHIT
FT                   VIPVSVAGPCDWARSHEAAFGAPVFAPNRGVDVAQPPHTYGEPASSSVPCHEGGMCPRS
FT                   MTYARYGAAPYACPATAAYEAPMEVDESINTSIGADKTVNLSNSTVSCCNAGTPTTSTP
FT                   NKGSNTLYKMYVDGRPKVVRGVTRAEVSVKLRLGNEVFLVDDVPAVLGAVMVPEELVGR
FT                   YVIVEGDRGEDLGCIASVSHSGARSAGDASEAGRRLARVLREATAEELEAFQRLDELEE
FT                   SALRFCRAAVQSLNLRVPLQVERAVFQFDRKKLTFTYSSDSYVEFKTLLRALNRQYQCR
FT                   IWMHQLNWDMNCRDKRQSAGGEGEGRKRSGLKDEGGRRCEAGAVAA"
FT                   /protein_id="XP_847216.1"
FT   gene            complement(<1150494..>1151768)
FT                   /note="synonym: Tb08.10J17.390; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659387"
FT                   /locus_tag="Tb927.8.3860"
FT   mRNA            complement(<1150494..>1151768)
FT                   /db_xref="GI:72392832"
FT                   /db_xref="GeneID:3659387"
FT                   /locus_tag="Tb927.8.3860"
FT                   /transcript_id="XM_842124.1"
FT   CDS_pept        complement(1150494..1151768)
FT                   /locus_tag="Tb927.8.3860"
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392833"
FT                   /db_xref="GeneID:3659387"
FT                   /translation="MLSSYFSWMEHVDARVLRAGGTSDNHMRPLYLPYEAPPLLRVEPV
FT                   CTLRDHTDRIWCVAWCPTANVVASCSGDGTVRLWGYMLNVGREEIPNGRDQNGTWSCIY
FT                   TLEGEHSRTVRHVSWSPSGTFIACASFDRTASVWRRVSDDPNCFEFELEAILDGHENEV
FT                   KCAAWGTDNTLATCSRDRTVWVWDRVDVGEFECAGVLAGHAQDVKACAWLFPSGGVEKP
FT                   LLFSCSYDNTVKVWTESHKRDDWYCHQTLTRHDGTVWSVAVQPIEQPIDSLQMEEEERE
FT                   GTALEYSPVVCCSSDDKTVTFWSRDGDGNFRSVCTASGFAERTIYSVGWAPSGSDVSPA
FT                   IVACGSGDNKVTLLGVYQSRGYEEVHVSVVAEVPSAHEADVNTVAFSRSTNELWGDNSR
FT                   GGEGLLLASGGDDNIVRIWRVTAAL"
FT                   /protein_id="XP_847217.1"
FT   gene            complement(<1152105..>1155722)
FT                   /note="synonym: Tb08.10J17.380; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659390"
FT                   /locus_tag="Tb927.8.3870"
FT   mRNA            complement(<1152105..>1155722)
FT                   /db_xref="GI:72392834"
FT                   /db_xref="GeneID:3659390"
FT                   /locus_tag="Tb927.8.3870"
FT                   /transcript_id="XM_842125.1"
FT   CDS_pept        complement(1152105..1155722)
FT                   /locus_tag="Tb927.8.3870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392835"
FT                   /db_xref="GeneID:3659390"
FT                   /translation="MPVTVEEVVLRYLEATCPSAAEAFKNRVPLQNHQEKNQNNASGAI
FT                   IEDAVRLYNNQETSVHTDEENEPLYKLLGKRIAEDCDVKKSEQARKKARTETSENKRKA
FT                   KDIENKGKVTPKKPVAPESSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDD
FT                   EPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDEPVRKPLVKANSSPKSNAAVKKPVAP
FT                   DSSSDDDEPVRKPLLKANSSPKSNAAVKKPVAPDSSSDDDEPVRKPLVKANSSPKSNAA
FT                   VKKPVAPDSSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDEPVRKPLLKAN
FT                   SSPKSNAAVKKPVAPDSSSDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDDEPV
FT                   RKPLVKANSSPKSNAAVKKPVAPDSSSDDDDEPVRKPLLKANSSPKSNAAVKKPVAPDS
FT                   SSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDDEPVRKPLVKANSSPKSNAA
FT                   VKKPVAPDSSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPESSSDDDDEPVRKPLVKA
FT                   NSSPKSNAAVKKPVAPESSSDDDEPVRKPLVKANSSPKSNAAVKKPVAPESSSDDDDEP
FT                   VRKPLLKANSSPKSNAAVKKPVASESSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPD
FT                   SSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPESSSDDDDEPVRKPLVKANSSPKSNA
FT                   AVKKPVAPDSSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDDEPVRKPLLK
FT                   ANSSPKSNAAVKKPVAPDSSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDD
FT                   EPVRKPLVKANSSPKSNAAVKKPVASESSSDDDDEPVRKPLVKANSSPKSNAAVKKPVA
FT                   PESSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPESSSDDDDEPVRKPLVKANSSPKS
FT                   NAAVKKPVAPDSSSDDDDEPVRKPLVKANSSPKSNAAVKKPVAPDSSSDDDEPVRKPLV
FT                   KANSSPKSNAAVKKPVAPESSSDVVEDFGVTGRKRSLSHYEGESEEILRKVPRVEAVDS
FT                   YRRDRKQPVVGKCDDFSVRGSGSVRRPFQRIDPTKVAFASNDLRDNGPKAEHMALRQNQ
FT                   EMMRVKGKSFNKLKQKNKAKLYASGVDVSVRSFQFEDSE"
FT                   /protein_id="XP_847218.1"
FT   gene            complement(<1157696..>1158607)
FT                   /note="synonym: Tb08.10J17.360; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659388"
FT                   /locus_tag="Tb927.8.3880"
FT   mRNA            complement(<1157696..>1158607)
FT                   /db_xref="GI:72392836"
FT                   /db_xref="GeneID:3659388"
FT                   /locus_tag="Tb927.8.3880"
FT                   /transcript_id="XM_842126.1"
FT   CDS_pept        complement(1157696..1158607)
FT                   /locus_tag="Tb927.8.3880"
FT                   /gene_family="HOG000137465" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392837"
FT                   /db_xref="GeneID:3659388"
FT                   /translation="MSVYVIHVAFSCFPVLLFYRWPPIVRYPCPVYSAKYFHSVVCLLL
FT                   FLFPFIIFLNSGAPKESMCAGRDCSPALNVLAGPPTDNGKQPASLPPDAGWKTPPTAMD
FT                   DQFLYGVYVPPAAYGKLHNRGNLDESAEGLLSVPYGGAQKWEGENEWETSMLGAPCSEP
FT                   LFCLGACCCPWCCAFLQRKKLLENDWSRYLCCAGMFCGSRCCVCEGCEPCCLCLESCFC
FT                   LACAVYGNRFIIRKHYNLQNDCCDSVIIWCAYLCSCLACLLNDESLKTIADVFFYIVIG
FT                   CMLSQHQHQMKKQGYPWCRIMK"
FT                   /protein_id="XP_847219.1"
FT   gene            complement(<1160256..>1161233)
FT                   /note="synonym: Tb08.10J17.340; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659392"
FT                   /locus_tag="Tb927.8.3890"
FT   mRNA            complement(<1160256..>1161233)
FT                   /db_xref="GI:72392838"
FT                   /db_xref="GeneID:3659392"
FT                   /locus_tag="Tb927.8.3890"
FT                   /transcript_id="XM_842127.1"
FT   CDS_pept        complement(1160256..1161233)
FT                   /locus_tag="Tb927.8.3890"
FT                   /gene_family="HOG000137465" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392839"
FT                   /db_xref="GeneID:3659392"
FT                   /translation="MSVYVIHVAFSCFPVLLFYRWPPIVRYPCPVYSAKYFHSVVCLLL
FT                   FLFPFIIFLNSGAPKESMCAGRDCSPALNVLAGPPTDNGKQPPPPAGYGQPPPPAGYGQ
FT                   PPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPCGVYKPPDDYAE
FT                   VQKWEGENEWETSMLGAPCSEPLFCLGACCCPWCCAFLQRKKLLENDWSRYLCCAGLCG
FT                   DRNCCVCEGCEPCCLCLESCFCLPCAAHGNRFMVLQHYNLQNDCCDSVIIWCAYLCSCL
FT                   ACLLNDESLKTIADVFFYIVIGCMLSQHQHQMKKQGYPREQTME"
FT                   /protein_id="XP_847220.1"
FT   gene            complement(<1162882..>1163994)
FT                   /note="synonym: Tb08.10J17.320; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659391"
FT                   /locus_tag="Tb927.8.3900"
FT   mRNA            complement(<1162882..>1163994)
FT                   /db_xref="GI:72392840"
FT                   /db_xref="GeneID:3659391"
FT                   /locus_tag="Tb927.8.3900"
FT                   /transcript_id="XM_842128.1"
FT   CDS_pept        complement(1162882..1163994)
FT                   /locus_tag="Tb927.8.3900"
FT                   /gene_family="HOG000137465" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392841"
FT                   /db_xref="GeneID:3659391"
FT                   /translation="MSVYVIHVAFSCFPVLLFYRWPPIVRYPCPVYSAKYFHSVVCLLL
FT                   FLFPFIIFLNSGAPKESMCAGRDCSPALNVLAGPPTDNGKQPPPPAGYGQPPPPAGYGQ
FT                   PPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPPPA
FT                   GYGQPPPPAGYGQPPPPAGYGQPPPPAGYGQPPCGVYKPPDDYAEVQKWEGENEWETSM
FT                   LGAPCSEPLFCLGACCCPWCCAFLQRKKLLENDWSRYLCCAGLCGDRNCCVCEGCEPCC
FT                   LCLESCFCLPCAAHGNRFMVLQHYNLQNDCCDSVIIWCAYLCSCLACLLNDESLKTIAD
FT                   VFFYIVIGCMLSQHQHQMKKQGYPREQTME"
FT                   /protein_id="XP_847221.1"
FT   gene            complement(<1164485..>1165522)
FT                   /note="synonym: Tb08.10J17.310; thymidylate kinase,
FT                   putative"
FT                   /db_xref="GeneID:3659398"
FT                   /locus_tag="Tb927.8.3910"
FT   mRNA            complement(<1164485..>1165522)
FT                   /db_xref="GI:72392842"
FT                   /db_xref="GeneID:3659398"
FT                   /locus_tag="Tb927.8.3910"
FT                   /transcript_id="XM_842129.1"
FT   CDS_pept        complement(1164485..1165522)
FT                   /locus_tag="Tb927.8.3910"
FT                   /gene_family="HOG000255708" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thymidylate kinase, putative"
FT                   /EC_number="2.7.4.9"
FT                   /note="similar to SP:P00572: Thymidylate kinase (EC
FT                   2.7.4.9) (dTMP kinase) {Saccharomyces cerevisiae}; 51%
FT                   similar to SP:P00572: Thymidylate kinase (EC 2.7.4.9) (dTMP
FT                   kinase) {Saccharomyces cerevisiae}; go_function:
FT                   thymidylate kinase activity [goid 0004798]; go_process: TTP
FT                   biosynthesis [goid 0006234]; go_process: pyrimidine salvage
FT                   [goid 0008655]"
FT                   /db_xref="GI:72392843"
FT                   /db_xref="GeneID:3659398"
FT                   /translation="MVAVNRKIVVFTDVEDKQVLEVIREVAGDAETIQLEKSFAYEFMW
FT                   RGKHTPYRVGTPMCFITEKTVEDADVVFAVYSKRVPVLSLTTGGETTNLLETISSLGIE
FT                   CKQNTSETWADAVRAFLPNNNSESAVIVFEGGDGAGKATQTEYMRKRLDKEGKAHASLD
FT                   FPSDKHRYGKLIRKVLSGERGALHDLDPKLFSLLFSLNRFDTLPELRYWLTHGKKILLD
FT                   RYYTSNFGHQASKLEESERSDFIRHLEQLELEWLKLPPPDVALYLDLPPAAALVAMQRD
FT                   EKRESLDIHETAGLSYKENVRQTYVWCCQNQRNWVQIECCNDEGERYSREKVHEMIYNA
FT                   VAKHI"
FT                   /protein_id="XP_847222.1"
FT   gene            complement(<1165683..>1168526)
FT                   /note="synonym: Tb08.10J17.300; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659397"
FT                   /locus_tag="Tb927.8.3920"
FT   mRNA            complement(<1165683..>1168526)
FT                   /db_xref="GI:72392844"
FT                   /db_xref="GeneID:3659397"
FT                   /locus_tag="Tb927.8.3920"
FT                   /transcript_id="XM_842130.1"
FT   CDS_pept        complement(1165683..1168526)
FT                   /locus_tag="Tb927.8.3920"
FT                   /gene_family="HOG000137459" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392845"
FT                   /db_xref="GeneID:3659397"
FT                   /translation="MSVEEVDTLLQGVVTCGTNADEVALEKLREIPLLQLSRMMGKYLT
FT                   GEEHVVNAVRVLGLATVNRRDRTIEEVDVMLRFFSRKLSSMQTIAVAVESTALLVRELS
FT                   SEGPCTSDVFNVLHTEFLQSFSLQALPTNVRSWGYDVLRFTVTKETATWFTTPFLQVVL
FT                   KSMDEENEPELLMRALELHHIIASYAREDAMQPLLEEYFDSISSYFPVVFSQPPGCKVS
FT                   KEDLRRVLSACMTHPLYLNICVPFLLSRMASPSSVVKQESTNALLNIFSLDSSHTTESL
FT                   CPHVVSVTNHIRNEVVRAVSLGSGECEPYVKDCVHVLKFISKRAQDVSLSIVRSWLEPM
FT                   TSGALASLRSGPAVCSAYATMFYHLVSSSTCCGAATVQCFLLQLLSNTREDSFEVDDAV
FT                   LIISAILSGIFDAGNGGECGKRPPPQRDVKEGLETVSEKLFQLVEKLTLSLQKADASSV
FT                   HVRCELLASLVTLAAWLPHWMPDDTVLLIYKRLIALCLCGDEEVGNRVVKHISRIGSVE
FT                   GNLLNVALLDMPADINPTAAGILTLYKGLLGSQASLSLAATKSLLECPEGLFGFTLTER
FT                   DVFSLCRSSLSAHADYSTEDIRCLLLLTKKRNSVASFDYLCDLLLLLPIAFVPSVLQEV
FT                   GGEQWGVLTASLVSCFDMDVLGVSDHIEHWMCEVLDAVRSTPTDVLTMQSVSSLCARVP
FT                   GVAGRFLEAAKRLNPTTQLAARAAVARGLLACGVAEGGIIELIIEEITNSLRSGYVQDC
FT                   YVDILTGVFVFCYQGCRKTTTLILPLVHAATRGSKPVSLELLRVVAKLLQDVSPTCGLE
FT                   WGDIVEFSRRVSKPLNEEFVNELVELLDLALSQMDPKNVLVEALLGTDDLLPLVLSGVR
FT                   SPLLKVRCTSLRLLSEAALFVMQFSSENGDSGNSYMSSALQVRDEVLHVSQVALSDHKR
FT                   MVRRSAAQCRHQWYKLK"
FT                   /protein_id="XP_847223.1"
FT   gene            complement(<1170056..>1171984)
FT                   /note="synonym: Tb08.10J17.290; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659396"
FT                   /locus_tag="Tb927.8.3930"
FT   mRNA            complement(<1170056..>1171984)
FT                   /db_xref="GI:72392846"
FT                   /db_xref="GeneID:3659396"
FT                   /locus_tag="Tb927.8.3930"
FT                   /transcript_id="XM_842131.1"
FT   CDS_pept        complement(1170056..1171984)
FT                   /locus_tag="Tb927.8.3930"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392847"
FT                   /db_xref="GeneID:3659396"
FT                   /translation="MNFLSQIYTDSCYKSYLDNEPPFLVAVVSGKRLCISEGLSRMSNQ
FT                   SSLFHIKYFPDLRSLPTKQKAAGAPLPNALGVLKSDWCTRRLHSRFSCVIFSLDWETVS
FT                   DVAMDEIGNSSMWDQLLAWTRTLRSKIIVALATEKCSNEGEDVKEKLETLQRVLKQRLG
FT                   DDFNELIILFKLGMERESAERLYHMLKKTSTAYHMEELARIRNKPPEPNYLAVRLGFKT
FT                   GWHSLVVRDLGAAVKHFTNAYNCLRDVAPPQSPMELRMCGTVIIMHLLNAAKALSDVSF
FT                   EDLYYGMCEDHIVWLGQITPSTGENFTMVQFLKPLLIAECHYWLAKNTCHAVPVASMGH
FT                   LCACMFAYEDALKVNRSLETSAQQTVAPVLIGVECCSEAHVNICSLSGTSDALTKRVGE
FT                   LLSECASLTVPTVELLYTSARLNVMLRRTDEALYSLEMLWEHGVKSYEGAKVIHGLLIE
FT                   LSKSVPDELVEKCSREVTLSYASLSFGPGAEESQRRFRDSFAKMMSSFSLDSFLSYPHK
FT                   GYYAPFNIFCGFSEVHGDDSMHELVMVFRTHSIDNVNVDSLCVNLSRMRDNKLDSWATQ
FT                   TSVDRSVELCSCNSSSVSALFDLREPGVYYCSRVQGRVKCGDICLNVEWNFDDTSVENN
FT                   NVGTAVY"
FT                   /protein_id="XP_847224.1"
FT   repeat_region   1173579..1174259
FT                   /transposon="DIRE"
FT   repeat_region   complement(1174260..1174463)
FT                   /transposon="RIME-A"
FT   repeat_region   1174464..1175051
FT                   /transposon="DIRE"
FT   gene            complement(<1178282..>1179982)
FT                   /note="synonym: Tb08.10J17.250; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659393"
FT                   /locus_tag="Tb927.8.3940"
FT   mRNA            complement(<1178282..>1179982)
FT                   /db_xref="GI:72392848"
FT                   /db_xref="GeneID:3659393"
FT                   /locus_tag="Tb927.8.3940"
FT                   /transcript_id="XM_842132.1"
FT   CDS_pept        complement(1178282..1179982)
FT                   /locus_tag="Tb927.8.3940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392849"
FT                   /db_xref="GeneID:3659393"
FT                   /translation="MVKVEPPVQLLQRHISALPFDVLIRRIHSSALANPSRSLEAHFLG
FT                   SHSPPDRCEVVATRAVSATTSSAARTAGATATELRSLLSQRLLLDIRRYQASNQLDLDD
FT                   LSLVLANAIRHRLSPELAAITLQYFADALSATGAANQEPRRIEALSRIMEACCDAELTE
FT                   WTPMTWDCLATIVALIEQRWLALAATASVCALLLQFLSTVVGAQLQGRAASSGLLKTDS
FT                   QLLKERCLKLADSATQALAEALESDESSRWNPGQLQGVCAVVEQLRKFENLNAHISHSS
FT                   AKQMSFWKRHGTVNEPTYVWKKVRRVLTMQILTHGTLERAVRAMTLQQASELFASISTT
FT                   CGADAVGKVAAPLHRMLKVVVAADLGTMGNVIRIGEASLVAEGASALLAQSIDIIGRYN
FT                   YVLTGGNGWGLLIAACTLFERAPLSISPVVDRTLGALQLALEDAQWVSPDSPEFFAHSL
FT                   AVASLATLLVTHKLSTTTKLESRIVDIANSSPLLRDATRGPSIVVRCLFFLISTADGAN
FT                   GRGKIAEKRACALGLLMAESRDLHGKKEDCGGSFHLTAFERRILRFVQK"
FT                   /protein_id="XP_847225.1"
FT   gene            complement(<1180246..>1182990)
FT                   /note="synonym: Tb08.10J17.240; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659394"
FT                   /locus_tag="Tb927.8.3950"
FT   mRNA            complement(<1180246..>1182990)
FT                   /db_xref="GI:72392850"
FT                   /db_xref="GeneID:3659394"
FT                   /locus_tag="Tb927.8.3950"
FT                   /transcript_id="XM_842133.1"
FT   CDS_pept        complement(1180246..1182990)
FT                   /locus_tag="Tb927.8.3950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392851"
FT                   /db_xref="GeneID:3659394"
FT                   /translation="MGSVDHPGMLKHLLSENARLKALAAQPEHERILQDVLLTQLQRFF
FT                   SDARQSVEDTVDKTSTPCSERSERREGAAGEESGVQRFSALVETLCILGTQNEELQRHM
FT                   SDMQTKTVAALNEKVEALESERGSLKRRVEELEREVAAKGTTNTADEELTPPLMAELRS
FT                   LRTSEELLRQQLQNVHERGEAAVAESEKLAKDGIRATMLLPRLLESVEEVRGALKLVES
FT                   ERDVLRLQLQELKERQSVQHTLCEAQLREQVALSQSSVQHLLSRISVLETREAQARDEV
FT                   AACMQTIERQQGIIQNLQACQGVAVETLASKRRRLESEIFDNPDSVRRDLVTFWCEGRE
FT                   ELEQLREEVQKLRSKVQQLKPLKEKLGQLERNRSAVATRIVDLADEVSRVREENQKLRV
FT                   QYSGLEVERDYLRGSLAAVISQHMQEEELSSCCAAVREAAARSAASSVSAVVDPQVIQQ
FT                   TMRQARELQSEVAQLGKQKEKLHRCISLREKRLAALVAREAVQCPAAAAQEARPAVENG
FT                   SVMHTVSWAEAHAVDVLSSLEEGVATESGLQRQGVLVAMQTRLDAAEREVAVCKQQLEA
FT                   SDTAREEAEARYSAARAELQATLSARETAMTEMHHTNTVLLQSVERLRSEQKQLRQSYY
FT                   DLAAFTENLASALEVMLLFVQGETNLAASVGRLLLQHRSEICELTQQAADGWEMRRDDV
FT                   QRVVESIDRMCEYVRQSTEQNQREQALNSVTHLRRLTDAVKQQEGRLKEMQKNFTEVCQ
FT                   KLGESLATRVAEAQQQAEGLWKKRLGMLQEERHRLQGQLKAEKDLLSRMECLMIPGAMT
FT                   QPTLTAAEATVAHAVINPGTDAPELPDQERNEVVDVINRLLAAVSQPATTEEDVPNPLL
FT                   LPAGQCKRGGSGECEAELVEEEGQGGERGERDVLETVSGITKV"
FT                   /protein_id="XP_847226.1"
FT   gene            complement(<1184116..>1185345)
FT                   /note="synonym: Tb08.10J17.230; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659395"
FT                   /locus_tag="Tb927.8.3960"
FT   mRNA            complement(<1184116..>1185345)
FT                   /db_xref="GI:72392852"
FT                   /db_xref="GeneID:3659395"
FT                   /locus_tag="Tb927.8.3960"
FT                   /transcript_id="XM_842134.1"
FT   CDS_pept        complement(1184116..1185345)
FT                   /locus_tag="Tb927.8.3960"
FT                   /gene_family="HOG000255747" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392853"
FT                   /db_xref="GeneID:3659395"
FT                   /translation="MRFFVVAVSTTLGLASPSRWVLRQQALTAVLTPARRYVNALYRVP
FT                   PQNLIPTHSPIGEEVDTELFVRQVKDLFLALKQTHLVDQVHEMRACPYYDSLFAADILF
FT                   QHYDIVLPMPKYGREHRSSEISETLRYLRACGSTGDFNHVLQDVKGGSADGGDFVSTTH
FT                   GILMGYGTPRTNKLCMMAITDASAPNEAAAAQQRALNIVPIEMSPTAPPLADVLAFAGK
FT                   RTLIVQDTEHGRSAGEAAANAIRKVPWQILRIEPNCSIISHLCGVNSVFDVLVDQDFPT
FT                   SMERIGEAGLNPFPVEWTEPRKLGLSMRRVCLIARFARGTMSAGGYADSDGHRAASFTY
FT                   HSRNIASNSRLIHNGHRKHGDSGAPLEAQLRSGELPAPVYQRPPRYAPAIHRTGGLATT
FT                   ATTRDKRERE"
FT                   /protein_id="XP_847227.1"
FT   gene            complement(<1185733..>1187034)
FT                   /note="synonym: Tb08.10J17.220; oxidoreductase, putative"
FT                   /db_xref="GeneID:3659389"
FT                   /locus_tag="Tb927.8.3970"
FT   mRNA            complement(<1185733..>1187034)
FT                   /db_xref="GI:72392854"
FT                   /db_xref="GeneID:3659389"
FT                   /locus_tag="Tb927.8.3970"
FT                   /transcript_id="XM_842135.1"
FT   CDS_pept        complement(1185733..1187034)
FT                   /locus_tag="Tb927.8.3970"
FT                   /gene_family="HOG000255748" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oxidoreductase, putative"
FT                   /EC_number="1.6.5.5"
FT                   /note="go_function: alcohol dehydrogenase activity,
FT                   zinc-dependent [goid 0004024]; go_function: zinc ion
FT                   binding [goid 0008270]; go_function: oxidoreductase
FT                   activity [goid 0016491]; go_process: metabolism [goid
FT                   0008152]"
FT                   /db_xref="GI:72392855"
FT                   /db_xref="GeneID:3659389"
FT                   /translation="MGAGTSQPSSSHDINGNGRTSGKALGNALRCHGWMVSKCVRQWKA
FT                   AAAINSEITIPPPGKGQVRVKLYAAAVNPVDAKRAAFGYQVSSSLFTGGLSRGTGVAST
FT                   MLGPETLFPFPYVMGVEGAGVIESVGWDSSKEQQYDFQVGDRVAFLADMSQPFGGTFCQ
FT                   YAVVHADALGKIPAPTDGNDFIDFVEASTMPCSAGAAYVALFDKLRVERGRSIFISGAS
FT                   GGVGSVAVQLAKYVGLCVLASCSTVNVPYVSSLGADFVFDYTTNNVVKECLEHTQSVGV
FT                   DYVLELADAALAAKHAEALRFGGSICVLPGPMNANDANSGVFFRKQISVSYVCLAGLYG
FT                   SEVTRKLLRSVVEESLRLYQNGAFRLHVETASIERVRDVMDVVASGHARGKIVLTDFHP
FT                   TESPGVDAAVGSRRRKQVRDAAKLTAPAGDATAR"
FT                   /protein_id="XP_847228.1"
FT   gene            complement(<1187664..>1189781)
FT                   /note="synonym: Tb08.10J17.210; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659400"
FT                   /locus_tag="Tb927.8.3980"
FT   mRNA            complement(<1187664..>1189781)
FT                   /db_xref="GI:72392856"
FT                   /db_xref="GeneID:3659400"
FT                   /locus_tag="Tb927.8.3980"
FT                   /transcript_id="XM_842136.1"
FT   CDS_pept        complement(1187664..1189781)
FT                   /locus_tag="Tb927.8.3980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392857"
FT                   /db_xref="GeneID:3659400"
FT                   /translation="MDSVAEPLNAPEQGQSEEMKKHPQKVSAPCTAKRKGQKPKTEDNG
FT                   ELQSAGKQKRKKSPAKPPNKVRGGVKTRGMARAESVSKPQPSPEVVNEAPTSEKCNGTG
FT                   LPSSDDDSEDALVFPSGAPQMKREAAQFNPGLALVRSVIAKIEPPDEITPRITTKRPRS
FT                   MASGAADKNKKVAVEPPTKVAENSTPTDPVVLSPPSRGLASFGFYTQSKKSTESKASVN
FT                   KLFTPFVQDKRVSPLSLQFWLPDGPALKRETHVDDVLFLGETSPKSLQSEVCATNNGKV
FT                   VWAGEEDETHSTQMYQGVGTPYSSFAAMIEHATAHSDTNDGCSAYVTEALRRCPCSFHV
FT                   QLPPPRKDFCNEIIFCGFYAISFDPCESRPPYFGTYNSQNALNVEELMRLARFGVSEEM
FT                   PQMSNLDYEYDSGDDWDVADGDEDVGMSGDSNSDEEVDENSSSIVGSDEANNDFINDND
FT                   EYDDDSEAEIQRRMFDSRERRRNRLKGREKFVPAFSGPFVAVSALDHPLRDYDKFERIS
FT                   SELNDEVFTTMFEQCLRSCGNVGSSLTTNGNSNCTDVGENQQSFLPHSQQDKRDMTRQE
FT                   VDILHGIVAANSRISTAKIVTVLLEGGYCVGVSQAEMVRTIRRHYERNHGILVRRVEPW
FT                   AATDERLFKRRKKQKAGASTANDGDRKEGNDDDDDVQEMSGDDDDMGEEVPLAVTAMEV
FT                   VCASRDCRSKR"
FT                   /protein_id="XP_847229.1"
FT   gene            complement(<1190781..>1191653)
FT                   /note="synonym: Tb08.10J17.200; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659401"
FT                   /locus_tag="Tb927.8.3990"
FT   mRNA            complement(<1190781..>1191653)
FT                   /db_xref="GI:72392858"
FT                   /db_xref="GeneID:3659401"
FT                   /locus_tag="Tb927.8.3990"
FT                   /transcript_id="XM_842137.1"
FT   CDS_pept        complement(1190781..1191653)
FT                   /locus_tag="Tb927.8.3990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392859"
FT                   /db_xref="GeneID:3659401"
FT                   /translation="MPPKQHKEKKKKKKKSTPEDDLDEPYHRWLDETYYIARTHREHAA
FT                   AVHMKFINTAIKACTTAIVPYNEMLLLTTGIPTCETEVVPMVSVPSIIRSLGFNPTTKQ
FT                   LMQIGWITALVKEPPAEFLSDVLSRTLWESENENKLKRCMLMTHIDFESCDLLTSRKKL
FT                   ENVGLQLLQTGSFVFDPSQVPRVFLPAVDLLRRVPVVVQRSDADTLDKVFETIWAAANT
FT                   CERGTGGIRQMNIAALHKTLTTAMRSHRKTSETMEEPSLTKVEMESLLSFVCGEGGNVD
FT                   EDTFALTAV"
FT                   /protein_id="XP_847230.1"
FT   gene            complement(<1192394..>1194304)
FT                   /note="synonym: Tb08.10J17.190; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659402"
FT                   /locus_tag="Tb927.8.4000"
FT   mRNA            complement(<1192394..>1194304)
FT                   /db_xref="GI:72392860"
FT                   /db_xref="GeneID:3659402"
FT                   /locus_tag="Tb927.8.4000"
FT                   /transcript_id="XM_842138.1"
FT   CDS_pept        complement(1192394..1194304)
FT                   /locus_tag="Tb927.8.4000"
FT                   /gene_family="HOG000255751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392861"
FT                   /db_xref="GeneID:3659402"
FT                   /translation="MMGRIRVCPQPTYPSVLHLFCIGGVTALTACGGALLLYYRGVWVP
FT                   ERRRLLQQQTCLPPRRTRQFIAGSGSYQQQVAVFQYHPHVLREILFCGLVVLRTILLVV
FT                   HMVPVIWFTFLTYGLHFCSEPVFFGKVRDMLLAMGPSYIKLGQWIATRPDIFSPVMCSA
FT                   LEKLYDNTEPHSWSHTEKTLRNTFRESPQGSNDEGRKGDTGTRQNVLYYLREIEKVPVN
FT                   SGSIAQVHRAVLREDVDGVPTGTTVAIKILHPLTREIICADLVVMKCFVNVVTTLFRDT
FT                   VYLDLRRALGEFSSLLCSQLSLDLECDNLKQFAFNFRDFPGVIFPKPLPSFCTPDVLVE
FT                   TFEEGRPLQEIQPCDEFRDAAQRGCHMFLKMLFEDNFVHSDLHPGNILIRANPGAPLNV
FT                   PPTTFFSPTTVERYPDGKPKLKYELIILDAGLTTSLSPEERNNFISLFAAVACGDGSLG
FT                   ADLMIDRLPPDVRPPYPEAKREKFRMDMTNIFNTVAPGASDGFTLRHVRIGSTLCKIMN
FT                   TLRENKTPIDGNFASLVLTVVVGEGLGRKLIPDFNLFAEAVPYLMVLLEDNELSYLANK
FT                   LRSTYGAGTLLRDSLSLVELQRTPTYIEAGLRKASKTVDRILQQLTRQSAVTCASQEEK
FT                   A"
FT                   /protein_id="XP_847231.1"
FT   gene            complement(<1196773..>1198413)
FT                   /note="synonym: Tb08.10J17.170; flagellum-adhesion
FT                   glycoprotein"
FT                   /db_xref="GeneID:3659404"
FT                   /locus_tag="Tb927.8.4010"
FT   mRNA            complement(<1196773..>1198413)
FT                   /db_xref="GI:72392862"
FT                   /db_xref="GeneID:3659404"
FT                   /locus_tag="Tb927.8.4010"
FT                   /transcript_id="XM_842139.1"
FT   CDS_pept        complement(1196773..1198413)
FT                   /locus_tag="Tb927.8.4010"
FT                   /gene_family="HOG000137466" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flagellum-adhesion glycoprotein"
FT                   /note="similar to GP:1244788: flagellar glycoprotein
FT                   {Trypanosoma brucei}; 99% similar to GP:1244788: flagellar
FT                   glycoprotein {Trypanosoma brucei}; go_component: integral
FT                   to membrane [goid 0016021]; go_component: flagellum [goid
FT                   0019861]; go_component: flagellar pocket [goid 0020016]"
FT                   /db_xref="GI:72392863"
FT                   /db_xref="GeneID:3659404"
FT                   /translation="MGGRTESREALAALVAALLLLLGFVSPVIGDQTVGTKVIVNLFNS
FT                   CINCSSGQADGINGTGRLFKAVGGFFKNKSFPLLLCDVGGGGSTVRLVNKTGIYTVAGN
FT                   LAKRGDEVGPLEVARFNHPTSVVGVNNDIYVADRDNDCMKRIDADGMVTKFAANEVDKP
FT                   SSIIYHEQDGAPVLFISDTGNSRIMYSQISVSNNVTAKLVGGFQPGVMQISKKRNFMYV
FT                   VKETSWIAAVDLNSLSDSDGNKKSWDIANMSCLDYVDALMLTEDENELYYYGEPNGESH
FT                   IMSLELNSSETGLLCPKKVMEWMHGPIVSLVKVNGCEYYAITETAVYAVREKCYSPTPL
FT                   PPVTPTPTPGSPPRSTAVAAFRASSFPMGNDRLMHALYSWIIKDVEVAFRTEDFYAVFL
FT                   PPGEINVPGGTNVSTWTNLTAMMNLENTILITNYRGPPGMSKGRAQKRLFSSPWTWTRM
FT                   FLEEVSQQEQWSHLLPLCMVKCVDDCQHITLAESVCGDDSRLSRCDGVCLGGIVSSALL
FT                   GAVAIVLLFLMVVSPYNVKFAFVRLPAFE"
FT                   /protein_id="XP_847232.1"
FT   repeat_region   1198452..1198481
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(1198452..1198481)
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1198604..1198649
FT                   /note="A-rich"
FT   misc_feature    complement(1198604..1198649)
FT                   /note="T-rich"
FT   gene            complement(<1198784..>1199512)
FT                   /note="synonym: Tb08.10J17.160; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659403"
FT                   /locus_tag="Tb927.8.4020"
FT   mRNA            complement(<1198784..>1199512)
FT                   /db_xref="GI:72392864"
FT                   /db_xref="GeneID:3659403"
FT                   /locus_tag="Tb927.8.4020"
FT                   /transcript_id="XM_842140.1"
FT   CDS_pept        complement(1198784..1199512)
FT                   /locus_tag="Tb927.8.4020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392865"
FT                   /db_xref="GeneID:3659403"
FT                   /translation="MTISSAEATSTTQQLTTRAMVNYIVEHAAPSAVCLVRKIQNSPYQ
FT                   PLSSEKVLSVATPNVLSLRPPTHVAHQALMEFYSAINGHCGVNCPDPFSIELQVASGRP
FT                   RDANAEGRMRECPLPHNSATGTTPPYGCAGGTASSSLPHAPPSQGIGVVAGGRNSAHQQ
FT                   NMATPLPSPAGSPLLPTSAASSSEDYRLSQIRRNERHVGNATYGRVCTFFLTREGCRRG
FT                   KYCNFLHIGKGPAGGGSALP"
FT                   /protein_id="XP_847233.1"
FT   gene            complement(<1199747..>1200445)
FT                   /note="synonym: Tb08.10J17.150; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659399"
FT                   /locus_tag="Tb927.8.4030"
FT   mRNA            complement(<1199747..>1200445)
FT                   /db_xref="GI:72392866"
FT                   /db_xref="GeneID:3659399"
FT                   /locus_tag="Tb927.8.4030"
FT                   /transcript_id="XM_842141.1"
FT   CDS_pept        complement(1199747..1200445)
FT                   /locus_tag="Tb927.8.4030"
FT                   /gene_family="HOG000137467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /db_xref="GI:72392867"
FT                   /db_xref="GeneID:3659399"
FT                   /translation="MCLSKIFSPVDQSLKVLVEVMTRLAGQEVVKGTRKRGRSKECGTD
FT                   EEAHFVIRINGRVTQVPSAAPSLNLRQLLGQAGVLLQDITDEETPILLLPCPNTGNVTV
FT                   HPNHNYRLVKFVGEHMCLAGAMSHANNNSKTDHVAIAAKDGEAEKKSPLRSDIWAMAEL
FT                   WAVIAFMQEHRASCVQDFLSLPVERMATYYSRGVLNLRRQCFSGVESESSDEEVEESEV
FT                   CYEGKEDEED"
FT                   /protein_id="XP_847234.1"
FT   gene            complement(<1200841..>1202361)
FT                   /note="synonym: Tb08.10J17.140; endonuclease G, putative"
FT                   /db_xref="GeneID:3659408"
FT                   /locus_tag="Tb927.8.4040"
FT   mRNA            complement(<1200841..>1202361)
FT                   /db_xref="GI:72392868"
FT                   /db_xref="GeneID:3659408"
FT                   /locus_tag="Tb927.8.4040"
FT                   /transcript_id="XM_842142.1"
FT   CDS_pept        complement(1200841..1202361)
FT                   /locus_tag="Tb927.8.4040"
FT                   /gene_family="HOG000137468" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endonuclease G, putative"
FT                   /EC_number="3.1.30.-"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: endonuclease activity [goid 0004519];
FT                   go_process: nucleobase, nucleoside, nucleotide and nucleic
FT                   acid metabolism [goid 0006139]"
FT                   /db_xref="GI:72392869"
FT                   /db_xref="GeneID:3659408"
FT                   /translation="MHRITVRLMPTDTCTVIPLTPSITLCGINCRKKHTMAVSASSVGR
FT                   AFAFLGTALAGGAIGMVVERGGWFGVDKCHPSPVPYQQMTERTSPEVLHVQCPQPAYPK
FT                   ERCNDDGGETTPFVLRLTSKGLPSDDHLRYYKGFVSSLNYERRIPNWVLEYIPGRTTAA
FT                   DSVVTADNDLVNASAAEAQRDGMRFFADMTVPQLFRVQPGDYIGGGRGQHSRGLSRGHL
FT                   AAAQFHKSSTVELAQTFNMNANTVPQDMTMNAVDWLRLENLTRKLRRYYERGLWVVTGP
FT                   VFHPRLVDGDVRTWRWAEPSQCPSPVKPVSSGVLASGEHCHCGNDKAAVHLRKIVCYEL
FT                   VGKRDVAVPTHLFKVILGERADGAHEAAAFLMPNEPIAVERPLTAYQVPVVEIERLTGL
FT                   EFFRNVAAAGSDARFWGRELDALPNICRRVVCEARTAGMFRSYRDVARLRAAGSLPELQ
FT                   SVYSILLAEQQQKCGNTAGITVALDGVVAQEYRERLRELMAVSTNDTG"
FT                   /protein_id="XP_847235.1"
FT   gene            complement(<1203333..>1205585)
FT                   /note="synonym: Tb08.10J17.130; hypothetical protein,
FT                   conserved"
FT                   /db_xref="GeneID:3659405"
FT                   /locus_tag="Tb927.8.4050"
FT   mRNA            complement(<1203333..>1205585)
FT                   /db_xref="GI:72392870"
FT                   /db_xref="GeneID:3659405"
FT                   /locus_tag="Tb927.8.4050"
FT                   /transcript_id="XM_842143.1"
FT   CDS_pept        complement(1203333..1205585)
FT                   /locus_tag="Tb927.8.4050"
FT                   /gene_family="HOG000137440" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein, conserved"
FT                   /note="go_component: integral to membrane [goid 0016021]"
FT                   /db_xref="GI:72392871"
FT                   /db_xref="GeneID:3659405"
FT                   /translation="MPLWKQTNCEVETMNVREVVGTVHLGYVSQMLLLVATVATIVVRS
FT                   GAAPIELKRHVTTVAGKYGHIGDKDGFPGMSELSSPHAMCRGRNSDEILLGTVDRFRAF
FT                   SRKNRETTTITAWETDEDQKSGSRSVKVDKPRACVQWTVGGSTFVYFVESMGEVKYFKD
FT                   SGVFSHDVVRNGSLTGVALYGNHLYLTEQNTNTVWTCEVGSDGDPIACHSHVALSANCS
FT                   IYGPIGIAATQQGIFVVARGPAKQGTICWFDLQGHKIAEVDGEYVDITSTRSGDLLAAT
FT                   QNELHRVSTDGNKLTTKRFAGGSTNSCLPNTEGDDTLLCEITRLLVVTEYEMYVTSEKK
FT                   SVLRSVTLPPVYVQGLFPGRPLPVGYPDKDIMEWIVGNLTEDINTALGTTESIVASSSV
FT                   HVDSTTWLTNFTAGVQQPDFDDEKTEQALHESNYEHTKEAADEYYNLTDEQVYMDSTMV
FT                   PYCNRLSLDALRRKLAKEAGEVLNFTLIYADMPLKAESSDAENITTVKLLMPASFNNTV
FT                   THDLLSDANLTETAHSFIKYLRSSDTHVDVTFSNPPFNFSSLTPDEEQEVRWYIHDEVM
FT                   NQIKKCEERSTGRSMARREEVGDHSRTTIATALDSNVTGVCQSTITNRTVSLFYQPPYV
FT                   EMSLYEVFIPGNYTFDVSECVGEIDWQDLNDHLNNDTVRPTTEKAPKCGRVCLIIIAVV
FT                   CALIVAVLIVLAVVFTSKRRRLAAVVAPARPKFVSTLDEDEQDYASAYGNKERVEQ"
FT                   /protein_id="XP_847236.1"
FT   gene            complement(<1206258..>1208030)
FT                   /note="synonym: Tb08.10J17.120; flagellum-adhesion
FT                   glycoprotein, puta