(data stored in ACNUC8465 zone)

HOGENOMDNA: TRBRU1_9

ID   TRBRU1_9; SV 1; empty ; DNA; empty ; UNC; 4054025 BP.
XX
AC   NC_007283;
XX
DE   Trypanosoma brucei TREU927 chromosome 10, complete sequence.
XX
OS   Trypanosoma brucei TREU927
OC   Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
XX
RN   [1]
RP   1-4054025
RX   PUBMED; 16020726.
RA   Berriman,M., Ghedin,E., Hertz-Fowler,C., Blandin,G., Renauld,H.,
RA   Bartholomeu,D.C., Lennard,N.J., Caler,E., Hamlin,N.E., Haas,B., Bohme,U.,
RA   Hannick,L., Aslett,M.A., Shallom,J., Marcello,L., Hou,L., Wickstead,B.,
RA   Alsmark,U.C.M., Arrowsmith,C., Atkin,R.J., Barron,A.J., Bringaud,F.,
RA   Brooks,K., Carrington,M., Cherevach,I., Chillingworth,T.-J., Churcher,C.,
RA   Clark,L.N., Corton,C.H., Cronin,A., Davies,R.M., Doggett,J., Djikeng,A.,
RA   Feldblyum,T., Field,M.C., Fraser,A., Goodhead,I., Hance,Z., Harper,D.,
RA   Harris,B.R., Hauser,H., Hostetler,J., Ivens,A., Jagels,K., Johnson,D.,
RA   Johnson,J., Jones,K., Kerhornou,A.X., Koo,H., Larke,N., Landfear,S.,
RA   Larkin,C., Leech,V., Line,A., Lord,A., MacLeod,A., Mooney,P.J., Moule,S.,
RA   Martin,D.M.A., Morgan,G.W., Mungall,K., Norbertczak,H., Ormond,D., Pai,G.,
RA   Peacock,C.S., Peterson,J., Quail,M.A., Rabbinowitsch,E., Rajandream,M.-A.,
RA   Reitter,C., Salzberg,S.L., Sanders,M., Schobel,S., Sharp,S., Simmonds,M.,
RA   Simpson,A.J., Tallon,L., Turner,C.M.R., Tait,A., Tivey,A.R., Van Aken,S.,
RA   Walker,D., Wanless,D., Wang,S., White,B., White,O., Whitehead,S.,
RA   Woodward,J., Wortman,J., Adams,M.D., Embley,T.M., Gull,K., Ullu,E.,
RA   Barry,J.D., Fairlamb,A.H., Opperdoes,F., Barrell,B.G., Donelson,J.E.,
RA   Hall,N., Fraser,C.M., Melville,S.E. and El-Sayed,N.M.;
RT   "The Genome of the African Trypanosome Trypanosoma brucei";
RL   Science 309 (5733), 416-422 (2005)
XX
RN   [2]
RP   1-4054025
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (02-SEP-2005) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4054025
RA   Lennard,N.J., Barron,A., Clark,L.N., Corton,C.H., Harris,B.R., Line,A.,
RA   Berriman,M., Hertz-Fowler,C., Renauld,H., Bohme,U., Arrowsmith,C.,
RA   Cronin,C., Davies,R.M., Doggett,J., Fraser,A., Johnson,D., Larke,N.,
RA   Leech,V., Lord,A., MacLeod,A., Norbertczak,H., Ormand,D., Quail,M.A.,
RA   Rabbinowitsch,E., Rajandream,M.A., Reitter,C., Sharp,S., Woodward,J.,
RA   Hall,N., Melville,S.E. and Barrell,B.G.;
RT   "Direct Submission";
RL   Submitted (14-APR-2005) Wellcome Trust Genome Campus, The Wellcome Trust
RL   Sanger Institute, Hinxton, Cambridge CB10 1SA, UK
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CM000208.
XX
FH   Key             Location/Qualifiers
FT   source          1..4054025
FT                   /mol_type="genomic DNA"
FT                   /isolate="927/4 GUTat10.1"
FT                   /note="single VAT derivative of TREU (Trypanosomiasis
FT                   Research Edinburgh University) 927/4 (GPAL/KE/70/EATRO
FT                   1534)"
FT                   /db_xref="taxon:185431"
FT                   /organism="Trypanosoma brucei TREU927"
FT                   /chromosome="10"
FT   repeat_region   1..656
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ccctaa"
FT                   /rpt_type="tandem"
FT   misc_feature    776..861
FT                   /note="AT_rich"
FT   misc_feature    945..1021
FT                   /note="A-rich"
FT   misc_feature    1403..1423
FT                   /note="AT_rich"
FT   gene            complement(1712..3088)
FT                   /db_xref="GeneID:3662455"
FT                   /locus_tag="Tb10.v4.0001"
FT   mRNA            complement(<1712..>3088)
FT                   /db_xref="GI:71746435"
FT                   /db_xref="GeneID:3662455"
FT                   /locus_tag="Tb10.v4.0001"
FT                   /transcript_id="XM_817180.1"
FT                   /product="variant surface glycoprotein (VSG)"
FT   CDS_pept        complement(1712..3088)
FT                   /locus_tag="Tb10.v4.0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="variant surface glycoprotein (VSG)"
FT                   /db_xref="GI:71746436"
FT                   /db_xref="GeneID:3662455"
FT                   /translation="MGQPKIKVDLRYILALLVTVQASPAADLHDTKLKIENECDAAEHL
FT                   TLMLTKIHSTLDNQEQQLRTARQYLWQTVAAVATEAANGNPKYIPILAAQTQLLAAAEK
FT                   KTANFAKPLRATAAGLAQLIGAQTSLAEITDLKLSAQTPAAAAAFFTATTKAIPAQALN
FT                   NAKPKCKAKYENKPRDAATTPRNYAETTTVKFYHLEALTADNGALKTPKLCAKAGSAPA
FT                   ADCSDGEIGASAQLAVAGGNLLKTTAVEYSSKNAEKGQFKATTNNNALAPPKDFVQAAL
FT                   EGLHQAPEQLSNLNFRAESLRAGSITEEQAFKKAVALAYIPGADLSKLHELNDKISAVI
FT                   KSEYTDDSGSLTAKIWEPLGRVTLNKAETATDTTQTLKDDVQIEALGTAVAYRLIAAVQ
FT                   AKATSSGKKTEEDLSKKADSADKTGESKKQGDNKTTTNTTGSNSFVINKAPLLLALLLS
FT                   "
FT                   /protein_id="XP_822273.1"
FT   repeat_region   5612..5737
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   5768..5803
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   5839..5882
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   5926..5976
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   6010..6032
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   6079..6123
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   6157..6200
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   6243..6287
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   6321..6371
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(<10624..>11595)
FT                   /db_xref="GeneID:3662406"
FT                   /locus_tag="Tb10.v4.0002"
FT   mRNA            complement(<10624..>11595)
FT                   /db_xref="GI:71746437"
FT                   /db_xref="GeneID:3662406"
FT                   /locus_tag="Tb10.v4.0002"
FT                   /transcript_id="XM_817181.1"
FT                   /product="expression site-associated gene ESAG protein"
FT   CDS_pept        complement(10624..11595)
FT                   /locus_tag="Tb10.v4.0002"
FT                   /gene_family="HOG000130838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="expression site-associated gene ESAG protein"
FT                   /db_xref="GI:71746438"
FT                   /db_xref="GeneID:3662406"
FT                   /translation="MRVVILEWTILILLIVGAYGDNDHALVADYEGDAPLSETVCYLRC
FT                   LSDALNKLYTDGEKKLLVNEEVYANVSRILDSMEAKTGESVKYLSVISGAMVGESEKLE
FT                   KLISYGNTMGDLVAKVGGLFAEVNESVRTVRKEIPDALIKANKYYTSIAEIVRTVWDDL
FT                   KAIPTSIDPKCENGEFDGVKEFEVKCGDSSCPLRNGVSEDALKHYKRGRIEVNVLNGSV
FT                   SRCLNLQRKNLYKNGAEKHSSEVLKWPQDDATFFQLKLEVQSMFGPLIVSFAAGRTTSA
FT                   LLEMVENITSLRSRFKEIHSDFTSLLLNPNSTDNVNSTDSTI"
FT                   /protein_id="XP_822274.1"
FT   repeat_region   complement(12854..13100)
FT                   /rpt_family="RIME-B"
FT   repeat_region   complement(12855..18114)
FT                   /rpt_family="ingi"
FT   repeat_region   complement(17868..18114)
FT                   /rpt_family="RIME-A"
FT   gene            complement(20370..21740)
FT                   /note="variant surface glycoprotein (VSG, pseudogene),
FT                   putative"
FT                   /db_xref="GeneID:3662407"
FT                   /locus_tag="Tb10.v4.0003"
FT                   /pseudo
FT   misc_feature    29806..29839
FT                   /note="AT_rich"
FT   misc_feature    37899..37920
FT                   /note="AT_rich"
FT   repeat_region   37922..37945
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   complement(40010..45267)
FT                   /rpt_family="ingi"
FT   repeat_region   complement(40010..40257)
FT                   /rpt_family="RIME-B"
FT   repeat_region   complement(45021..45267)
FT                   /rpt_family="RIME-A"
FT   repeat_region   complement(46322..46542)
FT                   /rpt_family="RIME-A"
FT   gene            complement(48532..49891)
FT                   /note="expression site-associated gene (ESAG, pseudogene),
FT                   putative"
FT                   /db_xref="GeneID:3661489"
FT                   /locus_tag="Tb10.100.0010"
FT                   /pseudo
FT   gene            complement(52749..54230)
FT                   /note="retrotransposon hot spot protein (RHS, pseudogene),
FT                   putative"
FT                   /db_xref="GeneID:3661490"
FT                   /locus_tag="Tb10.100.0020"
FT                   /pseudo
FT   repeat_region   complement(54185..54421)
FT                   /rpt_family="RIME-B"
FT   repeat_region   complement(54428..54674)
FT                   /rpt_family="RIME-A"
FT   repeat_region   60644..60890
FT                   /rpt_family="RIME-A"
FT   repeat_region   60891..61141
FT                   /rpt_family="RIME-B"
FT   misc_feature    67421..67444
FT                   /note="AT_rich"
FT   gene            67708..68310
FT                   /db_xref="GeneID:3661491"
FT                   /locus_tag="Tb10.100.0045"
FT   mRNA            <67708..>68310
FT                   /db_xref="GI:71746439"
FT                   /db_xref="GeneID:3661491"
FT                   /locus_tag="Tb10.100.0045"
FT                   /transcript_id="XM_817182.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        67708..68310
FT                   /locus_tag="Tb10.100.0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746440"
FT                   /db_xref="GeneID:3661491"
FT                   /translation="MFYLVTSHHVLQRDYIYYYIFSFSHRMSTSERRRYGFQRTSKEIR
FT                   NERKLNKMQKWSEKLDSCDVVKLRTELRSMEKADFLLPRQKERKTLIERMIRDAELRKC
FT                   VEGTAPISCEQRPNEDTQDNSSCSSRCDDIILSPRLGVGDGVVVTTPDHFIPRSLRKRC
FT                   GGNNSQEGLKKRVKRAEEHLIANNSLEEDIDDFFDSL"
FT                   /protein_id="XP_822275.1"
FT   gene            68495..69622
FT                   /db_xref="GeneID:3661492"
FT                   /locus_tag="Tb10.100.0050"
FT   mRNA            <68495..>69622
FT                   /db_xref="GI:71746441"
FT                   /db_xref="GeneID:3661492"
FT                   /locus_tag="Tb10.100.0050"
FT                   /transcript_id="XM_817183.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        68495..69622
FT                   /locus_tag="Tb10.100.0050"
FT                   /gene_family="HOG000257229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746442"
FT                   /db_xref="GeneID:3661492"
FT                   /translation="MALVRRIGSSLLSHKEYSRFLDNRKWLEGALEGFSIENVLGISQL
FT                   SSRPSVLMYGSCVSGTAFSNADADYAVLFLTQGNTEESSMANMLNYTHSKFIEVKREHH
FT                   QRVLLAILEHIRVSFCSTVLKCEQIYSARVPFIRLFKSSANNTEGSHLDVSLSFDGPRN
FT                   SLLLRLYMEGDPRLRCGVLCAKKWCRSQGILDARRGWISAYALTVMYIFYMQVTKRAVR
FT                   IIDESEVNNILYCMSKQMLEGVNECFPFVGDVCSCSDVDIQNVLSDLHGFFHFFGGSMC
FT                   FDFDTDVVDIRKNDKLVSKESWLEGINHFDEKTRWNLLGYETIMIRDPYEDHNLGRSVD
FT                   FFRGERIREVFRLASETKIEDVLNELAKQGRLSSV"
FT                   /protein_id="XP_822276.1"
FT   gene            69948..71231
FT                   /db_xref="GeneID:3661493"
FT                   /locus_tag="Tb10.100.0060"
FT   mRNA            <69948..>71231
FT                   /db_xref="GI:71746443"
FT                   /db_xref="GeneID:3661493"
FT                   /locus_tag="Tb10.100.0060"
FT                   /transcript_id="XM_817184.1"
FT                   /product="centromere/microtubule binding protein"
FT   CDS_pept        69948..71231
FT                   /locus_tag="Tb10.100.0060"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="centromere/microtubule binding protein"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   RNA binding [goid 0003723]; go_function: pseudouridylate
FT                   synthase activity [goid 0004730]; go_process: tRNA
FT                   modification [goid 0006400]"
FT                   /db_xref="GI:71746444"
FT                   /db_xref="GeneID:3661493"
FT                   /translation="MVSKKLGEAQRKEDFCIPLEGQHTDCALSPEEWPLLLKNYDRLNV
FT                   RSSHFTVLDCGWSPLRRPLSQYVKYGMINLDKPSNPSSHEVVSWIKRILKCEKTGHAGT
FT                   LDPKVTGALIICIDRATRLVKSQQNAGKTYIGVLRLHDTVSEKKVVASLQRLTGPCFQR
FT                   PPLIAAVKRQLRIRNIYSNQLIEYDKHRHLAVFETHCEAGTYIRTLCVHLGLILGVGGH
FT                   MEELRRIRTGVISEDDHISTMHDVLDAQWLYDNEKDETYLRRVILPCEYLLTNYKRVVV
FT                   KDSAVNAVCYGAKLMIPGLARFDNGIERDDVIVLMTTKGEAIALAYAEMSTSQMASVDH
FT                   GIVARSKRVIMDRDTYPRRWGLGPVAVKKRTMMKDGLLDKYGRPQANTPSDWFYVDYGG
FT                   VSTNAEGVQYGEAPRKNGKRPRSEADDT"
FT                   /protein_id="XP_822277.1"
FT   gene            71480..72397
FT                   /db_xref="GeneID:3661494"
FT                   /locus_tag="Tb10.100.0070"
FT   mRNA            <71480..>72397
FT                   /db_xref="GI:71746445"
FT                   /db_xref="GeneID:3661494"
FT                   /locus_tag="Tb10.100.0070"
FT                   /transcript_id="XM_817185.1"
FT                   /product="ATP synthase F1 subunit gamma"
FT   CDS_pept        71480..72397
FT                   /locus_tag="Tb10.100.0070"
FT                   /gene_family="HOG000257231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP synthase F1 subunit gamma"
FT                   /EC_number="3.6.3.14"
FT                   /note="go_component: proton-transporting two-sector ATPase
FT                   complex [goid 0016469]; go_function: hydrogen-transporting
FT                   ATPase activity, rotational mechanism [goid 0046961];
FT                   go_process: ATP synthesis coupled proton transport [goid
FT                   0015986]"
FT                   /db_xref="GI:71746446"
FT                   /db_xref="GeneID:3661494"
FT                   /translation="MSGKLRLYKEKLEGYNRFYSIVKTIKMVTLAKYRAAQGRIRTRDF
FT                   SLRYTELAFSKPQASRDAVAAAKNALVYIPITTNRGSCGALNSNIVRCIDSVVSSKMVL
FT                   MPVGKRGIDSFSKLFPDEFRYGIINDMKESMHFGYATFVIENAYEVSKDADRYQVIFNR
FT                   FVSAGVQRNAVYNIPSYEKWKEDLADAGSSDNQKNRYLFANALQNEEEQLIRDFFDFHA
FT                   ALAVLNAVGENELSEQAARLVAVEGQLTNISSLQQRTSSLYNKTRQFGITAALIEILSA
FT                   MSSLEGNAMKGVRRNKFWEGAVTK"
FT                   /protein_id="XP_822278.1"
FT   gene            72663..73415
FT                   /db_xref="GeneID:3661495"
FT                   /locus_tag="Tb10.100.0080"
FT   mRNA            <72663..>73415
FT                   /db_xref="GI:71746447"
FT                   /db_xref="GeneID:3661495"
FT                   /locus_tag="Tb10.100.0080"
FT                   /transcript_id="XM_817186.1"
FT                   /product="40S ribosomal protein S6"
FT   CDS_pept        72663..73415
FT                   /locus_tag="Tb10.100.0080"
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S6"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: regulation of cell growth [goid 0001558];
FT                   go_process: protein biosynthesis [goid 0006412];
FT                   go_process: regulation of cell proliferation [goid
FT                   0042127]"
FT                   /db_xref="GI:71746448"
FT                   /db_xref="GeneID:3661495"
FT                   /translation="MKLNVAYPRNGTVKQVEVTDEVLRRVNLGDYRLGNEVDGAIFGEA
FT                   FRGYTFKLRGGSDKEGFPMVQGVMAPSRVSLLVKRGAVGFNTFRGYQGERRRKSLRGCI
FT                   LGSDIAVLNVTVEKVGEQPIEGVTDVSVPRRLGPKRANKIRKLFNLGRTDDVRKYVIRR
FT                   KVTKEGKKDRFKAPKIQRLITSTIRARRAKKVRVAIDKVRKSAAERREYLRLVGARRRA
FT                   ARQRKAARHHSSRVNAQRKEVDAFKARK"
FT                   /protein_id="XP_822279.1"
FT   gene            73627..74202
FT                   /db_xref="GeneID:3661496"
FT                   /locus_tag="Tb10.100.0090"
FT   mRNA            <73627..>74202
FT                   /db_xref="GI:71746449"
FT                   /db_xref="GeneID:3661496"
FT                   /locus_tag="Tb10.100.0090"
FT                   /transcript_id="XM_817187.1"
FT                   /product="vacuolar ATP synthase"
FT   CDS_pept        73627..74202
FT                   /locus_tag="Tb10.100.0090"
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="go_component: hydrogen-translocating V-type ATPase
FT                   complex [goid 0016471]; go_function: hydrogen-exporting
FT                   ATPase activity, phosphorylative mechanism [goid 0008553];
FT                   go_process: ATP hydrolysis coupled proton transport [goid
FT                   0015991]"
FT                   /db_xref="GI:71746450"
FT                   /db_xref="GeneID:3661496"
FT                   /translation="MKTQNLLFAASAAVSAGAAAAGAVSCDEMYPQSAAFFGSMGCASA
FT                   LIFANLGSAYGTAKSGVGVAHLGILHADRIMRGIVPVVMAGILGIYGLIVSVIINNNIK
FT                   TELHAYAAFSGYLHFGAGLAAGLSSLAAGLSIGIAGDASVRAYGKQEKIFVAMILMLIF
FT                   AEALGLYGLIIALLMNNTANKVNYGPCQ"
FT                   /protein_id="XP_822280.1"
FT   gene            74632..76017
FT                   /db_xref="GeneID:3661478"
FT                   /locus_tag="Tb10.100.0100"
FT   mRNA            <74632..>76017
FT                   /db_xref="GI:71746451"
FT                   /db_xref="GeneID:3661478"
FT                   /locus_tag="Tb10.100.0100"
FT                   /transcript_id="XM_817188.1"
FT                   /product="GPI transamidase component GAA1"
FT   CDS_pept        74632..76017
FT                   /locus_tag="Tb10.100.0100"
FT                   /gene_family="HOG000257232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GPI transamidase component GAA1"
FT                   /note="go_component: GPI-anchor transamidase complex [goid
FT                   0042765]; go_function: GPI-anchor transamidase activity
FT                   [goid 0003923]; go_process: GPI anchor biosynthesis [goid
FT                   0006506]"
FT                   /db_xref="GI:71746452"
FT                   /db_xref="GeneID:3661478"
FT                   /translation="MLQAGTKKFLREYGSTCAPLFLALGVCLICCLPAACPKENFIDEN
FT                   AISVSRVPVITGMLGELHMDTRISQYTRVVRGRRSVGSESIAVYVNAAFESSVVLANHL
FT                   IYVLREKENMACDTNFYFFNDTSKDWPIPDSFVRAAIVINVTSFHTNNLCFNVFGANGM
FT                   QPNQDLFNLAVAIAEKWRFNIDVLCQNPYISFSTSRPIYEHYFLALQTALVAPLRYQPW
FT                   YKMRSRGISLLAISTEKSERRTKSSYGYNMAAAHEQLIATLSYLHERFHHSTSVWIPLS
FT                   VDQYVEYDVIQFATILFVASLLSTCYSIYEVEGFSFSPCAALVSATGLAALVSTLNFGT
FT                   AGFFVSSGVLTVGLGAFSWDMSWGAINAVVLCLLIILQPVAGLVMGFGATLQLQFIHVR
FT                   CRKWHVLLIGAILSWIVLVALTEVMKAKLFDTETTAGVYFSFFLYPNALWISSRLIRST
FT                   LGA"
FT                   /protein_id="XP_822281.1"
FT   gene            76235..76516
FT                   /db_xref="GeneID:3661479"
FT                   /locus_tag="Tb10.100.0110"
FT   mRNA            <76235..>76516
FT                   /db_xref="GI:71746453"
FT                   /db_xref="GeneID:3661479"
FT                   /locus_tag="Tb10.100.0110"
FT                   /transcript_id="XM_817189.1"
FT                   /product="60S ribosomal protein L37a"
FT   CDS_pept        76235..76516
FT                   /locus_tag="Tb10.100.0110"
FT                   /gene_family="HOG000229493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L37a"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71746454"
FT                   /db_xref="GeneID:3661479"
FT                   /translation="MAKRTVKMGVMGRYGARYGSNPRKRAKKLEVSQHAKHFCSFCGKF
FT                   AFRRKAVGIWRCDGCSKTVAGGAYTLSTPNNTTVRSTVRRLRELKQSN"
FT                   /protein_id="XP_822282.1"
FT   gene            76763..77503
FT                   /db_xref="GeneID:3661480"
FT                   /locus_tag="Tb10.100.0120"
FT   mRNA            <76763..>77503
FT                   /db_xref="GI:71746455"
FT                   /db_xref="GeneID:3661480"
FT                   /locus_tag="Tb10.100.0120"
FT                   /transcript_id="XM_817190.1"
FT                   /product="proteasome subunit alpha 5"
FT   CDS_pept        76763..77503
FT                   /locus_tag="Tb10.100.0120"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome subunit alpha 5"
FT                   /EC_number="3.4.25.1"
FT                   /note="curated by J. Mottram; go_component: nucleus [goid
FT                   0005634]; go_component: cytosol [goid 0005829];
FT                   go_component: proteasome core complex (sensu Eukaryota)
FT                   [goid 0005839]; go_process: ubiquitin-dependent protein
FT                   catabolism [goid 0006511]"
FT                   /db_xref="GI:71746456"
FT                   /db_xref="GeneID:3661480"
FT                   /translation="MFSSKTEYDRGVNTFSPEGRIFQIEYAIEAIKLGSTSLGIQTPDA
FT                   VIIAAEKRVPSTLVDPSSVNKILEIDHHIGTVLSGMVADARILVDHARVEAQNHRFTYD
FT                   EPMSVESCALATCDLSVQFGESGGRKKLMSRPFGVSLLIAGVDENGPQLWQTDPSGTYT
FT                   RYDAQAIGGGAEAAQTVFSERYHRNMTVEEAENLTVQILRQVMEEKLTKTSVEIAIVPV
FT                   STGRLQIYDQEQIQRIIDRQAEEN"
FT                   /protein_id="XP_822283.1"
FT   gene            77732..78832
FT                   /db_xref="GeneID:3661481"
FT                   /locus_tag="Tb10.100.0130"
FT   mRNA            <77732..>78832
FT                   /db_xref="GI:71746457"
FT                   /db_xref="GeneID:3661481"
FT                   /locus_tag="Tb10.100.0130"
FT                   /transcript_id="XM_817191.1"
FT                   /product="peroxin 14"
FT   CDS_pept        77732..78832
FT                   /locus_tag="Tb10.100.0130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peroxin 14"
FT                   /note="go_component: glycosome membrane [goid 0046860];
FT                   go_function: protein binding [goid 0005515]; go_process:
FT                   protein-vacuolar targeting [goid 0006623]"
FT                   /db_xref="GI:71746458"
FT                   /db_xref="GeneID:3661481"
FT                   /translation="MSLLLSGVVDDGKSKPEVEHTHSEREKRVSNAVEFLLDSRVRRTP
FT                   TSSKVHFLKSKGLSAEEICEAFTKVGQPKTLNEIKRILSERPYVPTGPNSQHMTQPLRD
FT                   ESADSVPTPHPNQSRRHTSLLYAPQAPPLPEAAAATRGVDWRDLVIGAGAAVIGGFAAF
FT                   KAFQLYSPYEIRLKDEGSKPRSRRSRRGGRHASSDSEAERSLVHREVPALPVPAIPVAS
FT                   ESHVDAKQAEIERLKTELKETQEALEAEKKGKAELSITLGKLRGQVTAYSRTNEKQESQ
FT                   IKSLQEEVNRLKSEIERKEDSAKVNANSNVEETLDSKEEGLPSSDTESSNPNGASSEVA
FT                   RDTQQQDGPAPLSTETDGTVVGGEAA"
FT                   /protein_id="XP_822284.1"
FT   gene            79083..81254
FT                   /db_xref="GeneID:3661482"
FT                   /locus_tag="Tb10.100.0140"
FT   mRNA            <79083..>81254
FT                   /db_xref="GI:71746459"
FT                   /db_xref="GeneID:3661482"
FT                   /locus_tag="Tb10.100.0140"
FT                   /transcript_id="XM_817192.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        79083..81254
FT                   /locus_tag="Tb10.100.0140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746460"
FT                   /db_xref="GeneID:3661482"
FT                   /translation="MSELTAGGKSRGAENLSGVTCGNVNDFVASTDSDTDTLNATARPV
FT                   TPQQSPPPQSSRAGPRPNEVVGDNWATNRSGGPPGSNVANSGASGVVSDLQFNSQDRAA
FT                   EGAVPNLSGGFFSLPLNSQLPPHLAAPKDSNNGLNLTDLPTHTNSINCREEVAVPARRT
FT                   KPKSENCLAKLYYSGMARRKRVEERLEILRARDKELRNCTFKPVITDLAKTMERPGAFP
FT                   YCRSEEAQLRQRALLETWESKIEKECRPTPKISKGSEQIVQRVRSSSACVIPVADRLYM
FT                   ESARRQCRKQEEEEKGFQQTIPLRRSASDVNALIHRLYELEEKRVATIERKRGELWLDT
FT                   KPKRRCENSEQLVERLYRPTPRRRRPCKSEPILFSPQVNETTKELSLRANRRRLEQWHQ
FT                   LWSKVWKGYGEKQERQIICCEHLMILKKIDDVARSSGLTGNCTLNDFCTAMEDYERTHG
FT                   VQHWRLTPLPLKPHVNEDLTFSPVILPSHRERKGSPPAHQRLFEAAKAKQLQQREEERK
FT                   RREEELRQEEKSRAVSRRASRRSSKQLDIKDPAEKGASAWPCSPTESVSSTDHSRGYKS
FT                   VELSSLSPSSSPERMPVGFSPPPVWLTPGLIEVAEDLKQLMDEPRGGWSYAQLNHSRTK
FT                   VDAPPDATLRPSPSVGPKRSGSNHRPLRAPQKKKKRRPVSELLSDELLLECAASRCSPF
FT                   SWNVSARNREHRDSNRRLRNMGKLLYHKM"
FT                   /protein_id="XP_822285.1"
FT   repeat_region   81409..81431
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            81453..81791
FT                   /db_xref="GeneID:3661483"
FT                   /locus_tag="Tb10.100.0150"
FT   mRNA            <81453..>81791
FT                   /db_xref="GI:71746461"
FT                   /db_xref="GeneID:3661483"
FT                   /locus_tag="Tb10.100.0150"
FT                   /transcript_id="XM_817193.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        81453..81791
FT                   /locus_tag="Tb10.100.0150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746462"
FT                   /db_xref="GeneID:3661483"
FT                   /translation="MEIHAQVTTAVKKSITFLILFFFLFDQFSAVEVAGMVTQTEMEER
FT                   IRVSLEPESCDVVVLSEEDRKYGVVIVSRKFNDVPLVKRHRMVNDLFKDELLSGEIHAL
FT                   TITAKPLP"
FT                   /protein_id="XP_822286.1"
FT   gene            82490..82888
FT                   /db_xref="GeneID:3661484"
FT                   /locus_tag="Tb10.100.0155"
FT   mRNA            <82490..>82888
FT                   /db_xref="GI:71746463"
FT                   /db_xref="GeneID:3661484"
FT                   /locus_tag="Tb10.100.0155"
FT                   /transcript_id="XM_817194.1"
FT                   /product="60S ribosomal protein L32"
FT   CDS_pept        82490..82888
FT                   /locus_tag="Tb10.100.0155"
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L32"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71746464"
FT                   /db_xref="GeneID:3661484"
FT                   /translation="MVKPFVPRNIVKKRTKKFTRHRCELFPQLSSSWRKPRGEDSPVRR
FT                   RYKGQKAMPNKGYGSDRRTKYITPSGFKNFPVNNVQDLYMLLMQNRKYAGVISHTVGAK
FT                   ARKAIVRKAHELDVRLINGNAKLRRVDV"
FT                   /protein_id="XP_822287.1"
FT   gene            83141..83617
FT                   /db_xref="GeneID:3661485"
FT                   /locus_tag="Tb10.100.0160"
FT   mRNA            <83141..>83617
FT                   /db_xref="GI:71746465"
FT                   /db_xref="GeneID:3661485"
FT                   /locus_tag="Tb10.100.0160"
FT                   /transcript_id="XM_817195.1"
FT                   /product="cytochrome C oxidase subunit VI"
FT   CDS_pept        83141..83617
FT                   /locus_tag="Tb10.100.0160"
FT                   /gene_family="HOG000257227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome C oxidase subunit VI"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: cytochrome-c oxidase activity [goid 0004129];
FT                   go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:71746466"
FT                   /db_xref="GeneID:3661485"
FT                   /translation="MPFVDHNKYKIQREDLPALPHFTDFNDPRFCGTNNKQKNGILAYY
FT                   QWLHCVGNWGEEHSMCKKMRWYVERMMQEVWLEKWEEKRALGHFDHVLLYGVKPWKDFE
FT                   PLYQPVKTNRKGAYEFWLDRDFEPLYDADASDFCEKAPILHDIFVKGKKPVYDE"
FT                   /protein_id="XP_822288.1"
FT   gene            84003..84698
FT                   /db_xref="GeneID:3661906"
FT                   /locus_tag="Tb10.100.0170"
FT   mRNA            <84003..>84698
FT                   /db_xref="GI:71746467"
FT                   /db_xref="GeneID:3661906"
FT                   /locus_tag="Tb10.100.0170"
FT                   /transcript_id="XM_817196.1"
FT                   /product="proteasome subunit alpha 2"
FT   CDS_pept        84003..84698
FT                   /locus_tag="Tb10.100.0170"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome subunit alpha 2"
FT                   /EC_number="3.4.25.1"
FT                   /note="curated by J. Mottram; go_component: proteasome core
FT                   complex (sensu Eukaryota) [goid 0005839]; go_function:
FT                   endopeptidase activity [goid 0004175]; go_process:
FT                   ubiquitin-dependent protein catabolism [goid 0006511]"
FT                   /db_xref="GI:71746468"
FT                   /db_xref="GeneID:3661906"
FT                   /translation="MSESSYGLTTFSPSGRLVQIEYATTAASKGTTALGVKATDGVVIA
FT                   AEKKTTSPLADSLTLHKVFALDDHVGCTYSGIGPDCRVLVDAARRACQRYRLTYHEPMP
FT                   ISQLVRQISFLFQEFTQSGGVRPFGCSLLVAGADSRGNHLYQLDPSGTFWTWKATSIGK
FT                   GSPDARTFLEKRYTNEMEIEDAVHTALLTLKEGFDGRMTAENTQVGRVVEGRFELLTVE
FT                   QLKDYLDQI"
FT                   /protein_id="XP_822289.1"
FT   gene            85150..85914
FT                   /db_xref="GeneID:3661907"
FT                   /locus_tag="Tb10.100.0180"
FT   mRNA            <85150..>85914
FT                   /db_xref="GI:71746469"
FT                   /db_xref="GeneID:3661907"
FT                   /locus_tag="Tb10.100.0180"
FT                   /transcript_id="XM_817197.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        85150..85914
FT                   /locus_tag="Tb10.100.0180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746470"
FT                   /db_xref="GeneID:3661907"
FT                   /translation="MEHVVARVAGVQKPVDMPLRLLKKQQWVRCALDCSHKRVLRKEAF
FT                   IELCTSNPYTPLCERMSKSEGIKFLQALHNARQVIVVQDYVYINPADVVDAVHVRLELP
FT                   NVARRAPVTSRNCSSGQPKDSEVTLRSDMERRRFFWAIVSLLSSAQMSILAYLTFSVYG
FT                   WSVMEPICYFVTTSTSLCAYAYGLCYKRNCSYEAIDSQLASSDTLVEGKSPSTVCTQPF
FT                   FMEAVELLRTVQAESDNSGLAEASSSDTKDKA"
FT                   /protein_id="XP_822290.1"
FT   gene            86501..88258
FT                   /db_xref="GeneID:3661908"
FT                   /locus_tag="Tb10.100.0190"
FT   mRNA            <86501..>88258
FT                   /db_xref="GI:71746471"
FT                   /db_xref="GeneID:3661908"
FT                   /locus_tag="Tb10.100.0190"
FT                   /transcript_id="XM_817198.1"
FT                   /product="pumilio RNA-binding protein"
FT   CDS_pept        86501..88258
FT                   /locus_tag="Tb10.100.0190"
FT                   /gene_family="HOG000257223" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pumilio RNA-binding protein"
FT                   /note="go_function: RNA binding [goid 0003723]; go_process:
FT                   mRNA metabolism [goid 0016071]"
FT                   /db_xref="GI:71746472"
FT                   /db_xref="GeneID:3661908"
FT                   /translation="MCSSSQGSLSLFLFVLFALKVSFWVYRMWTVQEDEYKNTELSFSG
FT                   LELSPLSGTEDAAFKPIGVYTKSSQVFVNASTTPLTGTPPNDRCPTATLLPPQRTPGSP
FT                   AAAGRFFPRSQAANVSVMRVDAPPFEPSSNNLAAAITFVETPTGGKRGGLPFTGPSERR
FT                   SPHLMMPIDDTPGRDKDRTTSQYVEWSGHHVNSYHSHNAMRPFTTGGSGNSTVSVENLR
FT                   GNVYELAKDQHGCRFLQRLLCDPEADCEIPRTIMSEIVPHVAELMTDQYANFLVQKLFD
FT                   IMPKDVRYSVACVAAPKIAAIALTPHGTFSVQKMIETISSREELVIIREALSKDVVRLV
FT                   KDANGNHAIQKVLQLFEPDDKEFVYAAVAVDCITIAKNKQGCCVLQRCLEYASPAQRST
FT                   LVRHILECCLQIAEDPYGNYVLQYVISAGDSKTIDTIAIAFLPHLVQLCMNKFSSNVME
FT                   KVLCRVSPLVQEMYVDTMCTPEVAARLIQDDFGNYVLQTALTICTAGQAEALVSVIRPL
FT                   MPSIRNTPYAKKLEGKIESAMLKNANGHVPAVGVEMGRLLEMQEAGSEHSPSCHSSDIR
FT                   APQNQPLSG"
FT                   /protein_id="XP_822291.1"
FT   misc_feature    88378..88398
FT                   /note="AT_rich"
FT   misc_feature    88717..88852
FT                   /note="A-rich"
FT   misc_feature    88921..88989
FT                   /note="A-rich"
FT   misc_feature    89685..89707
FT                   /note="AT_rich"
FT   repeat_region   90376..90409
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   90837..90859
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            90858..91436
FT                   /db_xref="GeneID:3661909"
FT                   /locus_tag="Tb10.100.0200"
FT   mRNA            <90858..>91436
FT                   /db_xref="GI:71746473"
FT                   /db_xref="GeneID:3661909"
FT                   /locus_tag="Tb10.100.0200"
FT                   /transcript_id="XM_817199.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        90858..91436
FT                   /locus_tag="Tb10.100.0200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746474"
FT                   /db_xref="GeneID:3661909"
FT                   /translation="MSTCFCIALYIFIYTYVQMLLLFFTVFCFSFTALALSFKFLYIIY
FT                   FFFVGTSSFRSVWAYGMDPADPTASECDKISSIVSRLEMNEKRQHELMLQISACEARIR
FT                   AIEAHMSRNSDEVPKKSLDSQVNDRMKTDDRKQAVAVTEERICDYCLIFTQCWSCPACG
FT                   REWYCSSRCQRLRTYLHGPFCGCQRPAVA"
FT                   /protein_id="XP_822292.1"
FT   gene            91763..93070
FT                   /db_xref="GeneID:3661910"
FT                   /locus_tag="Tb10.100.0210"
FT   mRNA            <91763..>93070
FT                   /db_xref="GI:71746475"
FT                   /db_xref="GeneID:3661910"
FT                   /locus_tag="Tb10.100.0210"
FT                   /transcript_id="XM_817200.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        91763..93070
FT                   /locus_tag="Tb10.100.0210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746476"
FT                   /db_xref="GeneID:3661910"
FT                   /translation="MEKARQWASELFSADVVEVMRARQALARLMSPRDLLELWRGGQQD
FT                   AAAALLNEAEEVGCPEVYASLGESFNQLLGSGCQASIASEFLILDESHIVLRFLLAGVG
FT                   HEDVMRAGCLRPALIGALAVLPERMAPAVGELFCASLRSEKILRLFDENSPESEDNLRV
FT                   CEFLAAHTDLPSFIVNATLEAFESDPLLVANYLIVSGIVSRHTELSTQLLGRIYHELTN
FT                   GINGFLFPFVCRACAITLNKHEENAGKYAELWGTAVAAQLDRCDPDTRDAIYDLLGAAS
FT                   TTQTGWGAVQSFVKEEDLLHALGAKKLCAGALSFMSVVVQSLFVPDTFFTRQILTAAWQ
FT                   LRVSQDDTTRERLWEFIVKCLSRESLVFIIFPLCASYLCSSRQEHLVNIRGLQLDAATR
FT                   LVASGVLPPELTERLQVYISRGLYPPGSVGVETMSH"
FT                   /protein_id="XP_822293.1"
FT   gene            93364..94251
FT                   /db_xref="GeneID:3661911"
FT                   /locus_tag="Tb10.100.0220"
FT   mRNA            <93364..>94251
FT                   /db_xref="GI:71746477"
FT                   /db_xref="GeneID:3661911"
FT                   /locus_tag="Tb10.100.0220"
FT                   /transcript_id="XM_817201.1"
FT                   /product="mitochondrial structure specific endonuclease I
FT                   (SSE-1)"
FT   CDS_pept        93364..94251
FT                   /locus_tag="Tb10.100.0220"
FT                   /gene_family="HOG000257220" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial structure specific endonuclease I
FT                   (SSE-1)"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: 5'-3' exonuclease activity [goid 0008409];
FT                   go_process: DNA catabolism [goid 0006308]"
FT                   /db_xref="GI:71746478"
FT                   /db_xref="GeneID:3661911"
FT                   /translation="MSVRERAVVLIDGPALIHRWYYRWLYTNRNNPVDVKRFAITNARH
FT                   TIAIAHSFDPSHLMQHLLSPQVEYTHTPKHNKLIICFDQGDGGRREIYPKYKLNREGRE
FT                   VGEELGVIQKVATKVFLGEPKNTLLIVPHFDSKLKNVNAEADDMISTLAQHTQRIRIPT
FT                   VIMSHDHDLYQLIDEASRCYYYDIRTKHLISEKGVIERLGVHPKLVRDYKCLAGDPSDN
FT                   IPGVKGIGKTRALQLLKKYGDLEGVLTKGTKKQGGVVGDLLRAGVEGAELSRKLVELRD
FT                   CPSVLRVCEFFLKL"
FT                   /protein_id="XP_822294.1"
FT   misc_feature    95063..95083
FT                   /note="AT_rich"
FT   gene            95519..97057
FT                   /db_xref="GeneID:3661497"
FT                   /locus_tag="Tb10.100.0230"
FT   mRNA            <95519..>97057
FT                   /db_xref="GI:71746479"
FT                   /db_xref="GeneID:3661497"
FT                   /locus_tag="Tb10.100.0230"
FT                   /transcript_id="XM_817202.1"
FT                   /product="protein kinase"
FT   CDS_pept        95519..97057
FT                   /locus_tag="Tb10.100.0230"
FT                   /gene_family="HOG000257219" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="curated by M. Parsons, P. Ward, J. Mottram;
FT                   GB:AAA19805.3: dual-specificity tyrosine-(Y)-
FT                   phosphorylation regulated kinase TbPK4 {Trypanosoma
FT                   brucei;}; go_function: protein kinase activity [goid
FT                   0004672]; go_function: ATP binding [goid 0005524];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71746480"
FT                   /db_xref="GeneID:3661497"
FT                   /translation="MISVLSPSDFEKAKEFRAFLRNLGLSKSLDLFSEQWDELVKQQKE
FT                   ITTNEERMSEQDKEKSQRVSSAGSTPSVTAARVLRVKHRVVSAVGIEDDLWQPVGHEFL
FT                   SPAFTTGAGISLEAYEMARQNDAVTLVCTNPYFKEPPPSNLPLEHFDLRVWYESGKTGF
FT                   EEEKELPISVDSIVAGRYQMLQYLDSAAFSRTVRCMDLHEDREVCLKIIRNSKDFFDQS
FT                   IDEIKLLKLINSSGDTEENCVVKMYDFFYYKEHMCIVTELLRDNLYRFSKYNRDEETEL
FT                   YFTLPRLQATARQVLTGLRFLHSLGLIHSDLKPENILIQSYSRCAVKIIDFGSSCFLTD
FT                   NLSSYVQSRCYRAPEVILGCKYDSGIDIWSLGAILAELATGNVLFENNSIPQMLASICS
FT                   VCNELPSKLLHEGRNTHHYVTKFGAFYEYCENMDLIFHYPVQGTPLPELFGYDDPLYVD
FT                   FVRSCLTLDHRQRPTAEELLKHPFIHNDYGSAYSKPPPLKKQVADTNGIKDTSI"
FT                   /protein_id="XP_822295.1"
FT   repeat_region   97459..97489
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   97582..97621
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   98048..98078
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    98688..98751
FT                   /note="T-rich"
FT   repeat_region   98863..98888
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    99002..99052
FT                   /note="AT_rich"
FT   gene            99383..100294
FT                   /db_xref="GeneID:3661498"
FT                   /locus_tag="Tb10.70.7980"
FT   mRNA            <99383..>100294
FT                   /db_xref="GI:71746481"
FT                   /db_xref="GeneID:3661498"
FT                   /locus_tag="Tb10.70.7980"
FT                   /transcript_id="XM_817203.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        99383..100294
FT                   /locus_tag="Tb10.70.7980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746482"
FT                   /db_xref="GeneID:3661498"
FT                   /translation="MFSQKPPPPRYVLNVDTGKWSKQVVVPETKPKESMPNIQSTLDLL
FT                   LYHAMHTAKTQLEEEGKRTRVVPDVAGQIATFEARHNIHANALRSFSLSRRGGCCSNPV
FT                   VGLLCGIPLYDVYTALTKRKGEEWDTYGGEPDPNKLLRLSLDELFDVCTSLVKPMVNYS
FT                   YVRDMFTMLPSDGEDDDNSVPLSCFFSFLVENAFHPTLNRNVEALFRAFDPEGTGVISE
FT                   ATLASPVLNAFAELNLFGHLRGEWERMASTLEIVGNIDYRIVDNIRLLTPEATRAVLCS
FT                   SPILYDAMENVDLDGSKLKVSS"
FT                   /protein_id="XP_822296.1"
FT   gene            100836..101375
FT                   /db_xref="GeneID:3661499"
FT                   /locus_tag="Tb10.70.7970"
FT   mRNA            <100836..>101375
FT                   /db_xref="GI:71746483"
FT                   /db_xref="GeneID:3661499"
FT                   /locus_tag="Tb10.70.7970"
FT                   /transcript_id="XM_817204.1"
FT                   /product="calcineurin B subunit"
FT   CDS_pept        100836..101375
FT                   /locus_tag="Tb10.70.7970"
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calcineurin B subunit"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:71746484"
FT                   /db_xref="GeneID:3661499"
FT                   /translation="MEVAAVASAPSAEEVSELRKHTRLSEAQITRLHERFTALDRCGKG
FT                   LISPSDFQSIASVASNPLLSRVLTVVSSSGDGNISFVDFAKAFAVFLPQTDRQEKLRFT
FT                   YMMYDIDGDGKISNSDLMEALKMMVGPNLTDVQLQQIVDKTFIEVDFNRDGFITFSDFE
FT                   KLSLPISLDNAHVLQF"
FT                   /protein_id="XP_822297.1"
FT   gene            101984..103012
FT                   /db_xref="GeneID:3661500"
FT                   /locus_tag="Tb10.70.7960"
FT   mRNA            <101984..>103012
FT                   /db_xref="GI:71746485"
FT                   /db_xref="GeneID:3661500"
FT                   /locus_tag="Tb10.70.7960"
FT                   /transcript_id="XM_817205.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        101984..103012
FT                   /locus_tag="Tb10.70.7960"
FT                   /gene_family="HOG000257217" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: mitochondrion [goid 0005739]"
FT                   /db_xref="GI:71746486"
FT                   /db_xref="GeneID:3661500"
FT                   /translation="MLRRSDLLLKKGWTHNPGRTRRGGKNLAWRPKMSERTLEQFVPLH
FT                   LAFPRRHPNSWQERQFHLLGYVKWPKEIGFYNAGDNFELTPQAAYRIYKQNCDETFWTR
FT                   LHNEKTIIHLLPLVEQDPGTNMVLVDDIFRHHLKRFGADHYIYNAVMQAAAFAKDFPRC
FT                   EQLLAEMRGLGLEPNAQSYVNMMLGARLTGKPRDQAEAFFREGIKTGAISAVMRLDTEF
FT                   QMWMDQLERLGSFKAKVGYLSVNEEGASPMPRDMWALWGWHRTEAKFISRKQMISEQVQ
FT                   NRVRSGKELVGTVYQKARRQPWAKYNGMFPYDYNGPAQRPAASFVDAPTPTHNAEVCGT
FT                   AY"
FT                   /protein_id="XP_822298.1"
FT   gene            103549..103998
FT                   /db_xref="GeneID:3661501"
FT                   /locus_tag="Tb10.70.7950"
FT   mRNA            <103549..>103998
FT                   /db_xref="GI:71746487"
FT                   /db_xref="GeneID:3661501"
FT                   /locus_tag="Tb10.70.7950"
FT                   /transcript_id="XM_817206.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        103549..103998
FT                   /locus_tag="Tb10.70.7950"
FT                   /gene_family="HOG000257216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746488"
FT                   /db_xref="GeneID:3661501"
FT                   /translation="MSVRIRFILTGACPPSYSGKQVQLNFPLEDENGAPTTTAHLKQLI
FT                   RTQWPENMSEMKEVVEKTEMRVLKTGNLLSDDTQIRSVLTATELSECSINPSAEGSGRA
FT                   DEDQKSVLMHLVFQSNQSQGRQRDGSAGGGRRDNASHDSGCCTML"
FT                   /protein_id="XP_822299.1"
FT   misc_feature    104016..104107
FT                   /note="CT-rich"
FT   repeat_region   104119..104149
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    105082..105119
FT                   /note="T-rich"
FT   repeat_region   105322..105361
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    105563..105585
FT                   /note="AT_rich"
FT   gene            105722..106201
FT                   /db_xref="GeneID:3663093"
FT                   /locus_tag="Tb10.70.7940"
FT   mRNA            <105722..>106201
FT                   /db_xref="GI:71746489"
FT                   /db_xref="GeneID:3663093"
FT                   /locus_tag="Tb10.70.7940"
FT                   /transcript_id="XM_817207.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        105722..106201
FT                   /locus_tag="Tb10.70.7940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746490"
FT                   /db_xref="GeneID:3663093"
FT                   /translation="MLESFEFDQERKEALNTVAELIASTIEGAESQDVHDVLSSSLHLP
FT                   HNWQEIVQKRAEQRRKLSATFTLFCEETIATPSTDGNAALDISEAPATCFLPELRPKTM
FT                   PPVTTSATRGFECPSCGNHWDVVDARKSLRNSNTSSAVRELSNADVGFCPVCEDI"
FT                   /protein_id="XP_822300.1"
FT   misc_feature    106316..106343
FT                   /note="AT_rich"
FT   repeat_region   106924..106989
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   107325..107347
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   gene            107407..108840
FT                   /db_xref="GeneID:3663094"
FT                   /locus_tag="Tb10.70.7920"
FT   mRNA            <107407..>108840
FT                   /db_xref="GI:71746491"
FT                   /db_xref="GeneID:3663094"
FT                   /locus_tag="Tb10.70.7920"
FT                   /transcript_id="XM_817208.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        107407..108840
FT                   /locus_tag="Tb10.70.7920"
FT                   /gene_family="HOG000257234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746492"
FT                   /db_xref="GeneID:3663094"
FT                   /translation="MTSVGFPCDMNTSSSLTFLANFYFHTKNGVDKNVRTTDRSRMEFW
FT                   VQRLPTVILQEIFMEVIRSDGFCFAWVGILSSVCRSWYCACQHPVMWAFMAKKVFVAYP
FT                   LVLRAQAVPEDKTNLRMRSVSNPIIDDADDFGTVSNSRDAMELPTLMTNQSLRRAIEDV
FT                   RLFDERRSYHTYVRQIRVLVLGMMLSGTLLLFSMFLFVTVCVLEGIKLGGVFTTYAALS
FT                   FLWATYWGIFTIIIANIVMEAHFEPTPLFPRLRKNKPLILTSTAILLIGLFTLVLPTLL
FT                   VHINLTREEKFSWMWCGATPLLFLLSWQLYVVLSCFSPSKWGELLRSPHVVLRPMKVVM
FT                   SLILNIPHAFPFCCAVALYSLLQYIQYGGRTYLLVAVFPLLASLPILSTLLLLDFYMKR
FT                   QMRDLLTGVSLLLASIFPLSLFWTDFRGFSLLPLAAASLLLFITHFRQVAQQSMLELVE
FT                   EIQRNRRPARWRRSHSVRM"
FT                   /protein_id="XP_822301.1"
FT   misc_feature    108858..108952
FT                   /note="CT-rich"
FT   misc_feature    109168..109194
FT                   /note="AT_rich"
FT   misc_feature    109308..109344
FT                   /note="AT_rich"
FT   misc_feature    109723..109743
FT                   /note="AT_rich"
FT   misc_feature    109921..109999
FT                   /note="T-rich"
FT   gene            110053..112782
FT                   /db_xref="GeneID:3663095"
FT                   /locus_tag="Tb10.70.7910"
FT   mRNA            <110053..>112782
FT                   /db_xref="GI:71746493"
FT                   /db_xref="GeneID:3663095"
FT                   /locus_tag="Tb10.70.7910"
FT                   /transcript_id="XM_817209.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        110053..112782
FT                   /locus_tag="Tb10.70.7910"
FT                   /gene_family="HOG000257205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746494"
FT                   /db_xref="GeneID:3663095"
FT                   /translation="MNESIIQVPLYVSTSAWRKEVQLRGLLRNHPSIIAHSDILPPATT
FT                   AKVFSTAQLAAHHRENVLAIGLNPLSTSGACVGLLTMESAEAKLSGMSKMQWLNLPSTE
FT                   PLSSVEWCEGSLLVGTSRGRIVVADVSPQTVEDSDGELQRRTCLVCSEEQTPVGDIVVP
FT                   PSKHAVSTLVRCVRSNAAVCSSSVVAVCDSRAMVWDVKGATQPVHTWVPSVDSSKNSPN
FT                   EQEPLLFAQWVPNSDSVVLTGSYSGSLVFTDIRTKEGSTSKLSLPARRGCMARCADFNT
FT                   LLPFALATASSDGIISVFDCRYPSTAVRTIPSLHGDIMSLKYLKLHSDIIATGGVDGSV
FT                   VLWNLRSLPTYRVGRAQYKCPVFDLITTPWSVEQHVIGVTCGGELTLTGLAQEAMATLA
FT                   VPVTERLSKPSGRRQEDKTAANEATELMEREKYGVGLLYSRRLREAYEVIVDCATKRFA
FT                   RKEITMAMRLAGLLDVKMLPKFDYRAKVESFEAEEKCKRELGVAALSQSQVIVAFEDAL
FT                   VRSSQWLFPSLLSENIRDLQKPAKQDVTKLEALQLNLLLHNNIASGCIGSVVGGLQYFI
FT                   ANGGNISLIDANTACSIAKKLLEVNVAEGQKFVSTLLSLVIEPDGTAVADALAKRLLIV
FT                   VQEPLVTAGMPVRQAGRHEELFVSDLLSAKRAVEVQMEIRSLGIENYKGVIAAVNKYQD
FT                   QCLRNGESGIFGWLAQEPLMLFLNCLTADSNYATFFWACVQLIEALAACPGMREVEATL
FT                   FATVNSIHVASNRLRSQLQELASKPRFTPATVREAGKTITTVLDFSVVLLRVQLECENV
FT                   AHESEMRTVPPVMCRIFDILSSASSDLLKVWETILGVLVACPLRSLVRKCCLTGMRNFA
FT                   LKVEGLLSLSSKKGGDEMLNEILDTCDEFFDRVAEDAD"
FT                   /protein_id="XP_822302.1"
FT   gene            113159..114280
FT                   /db_xref="GeneID:3663139"
FT                   /locus_tag="Tb10.70.7900"
FT   mRNA            <113159..>114280
FT                   /db_xref="GI:71746495"
FT                   /db_xref="GeneID:3663139"
FT                   /locus_tag="Tb10.70.7900"
FT                   /transcript_id="XM_817210.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        113159..114280
FT                   /locus_tag="Tb10.70.7900"
FT                   /gene_family="HOG000257204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746496"
FT                   /db_xref="GeneID:3663139"
FT                   /translation="MRVASFRASLASFSFHTRFYAAGKPGVPRAGFKAHGDIGDGRNDQ
FT                   QQLQSANPYKSREHMNHKWLILMCVGCLAGGSAAGHLTEVDETALKPPFKKSDVLSNIS
FT                   KTFEFRPDLAAMGVRVAFLLAARRAGLTTDSFDESCAVARGLEDIAGVFQQLGTMYHIS
FT                   TEDAASLVAVAALKFLKAPSESIENAWRWGRNDTDEAPPRRRRNDEKFPVEASGVQSLL
FT                   KGLCDLTDAECVALLACHSVGEFHEHVSGLDGATHIGSRYKLSNEYYKFLLSNEKRFFD
FT                   LEVPRTEENKEIRRLPKNFVCVYASTGKRGKKKQCVFNRSEVDAILKNSTWRKLAEYYA
FT                   ENEAAWAEAFQSGFTKMIDSNFKRLRPYDASTD"
FT                   /protein_id="XP_822303.1"
FT   gene            114592..114996
FT                   /db_xref="GeneID:3663140"
FT                   /locus_tag="Tb10.70.7890"
FT   mRNA            <114592..>114996
FT                   /db_xref="GI:71746497"
FT                   /db_xref="GeneID:3663140"
FT                   /locus_tag="Tb10.70.7890"
FT                   /transcript_id="XM_817211.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        114592..114996
FT                   /locus_tag="Tb10.70.7890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746498"
FT                   /db_xref="GeneID:3663140"
FT                   /translation="MSNRGFTPRAIIPPAAPSSRDKRPAGAPYGKNLNNAKATVPAQQR
FT                   VQGLKQNQPANSHPLPCESCRELMKCTQDARQALEKVLQNARMIFLDDTLHHQMDDERW
FT                   LRVLRALGGNKREYFTRIPSNCLTATDATL"
FT                   /protein_id="XP_822304.1"
FT   misc_feature    115626..115689
FT                   /note="A-rich"
FT   gene            115972..117729
FT                   /db_xref="GeneID:3663141"
FT                   /locus_tag="Tb10.70.7880"
FT   mRNA            <115972..>117729
FT                   /db_xref="GI:71746499"
FT                   /db_xref="GeneID:3663141"
FT                   /locus_tag="Tb10.70.7880"
FT                   /transcript_id="XM_817212.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        115972..117729
FT                   /locus_tag="Tb10.70.7880"
FT                   /gene_family="HOG000257256" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746500"
FT                   /db_xref="GeneID:3663141"
FT                   /translation="MLDSANVSDKEKKIQFLSLLIAAVESATGSKVSANPSKIVAGHEP
FT                   EQTNELLQLLASCAALPSDKKAAAVKAAKSAGDATKSSSSKGGDDDEKRKRREEEKKKR
FT                   KEEEGDGEKKKHKEEDGEKKKHKEEDGEKKKHREEDGERKKHKEEDSEKKKRKEGEGEE
FT                   KKKHKEEDGEKKKRKEEEGDGEKKKHRDEDGEKKKHREDDGERKKRKEEEGDGEKKKHK
FT                   EEDGEKKKRKEEEGDEKKKHREDESERKKRKEEDGEKKKRKEEEGEKKKRKEEDGDGEK
FT                   KKRRDEDDEERRRRHEERKRQEKKAAEQAQGSAGAEPSEGKGADGTTEGATGQQQLPTR
FT                   QLIRKSSAGKAPPRSKASHEVVADDGSSANVAEVIRETKRGAAGEGSKEDGEENDWMRV
FT                   AEQQAARPTKDSDGTLQDGEAKGYLGQQALRAKREQEEETARLAQDGGARGPREGGIII
FT                   HSNRAGKSGGTMAEGELSKLRQQLQLLTKASNPLGKLLESIHDDIDTMGRELEMWRSEA
FT                   RSQALAAADARRQTTESLQEVHAQLQALEDAISDQILKNHNIRRNIISNDNAIAGMVRM
FT                   FVNPDALTR"
FT                   /protein_id="XP_822305.1"
FT   misc_feature    116263..116565
FT                   /note="GA-rich"
FT   misc_feature    116621..116798
FT                   /note="A-rich"
FT   repeat_region   118066..118098
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            118672..120966
FT                   /db_xref="GeneID:3663142"
FT                   /locus_tag="Tb10.70.7860"
FT   mRNA            <118672..>120966
FT                   /db_xref="GI:71746501"
FT                   /db_xref="GeneID:3663142"
FT                   /locus_tag="Tb10.70.7860"
FT                   /transcript_id="XM_817213.1"
FT                   /product="protein kinase"
FT   CDS_pept        118672..120966
FT                   /locus_tag="Tb10.70.7860"
FT                   /gene_family="HOG000257257" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.1.37"
FT                   /note="similar to SP:Q96PY6: Serine/threonine kinase Nek1
FT                   (EC 2.7.1.37) (NimA-relatedprotein kinase 1) (NY-REN-55
FT                   antigen). {Homo sapiens}; curated by M. Parsons, P. Ward,
FT                   J. Mottram; go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:71746502"
FT                   /db_xref="GeneID:3663142"
FT                   /translation="MENYTQLRVLGKGSFGSAWLVQRRSDRVKFVAKEVRLAGLRPAER
FT                   DSAKREIDLLRTLHHPNITRYVDHFEHRGALYIVMEYADGGDLYSAIRNRRGTRFSEKE
FT                   ILHYFSQLCLAMLHLHEKHILHRDLKTQNVFLTSDGVVKLGDFGISTVLRNTFELKRTV
FT                   CGTPYYFSPELCLNKPYNNKSDVWALGCILYELTTLTHAFDGNNMKALVQKILKGSYPP
FT                   IHSSYSTSLSKLISSMLQIDPQRRPSVSEIISSPYIRESLSLLQRVVKDAHNNKGPCQL
FT                   AGDKERAAAGFKQQEKAQEAPMRAEERRKEEHAKAMHAAKERLQLRMQGEARNRENEEK
FT                   LRQLKLDQRQAEVEQKIRKQELEARVREQRKLLEKRAKAHALLEKQREEEWERNMREHA
FT                   EEVRRGQGEEGCARDNRETNAPNDRPCNRYGDGGRRSPLKVPPSPTAAAELYREMRRQA
FT                   ALNKQRFMEEMKVEQPPPAVSGQPNGNGKLPPNRGGNALGNPLGNGQQPQPISPLDDME
FT                   ARRKAYWDMRREAEENRRRALALEAGPSAVQVEQPEAAPPKESAMPHIVKKPAPQQRPQ
FT                   ANDNKPKDVCPLLYAKRTANNEGPPSPQLEPNTPANRVGVYPEVSRADSPDSGTEVKRD
FT                   EDYNALQTLIDRALTKKGDRESDEDFNDEAFVDSDISRFVLDGRTLVLPKVQATDPLMH
FT                   RIESLRLFLEGELGESKLLGAYRQMNDISADDDEAMQRVRDELPEAHHKYIPIIAQLIV
FT                   CEDAFNRQMLR"
FT                   /protein_id="XP_822306.1"
FT   gene            122438..124015
FT                   /db_xref="GeneID:3663143"
FT                   /locus_tag="Tb10.70.7840"
FT   mRNA            <122438..>124015
FT                   /db_xref="GI:71746503"
FT                   /db_xref="GeneID:3663143"
FT                   /locus_tag="Tb10.70.7840"
FT                   /transcript_id="XM_817214.1"
FT                   /product="choline dehydrogenase"
FT   CDS_pept        122438..124015
FT                   /locus_tag="Tb10.70.7840"
FT                   /gene_family="HOG000257258" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: choline dehydrogenase activity [goid 0008812];
FT                   go_process: betaine biosynthesis from choline [goid
FT                   0019285]"
FT                   /db_xref="GI:71746504"
FT                   /db_xref="GeneID:3663143"
FT                   /translation="MRCNKALHRYDAVVVGGGLAGCLVAGRLAMDNRRIAVIEEGEDIR
FT                   RQPRWHRNLACSLLSHRCGGRGYESHTNVTTPQLSHEKENAPAPVMIPTPKVLGGGGVM
FT                   GGRSWLIGDEADWTATPWDFRGDLLPRVQRLENVEGAGPHRGRRGRFTVGRSHAQSPLF
FT                   RVFCEAMSKDTSITSDFNKKAFAVRTGCGRTESFVDPNTGVAHTTLQSYLMDAIELRRP
FT                   LDVICNARVFGISSGKDDPAIATGVSYTQKGETVHVEADDVILCAGGIGTPLLLAASRG
FT                   PLPIDQSVGTNFWDAPQVKLQFRTPSSLSHNCFMDPLVQAFLWPNVTYGTPISSLRSAY
FT                   DDMICFWSSTGGQTPDVKFIFQPFTLNNDGSQPKNVTHGVQIIAQLLKPKSRGSICADG
FT                   TINPQYFSHTDDAAVLSKAVARVKELSKVLPFSNLFSELIAEHFESAGVYGGATYPAVA
FT                   PETFLVKGTRNVYACDESILPSPLLGGSLPFILALGEKFSDHYLQKLETTGKAAASEGI
FT                   DAKARIIY"
FT                   /protein_id="XP_822307.1"
FT   repeat_region   124025..124108
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            125501..126802
FT                   /db_xref="GeneID:3663144"
FT                   /locus_tag="Tb10.70.7820"
FT   mRNA            <125501..>126802
FT                   /db_xref="GI:71746505"
FT                   /db_xref="GeneID:3663144"
FT                   /locus_tag="Tb10.70.7820"
FT                   /transcript_id="XM_817215.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        125501..126802
FT                   /locus_tag="Tb10.70.7820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746506"
FT                   /db_xref="GeneID:3663144"
FT                   /translation="MVDVNGTTILTSTVGGSSQSKCIKNTNDFNNSLTRARKPLGMPQL
FT                   DEKQLEVGAPESTALNAPFVMHDGLAAPAPPATMENAAPPIGLGGPVLLVGPGSPYNAG
FT                   NLFTIDNSQGNAAFVTLCQQPSFHYQQPAPQPTVVDQEVALTHKCLQECPRAVLVAALT
FT                   SLLEEFPLLCPIIRQRCEKATMVLPKQQQHQQQQQQQQQQQHQLQHQQQGITGRFAGLT
FT                   QSAVPWAAHPPTASYDTQRTTLISTGGNSPQTGGSRKGRGNKSREEGICSLHNNVRSMN
FT                   HLQLNKQKGVYECVSGFHCLEDGCSGSASPASTKVARTPLAPVGVSQVRGGDGRGVASF
FT                   AAMSGGNLMASSKLSAPVGSIQAPKDQFSDFMANSLDSGLTPFRGDVSLGNSGIVPCDD
FT                   PQTAEGSETIDLDSSVVTLKSILHSVRMVAEMEE"
FT                   /protein_id="XP_822308.1"
FT   repeat_region   126066..126135
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    126838..126913
FT                   /note="A-rich"
FT   misc_feature    127143..127245
FT                   /note="T-rich"
FT   misc_feature    127565..127593
FT                   /note="AT_rich"
FT   misc_feature    127798..127925
FT                   /note="T-rich"
FT   repeat_region   127934..127953
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttaa"
FT                   /rpt_type="tandem"
FT   repeat_region   128017..128042
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    128580..128628
FT                   /note="T-rich"
FT   repeat_region   128816..128843
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   128869..128953
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    129162..129188
FT                   /note="AT_rich"
FT   repeat_region   129190..129238
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    129382..129478
FT                   /note="AT_rich"
FT   misc_feature    129585..129633
FT                   /note="AT_rich"
FT   misc_feature    129666..129692
FT                   /note="AT_rich"
FT   misc_feature    129776..129832
FT                   /note="AT_rich"
FT   misc_feature    130142..130219
FT                   /note="A-rich"
FT   misc_feature    130313..130342
FT                   /note="AT_rich"
FT   misc_feature    130409..130434
FT                   /note="AT_rich"
FT   misc_feature    130749..130827
FT                   /note="T-rich"
FT   misc_feature    131295..131324
FT                   /note="AT_rich"
FT   gene            131331..132335
FT                   /db_xref="GeneID:3663080"
FT                   /locus_tag="Tb10.70.7770"
FT   mRNA            <131331..>132335
FT                   /db_xref="GI:71746507"
FT                   /db_xref="GeneID:3663080"
FT                   /locus_tag="Tb10.70.7770"
FT                   /transcript_id="XM_817216.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        131331..132335
FT                   /locus_tag="Tb10.70.7770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746508"
FT                   /db_xref="GeneID:3663080"
FT                   /translation="MPLMSADGSGELPPVMLHRYPVTLGLPTADPYALAIECMLRIVGA
FT                   HYKKRDGGLPVTLEVPVDGRNKPAMKRHEGLTSCLQLIESATHQDAEVITSALEPEALC
FT                   VRLTAEVVLIPAFVYITHSDAGILRNAIQKAVEPKVASMWQRFRGSYSRHVVQQTSFCR
FT                   SYKNMGEAIENVERCLRAIEAICSINTAGNGMFILGTERPCSADALIYAAASSFFHADF
FT                   ASRQASGDIIAMQQRLREGCPTLLTYVERLRGLYFEDYSAFYHLRAPTCGMEGEATQKA
FT                   AEETFVRGRWKVLAFTGVFSITYFLVANIDVFSAVLLHYLEDDGEEEFLEDEE"
FT                   /protein_id="XP_822309.1"
FT   repeat_region   132869..132895
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            133297..134487
FT                   /db_xref="GeneID:3663117"
FT                   /locus_tag="Tb10.70.7760"
FT   mRNA            <133297..>134487
FT                   /db_xref="GI:71746509"
FT                   /db_xref="GeneID:3663117"
FT                   /locus_tag="Tb10.70.7760"
FT                   /transcript_id="XM_817217.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        133297..134487
FT                   /locus_tag="Tb10.70.7760"
FT                   /gene_family="HOG000257208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746510"
FT                   /db_xref="GeneID:3663117"
FT                   /translation="MQGSWSVLKKNCSNFFPGLLAFAQQTQEAYGIWLRIYNRQQKYGP
FT                   TDFVEQSETFSPDYHKRFHSQDKNMWVDKELCTEVSQKEVARLMTYKLDMWRMAHCAGA
FT                   LLATGGYAIPFGLFWLANDTWVPSSFNLTGEELRAWREAQDLYRYRSAPSYLTDTKWHF
FT                   DFHAYPWNETQERAWDDLFEKNDVRRDPKVVRPAAEMYDGFIKFELIRRKSLRHLCRSM
FT                   NIPTFPMLARLCNGTRVRDYWNLAWCEDYMVITQRLHESMTDEELYDYAWRRYLAPYDK
FT                   NLNREQLMERVEDYFEFLGPDFVAHGKAPNLVILTNYVLGYYNDPAYLEGDISELDKND
FT                   YDHLASWGKDAFLRRLEFENGPLRDQVEAHTQRLLAERAAIAKGDNAAAVEGRHTA"
FT                   /protein_id="XP_822310.1"
FT   gene            135497..137563
FT                   /db_xref="GeneID:3663118"
FT                   /locus_tag="Tb10.70.7750"
FT   mRNA            <135497..>137563
FT                   /db_xref="GI:71746511"
FT                   /db_xref="GeneID:3663118"
FT                   /locus_tag="Tb10.70.7750"
FT                   /transcript_id="XM_817218.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        135497..137563
FT                   /locus_tag="Tb10.70.7750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746512"
FT                   /db_xref="GeneID:3663118"
FT                   /translation="MGNEPDEARVGGVPEMPKVYEKKRTCTDIVFLCLFFVMLLAFAAL
FT                   GIIAFVDGEAKDSLNGRDRTGRYCGSGSPPEGFAESIPQGAPFQSKVWGENKYLWYPFP
FT                   LKQTAMSLNPLLYLSLGLCVQQCPMANERLLERLLKNPSSVTEEEKNTMKVYSYGGSSV
FT                   VESGMQPVNHAFPVYHTGPILRRCLPTITQPPSVRDLLMTSEYSQRVYAFVLKGVLEVK
FT                   ASWKVFLCAAAACTLLCFIFLFLVRFLISFVVWASIIACFLLLLSGGCICIQLYLNDGH
FT                   FMNLHLDVTKYSVLLLCVAIGLWIGALVYVFVIIGACPRIRLVCALAKIASRVVDNAPS
FT                   TVLLPILMNVAILCLLVWSILVALGLYNARRKTGKISFVPVTDAIGINDGSFKGIGETK
FT                   FYQGVVEGVEHRYALVYLLFGELFAFLWCVSFLNAVSFTSISFVSTFWYFSNLNGGKKR
FT                   VPFFGVLRAFVWTVFYHAGTLALGSLLIAILQIVRILLVYAAEKAEEAVDRHDLIQCLH
FT                   CYLQYALLCFENFVSSINKNIYVVVCLTSGSFCTSACTGLSVLKGHSSDLFLISWMVLC
FT                   VKILGKLFVTVGTVVTSYLLFKHTTLAPGVDSMVMPLILIGIGAYFLSGPFFDVFDSST
FT                   LALLICYCYDHHINQSVGIFYVPAELEHQLSDYSQKKKLRRLKNQQAAAHRRG"
FT                   /protein_id="XP_822311.1"
FT   misc_feature    137700..137759
FT                   /note="T-rich"
FT   repeat_region   138024..138046
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaa"
FT                   /rpt_type="tandem"
FT   misc_feature    138384..138454
FT                   /note="T-rich"
FT   misc_feature    138707..138772
FT                   /note="A-rich"
FT   repeat_region   138899..138927
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    139104..139133
FT                   /note="AT_rich"
FT   misc_feature    139811..139857
FT                   /note="AT_rich"
FT   gene            139933..141243
FT                   /db_xref="GeneID:3663119"
FT                   /locus_tag="Tb10.70.7730"
FT   mRNA            <139933..>141243
FT                   /db_xref="GI:71746513"
FT                   /db_xref="GeneID:3663119"
FT                   /locus_tag="Tb10.70.7730"
FT                   /transcript_id="XM_817219.1"
FT                   /product="ATP-dependent DEAD/H RNA helicase"
FT   CDS_pept        139933..141243
FT                   /locus_tag="Tb10.70.7730"
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAD/H RNA helicase"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_process: nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism [goid 0006139]"
FT                   /db_xref="GI:71746514"
FT                   /db_xref="GeneID:3663119"
FT                   /translation="MSSGLADFDGDDVRAPVVAAQPHIGVGLGTHSAVALGGFQDFCLK
FT                   SELANAIRENGFEHPSEVQHQALPQAMLGADILAQAKSGMGKTAVFVFALLEQVEKPTD
FT                   GQRPFCQAIVIAHARELAYQIEQEFKRFNKYLPHCTTGVFFGGVPEDENIKQLKKEVPA
FT                   IVVATPGRICSLIERKALDVSRVKWFVVDEFDRCLEDVKMRRDVQTAFLKTPKEKQVMM
FT                   FSATMTEELRNVAKKFMSNPTEIYVDQRSKLTLHGLAQYYINVTEAQKLRKLCDILDAV
FT                   EFNQVIIFTSTVERCEALSRQLQALKFPSKAIHSRMEQAERLVVYESCKTNQARIIVAT
FT                   DIFGRGVDIDRINLVVQFDMASDADSYLHRVGRAGRFGTKGLTVAFLTEEEKEIKRENR
FT                   KYTDQGIMKEVQERFEMQVQELTDIATQLNQSQYMNQ"
FT                   /protein_id="XP_822312.1"
FT   repeat_region   142177..142209
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   repeat_region   142304..142356
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   143444..143481
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    143898..143922
FT                   /note="AT_rich"
FT   misc_feature    143989..144051
FT                   /note="T-rich"
FT   gene            144156..145250
FT                   /db_xref="GeneID:3663110"
FT                   /locus_tag="Tb10.70.7710"
FT   mRNA            <144156..>145250
FT                   /db_xref="GI:71746515"
FT                   /db_xref="GeneID:3663110"
FT                   /locus_tag="Tb10.70.7710"
FT                   /transcript_id="XM_817220.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        144156..145250
FT                   /locus_tag="Tb10.70.7710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746516"
FT                   /db_xref="GeneID:3663110"
FT                   /translation="MNVYGKDQRIHNGSRTKAESWVMHSFTAITGLQASCIAVCLFRMR
FT                   GRLDNVLQNSYFITSPLQLNPVYHSQSCALEVNEDIAMFRNVTYTITGENVEYFFSRGA
FT                   FNTRILFFLVAMTTFIALVNHTLLWLDISKIRYHFVVIRKDPLAVFQVSAAVAGIFQNY
FT                   IVSREHKYMNDYLNTCNAPDRPSLHSVTPFIELYLLFGGTLVTFLINFLIAVILRCQKN
FT                   PKEELIRENELMQMEKSMTGELPFSGDQLMLSQRSRGDANVSNSSIPNQRLAHSRGPSE
FT                   GKEFRHVDPLASPTSQLSFARRDSVPASRVSVAREGRLSRGESARRALPSQASAWPPVS
FT                   GRRSFTGPVSAPAFDDIIGDSTHR"
FT                   /protein_id="XP_822313.1"
FT   gene            <146230..>146754
FT                   /db_xref="GeneID:3663111"
FT                   /locus_tag="Tb10.70.7695"
FT   mRNA            <146230..>146754
FT                   /db_xref="GI:71746517"
FT                   /db_xref="GeneID:3663111"
FT                   /locus_tag="Tb10.70.7695"
FT                   /transcript_id="XM_817221.1"
FT                   /product="40S ribosomal protein S11"
FT   CDS_pept        146230..146754
FT                   /locus_tag="Tb10.70.7695"
FT                   /gene_family="HOG000231341" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S11"
FT                   /note="similar to GB:CAB95532.1: 40S ribosomal protein S11,
FT                   probable {Trypanosoma brucei}; similar to 40S ribosomal
FT                   protein S11. (Swiss-Prot:P42756) (Dunaliella tertiolecta);
FT                   go_component: organellar small ribosomal subunit [goid
FT                   0000314]; go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_component:
FT                   cytosolic small ribosomal subunit (sensu Eukaryota) [goid
FT                   0005843]; go_function: structural constituent of ribosome
FT                   [goid 0003735]; go_process: protein biosynthesis [goid
FT                   0006412]"
FT                   /db_xref="GI:71746518"
FT                   /db_xref="GeneID:3663111"
FT                   /translation="MTSKQENYARTPTVDLTVQHEKAYQRQTAVNENIRTASKKHVNRS
FT                   GHIRYSKKIGLGFATPKAAINGKYIDRKCPFTSNVSIRGRILRGVVHSTKMRRSIVIRR
FT                   NYLHFIRKYQRYQKRHRNITVHCSPCFDPKPGDEVVVGQCRPLSKTIRYNVLQVVSKSA
FT                   ADKMGKKFSKN"
FT                   /protein_id="XP_822314.1"
FT   gene            147358..152415
FT                   /db_xref="GeneID:3663112"
FT                   /locus_tag="Tb10.70.7690"
FT   mRNA            <147358..>152415
FT                   /db_xref="GI:71746519"
FT                   /db_xref="GeneID:3663112"
FT                   /locus_tag="Tb10.70.7690"
FT                   /transcript_id="XM_817222.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        147358..152415
FT                   /locus_tag="Tb10.70.7690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746520"
FT                   /db_xref="GeneID:3663112"
FT                   /translation="MAWRYNSNSPPRGNVSANASLVSLSSANNNNRNFTDSADDNADTS
FT                   ALGNNNTFRRDRSAMDGAGAFLRSNAKGKMWSRQEGRDETPDDDVSSRDGTSPCSISFA
FT                   RPKLAPTESTTRPHRSLIFSRNPNRGVSGAATRSGMGSMSRLSVDSALNTPHRVASTRC
FT                   VEGRVTSSSIANWRLPRHSGSPPINTGECNGEMTIISESGDFDEDATGGDPLLGCADRN
FT                   LHRATEALLAEADPDLRATDFTPTKHVLQIVVKEDGTECSGAQIDERIAPLCGLQNRLD
FT                   DMLGLHIQSHKDVFNKAIGRFSDIVLAVSDSNEVLGLLKQRLGMATSSLENRAEQLQVL
FT                   RMRAAKALLMEESLKRMEAALASEREIKQLVASRHYLAAVRLLRQQKARLESPDMVNIR
FT                   ATQSMRDFANHTLETLHKNVLDGLMGCVFDKDRFSEADKQLMGRMVADGALENVAGTLS
FT                   FMGDTCGALSSQCFTGGGGKNGDSDFVSLDGIVDDPCDEGMVKNHLHFIPLCVKTLKEL
FT                   GKLDQCCEAFRSGATRSIEQCVANFLSLYDTWRRDAESSKCVGNNDDMGSTVRILELQG
FT                   RDVASCTVSHDEAVALIQQRDLCPLLNALFTELERVVRNADYLVRVVLLAYFPFLTDVP
FT                   PRSEVFDDNFSCHEWDVTQSPLRTKNELRDIVVRTLAEAISRHSEDSVSSETPESRRLA
FT                   ALKRLMAKFDVDKALKGSSSHDAPTSKKGSLRQGSVDDGSIRCESNNAVCLGDVLTSLN
FT                   AAAFLAVEEFPDGSEEVPACCERLSKAISSAVQDSFRSYMREIYLDWDLCALSSQLSYT
FT                   VELVFKLICSNDAATSSKSDATAVNLSKQNLKHRRTTSRSWWQIDSIGGSHTNETFTSL
FT                   DKMLSSHGSSGLLSAIEQIGGVSFSIVSTVNASSVEQVRAKDKKHLHSGAGTRIISSFG
FT                   EVQGAAAPLKSAARLRNWFMFTPMNILACYDCTGHFFKRWKSYKLYFATVPVVEMTNFF
FT                   QDFLERTYSPCLRAFHMMQLGKFLAEMPEPQGVHDGTESMGGPGDAGGTRANSSFATST
FT                   RQYMHHLKTQQEYMRWPTVTPGDNGCNGNAIHPVLTCVHYVGQVVQKLSRICRVLPSVL
FT                   VDKIQQFLVQPLLIELNSFLKRKVQLITRGSLSHCLLNSDFDDAFHGTHTARWDALCDE
FT                   TRRGDSYEAIDMGLFRFYRYINARRTRAGADGDVEVVVPEEMQELFNHVRVKREKQHER
FT                   SERRNEVFRSNGSLVSPISPRGAANGIQCEDVTAADLALQGDGIVVALALFCHSTEWLC
FT                   GLLLRAFGPEGWCQHSDGDKLVPGAAFRERRRPPRKGVTPMQEGTEGWQHLGNFVDQLY
FT                   TISQACLFHLLVEARFTAFQFIPQLSEHSYNIVAGAGTPDTFVQAYNRRMTNFFALLKP
FT                   YLPSKRVKFVCLTVAKPLSDLFMLEISQLRDKVISTTGVSRLQVNLLAMEAALQLVLPT
FT                   DDDVRESVKFHFARPATFVRYLSNGDVTDDLIASGDYKIFEVREMEELVRLVLKGDATA
FT                   SSVAEKIKLLHAGLEREQYDMISPLTTSPAITPNRKLPPVARGSSTGCKGHFPVSGSDA
FT                   AAHEEPGELDNAKSPSSPQRRSANNKGTLKHVDPNSGGIIDPSLVNSDLKMPSSPGDAR
FT                   EVTESHSSGSEEGDEEEEYEEEYEEYEESDEYEESDDADNDDDDSSL"
FT                   /protein_id="XP_822315.1"
FT   misc_feature    152302..152354
FT                   /note="GA-rich"
FT   gene            152753..153469
FT                   /db_xref="GeneID:3663113"
FT                   /locus_tag="Tb10.70.7680"
FT   mRNA            <152753..>153469
FT                   /db_xref="GI:71746521"
FT                   /db_xref="GeneID:3663113"
FT                   /locus_tag="Tb10.70.7680"
FT                   /transcript_id="XM_817223.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        152753..153469
FT                   /locus_tag="Tb10.70.7680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746522"
FT                   /db_xref="GeneID:3663113"
FT                   /translation="MLLQCGSCSQRIACCPGCGGRCFTFTDGRVAPITGVAPITATSVS
FT                   VAVTESPTPTTAFELFCQDTAVQEEALAANRIEGETDITWAAGGRKRVLAEMWLSADTP
FT                   VRRRYEEAAREGRKGVDLQAASGGDLSIARQKHAGNPTQVNNSNHSSSSGSSKGKIQPP
FT                   GAPVGAVPDGKANKASKKSKQRANTPTAYQLFCKRNNELHKSNRAAVFNAWKAMGAAEK
FT                   EPFDIEAAQLRVSLQK"
FT                   /protein_id="XP_822316.1"
FT   repeat_region   153785..153807
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            153991..156132
FT                   /db_xref="GeneID:3663114"
FT                   /locus_tag="Tb10.70.7670"
FT   mRNA            <153991..>156132
FT                   /db_xref="GI:71746523"
FT                   /db_xref="GeneID:3663114"
FT                   /locus_tag="Tb10.70.7670"
FT                   /transcript_id="XM_817224.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        153991..156132
FT                   /locus_tag="Tb10.70.7670"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746524"
FT                   /db_xref="GeneID:3663114"
FT                   /translation="MSRNPPDSVCVTPTRHIVTDALAESTVTMYFSVFPCNCEPIFCSN
FT                   RIPLLREAPPYCDGNVVYIGPAREVAQQKLQQLAFPRGFGCKNMEVRSGPSYSARFEQV
FT                   RKRGVLRYHRIKIASTFVALVVSENGELRTIQAKHTAVAVVITCPPNTPHYDTLLQNFD
FT                   SVLRYALHVSLDFAMWATQRFFLKLSRTAAFKELVAELEQHDRALETYSVVGAILANAL
FT                   TYTSPIPRLYSGASVTVASSASERLQSSSHDPAVSPVRNSGVFSSNPNVLVYEALRKLR
FT                   GINERFTSRVVAGFLSVSCWEGYGLSYRNGTGICVCNGIAEAQQQKGQQLNLSDGRSVG
FT                   KAAGFKCDADDIYADYWRFMEEEERQREKEAHESLRNVSGGTNSDEHEPGGGESDVWKS
FT                   EPNADIPESQAAVTEERNSSPHATESATSGTSALSCPLSLSRVGRVVIFCTDPEIAKCL
FT                   MILAAFFMRDRRVIASTTTPDMTPFAGRVESCAHSSLPVQWLMEDYNPRRFERLLCSPF
FT                   TVENIVLVIDPRSLVCQRLRVHKTFSVSPILVERFGERHPVVRPFQKLLLGNVRVASDA
FT                   VITSALRLACKLHKLGDPSSSCTKFLEWFVVCLVGRCHAIRFEKGLNSQLIKEVSPSPS
FT                   QFPHSVDERSRIGKVESPSRINDGDVSFLDLISNVFGNDGATSAGGPLPHRSTHEMIES
FT                   IFSGPKEGSQLLQYLPYDE"
FT                   /protein_id="XP_822317.1"
FT   gene            156997..158622
FT                   /db_xref="GeneID:3663115"
FT                   /locus_tag="Tb10.70.7650"
FT   mRNA            <156997..>158622
FT                   /db_xref="GI:71746525"
FT                   /db_xref="GeneID:3663115"
FT                   /locus_tag="Tb10.70.7650"
FT                   /transcript_id="XM_817225.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        156997..158622
FT                   /locus_tag="Tb10.70.7650"
FT                   /gene_family="HOG000257199" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746526"
FT                   /db_xref="GeneID:3663115"
FT                   /translation="MLYTRRLMTTGGSATADGAVSYSKGSYHIVPKKYTVGKRIAVRSY
FT                   LDRNRTELSDRTYMPQKAWFEPYTPKKFDMEHQRISHNFYNLETKLIWTAFDTPELIGI
FT                   LLHDETIKGAPHLYDAEFLESAVHWTRESRYWRCIGITKPFYNKTTLRAQCWHDRGLQV
FT                   GTLVFSQAMRDALMDLERAVRRKELGLEPNYVWDRWGPVGFIDGARTDHLPRFAHNPYV
FT                   DPDGVEVTEVDIAPFNTHEQIKERYGAFIDPDLRPFEGVFRAPSHGALTLDDVPHQEAV
FT                   RLYRDLMEKADMPVMLGNGAEIPPMDLRALFHLSANPERMKAASELSSWREVRGMLAPV
FT                   QEVCDEKVEALRLMENTRHDVARVRTFYEEKCGFSDFMRTPDKVITAAVLCYLQELQRI
FT                   CTERDWGKPLARCLTDLERVNVMGKDAFLVYRHIEDAILDKKRRVWATRFAGEANEEST
FT                   LDYLLENFGRRTEQTRNVGTTGTEFDREQEPIGRQVQRRVLDSDKASKLAEVRQKRGKM
FT                   WSNKKSVFDSLHQKQLQNVTYGVH"
FT                   /protein_id="XP_822318.1"
FT   repeat_region   158965..158984
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            159532..160506
FT                   /db_xref="GeneID:3663116"
FT                   /locus_tag="Tb10.70.7640"
FT   mRNA            <159532..>160506
FT                   /db_xref="GI:71746527"
FT                   /db_xref="GeneID:3663116"
FT                   /locus_tag="Tb10.70.7640"
FT                   /transcript_id="XM_817226.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        159532..160506
FT                   /locus_tag="Tb10.70.7640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746528"
FT                   /db_xref="GeneID:3663116"
FT                   /translation="MVVNTRVSPNARARPPPRRPVNQHHLPPLQPTTSLQPLHSPHVRK
FT                   TSEPAYRRGSTRNCCSVSATPVGADVVHYRAGNVEKDDPVSYAAKHQLPLLLNSMIRDL
FT                   LRERPEVDVDGWIMRWFEREYEEQKRVNKQRLEASTVVNTAEPTKPEPQQGHRQPSLPL
FT                   NEKWISQPFVTTVQKDVQPTTIISTTPSNMSSPTVVISLPQRRLSTEVMRTSTPSSLDS
FT                   RSCTIVMHPPEDRKANLLQLETSHPTFTKFPSISSVSVAPTIIVPRSLPQQQERRPQRI
FT                   GEEKEQQQMIVIRMPRPVDCRTKMRTTQYLDINGNDGAAPKAT"
FT                   /protein_id="XP_822319.1"
FT   repeat_region   160606..160640
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   160914..160955
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   161275..161313
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   repeat_region   161496..161545
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    161600..161683
FT                   /note="T-rich"
FT   repeat_region   162253..162313
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    162864..162907
FT                   /note="AT_rich"
FT   misc_feature    163297..163324
FT                   /note="AT_rich"
FT   repeat_region   163558..163579
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            163744..165348
FT                   /db_xref="GeneID:3663090"
FT                   /locus_tag="Tb10.70.7600"
FT   mRNA            <163744..>165348
FT                   /db_xref="GI:71746529"
FT                   /db_xref="GeneID:3663090"
FT                   /locus_tag="Tb10.70.7600"
FT                   /transcript_id="XM_817227.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        163744..165348
FT                   /locus_tag="Tb10.70.7600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746530"
FT                   /db_xref="GeneID:3663090"
FT                   /translation="MEFPQVTCDDVNALVQMCSIPHETAITSLKQCSSSLFVLLYQRLF
FT                   NCTIVGIESSPYTVEQKKWNVKCVLNELCAKCGMNVEGIDAEKIVQLNEEHISRLIALF
FT                   LEIANRMSIHTGAGRGALPVGAGLTAPTPFPAAALRPKLAEVPRDPAEDGTWYPPAAAT
FT                   HVLPTHLMRPVHAAEGHMRAAVQAYLHHNESSYRGHHDSAQLGDAVDSAHEKHKDNHDS
FT                   MRSGRKFYADVVEAEMSVSDVANSGDDDKATLLDEEDDGGSGGSFVNTEEKEIPTSQLV
FT                   EVWSAQVIPPKRHIGMGDSPDLTELRGQLTAMDKCLRRGEQRRVRLRHQQRQQSAAQNQ
FT                   RGHMDPVSDGVSAQMWRDRRAIASAFLPHGLNVDTIKGNKFYEKQPRRMIDYERRNEKI
FT                   EMLRSVRFIDELEREVGRKMVQQHRDTTMKLREEVKAALERDRQEVLERRRLIREEDQK
FT                   YRNAYTAILTAASNDLRMTKVLMLERMQHLAQQHALSLRESRRMCQLLKRESKERVRHD
FT                   LLRYASAVTEWQSHFVI"
FT                   /protein_id="XP_822320.1"
FT   repeat_region   166361..166424
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   repeat_region   166492..166516
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   gene            167064..169037
FT                   /db_xref="GeneID:3663091"
FT                   /locus_tag="Tb10.70.7580"
FT   mRNA            <167064..>169037
FT                   /db_xref="GI:71746531"
FT                   /db_xref="GeneID:3663091"
FT                   /locus_tag="Tb10.70.7580"
FT                   /transcript_id="XM_817228.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        167064..169037
FT                   /locus_tag="Tb10.70.7580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746532"
FT                   /db_xref="GeneID:3663091"
FT                   /translation="MSYKYSSREYCSPVCMRCVKSNGVRGSVDTVGGDTGRCECHTSIG
FT                   HRHKYSVERKNNAGRQTTSILSPAPCSARGTATDAPADRQNVDGQRRSSFAKPSPNDIV
FT                   WIPTSQLLPRFHGTDTGGSNEEEEYCPVTKWPKPQDIPLPSMIPLPSSVLRSLPPEKSQ
FT                   PPSQWSSIPVNEQTIKKKRGCDGQGYEVAERPVAPSVRVEGHVCPCEKRMLHTYPSNRE
FT                   TAETHEEAEQQKCDVKESEEEPANINNNNNTPGQYINECCDSDETQKYDSVQMWCQSLR
FT                   QPTRRCEQPPPRSRKSSASPTAEGFAACGTSQHRCTATHPDGSCERRRDSELRGGSGAR
FT                   ENSLHPPRKSVDSKVSRGTNNIHARKSETRKLREVVNVRTTSSNSDTASVRSEPEEVSR
FT                   DREERFRVHLTNMDELYRHLLSRYDEFQKDHADFLEKNGSSRRVVDEQTAHPQKLSIKK
FT                   DTVDLVDDIPPLPERGYSGKLYPLSEDSQKLQEQLISLETRWKQTGRPKKGGAEERMWG
FT                   LAETAVNAERDRKQTRPLARRTKTLSADRKFSSGRTYVVKKAESKESRGRTQSVKRVPT
FT                   DSKIVGTTRHMSPQGGARRRDVSPQLVYNFLAAQKDKNSEENDGNGECVSDSRGRHLDF
FT                   TREQVLHLVRERKMLFSREEKK"
FT                   /protein_id="XP_822321.1"
FT   repeat_region   169048..169089
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            169537..171891
FT                   /db_xref="GeneID:3663092"
FT                   /locus_tag="Tb10.70.7570"
FT   mRNA            <169537..>171891
FT                   /db_xref="GI:71746533"
FT                   /db_xref="GeneID:3663092"
FT                   /locus_tag="Tb10.70.7570"
FT                   /transcript_id="XM_817229.1"
FT                   /product="methyltransferase"
FT   CDS_pept        169537..171891
FT                   /locus_tag="Tb10.70.7570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyltransferase"
FT                   /note="go_function: methyltransferase activity [goid
FT                   0008168]"
FT                   /db_xref="GI:71746534"
FT                   /db_xref="GeneID:3663092"
FT                   /translation="MKPCVSAAAPADWPVASDEQKPSRPETAMEHDEETRGCSSSSVRL
FT                   QGYGVSGAGSLMDSMRQREMSGSAFFMFSLDGVNTDDPLAGNVSPLAALCPAGQYSKES
FT                   QHWFWKVLSNTSSWGMTACGSVSYSSWADPKSVRCIEGQLRLGAFLGIHAVVVPLPDFD
FT                   EEDPQCSEKLKAAALVISKHLQHSQTTNVWVRCDASRQADRVAFSRLRTFVLWGGENPP
FT                   TAEEAPHRVVRPAPYRIVAFLNFSETFGAIPSEWLGESVAAFELPNAEKLRRALSASDC
FT                   GRHMKLPSDLMPLKDSYWGTAQPMFVSLATFVVELLRRRAAPVFAMEEFVDSYQLLNTL
FT                   YEMHVADGGRDKFFDYEDVLQLPLQPLGHMLASGVYEVFEQDRTKYQQYHTAMSKYFNE
FT                   WLNHSESRSHEKMWLQGPNPRDGCGCSAMGSVYVVLLGAGRGPLISECLCAATGVGVRV
FT                   HLFVVEKNPEALELVRLRVRADPQWHDWMNYSGHVVETIYADGRSVWSGEAPGSDDRLP
FT                   PYWGLCDLVVSELLGSFGDNELSPECLDDFYCNLLSYQESSGIPCNPYLTSIPQQYTAW
FT                   IAPLHSARMEESVATAAFGGLTTPPADCHDRHAALYHSMFVSNVCRAVGLCLPQPCWTF
FT                   HHFATKVQSKEREATLNFTLSGDGRFSGFICYFSAVLFTPGDTGNVEDSIALLCASAGS
FT                   LSTVQYGRTTGLFSWFPAFLPVEPRDVVEVKCGDELSIHLKRCVDVKKGRVWYEYEASI
FT                   LVKGHPDGKFMKRLTKTMNAGGWAGHISLLT"
FT                   /protein_id="XP_822322.1"
FT   gene            172507..173169
FT                   /db_xref="GeneID:3662591"
FT                   /locus_tag="Tb10.70.7560"
FT   mRNA            <172507..>173169
FT                   /db_xref="GI:71746535"
FT                   /db_xref="GeneID:3662591"
FT                   /locus_tag="Tb10.70.7560"
FT                   /transcript_id="XM_817230.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        172507..173169
FT                   /locus_tag="Tb10.70.7560"
FT                   /gene_family="HOG000257188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746536"
FT                   /db_xref="GeneID:3662591"
FT                   /translation="MPRYYTPHEVRAHCFEDDAYVSINGKVLDITPLIQMYQGTRYASL
FT                   LQPLILAAGTDMTHLLDKKTMDFKTCIDPETGFRTYAQPFGRFAHTPTVLPDSSIDLSY
FT                   EVPWWQDERYVIGQLTRKTRKIRIVNTLNGHEHTLEVCSEETLREIVMTRYLSHNAHAL
FT                   SYTWRRLDSEPRDLDMDKTLDENGVLDESEEFESLGLNADYYIPALHLYYDDDLTEA"
FT                   /protein_id="XP_822323.1"
FT   gene            173855..175105
FT                   /db_xref="GeneID:3662592"
FT                   /locus_tag="Tb10.70.7550"
FT   mRNA            <173855..>175105
FT                   /db_xref="GI:71746537"
FT                   /db_xref="GeneID:3662592"
FT                   /locus_tag="Tb10.70.7550"
FT                   /transcript_id="XM_817231.1"
FT                   /product="2-oxoisovalerate dehydrogenase subunit alpha"
FT   CDS_pept        173855..175105
FT                   /locus_tag="Tb10.70.7550"
FT                   /gene_family="HOG000281337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-oxoisovalerate dehydrogenase subunit alpha"
FT                   /EC_number="1.2.4.4"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: oxidoreductase activity, acting on the
FT                   aldehyde or oxo group of donors, disulfide as acceptor
FT                   [goid 0016624]; go_function: 2-oxoisovalerate dehydrogenase
FT                   (acylating) activity [goid 0047101]; go_process: metabolism
FT                   [goid 0008152]"
FT                   /db_xref="GI:71746538"
FT                   /db_xref="GeneID:3662592"
FT                   /translation="MLRVSCRFFGALQEIFSRGQGVWNLDFGNSPTTEDLIFNSAPKTS
FT                   TPPFHVLDLEGNIVNKINEPVVPKETLVKIMETMIRSNTIDNILLEAQRQGRISFYLTA
FT                   LGEEATVVGTAAGLEIRDEAFLQYREAGFLLYRGYNIPQLVAQCMGNVEDVLKGRQMPI
FT                   HYGSRELNVHMVSSPLATQIPHAAGAGYAFRLENEELSDESKSRVAVVIFGEGAASEGD
FT                   FHGGVNFAAATGSNTLFVVRNNGYAISTPARVQYKGDGVLARGIGYGIPSARVDGQDVL
FT                   AILQAVQQARQIIRTTNQPVLIEALCYRLQHHSSSDDSGMYRSSDEIENFLALSPLDRF
FT                   EKFLVKRDLWTAEHTGALAKQVREELLQELRRQELLPHWPADVMHDDVYKVKTPDLVKA
FT                   QKELQAHYERNRGFYGK"
FT                   /protein_id="XP_822324.1"
FT   gene            175563..176243
FT                   /db_xref="GeneID:3662593"
FT                   /locus_tag="Tb10.70.7540"
FT   mRNA            <175563..>176243
FT                   /db_xref="GI:71746539"
FT                   /db_xref="GeneID:3662593"
FT                   /locus_tag="Tb10.70.7540"
FT                   /transcript_id="XM_817232.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        175563..176243
FT                   /locus_tag="Tb10.70.7540"
FT                   /gene_family="HOG000257187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746540"
FT                   /db_xref="GeneID:3662593"
FT                   /translation="MSYRFKGRLNPTILRKLPRNLVVFDGHCLMCQARVQYVLERNFSY
FT                   FSLLNLTHDVDKVKLEENKVLFCSFDSIEWRELRRHFPDVTKDVEGIILFEKVPSRTAD
FT                   FLSRVRRMKKRSKSLSKSNEALSFPVASSSHRRSFTDVEDELDILISTKHTAVCRVGMK
FT                   LDRWLPSVVARCMLYAMPRWIGDRWYDRVLRRRTLWGTSEEDAVRYPARVLGLKERTWR
FT                   LRDM"
FT                   /protein_id="XP_822325.1"
FT   gene            176568..177440
FT                   /db_xref="GeneID:3662594"
FT                   /locus_tag="Tb10.70.7530"
FT   mRNA            <176568..>177440
FT                   /db_xref="GI:71746541"
FT                   /db_xref="GeneID:3662594"
FT                   /locus_tag="Tb10.70.7530"
FT                   /transcript_id="XM_817233.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        176568..177440
FT                   /locus_tag="Tb10.70.7530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746542"
FT                   /db_xref="GeneID:3662594"
FT                   /translation="MRRSLVFPPCHLQEARLLQSQQLFGWYHQTRHFTSLVDRLSTGVA
FT                   RKLSSLTETHMMPLSEKHITEPRRPYPKRPSMQENLAERLAEQRRWRSRVVPQQIILSK
FT                   DKLYIEFVWSAATLSAAAAREMRQQQNNEEENGDGCTQKRKGISCGSFANDGIIKSEKL
FT                   MSHRTRFLAEFLRAYSPSTDVIGADALIYGRRGITITDVIPVGNYALRIVFSDGHSGGI
FT                   YPYEYLFHLGQCKYTKMREYIRRLREKRKSRDPPKRVPSKYVPRGRNAAEGTPKRDKTD
FT                   DCGHRVAAK"
FT                   /protein_id="XP_822326.1"
FT   gene            177882..178886
FT                   /db_xref="GeneID:3662595"
FT                   /locus_tag="Tb10.70.7520"
FT   mRNA            <177882..>178886
FT                   /db_xref="GI:71746543"
FT                   /db_xref="GeneID:3662595"
FT                   /locus_tag="Tb10.70.7520"
FT                   /transcript_id="XM_817234.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        177882..178886
FT                   /locus_tag="Tb10.70.7520"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: metal ion binding [goid 0046872]"
FT                   /db_xref="GI:71746544"
FT                   /db_xref="GeneID:3662595"
FT                   /translation="MTRTSRSTHEAVWYFTYIMVQRGGIVVLTMGLSLVVFCSVTTVRS
FT                   VIPMLVEPGTLGFMILYGLCCILSFGILFNYVAVACLCGPNIDPKETKRLTEQAEALPP
FT                   QERCRLLDAPRRFCHICERLKAPREYHCRICGRCIARRDHHCPWINNCVQAENNRYFLM
FT                   MVLYLLLSTGFVSSMLCAIYTHSVWHGSTVAARDVKRSTSHQFCKSGVYSSPILLLFGV
FT                   CIITFFILLFLFGAATLAALRNETAVESFIVAQKQSAFQGSLVPFRNPYDLGRQRNLLA
FT                   LFETKGDPLITHLRRGGRISNIWIGVWLLLPTLRPSAFDGMHYVVFDDVVHAV"
FT                   /protein_id="XP_822327.1"
FT   repeat_region   178900..178924
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            179153..179938
FT                   /db_xref="GeneID:3662596"
FT                   /locus_tag="Tb10.70.7510"
FT   mRNA            <179153..>179938
FT                   /db_xref="GI:71746545"
FT                   /db_xref="GeneID:3662596"
FT                   /locus_tag="Tb10.70.7510"
FT                   /transcript_id="XM_817235.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        179153..179938
FT                   /locus_tag="Tb10.70.7510"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746546"
FT                   /db_xref="GeneID:3662596"
FT                   /translation="MLPWLLFINAITFAALLIAVAVPPLYFQFGNANDTPTDSYPAGNS
FT                   FPGRNAEGEIVWQRLYILFAVPLCGCLNGLFLYFTYYRHMRHMQFRVELCCTEQRNLKT
FT                   ALFVFLHKKKKPSGMFSESEEEGNFSADLEGNWRLPGDSFIRGSFAFQPKEGKAPPIRT
FT                   EGLSHRAYSTTPWLPELRELQDIIASVFIQRADKLRDEVMELLHETVLMHIERDKGLTE
FT                   RSIQKSILLLLQQKEELSVPVMTKCLKQIEIEGFSKVVS"
FT                   /protein_id="XP_822328.1"
FT   gene            180560..181459
FT                   /db_xref="GeneID:3662597"
FT                   /locus_tag="Tb10.70.7500"
FT   mRNA            <180560..>181459
FT                   /db_xref="GI:71746547"
FT                   /db_xref="GeneID:3662597"
FT                   /locus_tag="Tb10.70.7500"
FT                   /transcript_id="XM_817236.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        180560..181459
FT                   /locus_tag="Tb10.70.7500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746548"
FT                   /db_xref="GeneID:3662597"
FT                   /translation="MRSAYCRKPSSGFMAHSNVVVALLSLVALHFVPYYIQGTVSADSG
FT                   SNTTVGFRCMRPFASLPRFSSTSMDAAENCKFKRYNVLNASAVVKCESTGNATGKAEPT
FT                   AVTSTCSVTIHAAFRTMGGGKDDNADAADVYRYSLQLRAINNSVVHYKGFDQNGYGLCC
FT                   SFIEGAKCTWEERETSGVQEAKQEVNATTSQAPTVKEPAVVSCPLHHGEEEHIAFRGST
FT                   VKPLHRLVVGNWEARLEFWRGGPSNREVLGRLLVPFRLTDENIAQGNNNTITERSDHTT
FT                   AVVVVAEQGQLTGSRGDL"
FT                   /protein_id="XP_822329.1"
FT   gene            182291..185542
FT                   /db_xref="GeneID:3662598"
FT                   /locus_tag="Tb10.70.7490"
FT   mRNA            <182291..>185542
FT                   /db_xref="GI:71746549"
FT                   /db_xref="GeneID:3662598"
FT                   /locus_tag="Tb10.70.7490"
FT                   /transcript_id="XM_817237.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        182291..185542
FT                   /locus_tag="Tb10.70.7490"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746550"
FT                   /db_xref="GeneID:3662598"
FT                   /translation="MPKKSEPVAPVTSARSSSPTCRPPVHPSSLGEWVNDSVNQENVKG
FT                   EAANRFHPESMRGVDSLFYRPPVQQMKTPPRGGPLGEVNADPLGELEAILTYVEHVTVS
FT                   LTRRERVSPPPESLRTLHGSLVTFRRAVNTSDRESTTRRALAAELHDQAATLLAWIARL
FT                   EYVSISQSISLRELEKEVGASAANIDAVLDAIEVRYRNHDVADVQEFFMGSRETLKSCR
FT                   SAVSDLVGGARKVLVLRRAVASREAVRVKELFGEYWGNKGGGGTVRIVCPFVDWVEKSW
FT                   FPAIEKWEAIVSGAKKEAELGDVKGAFARAQRLALTESSMIGKIIQPGETLSELLHQYL
FT                   EEPLAAVEQSLKRRKSRMEALRVAMTTKDGKRLAECLCAVEELRAGKELSAEDTELAEK
FT                   ARKQIVHLQQVGNITMALRLAVQAGETVTLFRTIHQANELLLQLGIVGNPEAGEETVQR
FT                   CNTLLREMQNLPSGVSLTDFVVKRVNPMKMNLAHVPSHVWTSETTAAYQAAWQRLATRA
FT                   MQGLCRFQHESDPESDSGTAHGLHTRSNSGLSCGSHSVRGGGNAIAAFTRTRTQQTEVG
FT                   NPQNEWSHVQFGSWVEPAASERALAGRARSSDVDGFKLKIHFEAQLRVLRIQGTETCTF
FT                   DEVYKRVHDLCTQQTALHHRPAGQKLRLRYEDAEGDCISLLTQEDWNVFISEQAPSGLR
FT                   GAKLEIYCDFPPVPSQSTLDRTPLSTTSKDGGSSPTVKNTPQTTTSARLATGGTQMKPL
FT                   LESDQAKGAKPSRCQSAGIAHRRGNGVSRLVSNRRVSHDDFHVPKQTPKTPAGMGTSAD
FT                   GGKDALEIGVPRDFDAAVHEREVPKRIGAAPSVSYTQPRAFPVKQTTSSGNAMRVSPKV
FT                   GRPLGTAAEAKKLRTPPKLVGGDVKNAVRGAGLAGNLAVEEPVEAIEAKKWKDDETGME
FT                   SDVVTSTISQARTPISQRKAPSRVVSAMKQTVPRSAVTGHHVNSRVRNAPVGGIPCDAA
FT                   VVEEKREWSVYHFRPSEIHPVANDREETPPSVGSRVKGALVTERLSGSSSTSIPNSTTT
FT                   LNGGAKKAEALIRYRQLREEKQRALKAAVQKRISK"
FT                   /protein_id="XP_822330.1"
FT   misc_feature    185939..185960
FT                   /note="AT_rich"
FT   gene            186531..187937
FT                   /db_xref="GeneID:3661551"
FT                   /locus_tag="Tb10.70.7480"
FT   mRNA            <186531..>187937
FT                   /db_xref="GI:71746551"
FT                   /db_xref="GeneID:3661551"
FT                   /locus_tag="Tb10.70.7480"
FT                   /transcript_id="XM_817238.1"
FT                   /product="ATP synthase"
FT   CDS_pept        186531..187937
FT                   /locus_tag="Tb10.70.7480"
FT                   /gene_family="HOG000257180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP synthase"
FT                   /note="go_component: proton-transporting two-sector ATPase
FT                   complex [goid 0016469]; go_function: hydrogen-transporting
FT                   ATPase activity, rotational mechanism [goid 0046961];
FT                   go_process: ATP synthesis coupled proton transport [goid
FT                   0015986]"
FT                   /db_xref="GI:71746552"
FT                   /db_xref="GeneID:3661551"
FT                   /translation="MSSTPEVADALFHVRKTGFVDETMTQVLEQLFDCPQHGRVLETYM
FT                   RGRHEDICMVLIKTLATTHNKSTLGVLLRLFADLARSSTVMGKTLGLCSSVLVDQEDPV
FT                   QMFLYLATTHSRDRMISDPALYLAATTLRYADPKLNEESLERFFAIVNESLSVNPLQVE
FT                   AVSFTVHNCAIMAHAKALRHYFFDNKLVQYFPRLLTDTIGDDAASLVQLTYEVLVVTWL
FT                   LSYEVDGVVSLQEHKMLPHIHRVIQRMQKEKCIRVALMVLWNFVQAERQYMDAVTNPSD
FT                   ATWVSDEIFKLARVNGGKGPSFIAEMVGVGMLKTLTQLARRKFGDEDISELIQDLLNVL
FT                   ENSMETLTSFSEYRGEVLSGSLEWTPVHTCAKFWQSNIMQFEKNGYEVLEALGNIIMNS
FT                   TNSLTLAVACHDIGEIVRHHPTGRALLQLPQLEGVMARVMELMSHETPEVAKNALLSVQ
FT                   KIMVQRWECI"
FT                   /protein_id="XP_822331.1"
FT   repeat_region   188951..188975
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   gene            189600..193700
FT                   /db_xref="GeneID:3661552"
FT                   /locus_tag="Tb10.70.7470"
FT   mRNA            <189600..>193700
FT                   /db_xref="GI:71746553"
FT                   /db_xref="GeneID:3661552"
FT                   /locus_tag="Tb10.70.7470"
FT                   /transcript_id="XM_817239.1"
FT                   /product="structural maintenance of chromosome 4"
FT   CDS_pept        189600..193700
FT                   /locus_tag="Tb10.70.7470"
FT                   /gene_family="HOG000257179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="structural maintenance of chromosome 4"
FT                   /note="similar to Structural maintenance of chromosome 4.
FT                   (Swiss-Prot:Q12267) (Saccharomyces cerevisiae); similar to
FT                   GB:AAS44544.1: structural maintenance of chromosome protein
FT                   4 {Trypanosoma cruzi); similar to SP:Q8CG47: Structural
FT                   maintenance of chro; go_component: condensin complex [goid
FT                   0000796]; go_component: nucleus [goid 0005634];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   chromosome segregation [goid 0007059]; go_process: mitosis
FT                   [goid 0007067]"
FT                   /db_xref="GI:71746554"
FT                   /db_xref="GeneID:3661552"
FT                   /translation="MSCESNGDIAQPVVEKVSRLIIRDIDVENFKSYAGKHRIGPFHKT
FT                   FATVVGPNGSGKSNVIDAMLFVFGKNARKIRLEKLSELIHTSAAHPNFTYASVTVHFVR
FT                   LRESAEQQRDPNQREEIPNSVLSIKREVYKTGASQYFIQGTRTTQREVVETLIKEGVDL
FT                   EHNRFLILQGEVEQIALMKPKAEREGEEGLLEYLDDLIGTNDFAQCISEATREAEAAQQ
FT                   QRLDALDRERKLRAEREALDSAKNSAIEFVKKDNLQQKTLIVLCQLRMQVVEEKLAEPR
FT                   RLLKEIDNRVEKLKVTVDEKMAEKSAAEDELHKRKKELAEATKERDAARTKRDVAQKEV
FT                   DRLKSGADEQSKSRKEKEKQIKDAASDMQKAQLQQQDADREAAIHQQNLNEAREQVEKL
FT                   QKEYDVATERFVSIFTPLRQELDKKKADFAPYEKALVEAKEQLDTAQNRLQLLDVSGTK
FT                   RQEQLHNIASALQCNMRRIEEVERLLKGADPNKYNAELKGLQETLAKAAEKKHSINASI
FT                   QDIKNSFSEGESDDRAVRFLLLQRSLKGYYGTLRQLGRIDDAYDVAAGVASNAWSYHVV
FT                   EDRETAAKALELLRTHDIGRATMIVLKEIERQIGNRMETPFTSPTPKAKRLFDLITPVN
FT                   DRFRIAFYQALGNTLVVSGLTEAREVAFGGPQRYRVVTLRGELAEPGGSLTGGGNTPRG
FT                   AGLKAARLPVDKEAVRATLQNLQAELVEAAQAECDAQSRIHELREKQRHLNPAQISQLH
FT                   VELNTLRVTVEADSQRQARIEREIREASQENERKRRALECAVEEAERQLGAAEKSHIKH
FT                   RSALEELENKIDNVGGLEYKALCQNLKTQQERVEAEDKALRECRRLSQRLRATQERKER
FT                   DIAQYNEDLNRILAESSGELEAALVTAKEIAEEVTRAFKGAEMRFNDAQLALEGAKAAV
FT                   PVAHKALVEAQRRLDDEDRFRQIEVAKMADALQELAKFEQKIDGCEEKIRENVDFYGIE
FT                   TLDLKDNEEERRDEDEENDAVNANDESASQDAEGDGRSDNGADDVLSQDREEEKVDVRN
FT                   MTFRLSAEQLLNYNYDECVHKAKLLSEEAKRLNNMIDFRAVRLWRERDAEHRKGKAEYL
FT                   RIREISDAADQRLQKLKDERRDCFMACFVRVQNRLREVYQLLTHGGDADLELVDANDPF
FT                   EGIQFVVRPPKKSWKQISNLSGGEKTLSSLALIFALHDIKPTPIYVMDEIDAALDFRNV
FT                   SIVANYILRQASGAQFIIISLRNNMFEMAHQLVGVFKRSDVARTVGINPVVFQQKVLSV
FT                   LQERKRKRTGSTGDVQIKVEDKVACNNEAADILVSSRSASRCRSSVPRAKTTPKSSQKG
FT                   SGKTPRNCGVAANGVRLKVEEDA"
FT                   /protein_id="XP_822332.1"
FT   repeat_region   193805..193828
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tc"
FT                   /rpt_type="tandem"
FT   misc_feature    194348..194403
FT                   /note="CT-rich"
FT   misc_feature    194531..194567
FT                   /note="CT-rich"
FT   repeat_region   194606..194626
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    194885..194906
FT                   /note="AT_rich"
FT   gene            195021..195401
FT                   /db_xref="GeneID:3661553"
FT                   /locus_tag="Tb10.70.7460"
FT   mRNA            <195021..>195401
FT                   /db_xref="GI:71746555"
FT                   /db_xref="GeneID:3661553"
FT                   /locus_tag="Tb10.70.7460"
FT                   /transcript_id="XM_817240.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        195021..195401
FT                   /locus_tag="Tb10.70.7460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746556"
FT                   /db_xref="GeneID:3661553"
FT                   /translation="MLNSCLCKIFMFVRFLVLIVFALCTNILSAGAKECKLMGEMEAWK
FT                   HDGGSFIHDEKSGTWHELNSDGESVASFVEFTRKDDTVVLRDESRHLFLLLRPDLAAIM
FT                   NNGDDNFQPLFQGRFVSSVSCA"
FT                   /protein_id="XP_822333.1"
FT   misc_feature    195648..195682
FT                   /note="T-rich"
FT   misc_feature    196087..196109
FT                   /note="AT_rich"
FT   gene            196635..197459
FT                   /db_xref="GeneID:3661554"
FT                   /locus_tag="Tb10.70.7450"
FT   mRNA            <196635..>197459
FT                   /db_xref="GI:71746557"
FT                   /db_xref="GeneID:3661554"
FT                   /locus_tag="Tb10.70.7450"
FT                   /transcript_id="XM_817241.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        196635..197459
FT                   /locus_tag="Tb10.70.7450"
FT                   /gene_family="HOG000257177" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746558"
FT                   /db_xref="GeneID:3661554"
FT                   /translation="MTACGWTCEEDHKRMLERSGGVALGLPFPSTGKLPPPQITYTDSL
FT                   RAAVSGTSVMALVRQVFGGAVRVWDIQSVHLAAPQESFGLRMPSVYMNRGTKLAIIALV
FT                   PLHDTPMHMGTPVIVKGSNSSDTYAALRSSYGQHDVEGDDICGDGCYTDDPDELLPLGK
FT                   QLGIDEVTGRRITVDVNPFLSVAVEPGDVILLTVYTMHSFLTNTTDCWRIMTEAVWTME
FT                   GDDVGPDPRYVGSNAPGLNKWCSERDNRKKYPRTMNEAKKAWGLVPDAPSTI"
FT                   /protein_id="XP_822334.1"
FT   repeat_region   197468..197500
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   repeat_region   197659..197679
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            198315..200213
FT                   /db_xref="GeneID:3662910"
FT                   /locus_tag="Tb10.70.7440"
FT   mRNA            <198315..>200213
FT                   /db_xref="GI:71746559"
FT                   /db_xref="GeneID:3662910"
FT                   /locus_tag="Tb10.70.7440"
FT                   /transcript_id="XM_817242.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        198315..200213
FT                   /locus_tag="Tb10.70.7440"
FT                   /gene_family="HOG000257176" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746560"
FT                   /db_xref="GeneID:3662910"
FT                   /translation="MHRQRRLVRGLLSNSSSQMLGCRPFFGMSGRGSGGAGGRGDSGKE
FT                   GEVGGKGWSGLFSGAGGLPPGFDEQRLKAVQEIFNKQSPEKQAELMKKALEFQKVFGKV
FT                   PGIGKMAQKNIEMLEKVVINNSSQQQQQTPPKANGIRSMSGAAERENKAKIKSSNESTA
FT                   AGSARISGGAAGPTIDELKKINLGPEIEELFAELSSIRAKKNSYRSKFLAAETDLEKLR
FT                   KEVEQLRETDASLRSKLRRVEQDVMLLNSENMELKEHEKEWRQVRHKNEKLTDAVQRLQ
FT                   HDNAAQDRQLSEALQVQLKEKDDMLRSLQRKLDRLRKRDPLLQFSLLCSDVARLCDTEQ
FT                   NAAKDAAEDAFNMLQGIHQQKQDAAWKSAMLQDGAAAKAFMAVVRRFYLSRVPHANYDA
FT                   LVAVDDAEALRPLVSEMGFTLEHVAAGRYVIVAPSVEVPKTFIGPYGLCAALYLAGKSV
FT                   EGEKMFSFKLTVVYPHVSSTLFGNTCRTGVQYDTARSSGPGGQAVNVSETQIIAKLSID
FT                   GDAAYTAEAQDSRSALNNREAATEKLAKTRRQHYNEQLAKQHKPEGLERELVAVVQSTL
FT                   NGNGSSGSDGMVGPVPKEIVELVNDTVAKKLLPGAELGLLYGMLYLFREAAAAASS"
FT                   /protein_id="XP_822335.1"
FT   misc_feature    200692..200761
FT                   /note="T-rich"
FT   gene            200793..201314
FT                   /db_xref="GeneID:3662911"
FT                   /locus_tag="Tb10.70.7420"
FT   mRNA            <200793..>201314
FT                   /db_xref="GI:71746561"
FT                   /db_xref="GeneID:3662911"
FT                   /locus_tag="Tb10.70.7420"
FT                   /transcript_id="XM_817243.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        200793..201314
FT                   /locus_tag="Tb10.70.7420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:71746562"
FT                   /db_xref="GeneID:3662911"
FT                   /translation="MYFCHGCQNFHTGIGASEQLTQCQACQSPLIERVYSHGQMNELCA
FT                   LYGLRHITIHEDSEVDEILHLLQFLQSAEERAARHSSATNNAIVEELMRTFVSAAEESR
FT                   SEPPEAMGPFSCRICLDSDDLDDIQVAQLPCQHRYHANCIRSWLQKSLVCPLCRASVLP
FT                   ASTADTNTTA"
FT                   /protein_id="XP_822336.1"
FT   repeat_region   201417..201437
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    201748..201770
FT                   /note="AT_rich"
FT   misc_feature    202408..202463
FT                   /note="CT-rich"
FT   repeat_region   202545..202622
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   202998..203020
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            203046..203765
FT                   /db_xref="GeneID:3662912"
FT                   /locus_tag="Tb10.70.7410"
FT   mRNA            <203046..>203765
FT                   /db_xref="GI:71746563"
FT                   /db_xref="GeneID:3662912"
FT                   /locus_tag="Tb10.70.7410"
FT                   /transcript_id="XM_817244.1"
FT                   /product="vesicle-associated membrane protein"
FT   CDS_pept        203046..203765
FT                   /locus_tag="Tb10.70.7410"
FT                   /gene_family="HOG000257174" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vesicle-associated membrane protein"
FT                   /note="Curated by Mark Field.  similar to Vesicle-
FT                   associated membrane protein 722 (AtVAMP722) (Synaptobrevin-
FT                   related protein 1). (Swiss-Prot:P47192) (Arabidopsis
FT                   thaliana;); go_component: integral to membrane [goid
FT                   0016021]; go_function: v-SNARE activity [goid 0005485];
FT                   go_process: synaptic vesicle exocytosis [goid 0016079]"
FT                   /db_xref="GI:71746564"
FT                   /db_xref="GeneID:3662912"
FT                   /translation="MQGGTKIYGGVVVRLTDRLLLCKAPGFTTSDFSIPELMWAELVSK
FT                   CAAPNMRTSSTMMANNATSSGSAAPQLSYHICTDNELAFAILSDMGLTRHKAHATLDEA
FT                   SKTFRKMFVESVASFTPKAVEVFVKPYRDLLLRSSDGGSSDDKVNKVKKAVDEVKEIAL
FT                   DNVERVMQRGQRIDDIVRSTEDLQLQAQGFQRSSRDLRQQMWWSSVKGKLLIAGVALFF
FT                   ILIVVFVFVGGKKEEKK"
FT                   /protein_id="XP_822337.1"
FT   repeat_region   204124..204151
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   misc_feature    204165..204237
FT                   /note="A-rich"
FT   misc_feature    204284..204364
FT                   /note="GA-rich"
FT   misc_feature    204553..204646
FT                   /note="GA-rich"
FT   repeat_region   205183..205239
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            205307..206527
FT                   /db_xref="GeneID:3662913"
FT                   /locus_tag="Tb10.70.7380"
FT   mRNA            <205307..>206527
FT                   /db_xref="GI:71746565"
FT                   /db_xref="GeneID:3662913"
FT                   /locus_tag="Tb10.70.7380"
FT                   /transcript_id="XM_817245.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        205307..206527
FT                   /locus_tag="Tb10.70.7380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746566"
FT                   /db_xref="GeneID:3662913"
FT                   /translation="MHPEIEALKRRNRAAGKRLVPIEPDHTNRQSRSTSCSVRRNGSIS
FT                   SLTARTPQSLEQSAERVHEERRQVSSLTSRFTATAPISVNKSYNNRNDGMYTVANGRMG
FT                   QKPQLSIPRVPARPPVGVRGKTRNNLGSFVRTPTNGEDPVACVSGPAVANVSKVGNKIS
FT                   PEMCHMPSSGGLSSTSVHPAEKDVIEEEYRQHVEESLNDGDEVSSLGGHLAKHEFKSVP
FT                   DHIRRMLEGDRIEEPYTTKLWEQINTDEGRRTNGYYECIRCGMPLVSPKHQIRFFTRGI
FT                   AAFSLMHWDGVEVRVGGVASSNNKSKSRGTSEALQLQVRCKCCSGFVGILVPDPEGEPR
FT                   NIFVVNSCCLSYVKDKTTRCKLSKPCGAHGDDGDGSGMKRLNSRNSRASEGDVEIDFND
FT                   PDIFEID"
FT                   /protein_id="XP_822338.1"
FT   misc_feature    206894..206923
FT                   /note="AT_rich"
FT   repeat_region   207162..207193
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    207249..207284
FT                   /note="AT_rich"
FT   misc_feature    207526..207603
FT                   /note="CT-rich"
FT   gene            207991..209802
FT                   /db_xref="GeneID:3662996"
FT                   /locus_tag="Tb10.70.7360"
FT   mRNA            <207991..>209802
FT                   /db_xref="GI:71746567"
FT                   /db_xref="GeneID:3662996"
FT                   /locus_tag="Tb10.70.7360"
FT                   /transcript_id="XM_817246.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        207991..209802
FT                   /locus_tag="Tb10.70.7360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746568"
FT                   /db_xref="GeneID:3662996"
FT                   /translation="MGAEKKINRPTNSGEVAENVGAFTEVMVPVWSRLCDKVIAAYKAG
FT                   EDIVVLQHFEELRATPELDVIAHDSLISAAPDLTVGAVEKKEDDRAAKKERLEYCWGRA
FT                   LLSARHLAGDDDEHINSIVESFEQQFGCVSGYLRALAINAESALEVLQLYQMMEGPVTT
FT                   RVATAALHRFLTNDASEVSGLLQFLKLNNVPLTREFHDQLEKNFVMRMKTEDAEEVFKD
FT                   MRNAGVEPVSTHPYNFIFMKTPPFKYMDLLDYYEDMLDRGIVPMNSTFRILSRQTQNGG
FT                   LVNQHFSALARGTTTGSDRRHETEGHGGTQAFFATRLEELARLKSSTTLDDALRVLRRM
FT                   DVEGTPLISGSVVLNVLLSVFCRAGHIEDTERVLQLAKERGCTPNGATLSRVLKKSNAD
FT                   RFLQAELILPDALEAGDVRLSDITDVMCHFFNNGMRSQVVRILRAYVVRCYRNPTESIP
FT                   HTVALWALRLGPFDWALGFLAILLASNDEPLSDRIQRRMHEVVKENRSREILKVLEGHK
FT                   WDRRSILLAPQLQEPTNSSDGAGEVNGRSSEGGNSGGGHHRRDMGPSWMSAMHLVLKEM
FT                   GVEKEVLMGYKAKLSALINDAKKKRDN"
FT                   /protein_id="XP_822339.1"
FT   repeat_region   209904..209935
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   misc_feature    210130..210171
FT                   /note="AT_rich"
FT   repeat_region   211318..211349
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            211624..212661
FT                   /db_xref="GeneID:3662997"
FT                   /locus_tag="Tb10.70.7350"
FT   mRNA            <211624..>212661
FT                   /db_xref="GI:71746569"
FT                   /db_xref="GeneID:3662997"
FT                   /locus_tag="Tb10.70.7350"
FT                   /transcript_id="XM_817247.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        211624..212661
FT                   /locus_tag="Tb10.70.7350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746570"
FT                   /db_xref="GeneID:3662997"
FT                   /translation="MESPVEMYRSHCQAVGVAMNSALLRGLPETTEKLRNMKVMHFGRN
FT                   FLGDRGILPLLPVIKQAKSLHTLDLRNNGIGNEGVKALCRQLRDHPSLRVLELGGNPFT
FT                   YLAARQLTYLCEYNDRITFIGVDDTLMTEPLRQSIVHRMQATMKRRENRRQRKQASPNV
FT                   IDNEENTTEEVTATGDTEYIDDAAVAMGVFVSEDPLATPLQPVEVVTEACVQLISPPAN
FT                   TPSVKSEKVAEMTGDEMISGPSPSSSSVTPPSTGAAASSTSDSRETTQANEDEVGEPAE
FT                   VFSDEEQNKVAAVEETDETSDVSVHSAGEELSGSMVDDDVQSESSVTRSDATEPQEDSI
FT                   VEDED"
FT                   /protein_id="XP_822340.1"
FT   misc_feature    212695..212742
FT                   /note="GA-rich"
FT   misc_feature    213017..213081
FT                   /note="T-rich"
FT   misc_feature    213602..213659
FT                   /note="GA-rich"
FT   misc_feature    213861..213946
FT                   /note="T-rich"
FT   gene            214354..215136
FT                   /db_xref="GeneID:3662998"
FT                   /locus_tag="Tb10.70.7330"
FT   mRNA            <214354..>215136
FT                   /db_xref="GI:71746571"
FT                   /db_xref="GeneID:3662998"
FT                   /locus_tag="Tb10.70.7330"
FT                   /transcript_id="XM_817248.1"
FT                   /product="adenylate kinase"
FT   CDS_pept        214354..215136
FT                   /locus_tag="Tb10.70.7330"
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="go_function: adenylate kinase activity [goid
FT                   0004017]"
FT                   /db_xref="GI:71746572"
FT                   /db_xref="GeneID:3662998"
FT                   /translation="MADLSDNKFAYLKDKNIPQLMEYILQKLVTDLPENPMHYIGELME
FT                   EPVPPRIIVAGPPGSGKGTQCEAIAEKFGVVHISTGDLIREEATADTEEGRELAQLMEE
FT                   GDLVPDEFISQLVYRRLQKDDAKRFGWLLDGFPRSKQQAMELDTWMCPPHLFILLDVAD
FT                   EEVFKRIEHRRADPVTGNVYHLIFNPPPKSDKELWNRLVQRTDDHRDTVAKRLEVYREE
FT                   ISWLMGHYGGITEVVDGNQGIRAVTADVLKTVESRLLR"
FT                   /protein_id="XP_822341.1"
FT   repeat_region   215180..215216
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   216098..216127
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   217112..217148
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   misc_feature    217342..217364
FT                   /note="AT_rich"
FT   gene            217408..222567
FT                   /db_xref="GeneID:3662837"
FT                   /locus_tag="Tb10.70.7320"
FT   mRNA            <217408..>222567
FT                   /db_xref="GI:71746573"
FT                   /db_xref="GeneID:3662837"
FT                   /locus_tag="Tb10.70.7320"
FT                   /transcript_id="XM_817249.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        217408..222567
FT                   /locus_tag="Tb10.70.7320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746574"
FT                   /db_xref="GeneID:3662837"
FT                   /translation="MIGTRRSTKSTSFQHLYGSQNRTLRGANGQKGFSHQRNGTAREEQ
FT                   QSTKPPGPRNSVLINRVVDVLPLFSINGTVRYIEAVGGRSAWTAEADGCIRVRSVPKGT
FT                   EVRTLEGREGCFCTCILYVESTNAMWTTFSDGFIRVFDFNTHALLSEFIKHDKAIECIW
FT                   EVEGYVFTGGRDWQIYQWKPDTYVCERRLSGHNNTVRCLCQYAGDTGAVLFSGSDDGTV
FT                   RAWDPYLPARKGKDGGPMMHIFTGHTQGVLSLELVTVSNQLWSGGEDTTIRVYDLQTLG
FT                   CVSVLKHHRAPVSSIKLIGIRVWSADKYGKTLLWDPKTLTPLKDLTTHMATDPGSMLSI
FT                   CKVKQLVSWKVWTACSGGKIYCWNADSIPIAFDGPTAGKDAVDVSDAVQLLTENKGLRG
FT                   EIEKLRRQLMGEAEDGGSSANRGSASVSPSRAKSVPSHPRHHESKMGRGTSPSATPPGK
FT                   RRSPPAFSAEYANDTPIHERANTASREGDDARGCTTCHERFFYGDAWEFIFRQDTEELC
FT                   AVIRHEVATVLGIPADQVQITQMELGSAGQGCVVKLNIQHSASLPPSEIDTMLSNYPFI
FT                   DVYELYGRYLAKKYGDPNEVHVSESGSGTLGGQVHRSLCVDDSRGEEEMANGYDDPTPL
FT                   QNMINTLLKENEELRGQLMPKAETPPDENNAEVRTALTNYEEERMKPRIAQLEKALAER
FT                   DETLHRKDERIRQLERELEATKSDTGMKEVMKDLRKREKKLLTEVEALTSQVEAMEEDK
FT                   RRAEDDASFYRRENELLRNRISAMNEQMAKASGSEAEEMQKVLTSYEEENVKPRIARLE
FT                   EVIAEKDENLQSRDEKIKKLEDELEAAKQEAKFASGESVKSNGKAGSETETSLLTEVQV
FT                   LRDQVEAMEEDKRRVEDDASFYRRENELLRNRISAMNEQMAKASGSEAEEMQKVLTSYE
FT                   EENVKPRIARLEEAVSQRDEVLRSQDERIKELTREIEENRREDKKGSYHVTDEAVVASK
FT                   EEVQALKNQMKAMKKEKEKLENESKLYRKENESLKERLSETNDQLKKSSPLHEEEKQKV
FT                   LSRYEEENMKARVARLEEAVTQRDEALRAKSERIRQLEKELRAAHREVKAALEESKKSS
FT                   SRLHSDSTQTSAEELRSLMTKAREREKEKLKNESKLYRKENESLKERLSETDDQLKKSS
FT                   SLDEEEKQKVLSRYEEEDVKPRVARLEEAVTQRDEALRAKDERIRQLEKELRAAHREAK
FT                   SALEDGRRNSSRLHSDSTQTSAEELRSLKTKMDEMENDKRRLNEEIVLLRKENETLKRN
FT                   LGDVMRRLKNPSSFIASEKQKLLSSYEEEHVKPRITRLEHAVTLRDERLQAKEDRIRQL
FT                   ERELDALRYGGKNDVDNNAVEDGKTFRQLEEALLVEIQGVKDQMRAMAKSNQKMQEEAV
FT                   CLMRENQMLRDRLAEACEQLGKTPSIEARETSRELVKCEDVSPNPRIAQLEQAVTERDE
FT                   ILHTKDERIRQLERELEMFQHENRAICGNRDCRDAGRKLAAENQELRNLVKYIENDKQK
FT                   LEHEASFFKHENDALIGRIAELESTPRAPSLSPTKTHTLSGDREALMSRLGTAIEQVHN
FT                   VQKEREAAERKIAVLQEDCRDLRMRLQHASDTPVRNEALFPSSTNCDGTYQTGLHSGED
FT                   AHLIESARGAPHSSSDAIVELLPDRLTALEDTMASLNTGLHDAIRRLSSVSDNSALLRT
FT                   QIADMLSQRSSHNLITDPHERS"
FT                   /protein_id="XP_822342.1"
FT   repeat_region   223851..223880
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tcc"
FT                   /rpt_type="tandem"
FT   gene            224264..228772
FT                   /db_xref="GeneID:3662838"
FT                   /locus_tag="Tb10.70.7300"
FT   mRNA            <224264..>228772
FT                   /db_xref="GI:71746575"
FT                   /db_xref="GeneID:3662838"
FT                   /locus_tag="Tb10.70.7300"
FT                   /transcript_id="XM_817250.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        224264..228772
FT                   /locus_tag="Tb10.70.7300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746576"
FT                   /db_xref="GeneID:3662838"
FT                   /translation="MAMRRSSPSPRPRVRSASVASIPDTQRCEGILSSRSIAGTARSIE
FT                   YVGDRCVWAAAVDGRVLVYSLSDGEVVAEAAVRENTFCTVLRLVSRRRIWAGFADGFIC
FT                   CYDSSTANLLNEFVQHDGAVNCLATTPYSEFVYSGGEDWKVYQWLKESCTYVRLFSGHS
FT                   NAVRCVVAHIVESASTRSVSEGVRSLGDDMYNNEEDEGGEGCNARVNESMEEYIISGSD
FT                   DMTIKIWDPRAPLQIELNLACLTTLRGHNGGVHSMEVFRRKQELWSGDGEGALRVWDLH
FT                   DVRKPSCVAVLEGQHSASISSIVRIDSCMWSSGKDSFVVLWDAYEKVALRRFVPGGRAA
FT                   SRPIFVMRRLYRAAHWVIWLGGLDRNIHSLSFAADGDIDGKLLRSEKRCAANKLRYMRL
FT                   QERTMELCTLVEELEEKNKALETQVQQLNALLHRSLEASQPLDHGSGRSRSAGKGGVTF
FT                   RRLKSDAEGDKAPSRLAVDTTLKLPSGIASRCSTADPSPEKSFKKDVRAWEKQEKQTIT
FT                   GDISDGQKLIDQMELITSAEFTLQDVSGVDGTSRLAFEAYKKEVELKLAEEELSRQALQ
FT                   RELAEATKYKTMWETKNDALRDAYEQIENLQRNLEGEQRYVNDLLQEMAQLSNKKVRGE
FT                   GEEDLPCADNRTPTEPRDPSTGYSLYKSIPGNYWDNICTNYPDVLRDTLFSELSELVSS
FT                   LGAVVTNIAYASTGECLLVEAVVGPTTVGREKMQSCLELHAFPQTRTLHESMSTPFRKD
FT                   ASVKKSEKDNGWKLLVEAKERAEMERDEALAVLQEATDELEAMYEYQRQVEERRAKTPG
FT                   LCDITALRDQKNSSVTSSTSQACTKVPIYVATAEEYEEVLAVMGKLERERDEVLQLLQK
FT                   SQANSVSTTNKATSTSFIDSQHRQHREDTAASQTVSVNEYSRVVAEKEGAEAECREARR
FT                   KLQKALHELESLQKLHLQAEEQRSRTRGLAGSTRLHGRKSTNESLLESREGTKVPIYVA
FT                   TAEEYEEVLAVMGKLERERDEVLQLLQKSQANSVSTTNKATSTSFIDSQHRQHREDTAA
FT                   SQTVSVNEYSRVVAEKEGAEAECREARRKLQKALHELESLQKLHLQAEEEWRKKLNSSG
FT                   YSESSWRGGKKPLLSFYPDGDPTLRGLGSGEHVKTDDTDALLSGEEVADHRLRGGRRNP
FT                   SKGSTTFGSSDRTASADQRRSRLLPTASDIDIATGHVTPGLGSYFHNLAAKEEYASAAT
FT                   QNLTRPVDVGALDLKTSKFSRYRCMLGEMWGPLVKRYRALVEDVFLMEVFRATSIPPNY
FT                   VKGLEFGRGGLFVEVDIYDVHSCENVNLCLQRHKFSVLDKLIRLSQSCSATAHDPHQLG
FT                   EETSASQRGPGCVAERNLGLNGESRKFFQQTSHCIDEAQAKELDAFRCRRAFANSLRRG
FT                   EETLRSLLISQSEIDPKVPVDSLALQREPIYCVTLDEYRCVLRQLGAASRRVTQRQRDI
FT                   SGDEQTRLWNEHVVKQAEKERRFARRLSHPYPQFAKGSHTE"
FT                   /protein_id="XP_822343.1"
FT   repeat_region   229011..229044
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            229138..229491
FT                   /db_xref="GeneID:3662839"
FT                   /locus_tag="Tb10.70.7290"
FT   mRNA            <229138..>229491
FT                   /db_xref="GI:71746577"
FT                   /db_xref="GeneID:3662839"
FT                   /locus_tag="Tb10.70.7290"
FT                   /transcript_id="XM_817251.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        229138..229491
FT                   /locus_tag="Tb10.70.7290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746578"
FT                   /db_xref="GeneID:3662839"
FT                   /translation="MSVASVWITLCYQLTRVPRSAPLVFVEDTSGGGGEIERRKMHSPF
FT                   AALSASNCRRCFCVVRGKERGLARRWGGERGNNERSTITCKKEKKTIASGRVSVCGREK
FT                   GKAKQRKLFSPVR"
FT                   /protein_id="XP_822344.1"
FT   misc_feature    229677..229705
FT                   /note="AT_rich"
FT   gene            229803..233858
FT                   /db_xref="GeneID:3662840"
FT                   /locus_tag="Tb10.70.7280"
FT   mRNA            <229803..>233858
FT                   /db_xref="GI:71746579"
FT                   /db_xref="GeneID:3662840"
FT                   /locus_tag="Tb10.70.7280"
FT                   /transcript_id="XM_817252.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        229803..233858
FT                   /locus_tag="Tb10.70.7280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746580"
FT                   /db_xref="GeneID:3662840"
FT                   /translation="MSEPREVGYRHILRSASATSKVNAKNRSPTVTKSPSTPTDSRGVS
FT                   AARMRSFSGSSVARANPRIPQKDDSSREEVRALRLLLREREEQVELLHALLSEKQLLLN
FT                   HNKAAEERLRQCDEQLGTLAAVLGLEMESQEKDNLPHTTRQAKGSELGTVKKMPSVRCI
FT                   LDRVQQLVYDKTHLESELDVKLQELEWAQTELEMLRGGTLSQKVSLKNDAGKCGSLAQE
FT                   LESQLRVNAELERTLADLKEKYIMSERILETLEKDHHQVSQVLHGKEKEVLELQRKERS
FT                   VAAESSKRREYEIYHMQWKEPNNLITTHHRCHFRGDSWVGLLREKPQAMQAALLKDISL
FT                   ELRAPYGFITIATMESVSELVVFDVIIRHPVSLSEDDVELRLIGCSFDEMSLLLKQAEN
FT                   PKEGHDLVLHQLKLLQGTIVRKEEEIAALTKQLRTTKLSLEERQRQYDEESKLVHMALD
FT                   ETEETVKVTYSELKMRELREEELKLQLQQCSETILSRDQRIMELTAQLRELNSTVAEES
FT                   EENARIRDATCSNGPGDKHDGRSAEGRKKCVENESDGLCDTLVKIPSVKMHVVEASWKG
FT                   LDPLASTEAVMTLDSRAQSIVRTILIGEMATVAHVLPLKVLSLQCTCCSLRAEVQVHIS
FT                   SQVEDADRSTEGLDKFRPRTTIAFLEEWFNMRELIESRGRRVQSLADELTSLNLSVAAF
FT                   KESGKKNEEVEKAATTGTPSCAGETSQGDEEKREEKRLCESLDQQLRLERTQVRTLQAE
FT                   KRAKELALQRANDKLNEVTAAFEALQSNFAGRDHRPTRDEDANACRLADVQAKRRHGRN
FT                   QKDNNMKGVCDAELAGGNESLRAERGDVWSALADAYEEYDTLYERYENAMKQLQDLESS
FT                   LREKLLLTKRSHVYEKQVEELTQQKEALIAEQEKQREKEALLRETVTSHQRDIDRLQKE
FT                   LDRKTEWAEEVMRRLVEEEDECSRLEGAVRSLKQHSTAEVATKEKVVSNDLKTKDIQRV
FT                   LYTFCTTTLGIDVPEQEQSVDGVLALIARAYANKASGASMQVAFADREEVSTAIQSLNT
FT                   AVQLLQQSLPTVRRRACSDVRSRGRAAVDNSPRSSPTGVRKVPSRGRPMTFSGRGATTS
FT                   PPVRAPQISGRRLLGQATPMRSAPTNTPKRHKTPQQEKVNTVGPCHPLISSATRVVQLV
FT                   QQLTGTPVQPKVKPTKTATKPLSNTAGEELAEEFVRWSREQTISLALIVKDYLHDALRA
FT                   MSQVALAHDAVTTTYQGLPVDHTLNLNTAKSCVTHALKSIVQTISSLLSHREISEIEGK
FT                   FGKDYLSMTPAPRGKTTKQEDPRRQCSAPALGLAPRPANITLSSGDHCRSVSRDVDGLS
FT                   VRPQREAL"
FT                   /protein_id="XP_822345.1"
FT   gene            234990..236357
FT                   /db_xref="GeneID:3662841"
FT                   /locus_tag="Tb10.70.7270"
FT   mRNA            <234990..>236357
FT                   /db_xref="GI:71746581"
FT                   /db_xref="GeneID:3662841"
FT                   /locus_tag="Tb10.70.7270"
FT                   /transcript_id="XM_817253.1"
FT                   /product="thymidine kinase"
FT   CDS_pept        234990..236357
FT                   /locus_tag="Tb10.70.7270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: thymidine kinase activity [goid 0004797];
FT                   go_process: nucleobase, nucleoside and nucleotide
FT                   interconversion [goid 0015949]"
FT                   /db_xref="GI:71746582"
FT                   /db_xref="GeneID:3662841"
FT                   /translation="MHDGDGNIELIIGPMFAGKTTELMRRVQRHKHAQRSCYIINYSRN
FT                   SYQNQRLSTHDQLSLTANVSIAKLSEVCDEWRDYDVIAVDNGQFFPDVVGFCARAANEG
FT                   KTVIVSALDVDCRETPFDEVCRLVPRAESVLKLSAVCMECHEHDAFLTYRTIESNEREL
FT                   YGGADMYLAVCRWCYKQLTMSHVDAQKTSASTAAVVPNGAHGRIELIIGPMFAGKTTEL
FT                   MRRVQRHKHAQRSCYIIKYTGDTRYSEGAITSHDQRALTANVSVSNLHDVGDEWRKYDV
FT                   IAVDEGQFFPGVAAFCSKAADSGKVVIVSALDADYLQEPFEEICLLVSRADSVVKLSAV
FT                   CMECHNRKASFTYRTVKSDERKLVGGSDMYMSVCRSCYETKRNMVQTEKYIYSCVGINE
FT                   GSYSECSPGPSERSSAGTSGVQTSVKVDEQNCTEPNTEAKKMPLKRKRNQMAVDTT"
FT                   /protein_id="XP_822346.1"
FT   gene            237444..246113
FT                   /db_xref="GeneID:3662842"
FT                   /locus_tag="Tb10.70.7260"
FT   mRNA            <237444..>246113
FT                   /db_xref="GI:71746583"
FT                   /db_xref="GeneID:3662842"
FT                   /locus_tag="Tb10.70.7260"
FT                   /transcript_id="XM_817254.1"
FT                   /product="kinesin"
FT   CDS_pept        237444..246113
FT                   /locus_tag="Tb10.70.7260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin"
FT                   /note="ungrouped kinesin (curated by B. Wickstead, Univ. of
FT                   Oxford); go_component: microtubule associated complex [goid
FT                   0005875]; go_function: motor activity [goid 0003774];
FT                   go_function: ATP binding [goid 0005524]"
FT                   /db_xref="GI:71746584"
FT                   /db_xref="GeneID:3662842"
FT                   /translation="MLHKPCVQVVMRFRPNPGVASPFYSTDDTGAPWLTYDERTVRVVE
FT                   RDPPMDRKRVEPNGGPCGDSNDPPVSKALVPAPVTSYTFDAVLSDTSTQRDVHKCVGEP
FT                   VIGNVLKGYNATIFSYGQTGSGKTYTMLGPYGGLADAFFEDSPFYGERGLVPRVVEELF
FT                   NRLNTMKSEEYTWRVKTQMFEIYRENIVDLLIEGDQQPQTEYRIREGKNSQGSFCMYVD
FT                   SLKEVECRTAADFMDILQRGVASRHTRETGTNDRSSRSHCLLCLFVELKHNEDYSMWTE
FT                   SRLNFVDLAGSERVATSQAEGETLKETQYINLSLSLLGNVIHRLAGGNTGHIPYRDTKL
FT                   TRVLKDSLGGNSLTTLLCHGTTEAATKSQTINTLRFAQKALRIKTRAVVNKPSKTTIKQ
FT                   QQQEFYKEHTKQLEKQIRVLQEIIRSRENTEGENSMCAKCESMSATIASLTKEIERLQK
FT                   ELIAREEQLQQTQETGDYYKKNCETLENELAKLTEEQEANDARHIEAYTILEEESENLR
FT                   AEIEALQKQLAEKPHKDASNSEALSNKNNTRKNNYNDYKNRATMTDRRTHSNCCTMTDP
FT                   VTIVMPDVMEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTK
FT                   ELINCGTMTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDGTISTNRA
FT                   TMTDCRTHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPV
FT                   AIVMPDVMEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKE
FT                   LINCGTMTDGTISTNRATMTDRRTHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGT
FT                   MTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDGTVSTNCATMTDLRS
FT                   HSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDGTISTNRATMTDLRSHSNCCT
FT                   MTDPVAIVMPDVMEDMQRRLTKELINCGTMTDGTVSTNCATMTDLRSHSNCCTMTDPVA
FT                   IVMPDVMEDMQRRLTKELINCGTMTDLRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKEL
FT                   INCGTMTDGTVSTNCATMTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTM
FT                   TDGTVSTNCATMTEVCRQSNSLDRRVSCVSGTAENVSLSGETFCRNTSVNTRECSYIAR
FT                   NTIFASSVVSSFVPVIGEGQFEWWCLDDVYAHALLFSYCNPRDVGINIGLFDDCDDKVL
FT                   LQSLGVVHRTLGSIRADYDGSVVSVIRRFLVQQRGALAGDGALEGCVPCEALFEVLISA
FT                   KNALLVEPMVSDSSTVKGEDRVCHGDGEGALDSCVYAHLQVAMTAVFSIARERGGYLSD
FT                   IFASVKVQKALEAMRQFFTSSNLFSSGSSSVSSTSEANGDSSSFLEDMLRETEVPRFVL
FT                   GGALQRAAALLKDDVVTKLQRRRLCGGLSLEEALLACYLAEERITALTEIENLREEMVQ
FT                   PVTREALDLIDGAVRAFLKSEESEDFSAEATNHMKSSSFTTALAFLFTYVAAQTATETV
FT                   GLPQDSTEHVRDALNVVAQTLLRRSVSQTSRFDVAQSNTAIDPESMQQSLRIIMDYAES
FT                   QGYYPVTCDTSEAGSRSNHHCQYSQQTRRKDTPDIDVTKREALMEKMDSPRTTPRSSPH
FT                   PRLSSPQEQRPQTSVVVVSQPNVTSHHINNLVHRGRMTNPVAIVMPDVMEDMQRRLTKE
FT                   LINCGTMTDGTISTNRATMTDLRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGT
FT                   MTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDGTISTNRATMTDLRS
FT                   HSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPVAIVMPDV
FT                   MEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTM
FT                   TDIRSHSNCCTMTDPVAIVMPDVMEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPVAI
FT                   VMPDVMEDMQRRLTKELINCGTMTDIRSHSNCCTMTDPVAIVMPDVMEDVQRRPSNRLD
FT                   ASTSLKVSKNNGDVAVYEAVRFGDEKVVVDSCSVASVSDSFPRDLSSEVGKLQLRVLDL
FT                   GKEVYMLQKELMAREEQLQKTQERADYYKKNCETLENELAKLTEEQERNDARRTEAYTI
FT                   LEEESENLRAEIEALQKQLAEKPHKDASNSEALSNKNNTRKTDSDHAVDGKENLGLHHV
FT                   SSVRSLVHLRENKAREHLRSRSLSNGREPPGGVLPTELRTWPQTAQQSAPAACTHEKGV
FT                   ERKLSEELDESDVVNHLTAQATPEMLNLKPELFVKNPASFDRLVSYLTRLVERAEREPG
FT                   ALSCEERHLSEVLKVFSTFYCGYRSIESGTGTCPIVDGNLRSRGGSSHSLRPRAKGMWS
FT                   PESLRVSPDVGRNVDAVKEDQNGKHLGPVPSASTTFRTGRSERCTSSVRGVALVGGLLA
FT                   SRRRSSTAPSPTEGPRVPLQREEIEDLEGMSELVSSIEDMQSQLAYFNFSNEPELRESI
FT                   KQLQQHLEELRAVLESQMSTTKMSRSPSYISSFRGSCFSQGNQQGQGVQEGKPPLKAES
FT                   NGCQPATDSACDTNYSNGGQTGYLAVCNAVNTCCGGRGAFHRGSNRCSHWVPLRMHRAN
FT                   HDENVGLAMNEPGGSIPQGRSNAFDDGSQRKCMAPNRRNQSAVMRRLLDSMRFDLDSYV
FT                   YTAAEQNAASAALLEESSSLKEREADMWLRLNQTEFCEMARIEMRLKRDDLRELQHEIH
FT                   RMHLLHDKELVERKRRLLIYSYRKLLDFAKRMSDILKAREFCTGTLESQRLLLLDETSD
FT                   FTKDVEKYIEVL"
FT                   /protein_id="XP_822347.1"
FT   gene            247601..248116
FT                   /db_xref="GeneID:3662843"
FT                   /locus_tag="Tb10.70.7250"
FT   mRNA            <247601..>248116
FT                   /db_xref="GI:71746585"
FT                   /db_xref="GeneID:3662843"
FT                   /locus_tag="Tb10.70.7250"
FT                   /transcript_id="XM_817255.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        247601..248116
FT                   /locus_tag="Tb10.70.7250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746586"
FT                   /db_xref="GeneID:3662843"
FT                   /translation="MRRGHHRLRVNVSGEYAGRALNLLLVSGRHVATRKLSNFEEVATL
FT                   RRELAAAQQRIAELQLSQVAVHEALLKRLEESHQAVHKAAIHARHAALALQCSHDLMER
FT                   ELRRVLSITPTSSNMSGVEVDRLRRAAVEAGAREIVRRNIGFRVEKQLEDQLQVEKDSG
FT                   ESNTIKGG"
FT                   /protein_id="XP_822348.1"
FT   gene            248475..250865
FT                   /db_xref="GeneID:3662392"
FT                   /locus_tag="Tb10.70.7240"
FT   mRNA            <248475..>250865
FT                   /db_xref="GI:71746587"
FT                   /db_xref="GeneID:3662392"
FT                   /locus_tag="Tb10.70.7240"
FT                   /transcript_id="XM_817256.1"
FT                   /product="DNA repair and recombination helicase protein
FT                   PIF1"
FT   CDS_pept        248475..250865
FT                   /locus_tag="Tb10.70.7240"
FT                   /gene_family="HOG000257146" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair and recombination helicase protein
FT                   PIF1"
FT                   /note="Curated by P. Englund.  similar to DNA repair and
FT                   recombination protein pif1, mitochondrial precursor.
FT                   (Swiss-Prot:Q9UUA2) (Schizosaccharomyces pombe); similar to
FT                   DNA repair and recombination protein PIF1, mitochondrial
FT                   precursor. (Swiss-Prot:P0727; go_component: nucleus [goid
FT                   0005634]; go_component: mitochondrion [goid 0005739];
FT                   go_function: DNA helicase activity [goid 0003678];
FT                   go_process: telomere maintenance [goid 0000723];
FT                   go_process: DNA recombination [goid 0006310]; go_process:
FT                   chromosome organization and biogenesis (sensu Eukaryota)
FT                   [goid 0007001]"
FT                   /db_xref="GI:71746588"
FT                   /db_xref="GeneID:3662392"
FT                   /translation="MVVLRPKITLTSVRGRIQVTAEDGERVGPWGGTECFLSRQTGQGP
FT                   CLVVRSSRHKRHQGTFFRLEGVRQVLSLYAMEGKLTVVVPHQKRLCSVFIETFADVDAL
FT                   QMMAATLQDRSRWKDIEKNVACRVQRITRTNVVDTKRITNMDGGTDTHLDYKQFEWGGG
FT                   EDDSCAVGGVSCNPLEGARGERNGDGVESILQERPTGLPSAHSGGKLPKHMGGDELNPQ
FT                   LEGSTTPGRMQWTTDQIVATRLVCTGSNVFITGSAGTGKTEWLLHLVRNVLPRDDRTVV
FT                   TASTGMSARLLGGCTIHSFAGIGRGEGGFNRVYNRVKSKPEVVRAWRQCQTLIIDEIGN
FT                   ISPDTFSMIDEIARSLRGAPEKPFGGIQVILLGDFLQLPPVDSPKARNEWTNGNDTDTD
FT                   SNPIPGKLKWCFETATWESLKLALVGFRKSYRQMNDPDFALCLEDIRFGRYTRRVERIL
FT                   NECSTRQIKERHGIEPTLIVARRDEATEYNAERLKMLEDVHFHRYESEDYAAIPGMNLE
FT                   KEVSLQQLLELRIGAQVVLLASLPDAPHLSNGDQGVVVSFAEQTRGPALPVVCFATSGG
FT                   EEVLVPRVSMEVLGPEGRVIATRTQIPLQLSWAITVHRAQGMTLPLVSVRLNKCFFDCG
FT                   QAYVALSRVRSREDLMLTAFDPSAIFADARAVAFYEKNFPAQRQSVEDTECELVPIKGK
FT                   TRAKHPRSQGEKNSVDEGGNAPEEHPLRTDAAFTAYHDLDSQVSTDMPLVPQPPRKKRM
FT                   LVEELPQVTSSAIPNFTQESNNGDANSQLQHPFSQNNLMVDDD"
FT                   /protein_id="XP_822349.1"
FT   repeat_region   251071..251093
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tatatg"
FT                   /rpt_type="tandem"
FT   gene            251409..252302
FT                   /db_xref="GeneID:3662393"
FT                   /locus_tag="Tb10.70.7230"
FT   mRNA            <251409..>252302
FT                   /db_xref="GI:71746589"
FT                   /db_xref="GeneID:3662393"
FT                   /locus_tag="Tb10.70.7230"
FT                   /transcript_id="XM_817257.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        251409..252302
FT                   /locus_tag="Tb10.70.7230"
FT                   /gene_family="HOG000257144" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746590"
FT                   /db_xref="GeneID:3662393"
FT                   /translation="MPQDKRLIITRAVLHKVQRVCGSADAASAEGIFIEFVVPAVVVTQ
FT                   CPELTGKYVFQLPNRTYVMNGRTTCLIVPRLLSGGAFKVNKRHGYYDAVVTAEAICKRG
FT                   DTEAARRAAQVAKTFAHFVVDSRIVSKLPSCITDGAVVTKVATMKVPSTVADEKSDRKN
FT                   EQGRKGSQKPPDGAIVKGSQQYVETEKAPVGMPPLVKLSRKCITPLHNLDEQGNLTLRL
FT                   AQGASGSVVRVRQAGQLVVRVGHGGMVPGEVCDNAKSFVYTLKREFPTVWKYIHEFQMT
FT                   SAVTEPIRFMEVHIQK"
FT                   /protein_id="XP_822350.1"
FT   gene            252691..254628
FT                   /db_xref="GeneID:3662394"
FT                   /locus_tag="Tb10.70.7220"
FT   mRNA            <252691..>254628
FT                   /db_xref="GI:71746591"
FT                   /db_xref="GeneID:3662394"
FT                   /locus_tag="Tb10.70.7220"
FT                   /transcript_id="XM_817258.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        252691..254628
FT                   /locus_tag="Tb10.70.7220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746592"
FT                   /db_xref="GeneID:3662394"
FT                   /translation="MQNVILAHDGSVVAPRRYSTTQQQTAQQPSSSTHSTRNQKHHHQQ
FT                   LQQQSDADDNCAYLQRHCIPSKVEGLFSNVLNDLPNDPLLHIVEQLRASNNSNNLSNGG
FT                   NPPNHSKQATNESIREGATGSGTTEGKEPVPPTTPCAPFTRTALVSEGLNPEPPTRGNN
FT                   PVSGAEDPFVHSMNVATESGCRPVGENLNTPPASVDAAGLSLANATPTTTPLTTSATPS
FT                   VTTCESMNAFTLASGRARTPTPPAFSELSCTNYRGSVNGARPATHAMRPSSRGSSRNEV
FT                   VQGVCGVRFGATNDIFYGGPMPPTLDRDESTRSDLSAFSVASMDLQDFLQEFRSAKVES
FT                   VGAEAKMVDINALSDIIQNVNIPLPDTPIIADLFDEVRNIAALRYDTEASPDQANDMEC
FT                   QKRISATTTVVTGSESNLIDCIYFEAFLARMAFMIQGRYPMEVLRGTFYSIGESARQKP
FT                   SADGAAQPSSVTPPQTTQQQQQQKVCAEDIRGPSTSSFGVASRPYRVAAKSGCRNSNSG
FT                   ALSADSSSNTHTSPTVIPTTAACPINCSAAEQAAEPSALLNGVPLAICVEEGLWRGLGL
FT                   PATREEVERALHTLGIPVDGNYKCHVNDFVRLVTVLTSGGMSGLSCEKTSPWGPVGIGR
FT                   ESSFLQQPQE"
FT                   /protein_id="XP_822351.1"
FT   misc_feature    256065..256105
FT                   /note="CT-rich"
FT   gene            256763..257389
FT                   /db_xref="GeneID:3662395"
FT                   /locus_tag="Tb10.70.7210"
FT   mRNA            <256763..>257389
FT                   /db_xref="GI:71746593"
FT                   /db_xref="GeneID:3662395"
FT                   /locus_tag="Tb10.70.7210"
FT                   /transcript_id="XM_817259.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        256763..257389
FT                   /locus_tag="Tb10.70.7210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746594"
FT                   /db_xref="GeneID:3662395"
FT                   /translation="MTLGPTTRVTVNVTGTVTVPLHLNALESLDDAPLQEEIMREAVRL
FT                   SLAEQLGGFDNFTVTSARKGGNHVCEARLDVGDLCSIIADVKNAYEHGERRLRELQQLI
FT                   TAIREQLKESGREGGSEDEDITVPGIVKVVSDMVEDALRGPGESSLSAAIREVSNDKSW
FT                   LEEVPVGDRSGGAASKSDEDSPSGVGYTRLPDSGEDSNGSERQLE"
FT                   /protein_id="XP_822352.1"
FT   gene            257659..259065
FT                   /db_xref="GeneID:3662396"
FT                   /locus_tag="Tb10.70.7200"
FT   mRNA            <257659..>259065
FT                   /db_xref="GI:71746595"
FT                   /db_xref="GeneID:3662396"
FT                   /locus_tag="Tb10.70.7200"
FT                   /transcript_id="XM_817260.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        257659..259065
FT                   /locus_tag="Tb10.70.7200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746596"
FT                   /db_xref="GeneID:3662396"
FT                   /translation="MLRGVTALLEAIDERAEQHARQAVERNVEINVSSCSTEGHDPAQQ
FT                   GMLRCNVPDGSVAIDPAGSGVVYLPTFPEPPFPLHGFAAPPHHDDAVAPSLNTWSHIEG
FT                   NGIATTASALAAVGRDSSSPLTGQKEKQIEALTQMVQRYQAAAEVAKQELLQQSLRVCK
FT                   LEEALQDTKTELEEHKVKSRLLLEERQRQCEELHALLERRKESVPFYHSDDIPGQAESH
FT                   VEGVEGVKTEEGDVGDLRNSVTSLQRQREWLEAQVAAGRRETTEFRQRHSAVLQDLEFL
FT                   KADLKGVQEALDSEVAAHNHSKALLQSRQRELNELRAAVERNGGTFTASGALVALRPDG
FT                   RKEGDVLLSRQLLEKHKAMETALRDAAEWRRRCERMTNRLEEERTARVSIEAPYPMGEV
FT                   GEPHSVTFFGEEYNGVVGQFIGKCGHVLDSTALHAARLLRRSSPLRIFTMVYIVCLHVL
FT                   IVVVPLMLSS"
FT                   /protein_id="XP_822353.1"
FT   gene            259436..261265
FT                   /db_xref="GeneID:3662397"
FT                   /locus_tag="Tb10.70.7190"
FT   mRNA            <259436..>261265
FT                   /db_xref="GI:71746597"
FT                   /db_xref="GeneID:3662397"
FT                   /locus_tag="Tb10.70.7190"
FT                   /transcript_id="XM_817261.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        259436..261265
FT                   /locus_tag="Tb10.70.7190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746598"
FT                   /db_xref="GeneID:3662397"
FT                   /translation="MELIDPVVPYGDREVQEALRLLEEPIIVFGETMSERRQRLRKHMV
FT                   EKGYGSLDAVRGIQHYSGFTAAAAATPRVGRMISGAVEAGGKLSDAPSELVKKRVALLP
FT                   VTLERAERRIAKLKEAFVAPTAVRAAHHSMVDRLRGLRLTKSVRNVKVVRQRDGPSTSE
FT                   SASISEFFCMPFTCCAAVPALDHIAVTGAVNGVVTMWSASTCRALGSGSTCETGWGPVR
FT                   HLAAHPIQPLFFSTTMFDSRIAMWRISTQPLDDTSNAGESGSSVAGANGGTGAVADTNL
FT                   FLKRVALSSSKHTAGINRIAVDPTGVWLASASDDTTVRLWDINNDTPLLPLVSHNGYED
FT                   VCGILDVRFHPDSSLLATADKAGRVVAWDLRSGAVSFTAAGKHGGHLQACTCLSWSLCG
FT                   FRFATGGADNNVHVWDARYLCRGAAGAPCILAGHDDVVTSVEFCRNPSFPAVPAALVST
FT                   SLDGTVRLWDMNATGASVQVLRGPSPVRGQCWPAEGGQTGETLFTVAHSKYWSLWSCVA
FT                   DGESCEVTRRETEDTVVSEVVTLLRDDVVTSGFREEEGDGDDEEEEEDEMMALRKHNKT
FT                   ATGESCLAPNNGDECAHESTDDDEDEMQLLKRK"
FT                   /protein_id="XP_822354.1"
FT   gene            261662..266932
FT                   /db_xref="GeneID:3662398"
FT                   /locus_tag="Tb10.70.7180"
FT   mRNA            <261662..>266932
FT                   /db_xref="GI:71746599"
FT                   /db_xref="GeneID:3662398"
FT                   /locus_tag="Tb10.70.7180"
FT                   /transcript_id="XM_817262.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        261662..266932
FT                   /locus_tag="Tb10.70.7180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746600"
FT                   /db_xref="GeneID:3662398"
FT                   /translation="MPRGGVRSDSHVAAEKPPRLPNADYFIDSINPDDPSSIVAAMRFL
FT                   IEMSANLSDHGNQAESIKCAESVLLLRRAHENAVAPLIGPLVEEGLLPLCSVDHAADIV
FT                   LRCNSNAVSAFNQRCFDMAELFLGKALFLTDSRTTEELNYFPSAEARRLRLRAATLNNL
FT                   GCMEKRRGRLEESLRYLRQAVDMEVALDRTTGGSPSTYLNMCTVLNELQRHDEAVIAVE
FT                   NALSAMNEQMLRQQHKQQLPTCAMMLVVGLYNLGVSLELRNRSGDVERAKNVYQQALEA
FT                   SRKYFVDPACPTVEMAMMAIQRMHADPVFREERLEKEKKERGKTAKGPLPPISKAASAD
FT                   HFSSATEPPPQQQQAAQETATSVMSVIPSTPTRISSASKASILTPPLSSATRPQMPRNM
FT                   LPDHESTNRKGPPERSVAPDMQREPQGGSEEESPGPQDPQWSSTPGGRPSFPRTQASAC
FT                   SPPSPQFTLYRPETRLEASVQEEQPPPVIEIEPESTQLSAPVPLQLLPQQRQSEEACLN
FT                   PLEDAKAAPCSESSSAKSAAALVAKPGVPGLMKVNTQVTEWRSGVVRGQSPKSLSDELR
FT                   AQTVPEVTKKAPSMGWSGSSLFSRLESMSVKSGPSSQDPFVCSTTAKQAASGPLGATKR
FT                   SGIRPLVLSPIRSQSLKSGSTASAGVSDGQHRIALSSVFESKDARKLSKGSSSSRLDTM
FT                   SLFGRRRFASITSLAPKDSSETASTSRPILSAQQAASVEKHLMRAQLGQKKAEELRGSL
FT                   SAAGRSAALARAKEREQKRLAKEEAKNDVALAGVLYEKFVEGMRTDELRRCHRAAVAIQ
FT                   RIWRGSLARTLLTRMVIASKKIQKTFRIYLVKLQAIRLAEKVMEERRQSARLKKEMENA
FT                   IIIQNRVRQFLRRLEIRRCYLARKMRHRNAACRIQRGFRAFLRWREEHLAALIEAQRAE
FT                   EERIYEMEVRAARRIQVAYRCYLKRKMEFLFEQEQERRKHAAEVIQARMRGVLARAWFR
FT                   YYKAYHYEQELKSATNQKRIVVMQTATRALLSSRLRRRMEMDLLYQLQQQILNKSATKI
FT                   QCQWRNRLARIKLDRLRAEKAVLERRVTRVKRWYQTRVLRRSFLQVRENRRQNDAATCI
FT                   AQWYRMCKVREKERETARYHAIKAREARLARLQADSVVLLQASWRAHNSFVYVRSVRSS
FT                   FLRLTLCAEFFQRIARGFQGRMELFAYKCFLIRQAQERVEAQRRARAACVVQRAWRCAF
FT                   AKDRVVHMRRCHVAATMISKHYRARLCRMELQRLREAKRFEEETAAAMRIQKAARHFLR
FT                   RLDLLRHENRKRKRKERMFILMRRDEAATTLQAIWRGRVTRRVLEEERRELAALEVHIR
FT                   KVQRAWRTHKFRCGINATVLKHTDLRKRRSTAALKIQCFWRKMVAAEKVAVLRQLHRRR
FT                   VKNARIIQRWWRCMLAKMELEARRLKRQEEVAYQLYYMERWDEAVSLINAFLQTMLSQQ
FT                   HRLVVKRKRLLEQLTDKERERYLRRHAAIIKIQRFYRGHYERMYARGVRRKKMEEEQRK
FT                   REQEALEQRSALAIQCAYRVFRACCEVTARRRAKREKQLAEELEHYTTMDPQDVVRNLF
FT                   WMHESHMKRDHIRGRLNVKARSDKAAVVIQRVVRRWLAELRMARRREKSKALRAVAIIK
FT                   SYWKKYLECKRANLLEIQRRAATIIQAQFRGYIHRCEWEERRQASEKEKRQQVLGENKF
FT                   DATATVLQSFWRRITAQRLVNRMREERMEEKNFHVTNEAARTIQQVYRCYRERRMNQNQ
FT                   "
FT                   /protein_id="XP_822355.1"
FT   gene            267278..269221
FT                   /db_xref="GeneID:3661892"
FT                   /locus_tag="Tb10.70.7170"
FT   mRNA            <267278..>269221
FT                   /db_xref="GI:71746601"
FT                   /db_xref="GeneID:3661892"
FT                   /locus_tag="Tb10.70.7170"
FT                   /transcript_id="XM_817263.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        267278..269221
FT                   /locus_tag="Tb10.70.7170"
FT                   /gene_family="HOG000259220" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746602"
FT                   /db_xref="GeneID:3661892"
FT                   /translation="MCIPLSSLFCHCPYTHCCPVYSPRISFIIHVTCHVASKGWGMAAV
FT                   EPYRRFVSIELPFCLPVTVETNTDGTHSSCATATADRHTVEAFVPPSFLRPCIDDIIPT
FT                   AREKAERQEGGNDTAGKGEPKEMLGIATTTEYCTGEIFSGWRSLDFDADLESRLEGTAD
FT                   GNRSKLTTTANEEGEAERERIRRESFPSITPQLLLQGFFRNDLLVEVKRTRRVKRLRNV
FT                   ETGRVVKETYVDGGTDHKQTGVTVLGVVSREVDIVKPADFCFSPFTSENIESFPELCSG
FT                   NIFPPGHFIGEKSPFEVALVYDSHSGKRDMDRLDNTATSFNCDEAPLWEFEGVPTLTMA
FT                   AGDPNIPPPPSQAQMDILRRLNEGFDEQGCIEVRAVKALLEERPVWVTKDLIDAIFETG
FT                   VCPRTHINKKAVACLTYIIKNGPFNRMRIRMGFNPYANPSSACLQRIAVKICRRSELGT
FT                   CLRDISRVPYINEVLQEILDSKSHKRGSEEDSGAFKRPSSLPYRPRGTLFERLARAIGL
FT                   GQLYVALQLIDVSDDAFLQELLSTVSADAEIPLEDRTWRCGWIGSGCYQRAINHIISTF
FT                   TTFIREEVEPVLQRRRSGQENDQVGESAGERSPYASSTSSVSPESYGDDDNEDSLESVS
FT                   PVDDLSQHPDDG"
FT                   /protein_id="XP_822356.1"
FT   gene            269970..271124
FT                   /db_xref="GeneID:3661893"
FT                   /locus_tag="Tb10.70.7150"
FT   mRNA            <269970..>271124
FT                   /db_xref="GI:71746603"
FT                   /db_xref="GeneID:3661893"
FT                   /locus_tag="Tb10.70.7150"
FT                   /transcript_id="XM_817264.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        269970..271124
FT                   /locus_tag="Tb10.70.7150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.7150 by DGPI
FT                   v2.04 with cleavage site probability 0.24939999 near 361;
FT                   similar to TolA protein. (Swiss-Prot:P19934) (Escherichia
FT                   coli;)"
FT                   /db_xref="GI:71746604"
FT                   /db_xref="GeneID:3661893"
FT                   /translation="MAAVMKLEKFFVATLIVAVTRCFAEEVDTVAPGKAPPQDVVNTLC
FT                   GAKHLLEAVNKKAGTLASEVEKHVTDAKASLDGTVKASKSTQTLYEKLQKDVMDAGLTA
FT                   VVVERMKGIADAAVEVAASAEEAYEKVIRTNESVGTAAAEIETSSNHSANLIDKILMAT
FT                   AGVEDKETEEDFCSGVENKYGDGLKNASRPHCRLFDNCKLDDINGKAWQPTHMELVITY
FT                   HGICYRLDAVELSMGIAKDAATKASQMKTRAEEGMASAYQESIVVAREIAGEAERKRLL
FT                   AEKELAETREKAAADAKARKEAEEEMRRRAERERAEKEEAVARAERMEKKGKTVAEVVV
FT                   KAEHDQKAKDGASDISSRRIGSLWSPLRDVWLILPAASLCLWTQ"
FT                   /protein_id="XP_822357.1"
FT   misc_feature    272041..272068
FT                   /note="AT_rich"
FT   misc_feature    272220..272245
FT                   /note="AT_rich"
FT   gene            272366..272848
FT                   /db_xref="GeneID:3661894"
FT                   /locus_tag="Tb10.70.7140"
FT   mRNA            <272366..>272848
FT                   /db_xref="GI:71746605"
FT                   /db_xref="GeneID:3661894"
FT                   /locus_tag="Tb10.70.7140"
FT                   /transcript_id="XM_817265.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        272366..272848
FT                   /locus_tag="Tb10.70.7140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746606"
FT                   /db_xref="GeneID:3661894"
FT                   /translation="MKARSSRPVTTITVTSEETIQTHNARDTPRTFEYKTKRNELMRRL
FT                   EEMRNALEEDNNNNNKGSRVKLCYYDITFNCRDPVDVTVMSGFQRFEGLGDTLSGHMKC
FT                   EEDDRHKFVGLIKEIIQLDVSHRARNMDKSEIAVVRIAANFKELNSTFTRSAATLL"
FT                   /protein_id="XP_822358.1"
FT   gene            274794..275288
FT                   /db_xref="GeneID:3661895"
FT                   /locus_tag="Tb10.70.7120"
FT   mRNA            <274794..>275288
FT                   /db_xref="GI:71746607"
FT                   /db_xref="GeneID:3661895"
FT                   /locus_tag="Tb10.70.7120"
FT                   /transcript_id="XM_817266.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        274794..275288
FT                   /locus_tag="Tb10.70.7120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746608"
FT                   /db_xref="GeneID:3661895"
FT                   /translation="MYETGRVATGGKRQREERRRVPLFWVSVPSCVIMVSLRCDFLNIP
FT                   VGGCDSDLALRDCCSAALLGSFIPSAFALGAIRGNRRRVSGTSVSFKCGFLPPPPNFLA
FT                   ECPSQVPCQPSIPEKVLGKHRISAAPRPSFLSLLRCGPSVFCRPKPHSPCLPTLLRKQG
FT                   P"
FT                   /protein_id="XP_822359.1"
FT   gene            275302..275775
FT                   /db_xref="GeneID:3661896"
FT                   /locus_tag="Tb10.70.7110"
FT   mRNA            <275302..>275775
FT                   /db_xref="GI:71746609"
FT                   /db_xref="GeneID:3661896"
FT                   /locus_tag="Tb10.70.7110"
FT                   /transcript_id="XM_817267.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        275302..275775
FT                   /locus_tag="Tb10.70.7110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746610"
FT                   /db_xref="GeneID:3661896"
FT                   /translation="MHRMPFNSFPNLSIDAMTRGAVPCTNPCHLGGDPALPDGKFLRQK
FT                   SAVLPGRKIPKHSFTSGCTLNRSPLTGEKPVVYHSPLCSLPLFAPFTPRTPHTFQKLRD
FT                   PRARRPISLSLLISSNPHNLQPHQLHHILKPPRLLCCVFGFCLNEGIHQFQSP"
FT                   /protein_id="XP_822360.1"
FT   gene            complement(278259..279653)
FT                   /db_xref="GeneID:3661897"
FT                   /locus_tag="Tb10.70.7100"
FT   mRNA            complement(<278259..>279653)
FT                   /db_xref="GI:71746611"
FT                   /db_xref="GeneID:3661897"
FT                   /locus_tag="Tb10.70.7100"
FT                   /transcript_id="XM_817268.1"
FT                   /product="serine carboxypeptidase III precursor"
FT   CDS_pept        complement(278259..279653)
FT                   /locus_tag="Tb10.70.7100"
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine carboxypeptidase III precursor"
FT                   /EC_number="3.4.16.5"
FT                   /note="Curated by J. Mottram.  similar to Serine
FT                   carboxypeptidase III precursor (EC 3.4.16.5) (CP-MIII).
FT                   (Swiss-Prot:P21529) (Hordeum vulgare); go_function: serine
FT                   carboxypeptidase activity [goid 0004185]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:71746612"
FT                   /db_xref="GeneID:3661897"
FT                   /translation="MMLCHTSLFLISLLLLLQSASALQAIRRPTLRTTGSGWEPCDPGV
FT                   NQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAPVLLWMTGGPGCSSMFALLAENGPCLM
FT                   NETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADKADYDKNEAEVSEDMYNFLQAFFG
FT                   EHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGEGIYIPLAGLAVGNGLTDPYTQY
FT                   ASYPRLAWDWCKEVLGSPCVSSFVHVMMSAMVPACQSTISACDADNSSSADSSCKLSRV
FT                   TCGPMVALFSATGLNVYDIRKTCDGPLCYNTTGVDNFMNREDVQRSLGVDPMTWQACNM
FT                   EVNLMFAVDWFKNFNYTISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEF
FT                   VKAPGTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYGAGHMVPMDQPAAASTIIEKFM
FT                   RNEPLS"
FT                   /protein_id="XP_822361.1"
FT   gene            complement(279975..281369)
FT                   /db_xref="GeneID:3661898"
FT                   /locus_tag="Tb10.70.7090"
FT   mRNA            complement(<279975..>281369)
FT                   /db_xref="GI:71746613"
FT                   /db_xref="GeneID:3661898"
FT                   /locus_tag="Tb10.70.7090"
FT                   /transcript_id="XM_817269.1"
FT                   /product="serine carboxypeptidase III precursor"
FT   CDS_pept        complement(279975..281369)
FT                   /locus_tag="Tb10.70.7090"
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine carboxypeptidase III precursor"
FT                   /EC_number="3.4.16.5"
FT                   /note="Curated by J. Mottram. GB:AAO74600.1: serine
FT                   carboxypeptidase precursor {Trypanosoma cruzi;};
FT                   go_function: serine carboxypeptidase activity [goid
FT                   0004185]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:71746614"
FT                   /db_xref="GeneID:3661898"
FT                   /translation="MMLCHTSLFLISLLLLLQSASALQAIRRPTLRTTGSGWEPCDPGV
FT                   NQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAPVLLWMTGGPGCSSMFALLAENGPCLM
FT                   NETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADKADYDKNEAEVSEDMYNFLQAFFG
FT                   EHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGEGIYIPLAGLAVGNGLTDPYTQY
FT                   ASYPRLAWDWCKEVLGYSCISRETYDSMNSMVPACQSNISACDADNSSSADSYCEMAGA
FT                   ACSGFVSDFLLTGINVYDIRKTCDGPLCYNTTGIDNFMNREDVQRSLGVDPMTWQACNM
FT                   EVNLMFDIDWFKNFNYTISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEF
FT                   VKAPDTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYRAGHMVPMDQPAAASTIIEKFM
FT                   RNEPLS"
FT                   /protein_id="XP_822362.1"
FT   gene            complement(281984..283384)
FT                   /db_xref="GeneID:3661899"
FT                   /locus_tag="Tb10.70.7080"
FT   mRNA            complement(<281984..>283384)
FT                   /db_xref="GI:71746615"
FT                   /db_xref="GeneID:3661899"
FT                   /locus_tag="Tb10.70.7080"
FT                   /transcript_id="XM_817270.1"
FT                   /product="serine carboxypeptidase III precursor"
FT   CDS_pept        complement(281984..283384)
FT                   /locus_tag="Tb10.70.7080"
FT                   /gene_family="HOG000198296" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine carboxypeptidase III precursor"
FT                   /EC_number="3.4.16.5"
FT                   /note="Curated by J. Mottram.  similar to Serine
FT                   carboxypeptidase III precursor (EC 3.4.16.5). (Swiss-
FT                   Prot:32826)(Arabidopsis thaliana); go_function: serine
FT                   carboxypeptidase activity [goid 0004185]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:71746616"
FT                   /db_xref="GeneID:3661899"
FT                   /translation="MRLISYPVMLSLLAACILVVVLANTVYRSLSLALRTTGSGWEPCD
FT                   PGVNQWSGYFDIPGEQSDKHYFYWAFGPRDGNPNAPVLLWMTGGPGCSSMFALLAENGP
FT                   CLMNETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADKADYDKNEAEVSEDMYNFLQA
FT                   FFGEHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGEGIYIPLAGLAVGNGLTDPY
FT                   TQYASYPRLAWDWCKEVLGSPCVSRETYDSMNSMVPACQKVINACNAGASSSQYLCKLS
FT                   RVTCDPVTNLFTLTKISTYDIRRKCNATLCYKFDAIPAFMNRENVQKSLGVRPTVWKSC
FT                   VFDASKMFNIDWSKNFNYTISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSE
FT                   EFVKAPDTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYRAGHMVPMDQPAAASTIIEK
FT                   FMRNEPLS"
FT                   /protein_id="XP_822363.1"
FT   misc_feature    283443..283468
FT                   /note="AT_rich"
FT   misc_feature    283887..283909
FT                   /note="AT_rich"
FT   gene            complement(284914..286524)
FT                   /db_xref="GeneID:3662338"
FT                   /locus_tag="Tb10.70.7050"
FT   mRNA            complement(<284914..>286524)
FT                   /db_xref="GI:71746617"
FT                   /db_xref="GeneID:3662338"
FT                   /locus_tag="Tb10.70.7050"
FT                   /transcript_id="XM_817271.1"
FT                   /product="t-complex protein 1 subunit delta"
FT   CDS_pept        complement(284914..286524)
FT                   /locus_tag="Tb10.70.7050"
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="t-complex protein 1 subunit delta"
FT                   /note="similar to T-complex protein 1, subunit delta
FT                   (TCP-1-delta) (CCT-delta). (Swiss-Prot:P47208)
FT                   (Caenorhabditis elegans;); go_component:
FT                   chaperonin-containing T-complex [goid 0005832];
FT                   go_function: unfolded protein binding [goid 0051082];
FT                   go_process: regulation of cell cycle [goid 0000074];
FT                   go_process: protein folding [goid 0006457]"
FT                   /db_xref="GI:71746618"
FT                   /db_xref="GeneID:3662338"
FT                   /translation="MSTKKANENKKDTNTQTDVRLSNITSAKAVADCIRTSLGPRGMDK
FT                   MIIEPRGEVIISNDGATILSKLQVTHPCAKMLVELSKAQDVEAGDGTTSVVVLCGALLR
FT                   AVEELLLKGIHPTQISECFNECAKLAEQVLEGMSVKIDINDRETLIRAAITSLNSKIIS
FT                   QNSDLIAPMAVDAVRQIMRDNGDVDLRDVRIVTALGGTIDESVMLSNGMVFKQKASHVA
FT                   GGPVRIANATIALIQFQLSPPKTDMESTVTISDYNQMDRALKEERKYLLNLCKQIKDAG
FT                   VNVLLVQKSVLRDAVTVQSLDFLAKMKIMVVKDVERSDIDFITKTIGCLPVANIENLKP
FT                   EKFGHADLVVEENTPSGKIIRITGVQPPSEKINLQLFGKTVTFFLRGSNNLMLEEAERA
FT                   LHDSLCVIRSIVKKRAIVAGGAAGETEVCLQLSKYARERAQGMQTFCMRAFADAFEVVP
FT                   YTLAENAGLQPISIVTELRNAHASGNKNAGVNVRKGCVTDMVEENVVQPLLVSTSAVRL
FT                   AAECVMMILKIDDIIMTRA"
FT                   /protein_id="XP_822364.1"
FT   gene            complement(287473..288378)
FT                   /db_xref="GeneID:3662339"
FT                   /locus_tag="Tb10.70.7040"
FT   mRNA            complement(<287473..>288378)
FT                   /db_xref="GI:71746619"
FT                   /db_xref="GeneID:3662339"
FT                   /locus_tag="Tb10.70.7040"
FT                   /transcript_id="XM_817272.1"
FT                   /product="cell division protein kinase 2 homolog 1"
FT   CDS_pept        complement(287473..288378)
FT                   /locus_tag="Tb10.70.7040"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell division protein kinase 2 homolog 1"
FT                   /EC_number="2.7.1.37"
FT                   /note="curated by M. Parsons, P. Ward, J. Mottram;
FT                   identical to SP:P38973: Cell division control protein 2
FT                   homolog 1 (EC 2.7.1.-). {Trypanosoma brucei brucei;};
FT                   go_function: protein serine/threonine kinase activity [goid
FT                   0004674]; go_function: ATP binding [goid 0005524];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]; go_process: cell cycle [goid 0007049]"
FT                   /db_xref="GI:71746620"
FT                   /db_xref="GeneID:3662339"
FT                   /translation="MGSRYERLQKIGEGSYGVVFRARDVTTGTIVAVKRIRLEKEEEGV
FT                   PCTAIREISILKELRHENIVRLLDVCHSEKRLTLVFECMEMDLKKYMDHVGGDLDAGTI
FT                   QEFMRSLLSGVRFCHERNVLHRDLKPPNLLISREKELKLADFGLGRAFGIPVKKFTQEV
FT                   VTLWYRSPDVLLGSTQYGTPVDIWSVGCIFAEMAIGAPLFTGKNDADQLLRIFQFLGTP
FT                   NRQVWPSMDTYPNSSNMLSRPEFQQTLAATCEEQFQTNPAYAKLGPQGIDLLRWLLRYE
FT                   PSERLTAAQALEHPYFSVEF"
FT                   /protein_id="XP_822365.1"
FT   gene            complement(289141..289572)
FT                   /db_xref="GeneID:3662340"
FT                   /locus_tag="Tb10.70.7030"
FT   mRNA            complement(<289141..>289572)
FT                   /db_xref="GI:71746621"
FT                   /db_xref="GeneID:3662340"
FT                   /locus_tag="Tb10.70.7030"
FT                   /transcript_id="XM_817273.1"
FT                   /product="40S ribosomal protein S23"
FT   CDS_pept        complement(289141..289572)
FT                   /locus_tag="Tb10.70.7030"
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S23"
FT                   /note="similar to 40S ribosomal protein S23. (Swiss-
FT                   Prot:P39028) (Homo sapiens;Mus musculus;Rattus norvegicus);
FT                   go_component: cytosolic small ribosomal subunit (sensu
FT                   Eukaryota) [goid 0005843]; go_function: RNA binding [goid
FT                   0003723]; go_function: structural constituent of ribosome
FT                   [goid 0003735]; go_process: protein biosynthesis [goid
FT                   0006412]"
FT                   /db_xref="GI:71746622"
FT                   /db_xref="GeneID:3662340"
FT                   /translation="MTKTNGQHAARKLVRLRRKNRWADKGWKKSHTFVAQKANPFGGSS
FT                   HAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGCLHFIEENDEVLVSG
FT                   FGRSGHAVGDIPGVRFKIVKVSSVGLYALYRQKKEKPRN"
FT                   /protein_id="XP_822366.1"
FT   gene            complement(289953..290384)
FT                   /db_xref="GeneID:3662341"
FT                   /locus_tag="Tb10.70.7020"
FT   mRNA            complement(<289953..>290384)
FT                   /db_xref="GI:71746623"
FT                   /db_xref="GeneID:3662341"
FT                   /locus_tag="Tb10.70.7020"
FT                   /transcript_id="XM_817274.1"
FT                   /product="40S ribosomal protein S23"
FT   CDS_pept        complement(289953..290384)
FT                   /locus_tag="Tb10.70.7020"
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S23"
FT                   /note="similar to 40S ribosomal protein S23. (Swiss-
FT                   Prot:P39028) (Homo sapiens;Mus musculus;Rattus norvegicus);
FT                   go_component: cytosolic small ribosomal subunit (sensu
FT                   Eukaryota) [goid 0005843]; go_function: RNA binding [goid
FT                   0003723]; go_function: structural constituent of ribosome
FT                   [goid 0003735]; go_process: protein biosynthesis [goid
FT                   0006412]"
FT                   /db_xref="GI:71746624"
FT                   /db_xref="GeneID:3662341"
FT                   /translation="MTKTNGQHAARKLVRLRRKNRWADKGWKKSHTFVAQKANPFGGSS
FT                   HAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPNDGCLHFIEENDEVLVSG
FT                   FGRSGHAVGDIPGVRFKIVKVSSVGLYALYRQKKEKPRN"
FT                   /protein_id="XP_822367.1"
FT   gene            complement(290846..291415)
FT                   /db_xref="GeneID:3662342"
FT                   /locus_tag="Tb10.70.7010"
FT   mRNA            complement(<290846..>291415)
FT                   /db_xref="GI:71746625"
FT                   /db_xref="GeneID:3662342"
FT                   /locus_tag="Tb10.70.7010"
FT                   /transcript_id="XM_817275.1"
FT                   /product="60S ribosomal protein L9"
FT   CDS_pept        complement(290846..291415)
FT                   /locus_tag="Tb10.70.7010"
FT                   /gene_family="HOG000039905" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L9"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412];
FT                   go_process: ribosome biogenesis [goid 0007046]"
FT                   /db_xref="GI:71746626"
FT                   /db_xref="GeneID:3662342"
FT                   /translation="MKIKSHDQITFPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFR
FT                   VNKKLRTFTAVRWFGNKINNSTINTALSHVRNMITGVTKGFRFKVRFAYAHFPISVTVE
FT                   NQLVEIRNFLGEKRVRRQVVADDVKVYRTDAALVKDELVLEGNDLEQVSREAAVMHQLC
FT                   LVKKKDIRKFLDGIYVQTKTNIEVDE"
FT                   /protein_id="XP_822368.1"
FT   repeat_region   292813..292839
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(292948..298344)
FT                   /db_xref="GeneID:3662343"
FT                   /locus_tag="Tb10.70.6990"
FT   mRNA            complement(<292948..>298344)
FT                   /db_xref="GI:71746627"
FT                   /db_xref="GeneID:3662343"
FT                   /locus_tag="Tb10.70.6990"
FT                   /transcript_id="XM_817276.1"
FT                   /product="kinesin"
FT   CDS_pept        complement(292948..298344)
FT                   /locus_tag="Tb10.70.6990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="kinesin"
FT                   /note="go_component: microtubule associated complex [goid
FT                   0005875]; go_function: motor activity [goid 0003774];
FT                   go_function: ATP binding [goid 0005524]"
FT                   /db_xref="GI:71746628"
FT                   /db_xref="GeneID:3662343"
FT                   /translation="MAIEYPDNGYIYVCLRVRSVPTLSELELSCSSRKCGAGRMSPRHR
FT                   PPRSTTRASQRICVSTLENIVALHDPKSLDDAACAVRDAQHVVQLLVGRSLRTVGKHSK
FT                   RRPLMSTATANYFEFDNCLASMDADSMLQMPIVRNSDFIRPPEYGSQEDVYLSTAVHAV
FT                   SAAVEGINSCVFAYGQTGSGKTYTLFGDAAYIQRDPGVVPRTMDDLFMRLEAIKRNYEE
FT                   NTETDYSFRVQLSFFEIYQNEAFCLFSRKGPLRVTFVRDSSGREALVIHELQRHFVTAA
FT                   DKAMPLVELGFGRRQTGETGMNAHSSRSHTILQLHVTQWRTDKVTRETVELNALLNIVD
FT                   LAGSERQKTAKTDGKSRDEGIEINQSLTTLSRVINEISQGSKYVNYRDSLLTMVLRDYL
FT                   GGNSKTFMIATISPVAFCYQESCATMQYAKGVRKIRNRPVVNTTFQTRNSLLELNAALK
FT                   QENEKLRQHVENLLKVAGSGHSIDGLLSESDARDSDSGEITICGTIPHKTLRCGAPIKR
FT                   YGTVSEAVFSTADHCAVPLVVTVHRKYKNSTGIGVANVEGSRIGISSLTRNVVQFHLSD
FT                   LLSGAEGSGQLVARPKIPQLKCLETSHGLVEFERMPSNSCERRYWVRYVPPCKEGDEAV
FT                   LHKKVVCHMNGIKHSDGDQWSLTHGDVFCVYIDSVGDDSEKSFVTFHYVDANCLARHGR
FT                   YMESNDMPEDIASQLAPVSAPGSAEEQLSQLKHNRTNLLEVLRWQAQSVDYQCQLMGVP
FT                   LLRQGSETVKEKSDGGSDRHSCYTPNSRGFDAHYDNETSPLPRPMLPYGDHIHTHMHSV
FT                   KPMDMSTAAHAFQRTSNWKCCSVGAGALAESQRDCLRESEVCSWRFAKRSVEFGEVARC
FT                   LAELERSSSLSQPVTANVVNSPPMESGIMEDGKGIKFIGCGDEAVVRVEKGTDTIVHMP
FT                   YQKGGDEFDGGERKVKGLRESKTSTPSGAANPLRNGPHPREGARTSPLPGTRMSLVGDF
FT                   CSELNADTVVGYSANANIFHLTSDGVRERELWVRIRSLERSVEDLRGQKSVLESKLRIA
FT                   QDANTELELSEAQLKDELSQLTKEFLDSAADHSKLKGEISNLGAILHSMEGALMEVSVV
FT                   SEFEMNEQFPIMAEKILMLRALTRMWKRRAMGSVARGTFTSGSRSSTNVSLTSGEGRTR
FT                   GVVQASRDDLHLELSDTRAQQFLKEHVPDFPANTSVVEHSEKETAAESVFVVGTVLVGL
FT                   EREKNQLVTDVNRERDEGEHYKGLVFRVQGDVNDLKMNAKKRESPTTEKMAERMAVSSV
FT                   RSRQLVEAGRKRDASDMNLWTTDQADSNIRKKSLDNKVTLLQEQRMLLKQQQREYDRRA
FT                   ASLACKVEELRYTLSCLREKVQDNGPNGFKDANDLYQRVEELINEAMSGFGGQGCHSTS
FT                   PPDFKFTGEMITLVLMGLRILLDRLKVELYVLNRQSLHRFALIAPAVHLRPETQFRYYM
FT                   HKLRGTISGIARKPQCVGADWTVTEADILSGLVSHRRRQAGDALYGLLIWYDHWDVAAK
FT                   TDHICYVELIRNRDHVMQIARLVRQESLVNTNATSCQNLLPDERRASTLGKEIPRSGKN
FT                   IGATDITVTASRNILGKLSARVKNSTLGNAMTKWKKCPPGSTSFRGTSASSTLHSPSQE
FT                   SGLTFLSLAPNTTFTPLDFPSREPMRLSKSGHLQKQSQSNSASEKPSGSTVEKFGRRSR
FT                   IIVVPVSEADITVAASTGLPRRSRTFNYARNLSTAYFSERELQPRALTKACTRFSRSKT
FT                   FAALGNMAHGKPCHLSNMASKSSSVCEGRNGKSMSSCSFLPV"
FT                   /protein_id="XP_822369.1"
FT   repeat_region   299162..299181
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   299865..299911
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(300557..302398)
FT                   /db_xref="GeneID:3662569"
FT                   /locus_tag="Tb10.70.6970"
FT   mRNA            complement(<300557..>302398)
FT                   /db_xref="GI:71746629"
FT                   /db_xref="GeneID:3662569"
FT                   /locus_tag="Tb10.70.6970"
FT                   /transcript_id="XM_817277.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(300557..302398)
FT                   /locus_tag="Tb10.70.6970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746630"
FT                   /db_xref="GeneID:3662569"
FT                   /translation="MLFAQRKRRQRIAGKIGHDDSEYEIDHHHNIGILPQGQPRNTPRA
FT                   YNGGPPATPRRQPHYVEQQQQQPWQQQQPSALMERFDVNFTPLQVNGNALGNNYRGGLV
FT                   SNFGQALPPLPPPPVQPAAAWAPLPPVVNKNPLWFKPMLGACAPVSHPLIAPGVNACYH
FT                   QSPPQYLYNCAPAAPNNLPPLQLPPVNAGTPRAETPLPYINNPIGRSCSRGDFHRPRSA
FT                   AVGTLPNLNAFEDSAEAKRAARQRAIEFQQENARLCEERRRQQQLERQLQMEEERRRED
FT                   AARAERLRLGQKEQSEMEREHSEAAGRVKKGRGGGRSNWTSDEQLREDLMRQINDKKQR
FT                   QEDERRAAELEMQKEKENNKNSVYSNFYSDNGTDHLRGGRGGSPEPLEHTAPGAEPLGN
FT                   GAAAGNDPVTNMAIPAGQLPGGNPHTLPQSYLPFAPHPLGTPRPFPAFQLDPILPLQRP
FT                   GVVAGMASAASVPAAGNDYITPHLPPFPSIEISTPRDRAPTREAERVESHLRDMINEHE
FT                   SITRMLESEVPTKPSEIPLYRPQPIAHTKVSFTSPTVDNLRWNPCGTPPAAAGTGTGTA
FT                   SAPAFAMGYAAACGGGSDELSAEPSTFVGAQLAGNNA"
FT                   /protein_id="XP_822370.1"
FT   repeat_region   302179..302214
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   gene            complement(303026..303850)
FT                   /db_xref="GeneID:3662570"
FT                   /locus_tag="Tb10.70.6960"
FT   mRNA            complement(<303026..>303850)
FT                   /db_xref="GI:71746631"
FT                   /db_xref="GeneID:3662570"
FT                   /locus_tag="Tb10.70.6960"
FT                   /transcript_id="XM_817278.1"
FT                   /product="dynein arm light chain axonemal"
FT   CDS_pept        complement(303026..303850)
FT                   /locus_tag="Tb10.70.6960"
FT                   /gene_family="HOG000259223" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dynein arm light chain axonemal"
FT                   /note="similar to 33 kDa inner dynein arm light chain,
FT                   axonemal (p33). (Swiss-Prot:Q26630) (Strongylocentrotus
FT                   purpuratus;); go_component: axonemal dynein complex [goid
FT                   0005858]; go_function: microtubule motor activity [goid
FT                   0003777]; go_process: cell motility [goid 0006928]"
FT                   /db_xref="GI:71746632"
FT                   /db_xref="GeneID:3662570"
FT                   /translation="MQPYGMSTSRTNRRPLVASRGGPNAPQRNYAMVTGPVDPSTSLIR
FT                   YELPFSPADPKRSVKLRRRFGEPIEESVVDPNVRVVLDSFIPPRAWYDDDGVLWVQHAS
FT                   PKPASRTDTVETHEKLRRRLRETGAKRTGICPIRSLLLAECFLEVIRQVTVECWERGLV
FT                   LLKIHAERVAAQTAHRELFESRVGYAFRLALKGEKDTSRVQQDLGKLKKRMEELAEEEK
FT                   TLRQQCDEASARGEEEMLIVGKQHSDEVAAIKKEGILKRNQLEHMISMPSTP"
FT                   /protein_id="XP_822371.1"
FT   gene            complement(304303..305766)
FT                   /db_xref="GeneID:3662571"
FT                   /locus_tag="Tb10.70.6950"
FT   mRNA            complement(<304303..>305766)
FT                   /db_xref="GI:71746633"
FT                   /db_xref="GeneID:3662571"
FT                   /locus_tag="Tb10.70.6950"
FT                   /transcript_id="XM_817279.1"
FT                   /product="epsilon tubulin"
FT   CDS_pept        complement(304303..305766)
FT                   /locus_tag="Tb10.70.6950"
FT                   /gene_family="HOG000165713" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="epsilon tubulin"
FT                   /note="identical to GB:AAF32302.2: epsilon tubulin
FT                   {Trypanosoma brucei}; similar to Tubulin epsilon chain
FT                   (Epsilon tubulin). (Swiss- Prot:Q9UJT0) (Homo sapiens);
FT                   similar to Tubulin beta-1 chain. (Swiss-Prot:P18241)
FT                   (Brugia pahangi;); go_component: microtubule [goid
FT                   0005874]; go_function: structural molecule activity [goid
FT                   0005198]; go_process: microtubule-based movement [goid
FT                   0007018]; go_process: microtubule polymerization [goid
FT                   0046785]"
FT                   /db_xref="GI:71746634"
FT                   /db_xref="GeneID:3662571"
FT                   /translation="MPREVVTVQVGQCGNQLGLKWWDVLLQEHKANPQFTDARDALFDV
FT                   SGSAPLASVGDKACRAGSLKARCVAVDMEEGVLRAMLRGPLGHLFDATFFVSDVSGAGN
FT                   NWAVGHMEYGDKYIDSITETVREQVERCDSIQSFLIMHSLSGGTGAGLGTRVLGMLEDE
FT                   FPHVFRICPVVMPSAIDDVVTAPYNTAFAVRELIEHADAVLPLDNDALARMADSALGQK
FT                   TIGQAAGERKEPQTTLGAPAARGYSVAQPTQTKLPYDSMNALVAQLLSNLTCAMRFPGP
FT                   LNMDINEITTNLVPYPRLLFLTSAIAPLSVARHAAASAPRSVDTMIAACLDKNHQFVDV
FT                   SNGLSSALTHEAGTCLATAIVARGPQITVGDLTRNIPRIRERQKLVYWNEDGCKTALCS
FT                   VSPLGHRNSVLMLANHCSIAQKLQSAHERFMRLYSVRSHVHHYEPYLEQAYFDDTCDTV
FT                   LTVVDDYNYLNTVQMPADVPRSMRDLVYF"
FT                   /protein_id="XP_822372.1"
FT   gene            complement(306103..309105)
FT                   /db_xref="GeneID:3662572"
FT                   /locus_tag="Tb10.70.6940"
FT   mRNA            complement(<306103..>309105)
FT                   /db_xref="GI:71746635"
FT                   /db_xref="GeneID:3662572"
FT                   /locus_tag="Tb10.70.6940"
FT                   /transcript_id="XM_817280.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(306103..309105)
FT                   /locus_tag="Tb10.70.6940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746636"
FT                   /db_xref="GeneID:3662572"
FT                   /translation="MLPMASNPTADLTTSPEATASLNACLDILAHVRKAQADSVSIISV
FT                   LRNCVVEGVGCGPGTACSGVQPLKSPTSVETINRTLVRLRVTEVKLSALQPELWESAKT
FT                   AVVQVRALLQSNSTVPAGAVRFGDINMKQHVDKFDRISKTLEQCGSLAQLQREAVQSLY
FT                   AQLRKLAAQSPAGVPRCGYPPFNILDAVQTGKAIPCVEVRQTDAGEEVVRFVQQLEDLM
FT                   LNKQQVFDYLEAALRDAYGHFPTSVPTLDGHCSRQYGDGLNIFPSDQFVSVSSDSADGN
FT                   DAASCTQPELGSCGGTQCGSSEHSAAAGSGGGDGCFNIYSVVSTGRRDQHASNDLDSCA
FT                   TGESMGQRTSTDMNRNRLCSRRQEYPSGQDVDHVMENAYLRCLLEAKDRLITDLQESIF
FT                   GAVDPYIYKRSAGTITAPPPLSPPHQFGPAAPPDETLVGRSGGDSSGDVNIRACGLPHT
FT                   IDGQVLRDKLEEVVEIGFNLRAGLIALREEGQRWRHIAQGFQEENELWREGGTMVRKFR
FT                   GTQERRSGLSGPSIAHEGGRRVLTSRVEGKAEAGLGSLPPKCPKRSTLNGVGRNSIGDG
FT                   ANVVNRMPRSEIVTSTSAVSAVADGSLPASEQAGNPPSASVTVGSKPSCVRDSGEGGGA
FT                   PRSAKAMVAVDSVDVRKKMPASERGPTSGPLLTRPLKVSGNTAGTGPCHSSLSSFERTN
FT                   SGRAPQFQLPSLEDTPGGSLSTGGVAGTGDAAAYIEKILISAQSCLVSVGCSNGDDMSS
FT                   PYSGTDSFGIPQFHCNSPQARPSTPPSETTSPAGLYCDSPLEEPLFKEPRLSEGGDGIG
FT                   VKPVTTLSNGATACGVTATVDTVCNSDDNTLASSSFSPPSLLLEFPSESALPPMEDVDC
FT                   SSGTEGVLPQSTVHQSMLRELRSQLLLLQSKHAGVLRQRKILRQNREQVAALLQRPDIS
FT                   NVKTTTDSSSLISGDMRYQVEKLLTRLDAAQESVCKREVELEKRVEAVRQYISSLRERS
FT                   VSFVQELRASR"
FT                   /protein_id="XP_822373.1"
FT   repeat_region   309497..309519
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(309702..310148)
FT                   /db_xref="GeneID:3662573"
FT                   /locus_tag="Tb10.70.6930"
FT   mRNA            complement(<309702..>310148)
FT                   /db_xref="GI:71746637"
FT                   /db_xref="GeneID:3662573"
FT                   /locus_tag="Tb10.70.6930"
FT                   /transcript_id="XM_817281.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(309702..310148)
FT                   /locus_tag="Tb10.70.6930"
FT                   /gene_family="HOG000259225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746638"
FT                   /db_xref="GeneID:3662573"
FT                   /translation="MVRYAKRPWYSPLGFMSHSPQSYAPLLMVVGVTATFPLRYKISDY
FT                   FERQRDGPHVELRRKAVLYYNEVERMHRRQALQNQANVKDDDSSHRISSTLQAEALRLG
FT                   HMDQEYNYWHAHQRDALRAEKLLAEVRELQERLNSAQMEQLAEA"
FT                   /protein_id="XP_822374.1"
FT   gene            complement(311346..316589)
FT                   /db_xref="GeneID:3662574"
FT                   /locus_tag="Tb10.70.6920"
FT   mRNA            complement(<311346..>316589)
FT                   /db_xref="GI:71746639"
FT                   /db_xref="GeneID:3662574"
FT                   /locus_tag="Tb10.70.6920"
FT                   /transcript_id="XM_817282.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(311346..316589)
FT                   /locus_tag="Tb10.70.6920"
FT                   /gene_family="HOG000259226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746640"
FT                   /db_xref="GeneID:3662574"
FT                   /translation="MQVKHYKTLMACQQGIARTQAICWSPNNKRLAVADNNRVVNLYDE
FT                   HGERRDKFPTKAADGKNGKAFVIEGMAFSPDSSKIAIGQSDGIVAIYRVGIEWGEKKAI
FT                   CSKFPQNSPVTCLCWPETSQGVELVVFGTLDGKVKVGILKANKSQALYAHEHAVVSIAS
FT                   SPDGNKVISGHLDGAVYQYTFESEDAGGGSGSKKLFNHGHPPYVLLWGENICAAGQNSF
FT                   VTFYDRSGQKVQSFDYKAEDEGEFTVGSFNPSGHAIVLASREQLRLFDFNLRSRKWEEG
FT                   AVIRVPNSCSFSAISWKYDGSRFVTGSLAGAVDMFDVCLKRYRLRGAFEFTYVSHNQVI
FT                   VKRLATGTRIVLRSSLGYEVQCVNVHQDRYLVAHTSTTLLVGDLISCKLSEVPWQLSGR
FT                   EKFVFDNPQVCMVFAAGELCLIEYGKNEILGTCRTEERNAHRISVRVHDPSITSEGEGQ
FT                   QGRKFIAYLIDRQTAQIDDLSSGTAVARLSHQCRIDWLELNYRANKLLFRDKQHQLFLY
FT                   DLEEQNRTTLLNYCTYVQWVPGSDVVVAQNRVELCVWYSINSPDRVAVVPIKGEVEGIE
FT                   RGNGKTEVIVDEGVNTVAYGLDEALIEFGTAMEDHDYIKACDLLDQIALTPETEAMWAN
FT                   LASLALQELKLPIAQRCYAALGDMAKVNSLNQINELAVSEARSSGGATDGYDHYAVRAE
FT                   LSMLNKDYKQAEQLYLENAKIEDAMAMWEELNRFDESISIAEARGWPDLANKRTRYYNW
FT                   LVETGQFEKAGEQKEREGKHNDAINLYLRGGTPARAANVISANNMKPESQLLEAIAASL
FT                   FKAQVFEKAGDFFEKLKMNDRAIQAYKKGHVYSRAVEFAKRAVPDRVVALEEEWGDYLV
FT                   SQKHVDQAINHYIEAKKYDKAVKAAIDSRQWSKAAHILESQTVGSDNDETVKGFYKNIA
FT                   RHYEELHQYGEAEKFYIKANAINEAVDMYSRAGMADHMYRVAQRHLSQQQLVALFVDQA
FT                   KRLETKGDYAGAERIYVKVNEPDQAIVMYKKARDYTNMIRLVQAYRPDFLSKTHLSLAA
FT                   QFEKESNYKMAETHYVAGKDWGRAVNMYRDHEMWEDAVRVAKVHGGANAAKQVVLSRAM
FT                   VVEAEDGVRLLMKFSFINPGIEAALEAQKFDLALQWAQLAQPAKLPYVYLKYAMYYEDQ
FT                   GDFRMAEEAFLKSGKPREAIDMYLHQHEFENAMRVAEGYDQTAIPSILQAQGRACFQKS
FT                   NYREAESFFIRANAPEPLLKLYMENRMYTDAQRVAKEYYPDMLGEIAKRIALQSSDPQK
FT                   AGAVLEEHGEYQMAVETYLGATAEQVQNPNVLANLWVRAVKVAQKHDRNMLKNVLRVAT
FT                   GKLKEAQRYVEAGKCLEDCEDYKGAINMYVEGKKFDLAEYLAKHISPELEDYVKRAIVQ
FT                   NSIEGGGMKDAKMVEEIDPEAAFKAYIANNDWENALRMAKQRPPEEMKYVAGLKMKYHA
FT                   NKGELGAALGVVEELPLDPGDFRFYETWLEMADRILAQLPLRPDSDLKLERFHTCFSDV
FT                   VESMSRSGQKQEDVAKANAFAHIIHIYYMSARMRELSLDDYALKLMLGLPRWIPHIAPE
FT                   KAFYDAGMAARNSGQDAIAFLYLNRFLDISEKIEDGAVDSSAIDNGDFDCTDFPKKYPM
FT                   PKSSSVEKTSEEEVNRWVLAISIDNSLDPHLPTVTDPQGQVEMFEGSLQSPAGVTYPEC
FT                   AVTGYPIVGGGVVKCRNCQRPANQDDWTRYITLAKACPWCGAADSPVFGI"
FT                   /protein_id="XP_822375.1"
FT   gene            complement(317111..318556)
FT                   /db_xref="GeneID:3662575"
FT                   /locus_tag="Tb10.70.6910"
FT   mRNA            complement(<317111..>318556)
FT                   /db_xref="GI:71746641"
FT                   /db_xref="GeneID:3662575"
FT                   /locus_tag="Tb10.70.6910"
FT                   /transcript_id="XM_817283.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(317111..318556)
FT                   /locus_tag="Tb10.70.6910"
FT                   /gene_family="HOG000259227" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746642"
FT                   /db_xref="GeneID:3662575"
FT                   /translation="MPLTCLGPSKVVPGATGVFLTCALKKFTPVEIAPTVGATSPPYLC
FT                   NLISAPRRTISLRRFLALRHQFSSGMCFNIATLRGWYLLAPSTHAPLSDPSGLRAWMQR
FT                   HHHRYTHVCSTGNGSGSLGLRYEGEEQGVFTASGGDCNPADFEDEEDETVVEDKGDAMQ
FT                   SSAAASPGRSTSAGAVSPLCIQEEHLFEINDGILWEMPPNDDLASPTYWRRHRERMQVY
FT                   EDTSVGVEQAELIGSDATGGSSHESVVAVEKEQYTGQLRLVRALTCKANVRLTVDDNTQ
FT                   LLVLMPVVDLKEGDELLLHYGREWWSHRLLSTLFMSVQDKEISDVRWVESLFAKPTDVH
FT                   RPFPLLCRAFAGKRKRRLVGRERDAGREGRTSTECSNSEGTGNDAKVVLYNIATKKKAT
FT                   DSEALIFAVRRSCVDRNFFTSLVGGSERGAFNASRCDDEVPISRVRRVLLQSLRQGGGT
FT                   VGEGPAKDSLDEGETQDDGSFCF"
FT                   /protein_id="XP_822376.1"
FT   repeat_region   319428..319464
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(319572..321725)
FT                   /db_xref="GeneID:3661756"
FT                   /locus_tag="Tb10.70.6900"
FT   mRNA            complement(<319572..>321725)
FT                   /db_xref="GI:71746643"
FT                   /db_xref="GeneID:3661756"
FT                   /locus_tag="Tb10.70.6900"
FT                   /transcript_id="XM_817284.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(319572..321725)
FT                   /locus_tag="Tb10.70.6900"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746644"
FT                   /db_xref="GeneID:3661756"
FT                   /translation="MASHSRGCTEATPLSAVVEGRDLRSRRSHTNLRGSSMTSISEASR
FT                   SCLCTSSRNDAGERTLRARSVTEPTNLRPHSLRRGTSVTIYEDSCVRRAAIIRRLEKMR
FT                   PERKLSSAASEPVYTNGARSLVLTCTRHGHSKEYPPVRPKSASCSVRQSQRCSSVTGTC
FT                   ASARSDAEKYTRKGRLSAPPFQTGLPRAEQAKPERNSFSFAPGRVERSRCRVRERCEQW
FT                   FTGGEHLNAALISLFVACGASEQGGLGLTLFMKDFSQTCEAHQPVLPPKRIVLNAISSM
FT                   KSVCIIQPSTDKPGGINFCLALPDFFALLTKELRGFTSAKVQGSFPPTREPPAVCIVLA
FT                   ALVPEALERVFNAEVVEYFRNPLTIAYALEKLESQYENQVSTVSDAVRDKASITISSLP
FT                   QERVQHRRDVGRSACVSGSPSPVGGEASYPSISEITFSGDKSLAEAPYTGTNSTLSEVG
FT                   RKAQPVPRYMKPRLLDEISTSIIARAKARKLMDRLRKSAIPINRHVCFARIFYSQQAKA
FT                   GVVSANDDCCLAFTDSDDSDSEALVQLQPDPPQGRLRPTNILKWPLYDEYARGFSGINK
FT                   HRKPRRGLFEEQQGQFAQLKVCSDPPISQPCSVAMSSSRTFEIPEPLSCFSLSTSLSTS
FT                   SELTANDSSPLVATMTTYQRRMSKLLDRCSSQSEFSLADLSAVRFGMYGATRRRLYSAS
FT                   TGGTAAGVNDKKTTRGKSRTRKK"
FT                   /protein_id="XP_822377.1"
FT   gene            complement(322040..323077)
FT                   /db_xref="GeneID:3661757"
FT                   /locus_tag="Tb10.70.6890"
FT   mRNA            complement(<322040..>323077)
FT                   /db_xref="GI:71746645"
FT                   /db_xref="GeneID:3661757"
FT                   /locus_tag="Tb10.70.6890"
FT                   /transcript_id="XM_817285.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(322040..323077)
FT                   /locus_tag="Tb10.70.6890"
FT                   /gene_family="HOG000259229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746646"
FT                   /db_xref="GeneID:3661757"
FT                   /translation="MREVLLGVFDGYMPLERNKLTSETKIGGSPTYRPSLSESQLMTIR
FT                   EWTTCGVCGRHMFLVLQAFSPLPQSSAGHHRMIYVFCCNSDACSRQPSSSWCAFTLQAE
FT                   NMDEEALDDIQSEEAARSDPVMASELPPSTFPPCYVAIDSEPRKEIVVPTDLEAEMIRA
FT                   AQENAKNPDITENDIKELEQTIDLKDKPADYEFDKFRRRVAREPSQVIRYYERFPTESC
FT                   GVTLVSAVAPPLFMRPSRVKEIIRIPPCRDCGAALIHELQIMPTSVYYLRVRDYIASGS
FT                   PSGDEGVDWGTVTVFVCSKDCSKDRSGSSLRKEFVFVEKAPEQQDELENLEGRVDLRTF
FT                   MTGRT"
FT                   /protein_id="XP_822378.1"
FT   gene            complement(323646..325688)
FT                   /db_xref="GeneID:3661758"
FT                   /locus_tag="Tb10.70.6880"
FT   mRNA            complement(<323646..>325688)
FT                   /db_xref="GI:71746647"
FT                   /db_xref="GeneID:3661758"
FT                   /locus_tag="Tb10.70.6880"
FT                   /transcript_id="XM_817286.1"
FT                   /product="katanin"
FT   CDS_pept        complement(323646..325688)
FT                   /locus_tag="Tb10.70.6880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="katanin"
FT                   /note="katanin p60-like protein 2 (curated by B. Wickstead,
FT                   Univ. of Oxford); go_component: katanin [goid 0008352];
FT                   go_function: ATPase activity [goid 0016887]; go_process:
FT                   endosome transport [goid 0016197]"
FT                   /db_xref="GI:71746648"
FT                   /db_xref="GeneID:3661758"
FT                   /translation="MDDDVGLQKAIYSSLQSKRTQDAFNRFSRNAPSHGTVRSFPRNGK
FT                   RNALLREGIMPTVPRSQQVRSTTGWTFSQFGDYTDRPPWVNPLDEESCIPNMPVRLQQP
FT                   SDRVPGWTLMCSGGRIQRQNAMGSNILFICEEVHYAQNTKIHCNDLLALRTVAPLPQGK
FT                   NIACFTAQIQSLVSQGRYAMFGMGITPRAGDERQGFCVALVHYDSSGGIFLSVEKWRMT
FT                   EQDTFERLELLEPMKTLRLIRERVTITLLVSSEHFSLSINGEVVCPTLHAPGVRLGESL
FT                   PILLATGGKISVREVAVVEGHKPPANKLYGRPPPFTLSPKKSDTNKKGIPIVEEEPLCS
FT                   SGKAAFPDKVSNRKGKVVDKAVPKDKVLNSVAPCAPPGIAPELLERIEAEIIERSPNVE
FT                   WDDIAGIPEAKRLLKEAIILPLLVPELFTGVVQPWKGVLLFGPPGTGKTMLARAVATSA
FT                   KTTFFNISASSLISKYFGESEKIVRSLFHLARHYAPSTIFFDEVDALMSARGGNEHEAS
FT                   RRIKSEMLQQFDGLCTENDKRVLVLATTNRPWDLDEAMRRRLEKRIYIPLPDKAGRLSL
FT                   LKKQTATLSLDPSVDLEEISDKRTEGFSGADMNLVVRDAAMMPMRRLIADRSPAEIAAM
FT                   KEGGKMIVSPVTMNDFEDALKKIQPSVSQSSIKQFEKWAEELGSV"
FT                   /protein_id="XP_822379.1"
FT   gene            complement(327937..328377)
FT                   /db_xref="GeneID:3661759"
FT                   /locus_tag="Tb10.70.6870"
FT   mRNA            complement(<327937..>328377)
FT                   /db_xref="GI:71746649"
FT                   /db_xref="GeneID:3661759"
FT                   /locus_tag="Tb10.70.6870"
FT                   /transcript_id="XM_817287.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(327937..328377)
FT                   /locus_tag="Tb10.70.6870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746650"
FT                   /db_xref="GeneID:3661759"
FT                   /translation="MTSHPAVLATAFHTNHIRDRGIPISFVNTPQRVPQGERQAYTTRT
FT                   TISPSAHPPPPSRARRRFKSSRRSRRPQAALKWRESDNTPIRGAPGESVDRKGQDFPLS
FT                   PSHFSGTLLITFADAPRWRFPSYVSVTFLDSRGCHTPQKALD"
FT                   /protein_id="XP_822380.1"
FT   gene            complement(332414..333442)
FT                   /db_xref="GeneID:3661760"
FT                   /locus_tag="Tb10.70.6830"
FT   mRNA            complement(<332414..>333442)
FT                   /db_xref="GI:71746651"
FT                   /db_xref="GeneID:3661760"
FT                   /locus_tag="Tb10.70.6830"
FT                   /transcript_id="XM_817288.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(332414..333442)
FT                   /locus_tag="Tb10.70.6830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746652"
FT                   /db_xref="GeneID:3661760"
FT                   /translation="MAEERCLEGPMEYFFAALERQFPKQTALIGGAKSLTQAILRALDV
FT                   LYPFVEALFVRFMDYAKSLSSHELNQILPLIAGFSICFFGGCFFTLFSTVEIVYLTSWD
FT                   RIKKSAEVIHRNYVAAMEASRKDDAPGYGYTVTTGDESLSKNELLSRKLRIFLQSVDPV
FT                   SVKEELAAVALAFMAVVAALRDRFAYYVTLGCILADTAPRFFPLKAILEESLPPELQKL
FT                   AGPFSNFLFGALGTTIAVLASQYTITLHCATRGSKMLVDSALELAKTRGIVVQDVKVDD
FT                   SWVKAFAFGLAVIGFTWQAANGFSLPFPLNLLLFPVTVLEWIVNVIFRASGSAVWATTL
FT                   SV"
FT                   /protein_id="XP_822381.1"
FT   misc_feature    333944..333971
FT                   /note="AT_rich"
FT   gene            complement(333991..334749)
FT                   /db_xref="GeneID:3661761"
FT                   /locus_tag="Tb10.70.6820"
FT   mRNA            complement(<333991..>334749)
FT                   /db_xref="GI:71746653"
FT                   /db_xref="GeneID:3661761"
FT                   /locus_tag="Tb10.70.6820"
FT                   /transcript_id="XM_817289.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(333991..334749)
FT                   /locus_tag="Tb10.70.6820"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746654"
FT                   /db_xref="GeneID:3661761"
FT                   /translation="MRMSLTTRRPFCPVLLNIGSSRAVTLSHFHAKVCPSITATVKQTI
FT                   RELDDEASPNHQRRQESCFSSGELRLRPYGFSPERPQLQHESWSCAWHSYLNAVRLRGE
FT                   VSAAGVAPLPPTATSANSTSHNDDEFFPMTGTLTLPVPVVVPTSNNEPSNETIMMEFFR
FT                   VDAFIPVRVQMYHVMRRLIKMQAVWNNIVAIGIVVPTHEVEYFISAARAAHASDGERTP
FT                   HALLSRKPSVLVYDPEGLRFQAPESKRLRK"
FT                   /protein_id="XP_822382.1"
FT   gene            complement(335234..336019)
FT                   /db_xref="GeneID:3661762"
FT                   /locus_tag="Tb10.70.6810"
FT   mRNA            complement(<335234..>336019)
FT                   /db_xref="GI:71746655"
FT                   /db_xref="GeneID:3661762"
FT                   /locus_tag="Tb10.70.6810"
FT                   /transcript_id="XM_817290.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(335234..336019)
FT                   /locus_tag="Tb10.70.6810"
FT                   /gene_family="HOG000239325" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746656"
FT                   /db_xref="GeneID:3661762"
FT                   /translation="MTSVETRIQALVQRYTLMENNINKLRKALASLGEGQQNANTTPRN
FT                   EATAVAHHRDPCDLKELQPCPQDTPEVAALRRWCIEHSLTTAVFRWVPSDYYQHTLQWR
FT                   RDELAAPSVHHLCKSILMENTHCTNKDCGVRENSRYYLIVYPYTEKFDAEMVMRHVKGL
FT                   NEGLGKKKFNFRLAAPDVALQLTGFGHGAVAPFGTPTEIPVILSDKILQLTPAVFWMGG
FT                   GHVDCKVRVDVEQFMEVIKPIVASVTTPLSAEELGQLVD"
FT                   /protein_id="XP_822383.1"
FT   gene            complement(336476..338101)
FT                   /db_xref="GeneID:3661763"
FT                   /locus_tag="Tb10.70.6800"
FT   mRNA            complement(<336476..>338101)
FT                   /db_xref="GI:71746657"
FT                   /db_xref="GeneID:3661763"
FT                   /locus_tag="Tb10.70.6800"
FT                   /transcript_id="XM_817291.1"
FT                   /product="aspartyl-tRNA synthetase"
FT   CDS_pept        complement(336476..338101)
FT                   /locus_tag="Tb10.70.6800"
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   nucleic acid binding [goid 0003676]; go_function:
FT                   asparagine-tRNA ligase activity [goid 0004816]; go_process:
FT                   asparaginyl-tRNA aminoacylation [goid 0006421]"
FT                   /db_xref="GI:71746658"
FT                   /db_xref="GeneID:3661763"
FT                   /translation="MYRFWPSFSPFPTLKLLNIHRWCCSATGKPPMVGVAAIQRGALQS
FT                   AASARVRGRVENFRVRGKLAFIQLRQPPSHSIQVVAAGAEISHKVKELTPESIVDVIGV
FT                   IKPTERPVTSVSCSNYELHATSIEVVSKAAVPLPFPLHDQNAKLDTRLNNRYIDMRTPL
FT                   AVAMIRLVSAAAQSFRTQLLSRDFVELHTPKIIGTASEGGSALFSLDYFGRQAFLAQSP
FT                   QLYKQMAIMGDGMRVFEIGPVFRAEKSLTHRHLTEFTGLDAEFTVDEFYTELLDVLESI
FT                   LCGMIWKLQTENAEWISQARAALMELDSTEDCGTVVPRREDIVCEVAEEIIAMYNIRFD
FT                   DAASRIAPSVPTEPSEDRYHARIGTSGPKVLRMTFRDALQLIRDNDHQHAGRQQEVVGE
FT                   SDEEVVVDFNLNQERALGELIRLRYGVDLYVVDQFPLAARPFYTMPHPSEEGVACGFDM
FT                   YLRGEEICSGGQRIHDVAQLIHSMEQRRMEAAHMRDYVDSFRYGAWPHGGFGLGLERIV
FT                   LFLLGARDIRRVSLFPRDPRRLAP"
FT                   /protein_id="XP_822384.1"
FT   gene            complement(338592..342089)
FT                   /db_xref="GeneID:3663058"
FT                   /locus_tag="Tb10.70.6790"
FT   mRNA            complement(<338592..>342089)
FT                   /db_xref="GI:71746659"
FT                   /db_xref="GeneID:3663058"
FT                   /locus_tag="Tb10.70.6790"
FT                   /transcript_id="XM_817292.1"
FT                   /product="mismatch repair protein"
FT   CDS_pept        complement(338592..342089)
FT                   /locus_tag="Tb10.70.6790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mismatch repair protein"
FT                   /note="go_component: membrane [goid 0016020]; go_function:
FT                   damaged DNA binding [goid 0003684]; go_function:
FT                   transporter activity [goid 0005215]; go_process: mismatch
FT                   repair [goid 0006298]; go_process: transport [goid
FT                   0006810]"
FT                   /db_xref="GI:71746660"
FT                   /db_xref="GeneID:3663058"
FT                   /translation="MRNNFPIPLQYKLGVRYSVPITSMTDDSRQMFSANGAYPTNEDVS
FT                   ALSMPLEDPHSRGNFFTDASAPAAANLFNVLTPTAQQTQRLRGVGRGSSAQTFTRTAAG
FT                   TLTLSTARRTGTSQGCGDCIMALIDNRAGEVGAAICQLPSLTIIITQYGDSVTYAKTLS
FT                   FIFSRGPAELLVPETVVGSNFVQTLLRHFNDTTITGVQRRSFDEAQGAHRLLELMSTDE
FT                   AALEVSNTDRYLCLAAANALVEFLEMTYNYTLLPHTVRVKYLALENYMEVSRLSARALN
FT                   IIATGTDHLARFPNQKLDKETTEESVKTGNRKPPVRKTLFRSSRELKKDALFVPLATAV
FT                   NYTITAVGRRLLRSTVLQPLRDPTSIELRYDAVEWLCRDNEALAAIRRSLRLLTGDDLE
FT                   RVISNFSHTPKLATLKTMQRCIDAVVTLWQFLRATTQLLYTLRGLLSKGGTGNAPESEE
FT                   CDDVGDHSNLSSDGVDCSYESQVELHEREGVMEKENFHWPVPPRSSLCSTSEGHRKPPM
FT                   LLRKLLQTLTTCHMEEICAEIAHYLDESVVHVTGGDGASVGRRPRRTGGAVLQVQQCFA
FT                   VKSNINGTLDAARHQYSQTIESMFAHAESLKQQYGVGSLRVVYDGVRGYHLCYDSRHER
FT                   NAPDSIFLQKYSGGKHYALYHSGRAMMDVDVGGDLHGDSQQQRPPFYGSSVLHVETPEP
FT                   LNTAAQRAAVTKHQVRGRRVTCTTKEMLLLRRGADDVVAEILHTQNGVVHRLIEYLRQR
FT                   LGKLQAVCDGVAMLDLLIAFATYSRLNACVRPTVLRQGTSFNSSGTYFIEARHPGGLFT
FT                   ANTVQWSDRTNVLLLTGPNASGKTTLLRQVGQLIALAQSGCFVPAREAAIQPCDRIIAH
FT                   MLCDDLEDAATSSFAREMRELSYLCMNATRESVVLVDELGRRTAAREGMAIAWATVEFL
FT                   VEKRCRTIFATHYSRLTRLEEGTAGAVKNVHFVVAVEDGAGGSIPVGDDGMVVLVGGTA
FT                   PLTNVESGSKPASKKSCTLRFEYRLQPGPSHVDCYGLRLASRVGFYAPALKLAWELLPL
FT                   IGGREGGRSHEGAGDEAVAATIDESEIKSFHSAGSPCCVRVADKVVADVAKSPPVVSPS
FT                   TCNKEELSMIGGNRISGNHSEDISVASNSRCLRHTCLEGGAVDLSKMLQLSPCGSSTE"
FT                   /protein_id="XP_822385.1"
FT   gene            complement(342577..343098)
FT                   /db_xref="GeneID:3663059"
FT                   /locus_tag="Tb10.70.6780"
FT   mRNA            complement(<342577..>343098)
FT                   /db_xref="GI:71746661"
FT                   /db_xref="GeneID:3663059"
FT                   /locus_tag="Tb10.70.6780"
FT                   /transcript_id="XM_817293.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(342577..343098)
FT                   /locus_tag="Tb10.70.6780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746662"
FT                   /db_xref="GeneID:3663059"
FT                   /translation="MGMRKKETIKKAHKPGVAKGLSYRRPWATFVPTLICFLLLNYLAF
FT                   GTTVDEEGTDLVVPSGLGDNNTSSLSKLQLLFEDRLMRSLFRVGLFMFREMKVIQLVAV
FT                   LAFVIHCGEAGLAAGICIRCKADRRTFGLYTVLTLLGGATQLGPLFEAEKDYLKDTTNI
FT                   TTKDDVSKKA"
FT                   /protein_id="XP_822386.1"
FT   gene            complement(343533..343982)
FT                   /db_xref="GeneID:3663060"
FT                   /locus_tag="Tb10.70.6770"
FT   mRNA            complement(<343533..>343982)
FT                   /db_xref="GI:71746663"
FT                   /db_xref="GeneID:3663060"
FT                   /locus_tag="Tb10.70.6770"
FT                   /transcript_id="XM_817294.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(343533..343982)
FT                   /locus_tag="Tb10.70.6770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746664"
FT                   /db_xref="GeneID:3663060"
FT                   /translation="MRCGKICSLVYVNFLCNKPLSFDFFLCVTYTSCAFFFCLFYRIPH
FT                   KIGYFTIATFRFHWEKQWFSAMWREKWDMCCEGISTLWTVGGRLRNVYNSSKSEAERRR
FT                   DVWSTLLCTATFAMTAVAFAAIDAHGGVPPVVWNVLGGAKRLLRR"
FT                   /protein_id="XP_822387.1"
FT   gene            complement(344456..345724)
FT                   /db_xref="GeneID:3663061"
FT                   /locus_tag="Tb10.70.6760"
FT   mRNA            complement(<344456..>345724)
FT                   /db_xref="GI:71746665"
FT                   /db_xref="GeneID:3663061"
FT                   /locus_tag="Tb10.70.6760"
FT                   /transcript_id="XM_817295.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(344456..345724)
FT                   /locus_tag="Tb10.70.6760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746666"
FT                   /db_xref="GeneID:3663061"
FT                   /translation="MPAVCQSLISGYEEENQYLLVEAIHIQRELKHCGAEPIATDPCVR
FT                   MFPKQYASPLQMLRRTENQPIALSSELLNTWGGTTRQDRKECYCQPKLLSANYCRVEPY
FT                   CNNKVARPQLPSAFGGKGSLFPSIAARLENDVALGLAASLWPSGNVVGHCDDRLAHLLV
FT                   LSSTIVRCKKIAQRDCEKLGGVAAARGVSSELRCEYMKAIEHLVYLERSVTETILLVPP
FT                   NLGVSQERLPCRGGAALQDSVAKSHTSKGTSVELSVSILSAVRVLKGLIEPATLTDRAT
FT                   SNPTWQYSLVRTAADVPSRYDIVDAMSYTLEPYPGLAVPRIYCAVARQLALEILRSAGN
FT                   GSIGDRAAVAALRILQHINTRTECLCSEEREAGQRFLSRLQWRLQRLTQMLASEVVDEA
FT                   TLPTRELVAATRMFCGDPPVDFS"
FT                   /protein_id="XP_822388.1"
FT   gene            complement(345986..348820)
FT                   /db_xref="GeneID:3663062"
FT                   /locus_tag="Tb10.70.6750"
FT   mRNA            complement(<345986..>348820)
FT                   /db_xref="GI:71746667"
FT                   /db_xref="GeneID:3663062"
FT                   /locus_tag="Tb10.70.6750"
FT                   /transcript_id="XM_817296.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(345986..348820)
FT                   /locus_tag="Tb10.70.6750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746668"
FT                   /db_xref="GeneID:3663062"
FT                   /translation="MQTAPPATAAECSGVVKHHLWVFYTALRSSADEVVSAAVEITGLG
FT                   EEGSHRRGWGKAAGSERHDLTRNGSYSSHARGPAIPEDSLITAATAMLGRLLHENRKCG
FT                   GDGRGHVHSLTESEHMQRINTLAQVITWYCWAAVPVSENTFDFSLLAANRQDASRQQRP
FT                   VRRNVNGSDSKSTSSSHLIEDGQMAEKIFGVGVEAVVYASVSNINKGMVDAHATQGGDG
FT                   SGECASDELCHMVRMSAFYMLVAALMRFRNSPFNVTRYLPVLFPEVDARDARVSHPLLT
FT                   PLLWHREERIRAAAAALLSALLRKLSTNFTYAEEPQQKRQSFLSLASLSGRVLASIHYA
FT                   LLWATQTPDTPELMQGVCSKAVNVQNHRTGIHFSVFSVLVAVTPYNRCPQCREMVGSVL
FT                   RMNVLRECLVTCDSGRFKAATAFLCEVLKSESLISVVHDCLLWDEENVKVEVKNLEPFS
FT                   RSEPRCDGFRALVDSLLTHAAARVEVWRCVVQLSRLHPATVGAHFSQLITASRAVLRLS
FT                   TGLEGTTCPAGGAADATLGECLRGWVHFMGYVWQPFDGQSADPALRPNYASHRATQLQK
FT                   EQIVAELVLPVLRMAVGDSRHIEARRAALRCLAQVGDEYLLSLSDSARQEIIEKVVAAT
FT                   SATESSGRAEAFTTIGVWAWKYTALDSKTLDFVDLAVSCLFNDPCSTVRGKAAFALSNI
FT                   TSRLIENSAEGDGDDGVESAAAHENPLRQSPRHIQLLCEVALHAAEQYDDAAIMGHGIR
FT                   IMSHLLGCLTFEELIAEARAECEEQQQVVAEAFFDTLLRFLNPFSCDAKLRWNASCALG
FT                   FGLAREVVFDAEPKGATSAVERLCTVVCSDRIFKVRTQAASALARVPPSCLTAGRYATA
FT                   DLTPVVARALCGALREVIGDTTETYAQYKEQGALRAALRQGLSVMITGATSSAELQCIF
FT                   AEFRTILVAEGLLG"
FT                   /protein_id="XP_822389.1"
FT   gene            complement(349287..351434)
FT                   /db_xref="GeneID:3663063"
FT                   /locus_tag="Tb10.70.6740"
FT   mRNA            complement(<349287..>351434)
FT                   /db_xref="GI:71746669"
FT                   /db_xref="GeneID:3663063"
FT                   /locus_tag="Tb10.70.6740"
FT                   /transcript_id="XM_817297.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(349287..351434)
FT                   /locus_tag="Tb10.70.6740"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746670"
FT                   /db_xref="GeneID:3663063"
FT                   /translation="MAFLLRAIGFTESIPGFPYTPCSGSSTTTADTPTITWTMRQGECD
FT                   ESKRSVTIFSVNLADMEPRKRELVRHAMKRAKSLLLPGILRCYGAAEHRDTVYLATEPC
FT                   EPLSKMKCGQMGSPLATSGDDDDEGEAFNDIVALGLKAVGSAVSALHKNKLIHGNVGRD
FT                   SVFVISTGEWRLFGLELVSGFDDVGSSYLSYCSLLPAYRRPPETQHTNYESGGKTCAID
FT                   SWGLACLIYEVLGVNDQTSGKLSQSCSTEDLRSCRTLPRTLQSGFSGLCAVNPKMRHDV
FT                   DRFLRTSDFIISSDYVQSMQMLDDYSLKDAAERERFMEHLANVVHTFPRDACKHLVLQK
FT                   LRASFTFGILPGVVDTVVKIAARMPSPEEYATHVSPVIVALFRSKERMVRLRILQHAAE
FT                   LLPQMPPAVVDGEVWSEYASGFESPIAAIREHSARALVPIAPLLTEKRIVNDVPKYIAQ
FT                   LQQDSEGPIRTNATIALCLIADTIPAEYRSKLFAQRFGRMLKDPFAPSRTAALRSFHTT
FT                   LKHFTAQDIAELVIPGVSPLSMDKVAEVRAVALDVIHAAVSRLDANHREISSSTANEGN
FT                   VIPPAGVVNNNTNGAGNEVKGSNAALDTKGWGSSGSSSVIQLESTTKGGMENSIPAASK
FT                   ASPFPQKVWGSQSSPSVREDDEESWGEEIQMKPQKLRLHGTATRNGTGAVVPDSLTSDD
FT                   HPEDKRTLKIRKKGIGASRLS"
FT                   /protein_id="XP_822390.1"
FT   gene            complement(351794..353602)
FT                   /db_xref="GeneID:3663064"
FT                   /locus_tag="Tb10.70.6730"
FT   mRNA            complement(<351794..>353602)
FT                   /db_xref="GI:71746671"
FT                   /db_xref="GeneID:3663064"
FT                   /locus_tag="Tb10.70.6730"
FT                   /transcript_id="XM_817298.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(351794..353602)
FT                   /locus_tag="Tb10.70.6730"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746672"
FT                   /db_xref="GeneID:3663064"
FT                   /translation="MNLSNRVVAFPYTPPPEAKYANLCLQAKAGEEVQVVRQVGGWAVL
FT                   KLGERMGLFPLAYTVKKKDVKAGNGESSGVSVGCPLENENESVTKTDGCPEFFMEGGSV
FT                   VTDAEPPAQRAVRNHGNLKRPGCDRISLDFHVSGESEVANTADDAECNVLFTRVRCLPD
FT                   ESEREMPDGSGGAETEVIRKGDRTTTGNELRDAACVLSARKLPEETIGRRGKLRKMPQS
FT                   RHGDMDYRDNFEEAVGELRGQFVELDMEVEWLNSVTDRLQAVRQNLVGACTSRNETCGS
FT                   QQLQEGENEGKNHGDQFDAATLKQYVSQLQQSLVAYKAKSDTAPASSADGGLAGCEGAT
FT                   ATAAKQNGGECTDGFEVPWWWVISAELRAEMQSIRECIWRELETLSYYSGQRQRLCANA
FT                   DRLLCLKTSMDEESWTLKESEDALEVVAPAGTFKIAYGTGSNNSSYLTDSSHENSFVNS
FT                   NQDTSLSLAPEGSREDVEVVMKEGFVWPASIPGMLDNEKNVVETHQRAIKKYEEKLEKL
FT                   RKGKGEEAFERMRAMEKLRKALSTGDAALSALLNRLNEKKAFVMRYRNVAAIMEEQLAI
FT                   SRKLLQQKRVNSRGNPKSPQQAEPTN"
FT                   /protein_id="XP_822391.1"
FT   gene            complement(354113..355738)
FT                   /db_xref="GeneID:3663065"
FT                   /locus_tag="Tb10.70.6720"
FT   mRNA            complement(<354113..>355738)
FT                   /db_xref="GI:71746673"
FT                   /db_xref="GeneID:3663065"
FT                   /locus_tag="Tb10.70.6720"
FT                   /transcript_id="XM_817299.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(354113..355738)
FT                   /locus_tag="Tb10.70.6720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746674"
FT                   /db_xref="GeneID:3663065"
FT                   /translation="MRRWLNIASNVFPLLRYRQVLGIKPPPPLHLSREGIWRKTEGLTS
FT                   RTDGKGEITPADDLPPWPVDEIEFNTRAPMGGHDIRRAHEQQAAVLTGIDEDSGNLPSV
FT                   SSTTHLSCLQPQRLTEEQKSEVRRVESTTEEGAGALEAGGWVCGSCLHCMPYRSRSVCD
FT                   SCHTVRHDAATAVARWRGNPTTWFCSRCHEFNFERDAVCRCCNLAREAQTELHVAQHER
FT                   VADEIQRSPVGSVIVTRNRVARWRCFVCSESNALQSSICRNCETGRFDLSVSCWNCGGQ
FT                   QKLSNSQLYGSEPADRIHVARPFGLHNCFPRLAPEQRCNRCRVPLHGATASTRSDAWLC
FT                   GCGVVCNASLVSCTRCRIPRRFAHQSTLEELVRVWDFASATNWFCESCNHVNKSSRHVV
FT                   ALDRSCKNNSKSCPNGGTNLGTSGSFTDASVAKDASVKFARISHGTAKCERCGQKWHHQ
FT                   PVNDGQYWRCACHKVNKREDTRCQVCFLPAADGIRSDVLSFWSRGDWYCFNCQRQNYRE
FT                   KVVCACGEERPVDSRVDNKVAPAK"
FT                   /protein_id="XP_822392.1"
FT   gene            complement(356836..358788)
FT                   /db_xref="GeneID:3663066"
FT                   /locus_tag="Tb10.70.6710"
FT   mRNA            complement(<356836..>358788)
FT                   /db_xref="GI:71746675"
FT                   /db_xref="GeneID:3663066"
FT                   /locus_tag="Tb10.70.6710"
FT                   /transcript_id="XM_817300.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(356836..358788)
FT                   /locus_tag="Tb10.70.6710"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746676"
FT                   /db_xref="GeneID:3663066"
FT                   /translation="MGAACTKCSREGDVAEDKQVKKEKPAETVTAPDREDNGSAGRSSS
FT                   GPRVPAIVNDGNCSDGVDCEKFTSCSGKEAAPERADDLSLTSVPLSIRRSSETLPAQPS
FT                   EKSEPRGNDSSSAVGEAVEASLSAESVRSSMSGGMLSPAREISQISMVVDDGATEISAE
FT                   VSGECNTLNSVGGTETCDIGALHWPQGRFSLSVSAPCSMVHSSSPPPQRSKCCSRTSRR
FT                   ELQPGSESSLSIATPVHVEVTQTRRIDPCSLTGTSAAGEISAGDATTNHDCKYGPQHCP
FT                   SGGKPVSGDGTDGLDTAACMKDEARGVEHDPPMQQHRQLQQESGQQRDRREYVDSAETF
FT                   TPHLSMMDPGAGDTAVDTVDFINCSTLSASVGAVASCVMDETVSAAFLSHVMEQQRQKE
FT                   RRRLSPPVPLHDSVDPRVPRLSTPLTDKPDQGKTVHVEVSDLTPEDESDASAYSVVTDD
FT                   KPRIRVSDPSVLHRQPLQRDYLTAEDTNGGDMSNKTLRDSPDGADAVNVARQWPMPEST
FT                   ASSNPQGRTTNDLLNMLRDMVQKQDERRQQQQRKYKAFTRIKNPIPLTSPKMREDNELR
FT                   VDEKEAQSGSASPWSQIWQNRTPLTDGTPNTSLLPRRLSYSPPRDSKYPATKHWIDGEE
FT                   LVHCTDDSRFVTRVS"
FT                   /protein_id="XP_822393.1"
FT   gene            complement(358984..359331)
FT                   /db_xref="GeneID:3662978"
FT                   /locus_tag="Tb10.70.6700"
FT   mRNA            complement(<358984..>359331)
FT                   /db_xref="GI:71746677"
FT                   /db_xref="GeneID:3662978"
FT                   /locus_tag="Tb10.70.6700"
FT                   /transcript_id="XM_817301.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(358984..359331)
FT                   /locus_tag="Tb10.70.6700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746678"
FT                   /db_xref="GeneID:3662978"
FT                   /translation="MGASLPTETFCAPPSAWCEVPSADGRKGAVCGVIGSRCQEDFVGG
FT                   AVPRRINYTTFSRASSIALDTFSLRSPLLLVSASIPHDVAEWIGPSLSYIRTGACGATV
FT                   RADEVVSSASG"
FT                   /protein_id="XP_822394.1"
FT   gene            complement(359514..360365)
FT                   /db_xref="GeneID:3662979"
FT                   /locus_tag="Tb10.70.6690"
FT   mRNA            complement(<359514..>360365)
FT                   /db_xref="GI:71746679"
FT                   /db_xref="GeneID:3662979"
FT                   /locus_tag="Tb10.70.6690"
FT                   /transcript_id="XM_817302.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(359514..360365)
FT                   /locus_tag="Tb10.70.6690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746680"
FT                   /db_xref="GeneID:3662979"
FT                   /translation="MSASCFTVCESLTTRSSWLARNGWTALPGQSRALSDFLAFLGRIS
FT                   RCRKVHRYVTAGCICVVAVTCVMRHFRHPIARRGVSGPWKLLKGCQVWLRRARSCDPPF
FT                   RQQEDAVSVEGSFCSYQSSSITSTSTSSTPLSPGATLCVDEDVNSTDVAERSFDWHRRR
FT                   LERKYVAPLLLMLAEVECVGQRLLHAATLVRGAVSVPVGEKVAGAKGSSVKNEEAGSLR
FT                   KLLHIKTMDADDLLTQLITQLTMIPVGDNLSLKLRREALMSSTSVFAECIAKWMYLPLG
FT                   TW"
FT                   /protein_id="XP_822395.1"
FT   gene            complement(361482..364445)
FT                   /db_xref="GeneID:3662980"
FT                   /locus_tag="Tb10.70.6680"
FT   mRNA            complement(<361482..>364445)
FT                   /db_xref="GI:71746681"
FT                   /db_xref="GeneID:3662980"
FT                   /locus_tag="Tb10.70.6680"
FT                   /transcript_id="XM_817303.1"
FT                   /product="serine/threonine-protein kinase"
FT   CDS_pept        complement(361482..364445)
FT                   /locus_tag="Tb10.70.6680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="go_function: protein serine/threonine kinase
FT                   activity [goid 0004674]; go_function: ATP binding [goid
FT                   0005524]; go_process: protein amino acid phosphorylation
FT                   [goid 0006468]"
FT                   /db_xref="GI:71746682"
FT                   /db_xref="GeneID:3662980"
FT                   /translation="MTSRAPWDACTTQSTPQMGNGAQSHHLSGWRRFPRGQQIGSGSFG
FT                   SVFLSHDTLPGSEWYGQLVAVKVIQLKAISDDEVAHAMNEVAILKNLRHTNVLQYVDSF
FT                   VDDEQQLCLVTEYMAGGDLSLLLRGSGVCGSRSGSNEKRRSVCSGGGDASMRCGSRSSG
FT                   RRNAWKTTSRGDKSPSEEHQQWIESFRIVDLVRQCLDGLAHLHECGIIHRDVKPANVYL
FT                   TESDVVKIGDFGVSKVVSPTDPKLVTFIGTPFYLCPELCLGEPYSFGADIWALGVLTYE
FT                   LYCMKLPFAADNVLAQIHVVTEGQYDREALHCEHTFTPKQLHLLESQYGDAFTRQEKTL
FT                   HQLVVVLVERMLVMDPMERPSAAQLLREFFIFNPSRCPTPAATPPPSRLSAAEVCDLWA
FT                   TNGIATQTNRVNRLCCRIGSGGEMDDIFPLAAAIPTTSSPLASRVAGSYEELVSSLMPV
FT                   ERRYDVLHISERSGYSTPASSRPVTSQGAASDIADPGGTDAFDTFTQEMINAKISRIPW
FT                   LRHAEAFSRLSLCEGYDGEVVRVDWKDGENFTLVSSPHKHRNSTPGLRRSRVSDGLSVM
FT                   GQLALFAEPLSGVDAGSKSMSELLEARLLEVSQSPMASSLTEKSRTTECVITLEANRTA
FT                   KRQEMEGEADKECENSGGPHMLVGRCRGYSTQTLEAILRKKIYFSYLRRQRKLRAVREA
FT                   QKAREEESKRLRAELNELYARSYTEKCRHMFAQGGSSRADQFPYPPDELQMTRAPCQLA
FT                   QVTGLRFESGNFSHDSTAVTKTIDKLAELSCCKPHRPESTVLQPSKLAAEIVRMAADAA
FT                   AVAARRAEFAAHPPLRLDFRNSDGRSMSCSYSSSVGDPSRGMNTAIYTIPISLYIVRSD
FT                   IDVSCSRTSIVSDVCDGLLALPMSVALKPIRRRTRLRGIVWRVKEALKANGLDHVLLFP
FT                   LDIDDDEQVGAEELSLRYVDSAGDAVVVSEPSDWRYTLRDWRKNMNQSWLQLWMAMS"
FT                   /protein_id="XP_822396.1"
FT   repeat_region   364502..364530
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   365461..365480
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   365481..365508
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tagg"
FT                   /rpt_type="tandem"
FT   gene            complement(365936..366640)
FT                   /db_xref="GeneID:3662981"
FT                   /locus_tag="Tb10.70.6660"
FT   mRNA            complement(<365936..>366640)
FT                   /db_xref="GI:71746683"
FT                   /db_xref="GeneID:3662981"
FT                   /locus_tag="Tb10.70.6660"
FT                   /transcript_id="XM_817304.1"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT   CDS_pept        complement(365936..366640)
FT                   /locus_tag="Tb10.70.6660"
FT                   /gene_family="HOG000236520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   hypoxanthine phosphoribosyltransferase activity [goid
FT                   0004422]; go_process: purine ribonucleoside salvage [goid
FT                   0006166]"
FT                   /db_xref="GI:71746684"
FT                   /db_xref="GeneID:3662981"
FT                   /translation="MHSGHPLKPNFVGRDADGNVTVDGRSYPMAESVVATESTIHRSMK
FT                   EMAQTLANAYKTLKHRDTHNKGNSALAPITDENPLIIISVLKGSYIFTADMVRYLGDCG
FT                   LPNVVDFIRITSYRGTTKSSGTVQVLDNLRFTELTGKHVLIMEDIADTGRTMKLLVEKI
FT                   RREYRPASLKVCVLVDKPGGRVVDFKPEFVCLTAPTRYVVGYGFEVNDRYRNYRHVFVL
FT                   KPEYAKRYPSKL"
FT                   /protein_id="XP_822397.1"
FT   gene            complement(367844..368476)
FT                   /db_xref="GeneID:3662982"
FT                   /locus_tag="Tb10.70.6650"
FT   mRNA            complement(<367844..>368476)
FT                   /db_xref="GI:71746685"
FT                   /db_xref="GeneID:3662982"
FT                   /locus_tag="Tb10.70.6650"
FT                   /transcript_id="XM_817305.1"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT   CDS_pept        complement(367844..368476)
FT                   /locus_tag="Tb10.70.6650"
FT                   /gene_family="HOG000236520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   hypoxanthine phosphoribosyltransferase activity [goid
FT                   0004422]; go_process: purine ribonucleoside salvage [goid
FT                   0006166]"
FT                   /db_xref="GI:71746686"
FT                   /db_xref="GeneID:3662982"
FT                   /translation="MEPACKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLEN
FT                   PLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRASSYGHDTKSCGRVDVKADGLCDI
FT                   RGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVP
FT                   NVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKELERRKAAGEAKR"
FT                   /protein_id="XP_822398.1"
FT   gene            complement(368871..369605)
FT                   /db_xref="GeneID:3662983"
FT                   /locus_tag="Tb10.70.6640"
FT   mRNA            complement(<368871..>369605)
FT                   /db_xref="GI:71746687"
FT                   /db_xref="GeneID:3662983"
FT                   /locus_tag="Tb10.70.6640"
FT                   /transcript_id="XM_817306.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(368871..369605)
FT                   /locus_tag="Tb10.70.6640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746688"
FT                   /db_xref="GeneID:3662983"
FT                   /translation="MFRRCGLPLLSSTTPAGFSSASFTAGLGEENERLESMRTRHTGTA
FT                   EDEGWSGSAKRGSGGSAAVRPTIETYRAMTNTELETLLKQREQQVRQLRVVYENFHYEV
FT                   DKCFRTMVFDYHEKALQLSQVHGKMQLGSLQISREALVKMREQQEMYSRDHRIVLTICT
FT                   VLSFAFWVWVRRHYVHREELYGVQPERQQDSSARERTRSVSGAGSFNENLFTSAKRNSR
FT                   NVETSWEREVRESGRTRGHQSV"
FT                   /protein_id="XP_822399.1"
FT   gene            complement(371032..372423)
FT                   /db_xref="GeneID:3662984"
FT                   /locus_tag="Tb10.70.6620"
FT   mRNA            complement(<371032..>372423)
FT                   /db_xref="GI:71746689"
FT                   /db_xref="GeneID:3662984"
FT                   /locus_tag="Tb10.70.6620"
FT                   /transcript_id="XM_817307.1"
FT                   /product="methionine aminopeptidase 2"
FT   CDS_pept        complement(371032..372423)
FT                   /locus_tag="Tb10.70.6620"
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionine aminopeptidase 2"
FT                   /note="Curated by J. Mottram; go_function: methionyl
FT                   aminopeptidase activity [goid 0004239]; go_function:
FT                   metallopeptidase activity [goid 0008237]; go_process:
FT                   proteolysis and peptidolysis [goid 0006508]"
FT                   /db_xref="GI:71746690"
FT                   /db_xref="GeneID:3662984"
FT                   /translation="MPPKGGGAGSKKQQGGKKCKDDEADFDAQLAKALQEVQVSKDKQG
FT                   GDANKKAQKGKQRTSKQESNGEANDNNDASDPKVVSTADHPDNPYPQVAEGMKRQTWPE
FT                   PTIPVSQQFARGNFPVGIICEHPGEVNAYRYSSEEKRAMEHATEEQVQDLRCAAEVHRQ
FT                   VRRYAQSFIKPGISLLSMTDRIEKKLEELIEKDGLNRGQAFPTGCSLNHVAAHYTPNTG
FT                   DKCVLMYDDVMKVDFGTQINGRIIDCAWTVAFKDEYEPLLTAVKEATYEGVKQAGIDVR
FT                   LCDVGAAIQEVMESYEVELNGKVYPVKSIRNLSGHTIAPYVIHGGKSVPIVRGGEATRM
FT                   EEGELFAIETFGSTGRGFVQEDMECSHYMMVPGGEKTQVRSDKAQQLLRHIHKTYNTLA
FT                   FARKWLDRDGHDRHLLNLNQLVEAGAVNKYPPLCDIRGCYTAQLEHTLILKPTAKEILS
FT                   KGDDY"
FT                   /protein_id="XP_822400.1"
FT   misc_feature    372721..372756
FT                   /note="GA-rich"
FT   gene            complement(373463..374200)
FT                   /db_xref="GeneID:3663006"
FT                   /locus_tag="Tb10.70.6610"
FT   mRNA            complement(<373463..>374200)
FT                   /db_xref="GI:71746691"
FT                   /db_xref="GeneID:3663006"
FT                   /locus_tag="Tb10.70.6610"
FT                   /transcript_id="XM_817308.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(373463..374200)
FT                   /locus_tag="Tb10.70.6610"
FT                   /gene_family="HOG000257261" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746692"
FT                   /db_xref="GeneID:3663006"
FT                   /translation="MVEYKSAAAIAQALFTTHGKDSTTFNRLLRDRIGKRGDRFTEDHP
FT                   DTFLYIERSKNANVVAYTARFVDAETKKPVPSGVGRDCIIKHDGPVHAYFITLDPQQME
FT                   KLRAKGRTSLIDDLNFVQRKMAYGCSGKSFDVASASRECDNPADFKRWMSAFDPYTLSY
FT                   VALAKYPTLLLTLKPVKDSNGEENDTAVALIAVIGGELSVVKKIYVSSTEPKHFYELPT
FT                   VNYIEVFGVSVDKGSDTYEKKAP"
FT                   /protein_id="XP_822401.1"
FT   gene            complement(374937..375584)
FT                   /db_xref="GeneID:3663007"
FT                   /locus_tag="Tb10.70.6600"
FT   mRNA            complement(<374937..>375584)
FT                   /db_xref="GI:71746693"
FT                   /db_xref="GeneID:3663007"
FT                   /locus_tag="Tb10.70.6600"
FT                   /transcript_id="XM_817309.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(374937..375584)
FT                   /locus_tag="Tb10.70.6600"
FT                   /gene_family="HOG000257262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746694"
FT                   /db_xref="GeneID:3663007"
FT                   /translation="MKSSDIFFAYRLTPVVFKSRQHDSGVNQYGLKPTNAYDYINPTNL
FT                   INFGRGTTFDNLGVRRAGRGEIDSSPSHSGSPVFTQAKLIGLSGEEQLTMCQSETMALR
FT                   LCMAKAGKETCERESRALDSCLGRVGHLRRAMSEACWEFNDWFIQNVSDNHTKPFQHRP
FT                   HDWRHFYAQEKLVRERQQNGHAYGRRPKQFSFGARYVKTDGYGKRPRLPYNK"
FT                   /protein_id="XP_822402.1"
FT   repeat_region   376452..376474
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(377003..385621)
FT                   /db_xref="GeneID:3663008"
FT                   /locus_tag="Tb10.70.6570"
FT   mRNA            complement(<377003..>385621)
FT                   /db_xref="GI:71746695"
FT                   /db_xref="GeneID:3663008"
FT                   /locus_tag="Tb10.70.6570"
FT                   /transcript_id="XM_817310.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(377003..385621)
FT                   /locus_tag="Tb10.70.6570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746696"
FT                   /db_xref="GeneID:3663008"
FT                   /translation="MDGPFATMDEETRKTYMERGRAMMEARRAEILSHSPEKFEQLRRQ
FT                   GYIIFKRYLQGEQWMPLQGKLHSPLITTSEEPSKAHKQNMGSSGSSHLPQDDNITAKEY
FT                   NMPTTKLAEWCAPTDKPLFPESTPAEPEELHHVALLTMCGPSVSCVDGDDEDFKQLSYN
FT                   KDVATLHKTMEIQHQQIEQLNAQLRNQESEIDVLTNELKGVTEANARQLQKEEELQSLQ
FT                   EALQERDRELQLRLESVNEQNDSLKTQIMELHILLELKAKELQKLKDDNNALRGEVVTI
FT                   QNEGDTIKESETKCKERILQLEAANSELGVQVDVSKKEVEAAHQRIKNLEQELTRERKI
FT                   NEDSTVAYNKVKKELECKEKTEQQKQEEIKQRKRAEKAMIRELSELQDRIHTLESTQET
FT                   ENNSSTAGIPLNPFAKMVIQGEASQPRVEDDDDAVVFGVGDSVTPSVCVETGMALRVKE
FT                   LEMCISGLQQQLESERADAAREVDSLRHRIAEHDELLRQKLEEYKAEQEAKFLEELEAC
FT                   RTGNESDDAILERLNTLQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLRQ
FT                   KLEEYKAEQEAKFLEELEACRTGNESDDAILERLNALQACNDQLKEELRELEERQQVEL
FT                   ANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNTLQA
FT                   CNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELEA
FT                   CRTGNESDDAILERLNALQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLR
FT                   QKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNTLQACNDQLKEELRELEERQQVE
FT                   LANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNTLQ
FT                   ACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELE
FT                   TCRTGNESDDAILERLNTLQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELL
FT                   RQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNTLQACNDQLKEELRELEERQQV
FT                   ELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNAL
FT                   QACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEEL
FT                   EACRTGNESDDAILERLNALQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDEL
FT                   LRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNTLQACNDQLKEELRELEERQQ
FT                   VELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELETCRTGNESDDAILERLNT
FT                   LQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEE
FT                   LEACRTGNESDDAILERLNTLQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDE
FT                   LLRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNALQACNDQLKEELRELEERQ
FT                   QVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLN
FT                   TLQACNDQLKEELRELEERQQVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLE
FT                   ELEACRTGNESDDAILERLNTLQACNDQLKEELRELEERQQVELANVTQEAADRIAEHD
FT                   ELLRQKLEEYKAEQEAKFLEELEACRTGNESDDAILERLNTLQACNDQLKEELRELEER
FT                   QQVELANVTQEAADRIAEHDELLRQKLEEYKAEQEAKFLEELETCRTGNESDDAILERL
FT                   NALQACNDQLKEELRELEERQQVELANVTQEAGGTRGYCGVTVFVASTSSSVGSVRSLL
FT                   GADSCLPCINLETADCGAKEAECCISHREVVGNGSHCVDVLKGSEKVSSRVQTDSPEAI
FT                   GVVCRSFVDMTEDRENGERVDYGNLNGLSYCNFSGDIPDDIGMGNLVICRKQSKCNKSC
FT                   QVDDGVVPLDDSNEAELRVEDCQTLPDVTRNRVELQREEQSRLHSENGGSEKEVHTAEL
FT                   DHTTLKHNVVEDLFAEKVLTIPLVVEYLFRAVLDAHEYLVRHHVNFQRKLLSRCDVIER
FT                   AASDAMIEGERQCEEFMAVVEGAEVERQGLLRQITELQQEVATFKASSERVESELCSNK
FT                   EEHSKVIRKLHEKLDATQHEMEVVKVEYANSLHKMELVKTENANVLHLFSELKKTAADV
FT                   EDEQRREVVRLQEALREKTHTSRELLELTEQKLAAALEEVDQCKCSREDLEKQLRSTKS
FT                   SLDRVIPRLERAETERDSLESQLLDATQEVQLLTQRNRTAEEASRRQADALTATVEELR
FT                   EANTKLGESCKEQQAQLDSLKAQLAVAETELERLRMRATQQESDAQRLNGKLCELESSS
FT                   TLQVEEAAAALRAAEMRIAALEPRKAALQEEVDHVRRKNCELQGCCDELKERLRQAADT
FT                   TQNAEQMHNRRVQQLNEQVEALQLEVKQLQEAHDGLVADREQLVREQVGAAQETERIKQ
FT                   NLERCNQQKERLQNEIQWQRESYESEIQAAQETLNGAREELSKWRHTLEEAEAQQNAMR
FT                   DTISMLQVERTSNHEQIRAVRLQLREYQELLAQERGYLHETGLKFLRSCSDECSVQKSP
FT                   SVPYTPQRECGTRETCSLTSAPAGCCDSQKTQGSASQKSIARLRNIVAQKSLLLEEREA
FT                   QVESLYSEMKTAIVHVVQEARNAQLGSKALAPVDQRELLLNNIMHNLLLRLGRLSRVVR
FT                   EPSTDSTGSGSRDPANAEVSPNSSTNPEAVLNFSSAATPKERVSGGGDESTDAR"
FT                   /protein_id="XP_822403.1"
FT   gene            complement(386876..389416)
FT                   /db_xref="GeneID:3663009"
FT                   /locus_tag="Tb10.70.6550"
FT   mRNA            complement(<386876..>389416)
FT                   /db_xref="GI:71746697"
FT                   /db_xref="GeneID:3663009"
FT                   /locus_tag="Tb10.70.6550"
FT                   /transcript_id="XM_817311.1"
FT                   /product="protein kinase"
FT   CDS_pept        complement(386876..389416)
FT                   /locus_tag="Tb10.70.6550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="similar to SP:Q8VDF3: Death-associated protein
FT                   kinase 2 (EC 2.7.1.37) (DAP kinase 2) (DAP-kinase related
FT                   protein 1) (DRP-1). {Mus musculus}; similar to SP:Q9ES74:
FT                   Serine/threonine kinase Nek7 (EC 2.7.1.37)
FT                   (NimA-relatedprotein kinase 7). {; go_function: protein
FT                   serine/threonine kinase activity [goid 0004674];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:71746698"
FT                   /db_xref="GeneID:3663009"
FT                   /translation="MRSCCSCGKAWCCPERVEDRAEEILKGYVDCFGIDDYRNVQRMAE
FT                   LSGLLSHCSQVDWSNVAGSVSIGLIFRGKHVEDDCDVVVSVLKRPANKKDELSRYVQKE
FT                   VGVLAINFPNIIRVVDYFSVIEGEWAYSMALLKWLGGDGIVEFFTQSVLGKGRASDVER
FT                   DDIELRRHPTVDATRIMQGNVEGDYFDSKWRPSTPVREGNTCVVGDYEMYMDESLGKGQ
FT                   FGEVYRGKHIKEGYHVAMKIIKAPAKKRDETPDEISIMDLLGCPGHPNVVKAYGTYETI
FT                   DDKNEPSYVLVLELCEGGDLKEYLAKHDPLSEAQARRIMRQLVDCLCFLRERGVMHRDL
FT                   KPANILLTSCNIDEAVVKVADWGMAKVNSRKGSALEATEGEEMFESAVGTMAYMAPERL
FT                   NFDSYDYQAEVWALGVIMYELLFARHPYIYPKATVCSADALLGAIARAEQLDMTNRAPS
FT                   ASTSTTDGAGGELSQQEGGYVNRRRLSPSCYELLRQMLHSEAKKRCTIIDVKNHVWFTH
FT                   EEPRSAPVLVRGGSPRSVLADALGSASGVTLAGQALAEYPSAVDNSVLPVENCEGGRNV
FT                   LTTLEKRQTILALREYIHILQYNIVERERDPGRGLVLLSYGWDLLSAAVNTVFSECSNV
FT                   AGDTGGAANATNGPNMSASSSLFHDSLDDLKQVEGYIQTAASQLKQSLQSNQGTQTTAS
FT                   SAADNEEGVTQHSFTLMTRGTSLDCLPSAKELMLRHAVDLIRWAASEQLLLTPDDKREK
FT                   QRGVLEAELEPKKLQGKKLWEDAMAILRLLLQQVVVYSPTVTTRSIIADATMGGSVQVL
FT                   NVPLVPLTHEEDRRTVQALLHKVEGLYRNLFVRV"
FT                   /protein_id="XP_822404.1"
FT   gene            complement(390267..390899)
FT                   /db_xref="GeneID:3663010"
FT                   /locus_tag="Tb10.70.6540"
FT   mRNA            complement(<390267..>390899)
FT                   /db_xref="GI:71746699"
FT                   /db_xref="GeneID:3663010"
FT                   /locus_tag="Tb10.70.6540"
FT                   /transcript_id="XM_817312.1"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT   CDS_pept        complement(390267..390899)
FT                   /locus_tag="Tb10.70.6540"
FT                   /gene_family="HOG000236520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   hypoxanthine phosphoribosyltransferase activity [goid
FT                   0004422]; go_process: purine ribonucleoside salvage [goid
FT                   0006166]"
FT                   /db_xref="GI:71746700"
FT                   /db_xref="GeneID:3663010"
FT                   /translation="MEPACKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLEN
FT                   PLVVVSVLRGSFVFTADMVRILGDFGVPTRVEFLRASSYGHDTKSCGRVDVKADGLCDI
FT                   RGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVP
FT                   NVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKELERRKAAVKAKL"
FT                   /protein_id="XP_822405.1"
FT   repeat_region   391459..391509
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   391760..391801
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    392294..392353
FT                   /note="T-rich"
FT   misc_feature    392742..392903
FT                   /note="T-rich"
FT   misc_feature    392972..393011
FT                   /note="T-rich"
FT   repeat_region   393012..393040
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cattt"
FT                   /rpt_type="tandem"
FT   misc_feature    393041..393110
FT                   /note="T-rich"
FT   repeat_region   393190..393254
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    393279..393323
FT                   /note="T-rich"
FT   misc_feature    393526..393661
FT                   /note="T-rich"
FT   repeat_region   393723..393743
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttca"
FT                   /rpt_type="tandem"
FT   repeat_region   393842..393882
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   393992..394030
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    394314..394420
FT                   /note="T-rich"
FT   repeat_region   394544..394575
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   394631..394657
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   394738..394761
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    394894..395054
FT                   /note="CT-rich"
FT   misc_feature    395077..395189
FT                   /note="T-rich"
FT   misc_feature    395217..395240
FT                   /note="AT_rich"
FT   repeat_region   395266..395328
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    395424..395513
FT                   /note="A-rich"
FT   repeat_region   395534..395561
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    395666..395689
FT                   /note="AT_rich"
FT   misc_feature    395733..395784
FT                   /note="T-rich"
FT   repeat_region   395890..395936
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    395984..396059
FT                   /note="CT-rich"
FT   misc_feature    396097..396190
FT                   /note="A-rich"
FT   gene            complement(396325..399987)
FT                   /db_xref="GeneID:3662740"
FT                   /locus_tag="Tb10.70.6480"
FT   mRNA            complement(<396325..>399987)
FT                   /db_xref="GI:71746701"
FT                   /db_xref="GeneID:3662740"
FT                   /locus_tag="Tb10.70.6480"
FT                   /transcript_id="XM_817313.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(396325..399987)
FT                   /locus_tag="Tb10.70.6480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746702"
FT                   /db_xref="GeneID:3662740"
FT                   /translation="MRKAGANRNNERQGRNLGQQGPQMSPPGPSMMYPHHHQHQHHHQH
FT                   QHQHQHQHQHPHQHPHQHHHHHPHHNGVYGNAYDNIRQPQMPPHSFGQGVSGSPWNSPP
FT                   QQTPMYNQGYNQMSPGTGGGYGDMGGMYRDVHGGQYPSSPSHMGGGANIPYGRNPAMHN
FT                   GLPAGAPLPGGYGALPHQGAHTPMGFGRGGQPLMEHMQPSGMYGAPMMRHDGYPDTRVS
FT                   PPAQVGYGAGAPVGPPPPPPMPAGPPYGGVLPGAGVGPGGPMNASRPPAGIGGGGGGGG
FT                   NAGYLEMRARGMGPQMPASNASRPPRIGTPDPGMMPPNRMNQSPMMGQGLPPQVGNFMP
FT                   LPGVSPSPHAMIPTTPSMGDTFPGDDANMSGSTEALYDFLHDRGLVSVDNISKFFPEGY
FT                   GKDDPALKVAVDGNFCLTSLRDELRKRDSLWFLHSTLPEELLMLVQQHVEWMRNMKLEP
FT                   IWVFNGLSVSGDVETFLTTEAELRARDAVWSKLEDGEIPDEVEIQEAFDQPLGEDVQMA
FT                   VARYLKEELGVMAVTAPFLNWAQMVAFHKEGIADLLMGPPEMLLLPYDEMKVIVQIDVS
FT                   NSSVNYLDRDRVLRALFPNHVTETNTRVAGDRLMDLGLITATHAALSSARVTLNLSMQE
FT                   VYEELSTPTPKFRSIKDFINAHACSQETGKKAGLSIKHSKGRGYLRYSAVFSTKSRDTP
FT                   LVYLVRVLDPDLTNADMPTNLAGVLGHLVPLSLFYMQFSGLLSVRIMTAITQSYLRDEC
FT                   PVSDTKDYHTTLGLLMTMRSQVIGQILKRIAHPPPIKRTECLSWVRWFQPILAPMDRPR
FT                   DLIDLDEWEISDSDQLKKLDEDCLADYSIASVLSVTADASRPAVEESNRPAGRVPIRYN
FT                   SKRETFLAILLKSFDFLGYFSHSTAPNDAVDGMEMECCGMDGHDRGGSVPAAYHEKDLS
FT                   SMKRSEASDINFMADEGLKDYPSVYFPIYLRATIKANPLDVQASFVLLTELVRVRIINS
FT                   NPCRYINPANQQVEISMDDQDTNSDSRVLLASRIACLVKLPYRRASENLPFVWAPVYSR
FT                   HLCAFTVMVRAMCRCLRELVEVITSTVFLSGNSSCSLQDFAEFASILPFGDVPSTIGGL
FT                   LLHYVLVFPSDYQANLTSREERIEYLQGKFRDIPDLADHLHLVMSFTLQALYLINAYML
FT                   NDKETIVAKDQLTGTIVEDTIEMMWQKWRDHIDDNPPGDIHNLYPPRHQEPIPH"
FT                   /protein_id="XP_822406.1"
FT   repeat_region   399146..399169
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   repeat_region   399778..399885
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="atggtg"
FT                   /rpt_type="tandem"
FT   gene            complement(401055..403376)
FT                   /db_xref="GeneID:3662741"
FT                   /locus_tag="Tb10.70.6470"
FT   mRNA            complement(<401055..>403376)
FT                   /db_xref="GI:71746703"
FT                   /db_xref="GeneID:3662741"
FT                   /locus_tag="Tb10.70.6470"
FT                   /transcript_id="XM_817314.1"
FT                   /product="methionyl-tRNA synthetase"
FT   CDS_pept        complement(401055..403376)
FT                   /locus_tag="Tb10.70.6470"
FT                   /gene_family="HOG000200401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="similar to Methionyl-tRNA synthetase, mitochondrial
FT                   (EC 6.1.1.10) (Methionine--tRNA ligase) (MetRS).
FT                   (Swiss-Prot:O74634) (Candida albicans;); go_function:
FT                   methionine-tRNA ligase activity [goid 0004825];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   methionyl-tRNA aminoacylation [goid 0006431]"
FT                   /db_xref="GI:71746704"
FT                   /db_xref="GeneID:3662741"
FT                   /translation="MALKLLSEKANSQALKVLLCSYYVKRPVEVSLSGAYATPILHHPA
FT                   FKQPIIAPNEMARVILFYSVEPTSNNGGAADSSNGDGTASPVAGLTNLTLEHETWLEWE
FT                   ATTFTRAVHPLYTQRRQTAESLAVFSYLDKKISENDDRCVYSPAVEGKGAADPTDAVST
FT                   FFIDCIVWCAVLPALCESGVLRDSEKQQLPHLVKWFNTFQKEQKTLIDNAFENLSVQEA
FT                   ADFLRCPRVYKVSAKVEKVFFVTSPIYYVNAAPHIGHVYSTLITDVIGRYHRVKGERVF
FT                   ALTGTDEHGQKVAEAAKQKQVSPYDFTAAVAGEFKKCFEQMDYSIDYFIRTTNEQHKAV
FT                   VKELWTKLEQKGDIYLGRYEGWYSISDESFLTPQNITDGVDKDGNPCKVSLESGHVVTW
FT                   VSEENYMFRLSAFRERLLEWYHANPGCIVPEFRRREVIRAVEKGLPDLSVSRKKETLHN
FT                   WAIPVPGNPDHCVYVWLDALTNYLTGSRLRVDESGKEVSLADDFSELERFPADVHVIGK
FT                   DILKFHAIYWPAFLLSAGLPLPKKIVAHGWWTKDRKKISKSLGNVFDPVEKAEEFGYDA
FT                   LKYFLLRESGFSDDGDYSDKNMIARLNGELADTLGNLVMRCTSAKINVNGEWPSPAAYT
FT                   EEDESLIQLIKDLPGTADHYYLIPDIQKAIIAVFDVLRAINAYVTDMAPWKLVKTDPER
FT                   LRTVLYITLEGVRVTTLLLSPILPRKSVVIFDMLGVPEVHRKGIENFEFGAVPPGTRLG
FT                   PAVEGEVLFSKRSTENTKST"
FT                   /protein_id="XP_822407.1"
FT   repeat_region   404252..404286
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="attg"
FT                   /rpt_type="tandem"
FT   misc_feature    404429..404539
FT                   /note="GA-rich"
FT   misc_feature    404582..404607
FT                   /note="AT_rich"
FT   repeat_region   404740..404761
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   misc_feature    405619..405654
FT                   /note="AT_rich"
FT   gene            complement(405760..412740)
FT                   /db_xref="GeneID:3662742"
FT                   /locus_tag="Tb10.70.6450"
FT   mRNA            complement(<405760..>412740)
FT                   /db_xref="GI:71746705"
FT                   /db_xref="GeneID:3662742"
FT                   /locus_tag="Tb10.70.6450"
FT                   /transcript_id="XM_817315.1"
FT                   /product="transcriptional regulatory protein NOT1"
FT   CDS_pept        complement(405760..412740)
FT                   /locus_tag="Tb10.70.6450"
FT                   /gene_family="HOG000257132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulatory protein NOT1"
FT                   /db_xref="GI:71746706"
FT                   /db_xref="GeneID:3662742"
FT                   /translation="MLYEHTTDIGSSRGAAARYLIASATKSSLQTTLQALEKIAGQSVE
FT                   LYRFVVSAAVSSIWTPPQTEEKNLLVSKLVSTALEKSNALTLVSAAVDESPVTVTKESL
FT                   VTLMTRDLKLTPPQQLQFAMGLLAGSKKGKEAAAEFLNGISVAQYTVKEDVASLWSYSV
FT                   LARQLGDVQALETQLSAAAAGAAGGANDRVTVLPHDGVVDMHVSLSRIIDELGTACVAT
FT                   PADCRELLSLFPRPVTQVDVADVVGFFASQGSAPTDTNTYNALMASAGREPTKVQQNAA
FT                   ISPFPLLELLQERVQEPVDWDTVLRMLDKSNEGPFVRKHVSIVFDAYCKFKGTGTPGVY
FT                   PPITIFLGRWSNVGRQRTVLEYILKHPEKVSMQGLSCDQMAPIELVEVDAADAASSPTT
FT                   SGASASPSTVPESRAGEVELWRYFPFLEAAVHVASRDGAFDAETLRPAALRYPLLMLYS
FT                   LLFGSFPGTMKNFSTAKLILRDSRLPLERVATTIIPEAERRGKLNTVISLLSELTIVVP
FT                   SRTIDVMEAVLKTKNAVRAFLAVGGNPRLVTAIAMCMDESNEGGGGGANCGVSGGAGDS
FT                   WISKALEGKLHFRAHAAENRFAVATSIVEVAEQLLDKQKYVPKATAALNTFLASSLKDL
FT                   LRDVAEQARILLASTDSLFPTDVENDATEFYRRMYKAGDPTISASLAFIEQLLKSSKSR
FT                   DKQLCACIVSIMFEECNAIGCYPHKELQLFATLYGQMIARELLPPNQQQRAWTLLLPVI
FT                   VKPTDHLVEEYGIIALEQIKPRLAEWPQYGRALRHVKDLDIRIPGIMAAINRGIKAEEA
FT                   ARQSQSRAQNQEKTTQQQKEVESLLSDPAVLALSTERRDNMLAAEQQKDRVAAATLHQH
FT                   DIGTLLSKKNITAPPRVIQEQINFIIGNTDLHNVENNARELAKQLRPEYYEFFAEYFVV
FT                   KRAALEPNYHPTYLNLLNNLQSKQLEKAIRSATVSSIKLLLSSDKIRADPGERSLLKNL
FT                   GYWLGLLTLAKNIPITAQELCFKDLIILGLREGKLMAVVSCIARVLHHCMDSRFFCPPN
FT                   PWTMRQLCLLWEMYNLRNLRVTLRFEVDLLCKHMNVKLEEIEQYYNMHPIHSSTQLCIS
FT                   DVYREINIHQSADFRVDKMELQDVVQQPHKQVQQPQQAAQPQLQTQAARANRPLQANAE
FT                   PFKPKDSMVPSGGALAFEAVGPRRPPIVITPETVRVSEEEASLFGERLAVYKGYLAKTL
FT                   ERVTQELKPTVQRSGTIAAVTACHITTKDFLFDRDIKAQLRAADAMARSLASNLCTVAI
FT                   RDALPEPFNVQVGDLISRLIDVNVPSYTERRERLKGLIRENNMDLCVRALEWQAAEEGA
FT                   KRLHEKLDKIIKEKIDQITAREPPRAPKEYHDVRDLLMHMGEVLRPPHNLPPLQRAVYE
FT                   EFNNSVPVVGLLTAYVRTLEDATVQHYSTGDAKVLSLTSPEFANGHFGESHDVIRTRVI
FT                   GISNIINAETAIYCVGPMLRKLFVLAGAMKRADSGTAASNDLTTARHRNVCNLLNEVYL
FT                   FVLQTCYERGGDIIREELTQLYLQAEQRWSYTDLAVNLLRIKVLNVSRFDAALSKALLA
FT                   EGMGRQGVVDFAGATLSRVIVNEKLLSAKELRDTVSQLESIASKQDNQTPRQQQNQPKQ
FT                   QRHQPQSQQLPASGQDSGAMGGAQMAPGGAAPTNAMRASPALSNLVEQHVRRLVVPTLA
FT                   PQNQEDAEKIRGLFEEWLIVNARRMHSSSSESNQASGAATNAPSQEGATAPTTSSPASA
FT                   TAAPTSTTSAALPGNKPPPQYEYMMKLRDNKQLDGPQLRTFLTTSLRFCVEHYATKSLE
FT                   LERSNPAVLGRALTAEWKPGNAPPHRYQYDDGLFTHVDALSDLVTVLLYYCSLKNESRT
FT                   LLTLLRRVLDAFQWALIDNHQAVVVRLQQAQNPNHLGNAKSELPAGTAYAPMFQQQPYV
FT                   RFFSNLFTTLVRADSPKRETMEQITSAFADTLHNLPPLKYPAFTFGWLELVSHRIFLNR
FT                   CLRSPVPWPSYVALLVQGLEFIERFTREGNISKNVLVFYKAFFKLMLVLTHDYSRFLIT
FT                   YHYQLCDAIPPYCVQLLNTVLCSFPSGVKLPEFFARVPDDGSEMRKHPATDNQVKCIEE
FT                   SFKQHHFDGNALSEKLQDDRPMSESYMQSIVEKLQSLHNWRLMNAIVLHVCIVYLQVND
FT                   HAVKPNFPESNAMRFYRHLAGSLDHEHRYYFICSCANHLRYPNCQTNFFVKVISNLFLP
FT                   HRSIRNAVVQQCIQEQITRVAVEKTLIIQPHPWGVLSTFMELMRAPEYGFWEKSFICST
FT                   SFLESMFTKLRRSVESRNAQQQVQQSTGSASTSATQGKK"
FT                   /protein_id="XP_822408.1"
FT   gene            complement(414137..414946)
FT                   /db_xref="GeneID:3662743"
FT                   /locus_tag="Tb10.70.6420"
FT   mRNA            complement(<414137..>414946)
FT                   /db_xref="GI:71746707"
FT                   /db_xref="GeneID:3662743"
FT                   /locus_tag="Tb10.70.6420"
FT                   /transcript_id="XM_817316.1"
FT                   /product="small GTPase"
FT   CDS_pept        complement(414137..414946)
FT                   /locus_tag="Tb10.70.6420"
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small GTPase"
FT                   /note="similar to SP:P55745: Ras-related protein Rab- 21.
FT                   {Canis familiaris}; go_function: GTPase activity [goid
FT                   0003924]; go_process: small GTPase mediated signal
FT                   transduction [goid 0007264]"
FT                   /db_xref="GI:71746708"
FT                   /db_xref="GeneID:3662743"
FT                   /translation="MRSSVPSYKVVLLGEGRVGKTSLISRFVNDTFDAQQRSTTQASMY
FT                   SSVNVPLLNSDKTVNLNVWDTAGQERFHALGPIYYRNANGAILVYDVTDADTLEKVRLW
FT                   IRELRAVVGDQIQLVVCANKSDLEQEREVSEEKGRRFAKDHGAQHLSTSARTGMNVAEA
FT                   FQTLATAIASSAGATGGGGSGGGGSNNNNSASGAGGSVFFESEGSSAWAPKRRKRRGLL
FT                   RIEDDMPGEDDEVANLVSGGGGKHSTVNLSSNPNVAAATPRRNRCCS"
FT                   /protein_id="XP_822409.1"
FT   repeat_region   414990..415015
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(415469..417916)
FT                   /db_xref="GeneID:3662744"
FT                   /locus_tag="Tb10.70.6410"
FT   mRNA            complement(<415469..>417916)
FT                   /db_xref="GI:71746709"
FT                   /db_xref="GeneID:3662744"
FT                   /locus_tag="Tb10.70.6410"
FT                   /transcript_id="XM_817317.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(415469..417916)
FT                   /locus_tag="Tb10.70.6410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746710"
FT                   /db_xref="GeneID:3662744"
FT                   /translation="MSGVSGVGRAGDFGPLLTDFERDAKFWSQQLVTAAVERSTKLESQ
FT                   HFTRNARRGITQLPSNTNCVRDVALHVWGELGFFTVPPLEEEQVDLRACRPRECNGEKN
FT                   ASAPDEDVLKFVSALEGHYTQILKGGEMTLDDEDGQTCKKVQGVGLPQQLRCHELRNGV
FT                   WRVLFNAVFYCVAASGNQVLFPSLEEASPSHASARSNSSTLCDNGDERQSRLGEGSDEE
FT                   RSDQTVDFPIKLQWQSYQTVNEAVRGANQRGQRGRVSSSVDISESPAPQELPTPLKTAT
FT                   TSMFRQPRRQEDSTRPLRGTKVSFASMLQNPLPIIAWRFILHTLSQLGYRRDAFYVQTP
FT                   LHASLDELMLALLWLTREYQLVATAEHVNIHFAYPFLLEWCRNGDEYEKKGGFGEISPT
FT                   LSGTVGSLGEGFSTKCGSTDVAKQHYGDVLLHSFPAAVPWPPASFLEQEDIAYRLHQQA
FT                   RIIPAAGGELADTPRRPVDLSRQLLSVRRLIELSVSRLEHVLHQRAEQISAMGLHSDLD
FT                   LQLCHPAIHDTYCRLCCGLRHMLGLEKRLRDVTEQLARFGSLVAWSLSHVNRCGDGCCV
FT                   YDDLRNAKGVVEAMENDEVEASSASSLPSNYPLQNAFNSFRATHRLEQLHEMSAFFRRS
FT                   AKVNNSRTPQDDVALRTKVQHNMKARYSLKAALSAELMAMVEANNSGCRGSGHDATSLK
FT                   SRMPLLRSFDLATTSVNTRSGNDTCGDQTDTGSAFAGASIDAFIAFHSTRRAQAAVVGT
FT                   PASGGTTSARLEAERLREVKRQLPTVHETCEEVRQLLHAATRTLHHHKLRIVPPISKAQ
FT                   PCL"
FT                   /protein_id="XP_822410.1"
FT   repeat_region   418239..418316
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    418424..418479
FT                   /note="A-rich"
FT   misc_feature    419234..419308
FT                   /note="GA-rich"
FT   misc_feature    419342..419362
FT                   /note="AT_rich"
FT   misc_feature    420278..420400
FT                   /note="A-rich"
FT   repeat_region   421254..421274
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   421349..421376
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taaa"
FT                   /rpt_type="tandem"
FT   repeat_region   421541..421568
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(422075..423769)
FT                   /db_xref="GeneID:3662959"
FT                   /locus_tag="Tb10.70.6380"
FT   mRNA            complement(<422075..>423769)
FT                   /db_xref="GI:71746711"
FT                   /db_xref="GeneID:3662959"
FT                   /locus_tag="Tb10.70.6380"
FT                   /transcript_id="XM_817318.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(422075..423769)
FT                   /locus_tag="Tb10.70.6380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746712"
FT                   /db_xref="GeneID:3662959"
FT                   /translation="MPPADRNDIEEERVSRWCVTDEERPIPPDSYLSPNGALTVATNAV
FT                   SPPPYPCSVQRVVHPEGPVHHFVDSDSPGCGYDDKFGAGDDEVKGGELYMWVLDPHSRK
FT                   LRVPLSLMVPTHATANKGALPSLCLSFLEGHCRHEWCRQAHVPPHVLPMLRQQALNAPT
FT                   CCRLHKDPHSTTELTDRFKFIRLVGNEGSYSSRGTNGEQSDLIPAERVALTVGLQLIIA
FT                   QSAQAAKEKEEQSQNLGETNQGAANGAKVERKDVLDVPAKDVCRLHISRLCRYVEDCKN
FT                   IHICREYDLQLPPPPNLVCLLNGITPSMTMINIGERSYSSTMLSLGDVTDEVFNIICDQ
FT                   QRRSVMNNTPAARMTPASQPYQHANQVVSCANPGVDAAINSASPLSLGDANLYTAPRGG
FT                   TSPASCGMGDATPFAPASQRSLGQNGSPNLGAAAAGSSNVTRVLRIFDVRPKSAGEGGR
FT                   ERGSTHRGHNTNGNGSAGASPFLNGRGSESASRSRNGASVSYNNYTCPNSKNGSGNGCA
FT                   AGAGVPPCGINGSDRNACSGSHRRGSRHLTGQSNNSGRGSAKRRQKA"
FT                   /protein_id="XP_822411.1"
FT   gene            complement(425397..426845)
FT                   /db_xref="GeneID:3662960"
FT                   /locus_tag="Tb10.70.6360"
FT   mRNA            complement(<425397..>426845)
FT                   /db_xref="GI:71746713"
FT                   /db_xref="GeneID:3662960"
FT                   /locus_tag="Tb10.70.6360"
FT                   /transcript_id="XM_817319.1"
FT                   /product="proteasome regulatory non-ATP-ase subunit 5"
FT   CDS_pept        complement(425397..426845)
FT                   /locus_tag="Tb10.70.6360"
FT                   /gene_family="HOG000257129" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome regulatory non-ATP-ase subunit 5"
FT                   /note="go_component: proteasome regulatory particle (sensu
FT                   Eukaryota) [goid 0005838]; go_function: endopeptidase
FT                   activity [goid 0004175]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]"
FT                   /db_xref="GI:71746714"
FT                   /db_xref="GeneID:3662960"
FT                   /translation="MTDVDQWKCASFKQEEDHSEATDALLERINATAIPVLLRSTNSSL
FT                   DDLVNELLALEKMARLGGDALSAKRLVVEILRIYRVHGDHEKMLDTLETLMRKRGQTKQ
FT                   SQGAMIAECGVLLTEGNLSREQRRIVLERVVHLTDSRIHVELEHVRFAIDLAKLMEDDG
FT                   EKRAACDLLSGLHVETVTNMPRVEKLDALNRLIRLCLELEDYELARLVSRRINHRALSR
FT                   PGALQAKLKYFELMREYFAQRRSYFHVARCWYETFLSETDETACVSALSSMAVHYLIAE
FT                   HSSPKELEDHAECAAFSPATKFADRTAAIQGITTTLRKRLEENPQLQYLLEKFTSIELI
FT                   RERVADDVEALCINHPQLAGFPERQALLRSRCSEHDLLVISRFYRRLRLVRLAELVGLT
FT                   PQHTEEFLMMMVASRTLYAKIDRVDGLVVFEANKNANDVVTAWDEAVGRSVALLDKVSH
FT                   LIVKERMLHNITLAQLQQSGATAS"
FT                   /protein_id="XP_822412.1"
FT   gene            complement(427705..430188)
FT                   /db_xref="GeneID:3662961"
FT                   /locus_tag="Tb10.70.6350"
FT   mRNA            complement(<427705..>430188)
FT                   /db_xref="GI:71746715"
FT                   /db_xref="GeneID:3662961"
FT                   /locus_tag="Tb10.70.6350"
FT                   /transcript_id="XM_817320.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(427705..430188)
FT                   /locus_tag="Tb10.70.6350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746716"
FT                   /db_xref="GeneID:3662961"
FT                   /translation="MALSLSASKRVAYHDLFMDLHGRRPSGRIRLVSEAAPEASAAWAT
FT                   SWSAFASGGAQDAGMGRSKKRKLAGEHVAVAFNRTKGQASTELFFHVAVFRCDTWALQW
FT                   VARASSADPAARVLDVCCLSANIVAFLVECKDESETRAELCIATRFSIPSSENLSNVRW
FT                   RSFISEARVVDTGFTAEGIRSIQALSATSLLVLTGSGRLVRATVSRMETMETTCEQVAS
FT                   LSVMIRRTRGTHTTPALVVSRNCCGKGGAETKTKDRTYAAVLNDNGSKCYVLDLMAPCA
FT                   SRKLQHITFPKDTIAERVEFAGSYMLVVTLRLKESSLYVLQFTCLVPQDSPSEGSFTMT
FT                   SFDLIHLTARRTPLATMYDSEKETHIVVSQWQDTAEDSSTSEVVETEQWWRRMEFAEVS
FT                   LASGPYTTDVLRGATWLPLPEPFRSDVPALRTVVGSGVDGDDGEAAEVEYHQELSLLNK
FT                   ERVTGSWLPLYLHYALATPLSRMGDGVREVKTVLVTVFAIETAPFVHTRLAKQWHNAVQ
FT                   GLLFLLGVGWNVGEHRGKMKQIADGVPAFAVPWNPGHMRRALRLFGQRALRRLFSSVAC
FT                   ALRHSAEPSAAQQLFYGVATTSLTDVAMQIITLSRRVGAHLRAEDVETVVLLLRASRDL
FT                   GHAIVNHTTRSQVLLECIVKGRMAGRVLGGFDGRTKGDAGRGAEGDDEKNDEVKERRQE
FT                   SVGFLSGASEMRVERMLHNRYTTNDWSQQLLLKRSQHADVVAQARLYLNDVLPFVQHKQ
FT                   EQPICEEQKQQRQHQGREEEDEEVSEEEHNQKGRKTAMNDALLPDWVFMGRRPHADAGF
FT                   TEYEGILLRPGGASN"
FT                   /protein_id="XP_822413.1"
FT   misc_feature    431359..431381
FT                   /note="AT_rich"
FT   gene            complement(431710..432066)
FT                   /db_xref="GeneID:3662962"
FT                   /locus_tag="Tb10.70.6340"
FT   mRNA            complement(<431710..>432066)
FT                   /db_xref="GI:71746717"
FT                   /db_xref="GeneID:3662962"
FT                   /locus_tag="Tb10.70.6340"
FT                   /transcript_id="XM_817321.1"
FT                   /product="ATPase subunit 9"
FT   CDS_pept        complement(431710..432066)
FT                   /locus_tag="Tb10.70.6340"
FT                   /gene_family="HOG000235246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase subunit 9"
FT                   /EC_number="3.6.3.14"
FT                   /note="similar to ATP synthase lipid-binding protein,
FT                   mitochondrial precursor(EC 3.6.3.14) (ATP synthase
FT                   proteolipid P2) (ATPase protein 9) (ATPase subunit C).
FT                   (Swiss-Prot:Q06055) (Homo sapiens); go_component:
FT                   mitochondrion [goid 0005739]; go_component:
FT                   proton-transporting ATP synthase complex (sensu Eukaryota)
FT                   [goid 0005753]; go_function: hydrogen-transporting ATPase
FT                   activity, rotational mechanism [goid 0046961]; go_process:
FT                   proton transport [goid 0015992]"
FT                   /db_xref="GI:71746718"
FT                   /db_xref="GeneID:3662962"
FT                   /translation="MMRRLALQSSIRRATPFATPLVASTKALNPMCSAITIREASTVAI
FT                   SVQGLHYVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAI
FT                   GLFALMLAFLMLFS"
FT                   /protein_id="XP_822414.1"
FT   gene            complement(432438..432782)
FT                   /db_xref="GeneID:3662705"
FT                   /locus_tag="Tb10.70.6330"
FT   mRNA            complement(<432438..>432782)
FT                   /db_xref="GI:71746719"
FT                   /db_xref="GeneID:3662705"
FT                   /locus_tag="Tb10.70.6330"
FT                   /transcript_id="XM_817322.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(432438..432782)
FT                   /locus_tag="Tb10.70.6330"
FT                   /gene_family="HOG000257127" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746720"
FT                   /db_xref="GeneID:3662705"
FT                   /translation="MTAPVSTLASQKVLLDRDTLTEAEKWRYVVDNTLKKGSLGFLTGA
FT                   ALSLVVFRSVPVRVAATAFGCGFGIGKSYIDTRYILGHDVSVETVWTAEVLRKGFRGST
FT                   GVSDRESSGS"
FT                   /protein_id="XP_822415.1"
FT   gene            complement(<433906..>434235)
FT                   /db_xref="GeneID:3662706"
FT                   /locus_tag="Tb10.70.6325"
FT   mRNA            complement(<433906..>434235)
FT                   /db_xref="GI:71746721"
FT                   /db_xref="GeneID:3662706"
FT                   /locus_tag="Tb10.70.6325"
FT                   /transcript_id="XM_817323.1"
FT                   /product="ribosomal protein L36"
FT   CDS_pept        complement(433906..434235)
FT                   /locus_tag="Tb10.70.6325"
FT                   /gene_family="HOG000155312" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L36"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71746722"
FT                   /db_xref="GeneID:3662706"
FT                   /translation="MAATKKEAPAPRTGIIAGFNKGHKTTRRARRPSSNDRYALPHKKL
FT                   RAVKAIISDLVGFSPMERRVQELLRVGKDKRALKFCKKRLGSIKAAKKRRAKVEEALRQ
FT                   QTKKK"
FT                   /protein_id="XP_822416.1"
FT   gene            complement(434626..435756)
FT                   /db_xref="GeneID:3662707"
FT                   /locus_tag="Tb10.70.6320"
FT   mRNA            complement(<434626..>435756)
FT                   /db_xref="GI:71746723"
FT                   /db_xref="GeneID:3662707"
FT                   /locus_tag="Tb10.70.6320"
FT                   /transcript_id="XM_817324.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(434626..435756)
FT                   /locus_tag="Tb10.70.6320"
FT                   /gene_family="HOG000257126" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746724"
FT                   /db_xref="GeneID:3662707"
FT                   /translation="MYQSTSLLFWFSWDEATSLMRHTTQHYRVKSEKVLPEAERVSNEV
FT                   SEAIKKKDVSVESSLSPSMAGALSMWYPRLRSADEIDSFVSRFLASGGENEMGFSTTFS
FT                   PQIIDASCQRGVFPLAFDIGGSFVYGPKLHCQRYLTQLQSHVKGFPTGGDDDEGVFMVK
FT                   RLQVSKKYTRERNLSTRAASYDVFVNRKEDVAPVLSLIHAQHGENWLCHGLRVCLVHMF
FT                   VNSERYRTKIVFTAIRRHRHDVGTDAKTESSGGSAMCNRAHGDHVEEGDLVAAEVGFVV
FT                   GDIYTSATGAYCASGAGTLQLAVVGEVMRSVGCKVWDLGMGMDYKVKGLGCVPFPRKRW
FT                   LALVFERSQEGALSGFIDSKLREEFSRGVSVRQVLK"
FT                   /protein_id="XP_822417.1"
FT   gene            complement(436701..437144)
FT                   /db_xref="GeneID:3662708"
FT                   /locus_tag="Tb10.70.6310"
FT   mRNA            complement(<436701..>437144)
FT                   /db_xref="GI:71746725"
FT                   /db_xref="GeneID:3662708"
FT                   /locus_tag="Tb10.70.6310"
FT                   /transcript_id="XM_817325.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(436701..437144)
FT                   /locus_tag="Tb10.70.6310"
FT                   /gene_family="HOG000257123" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746726"
FT                   /db_xref="GeneID:3662708"
FT                   /translation="MSYSLRKLRLLVDDPNGELATNLATAKLFCAAEDDGESEELGSLM
FT                   GPEVHYANFWGVVRGQVAALAVMRKEHSALRLSWSTQVTVITPNTFERQGFAHFTSGGM
FT                   AAIPLVGSWFTKFSQRRVRESLVVRDGRVVFRDLSFQWGLGVH"
FT                   /protein_id="XP_822418.1"
FT   repeat_region   438242..438289
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(439303..440970)
FT                   /db_xref="GeneID:3662709"
FT                   /locus_tag="Tb10.70.6300"
FT   mRNA            complement(<439303..>440970)
FT                   /db_xref="GI:71746727"
FT                   /db_xref="GeneID:3662709"
FT                   /locus_tag="Tb10.70.6300"
FT                   /transcript_id="XM_817326.1"
FT                   /product="dual specificity protein phosphatase"
FT   CDS_pept        complement(439303..440970)
FT                   /locus_tag="Tb10.70.6300"
FT                   /gene_family="HOG000257124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="go_function: protein tyrosine/serine/threonine
FT                   phosphatase activity [goid 0008138]; go_process: protein
FT                   amino acid dephosphorylation [goid 0006470]"
FT                   /db_xref="GI:71746728"
FT                   /db_xref="GeneID:3662709"
FT                   /translation="MQELIAVRVKDGIFVGNAVAAHDREFISLNKITHVVNCAGGELAD
FT                   LFADDGVKYLTFPWKDPTGSVCTAVMFDSADENVKRTVRFIDEALEAGDCVLVHSQLGM
FT                   SRSPALVAAYLIVKYGWKLESAISFLEMAHKDMSIKPHFLRQLRMFAKRNTIEHDIFDV
FT                   DVDDSSFGLDNVQWMLRNTLLNGLTSASQRQNELYKLCSSKVDVGQPVKTSDVRVTTTR
FT                   MKKAKRLVFVDTKQGSDVEPRSGTPVVTVQPLRQSEPGNHFLGYHGSIALEGRRRSNSI
FT                   MRHSVSPCGRSVESDPSTNPHGRQELTLRFESKSGRSCSAFDGATSSQAARTASGYSTI
FT                   DGASHVGEYHTHLPSPDTIHAPARSPFATLTSGHKYRKGSPLPSVVYNSSPMRSVQRPS
FT                   SALVSEGRGAQLRTSSYTRPTGFSRSGVARSGSPCSVSSHSSAFLATSTRLSSYRNIAP
FT                   HRSQPSSNVQPAWSAGKTALSPSRVHRSLLRSSPLNNRPGSPVERPSSTPRRVSSPTSG
FT                   SADACSSRTVCGTNSGSKGGGVGLLRRQIPAAIPSSRS"
FT                   /protein_id="XP_822419.1"
FT   misc_feature    441292..441314
FT                   /note="AT_rich"
FT   gene            complement(441787..443682)
FT                   /db_xref="GeneID:3662710"
FT                   /locus_tag="Tb10.70.6290"
FT   mRNA            complement(<441787..>443682)
FT                   /db_xref="GI:71746729"
FT                   /db_xref="GeneID:3662710"
FT                   /locus_tag="Tb10.70.6290"
FT                   /transcript_id="XM_817327.1"
FT                   /product="ribonuclease L inhibitor"
FT   CDS_pept        complement(441787..443682)
FT                   /locus_tag="Tb10.70.6290"
FT                   /gene_family="HOG000222803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease L inhibitor"
FT                   /note="go_component: cytoplasm [goid 0005737]; go_function:
FT                   ribonuclease activity [goid 0004540]; go_process: mRNA
FT                   catabolism, exonucleolytic [goid 0000291]"
FT                   /db_xref="GI:71746730"
FT                   /db_xref="GeneID:3662710"
FT                   /translation="MPPKNRQDEEKSKLTRIAVVNHDRCKPAKCNLECSKCCPVNLQGK
FT                   LCVVVQKKSTISVISEELCIGCGLCVKKCPYGAIQIINLPSNLNKDTVHRYGPNSFKLH
FT                   RLPLPRPGQVLGLVGANGTGKSTALSILKGKTKPNLGRYKDEPSWEEILKYFRGSEHQA
FT                   YFQHMLEQKMRVLLKPQYVDQVPKVTKGKVGDLLTKADERGVKDYYMKELDIENVADRE
FT                   LEKLSGGELQRFTIAALCVQNASVYMFDEPSSYLDVRQRLMAAKVIRSLLKDDNYVVVV
FT                   EHDLSVVDYMSDFVCVLYGVPGIYGVVTMPYGVREGINIFLDGFVPTENLRFRQESLSF
FT                   RITDDLEETTKRSVQHSYPSMVKNLGGFTLTVESGSFSDSEIVVLLGENGCGKTTFIRM
FT                   LAGHIKPDNEVEVPQLCISYKPQKIAPKFQGTVKDLLQSKIYEAFSNPQFQTDVLKPMT
FT                   VEELYDQEVQHLSGGQLQRVGLCLALGTPANIYLIDEPSAYLDSDQRIIAARVIKRYIM
FT                   HAKRTAFIVEHDFIMATYLADRVIVYDGTPAVNCKANAPCALLEGMNKFLKSLDITFRR
FT                   DPSNFRPRINKFDSVKDREQKIAGNYFYMVEEVAKPVKPAKVDGEDEDEDDESNE"
FT                   /protein_id="XP_822420.1"
FT   gene            complement(445449..445967)
FT                   /db_xref="GeneID:3662711"
FT                   /locus_tag="Tb10.70.6270"
FT   mRNA            complement(<445449..>445967)
FT                   /db_xref="GI:71746731"
FT                   /db_xref="GeneID:3662711"
FT                   /locus_tag="Tb10.70.6270"
FT                   /transcript_id="XM_817328.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(445449..445967)
FT                   /locus_tag="Tb10.70.6270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: calcium ion binding [goid 0005509]"
FT                   /db_xref="GI:71746732"
FT                   /db_xref="GeneID:3662711"
FT                   /translation="MLSKMKCTLTHDVVSDLQEAFRLFDSADEGVIAMSRVRSLAFSLV
FT                   PKLNEGMFSRVLSTTKLEGCDVINFPQFVVLFSTLSDVSTRAENFGVDELVEVFSHYDT
FT                   NRTGYIDLNCFLQIMMEEGELLSAVEGSELVLHLRRFGCVHLNKVNYCKFVQRLVDSSL
FT                   LNPFSHFFV"
FT                   /protein_id="XP_822421.1"
FT   gene            complement(446161..447048)
FT                   /db_xref="GeneID:3662712"
FT                   /locus_tag="Tb10.70.6260"
FT   mRNA            complement(<446161..>447048)
FT                   /db_xref="GI:71746733"
FT                   /db_xref="GeneID:3662712"
FT                   /locus_tag="Tb10.70.6260"
FT                   /transcript_id="XM_817329.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(446161..447048)
FT                   /locus_tag="Tb10.70.6260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746734"
FT                   /db_xref="GeneID:3662712"
FT                   /translation="MFRQELRRCSVILFHGGLVPRRMIINEDPQERSRELALREKVAKK
FT                   YKGLSISEFSGFSYGHFAMGGLATSAAFRAREASQGNAPNFGNLSQGERRVDWLMFFTG
FT                   VVLVFVSSKIIIQRLFGGVSEDLALPLWIGSVDEQATYLLFTIQYDKSSRQRIKDEYLA
FT                   ERRINPFITFFPWLITRYPEYGRGVQFSRDVAFGTLREILSSGNQRSLLNLAGSTKDTL
FT                   LRNDSPAHRVDYFLRRVGVVPMIQGVNSDSKAAAYVPPAVASNLQLMYGSEPEAIKTVL
FT                   SVSPDERHGSVPFQ"
FT                   /protein_id="XP_822422.1"
FT   gene            complement(447281..447658)
FT                   /db_xref="GeneID:3661970"
FT                   /locus_tag="Tb10.70.6250"
FT   mRNA            complement(<447281..>447658)
FT                   /db_xref="GI:71746735"
FT                   /db_xref="GeneID:3661970"
FT                   /locus_tag="Tb10.70.6250"
FT                   /transcript_id="XM_817330.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(447281..447658)
FT                   /locus_tag="Tb10.70.6250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746736"
FT                   /db_xref="GeneID:3661970"
FT                   /translation="MGSGGSPLLLSHCWWCFPCAGSTRRYSIEWRWTVGLDVARCKFCG
FT                   GSQHGRHCLLRVSVDPRALQHECPVGKKLLWILQRLVIVTFPQGVGSSGVRAIRSFPVC
FT                   LWWVSNFGVHDCLGSRWDPIF"
FT                   /protein_id="XP_822423.1"
FT   repeat_region   448676..449910
FT                   /rpt_family="DIRE"
FT   repeat_region   complement(449911..450104)
FT                   /rpt_family="RIME-A"
FT   repeat_region   450105..450491
FT                   /rpt_family="DIRE"
FT   repeat_region   452087..452107
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            452401..453567
FT                   /db_xref="GeneID:3661971"
FT                   /locus_tag="Tb10.70.6220"
FT   mRNA            <452401..>453567
FT                   /db_xref="GI:71746737"
FT                   /db_xref="GeneID:3661971"
FT                   /locus_tag="Tb10.70.6220"
FT                   /transcript_id="XM_817331.1"
FT                   /product="histone deacetylase 1"
FT   CDS_pept        452401..453567
FT                   /locus_tag="Tb10.70.6220"
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone deacetylase 1"
FT                   /note="identical to GB:AAL86696.1: histone deacetylase-like
FT                   protein HDO1 {Trypanosoma brucei;} (PMID:12100550);
FT                   go_function: histone deacetylase activity [goid 0004407];
FT                   go_process: histone deacetylation [goid 0016575]"
FT                   /db_xref="GI:71746738"
FT                   /db_xref="GeneID:3661971"
FT                   /translation="MNEDGDCRRVALIDTSCYSADCTLSALVPQHAMKPYRLLVTMELI
FT                   ASLGLKRFCRTVVPPPIGIKELLTYHAEDYILNLGLHSNRSWLWNTEVSKVTFSGDCPP
FT                   VEGIVEYSLSTVSGSLMAAVLLNSGAVDTAIHWGGGMHHAKCGECSGFCYVNDIVIAII
FT                   ELLKCHDRVLYVDLDMHHGDGVDEAFCRSRRVFTLSLHKFGESFFPGTGHPRDVGIGNG
FT                   RHYTMNLAMWDGVDDFYYTTVFERALRSIVKRFNPNVVVLQCGADSLAGDRLGHFNLSS
FT                   WGHGKCVEEVKKLGLPMLVVGGGGYTLRNVAKLWAYETSILCGKRLPLNTVIPLHRMPL
FT                   SGWLFEESPQLLVSQDEENKPLPGVNVQRSFRVIIEQIDKHCPNIMTV"
FT                   /protein_id="XP_822424.1"
FT   gene            453801..454739
FT                   /db_xref="GeneID:3661972"
FT                   /locus_tag="Tb10.70.6210"
FT   mRNA            <453801..>454739
FT                   /db_xref="GI:71746739"
FT                   /db_xref="GeneID:3661972"
FT                   /locus_tag="Tb10.70.6210"
FT                   /transcript_id="XM_817332.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        453801..454739
FT                   /locus_tag="Tb10.70.6210"
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="similar to Nucleotide-binding protein 1 (NBP 1).
FT                   (Swiss-Prot:Q9R060) (Mus musculus;); go_function:
FT                   nucleotide binding [goid 0000166]"
FT                   /db_xref="GI:71746740"
FT                   /db_xref="GeneID:3661972"
FT                   /translation="MNLANSHCIGPDSPDAGLAPSCKGCPNASLCASAPKGPDPDIELI
FT                   RQRLSGVKRKVLIVSGKGGVGKSTLTKELAFAIGKRGLNVAVVDLDICGPSIPRLTGAR
FT                   GENAHYSATGIEPVMIDETVTMMSMHYFLENKNEAVLFRGPRKNGAVKMFLKDVIWNDV
FT                   DVMLIDTPPGTSDEHITTASLLQQCGGVSGAVLVTTPQMVAEADVRREVNFCQKAKLNI
FT                   MGIVENMSGFVCPNCGSGSFIFPRTNTRGAGKRLSEEFGIPLWGEIPLDPKLMSSCEEG
FT                   TPLAESVDQNNPTLDVLNSISRKLIESLAME"
FT                   /protein_id="XP_822425.1"
FT   gene            454850..456445
FT                   /db_xref="GeneID:3661973"
FT                   /locus_tag="Tb10.70.6200"
FT   mRNA            <454850..>456445
FT                   /db_xref="GI:71746741"
FT                   /db_xref="GeneID:3661973"
FT                   /locus_tag="Tb10.70.6200"
FT                   /transcript_id="XM_817333.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        454850..456445
FT                   /locus_tag="Tb10.70.6200"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746742"
FT                   /db_xref="GeneID:3661973"
FT                   /translation="MISPDFFFGGVSLLSDSIEVRSRWSCLKYLGDAIIVMSVVASFVA
FT                   ECARSGRWVRGVMALHSSIGAEDASIGRARLRLASSILRKHWCAALPLIRPEDVQYVDD
FT                   LARLVHECSMCAEVPADVFDSAVVKLLTRARGKDEIQTQLFLSATKWTNWHQATRFFTM
FT                   LDTPGALCRDSLMILLMNALGSGSISKQHTIGLILSQLKLTNSRHIGNGRRDHLSSISA
FT                   ANAAHSYIEKGTDLVKVWSALRERDGISTKLVMSLARAAIQGERCSWKLPLSIHGRNRV
FT                   VGDSTEVLSKMIAICCPQHWRAALGHFVVEGRLALWLASRYSWEAGLVVSKLVSIPRRE
FT                   KYDILCRCAIPLPQLRGIATVAGAKIRLSNASKRSIAVRLASGYTTEELQLSAFAKVCQ
FT                   KNGDWETSLSLFHRVATEEFQQRAVQCILAHCPGFGVKKLLQLVNEHCPANTWTTSMLV
FT                   KHSDDWVEALYVLRHVMARGTRCNPQILSAFMDVQPPVDVVSTVVRNTTFAGRSEGIMR
FT                   RLEILEISGKSPQH"
FT                   /protein_id="XP_822426.1"
FT   gene            456923..458500
FT                   /db_xref="GeneID:3661974"
FT                   /locus_tag="Tb10.70.6190"
FT   mRNA            <456923..>458500
FT                   /db_xref="GI:71746743"
FT                   /db_xref="GeneID:3661974"
FT                   /locus_tag="Tb10.70.6190"
FT                   /transcript_id="XM_817334.1"
FT                   /product="DNA polymerase eta"
FT   CDS_pept        456923..458500
FT                   /locus_tag="Tb10.70.6190"
FT                   /gene_family="HOG000257122" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA polymerase eta"
FT                   /note="go_function: damaged DNA binding [goid 0003684];
FT                   go_process: DNA repair [goid 0006281]"
FT                   /db_xref="GI:71746744"
FT                   /db_xref="GeneID:3661974"
FT                   /translation="MRCIAHIDMDCFYAQVEAVRLGVDCRTEPYVLSQWGNLIAVNYPA
FT                   RKFGIGRFDTVTDALEKCPHVKISHVATYAAGEVEYRYHENPSKQTHKVALEPYREASR
FT                   KIFRILDSFDGVEVEKGSVDEAFLDVTKAAHMKQGEMGLLSSQGELRLEDVADPTTIVI
FT                   PSRQAEIAAWLKEHGREFSDVFDVTLHPQPTAENMSLLAAASRVVWTIRQKIYDELRYD
FT                   CSAGIAHNKLLAKSISARHKPNQQTLLFPDCVASVMWDLPFKSIRGFGGKFGEVVRLAC
FT                   GGKETCREAWLHSLCAMSKFFESVGDAEYAYRRLRGYDEGKIRERSISKSLMASKAFSP
FT                   PSSTANGVQKWVTVLSGELSARYEDFCNTYGVKGHSFNVKLGNRGLDQPSSVANKTFPL
FT                   PELVTPQTLVSAAMQCVTAIMANRPGVVVNAVMLTIGSFKKQESDESGVRSQQTTLRDF
FT                   FKLKNPGKRERNHTDEAMVITLSSCPSSPVSRESLKSTPGTRVVFDVEDDGDDEEGESG
FT                   EKDVHIID"
FT                   /protein_id="XP_822427.1"
FT   gene            458690..460480
FT                   /db_xref="GeneID:3661975"
FT                   /locus_tag="Tb10.70.6180"
FT   mRNA            <458690..>460480
FT                   /db_xref="GI:71746745"
FT                   /db_xref="GeneID:3661975"
FT                   /locus_tag="Tb10.70.6180"
FT                   /transcript_id="XM_817335.1"
FT                   /product="ATP-dependent DEAD/H RNA helicase"
FT   CDS_pept        458690..460480
FT                   /locus_tag="Tb10.70.6180"
FT                   /gene_family="HOG000257120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAD/H RNA helicase"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_process: nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism [goid 0006139]"
FT                   /db_xref="GI:71746746"
FT                   /db_xref="GeneID:3661975"
FT                   /translation="MNIYSWESSARPQKGKAKKAGTIVFHPDETVDLSFNRLQKEYPLD
FT                   KTEHPNSQKASEGQTERKKAPLMTAGTAKNLVKRMGFEALLPCQAQCYRGVFNRRDVIL
FT                   HSRTGSGKTLAYALPIIERHLIMSSFSPPASTGPFLLIFLFSNELAAQTKGVLKKIYPK
FT                   LNILIAGFDNLEVRRCDVLIGTVRSLDEAIRGRLSKESTRGEKRTRSGRAREEEEEKEE
FT                   AYCDDPGTDEREGDFASSSVSASNVCAIVVDEVDLTLGPRFSNIGRRMRNLLNFIRKAN
FT                   GSLAKGLLTDYRAHHYVLCGATIPNWVVKAGFLGVKKYYYQLVTVGTAKLPERLECFSM
FT                   YCPQKARVDRAVQLLSTGNFGRTVVFGTRKQVLKIESFLLTQNLQFSFSSLDPGKDEVE
FT                   RIKAMENFNSGAASVIFCTDLAARGLDFIDVHMVLMLSLPKHNMAVETFVHRAGRTARA
FT                   GRPGKCLQLHDEREDAAIEVIEKNAHIVFKKYIVGGEGKGSVARKRIKKGNLTPPNDQA
FT                   KTTFTLTVKNPFRSTKPDAVVPTALDVLKKNIGSLFSNVCNVTEDVSGEIVTFEYPANS
FT                   SHEVRQKLWKFSLKEVTPQN"
FT                   /protein_id="XP_822428.1"
FT   misc_feature    460039..460074
FT                   /note="GC_rich"
FT   gene            460833..461906
FT                   /db_xref="GeneID:3662092"
FT                   /locus_tag="Tb10.70.6170"
FT   mRNA            <460833..>461906
FT                   /db_xref="GI:71746747"
FT                   /db_xref="GeneID:3662092"
FT                   /locus_tag="Tb10.70.6170"
FT                   /transcript_id="XM_817336.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        460833..461906
FT                   /locus_tag="Tb10.70.6170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746748"
FT                   /db_xref="GeneID:3662092"
FT                   /translation="MWRCSTLLHKGSLTALLRDVIRCTQPCGIPLGDVEIKAKEHFLSL
FT                   SNGEQEEFPLALKKALLEANDAHYIDGAKLYPCNWERVVQSIAVEMPCEGLTEKGLVDR
FT                   ILEFEPRFNMESASLGEPLSEWMARRFPHIILVSRSASTGVPVYRPVRGKLPEEVECIA
FT                   NALQLLGREKLPVYTDFALIAPLLPATVCPTRGNWVAFLERGSVQCHFDLDVDVHIRLS
FT                   PNSIPSTVCVDGTTVELARVNEVLAANGLSDSTCSLKVFRRAEDPVWSQDDIVLPSFLE
FT                   PEHAIGAAIASLGARSCMRIYILCGDSAVERYKTGLLDLLRSAETDVRIFTPCNAGFTD
FT                   GAISSGVDRREKTVGKS"
FT                   /protein_id="XP_822429.1"
FT   gene            462143..463291
FT                   /db_xref="GeneID:3662093"
FT                   /locus_tag="Tb10.70.6160"
FT   mRNA            <462143..>463291
FT                   /db_xref="GI:71746749"
FT                   /db_xref="GeneID:3662093"
FT                   /locus_tag="Tb10.70.6160"
FT                   /transcript_id="XM_817337.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        462143..463291
FT                   /locus_tag="Tb10.70.6160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746750"
FT                   /db_xref="GeneID:3662093"
FT                   /translation="MDTFQEKLDALQKQSKEQIAAAIAAMKGACREGAEPVRVAVAIGS
FT                   RLTPLNILSSFPVVCLLDAMVMAKGDETVAQVMKEFWRISPSLFVNYATTDEGLRDKVV
FT                   RVVQRWGSKKLIEPPMCEKLLGAIKGIRPDEASSAEEGKGEKRSDEAQNGRKGAVFTRS
FT                   EVSGFCAILHSCTKMIEKLPPHRASMYMEVAQKEMSSHVPNRPALLFFQGLHAELGKEL
FT                   TLYNSNAVKNEHQLAQAVSGGPSAKEALGNLLDKLSKDHASPSLEAGDGKGHAFHVVRY
FT                   ITPLQSDICQRLSLARRAGFGDWYRRPKNEYHYPKRESNARKVFRAPAGAGPLVRTWFP
FT                   SEQQWISENNMASLGLFRERDPDKERESSSLYAVARKRDRDC"
FT                   /protein_id="XP_822430.1"
FT   gene            463506..464339
FT                   /db_xref="GeneID:3662094"
FT                   /locus_tag="Tb10.70.6150"
FT   mRNA            <463506..>464339
FT                   /db_xref="GI:71746751"
FT                   /db_xref="GeneID:3662094"
FT                   /locus_tag="Tb10.70.6150"
FT                   /transcript_id="XM_817338.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        463506..464339
FT                   /locus_tag="Tb10.70.6150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746752"
FT                   /db_xref="GeneID:3662094"
FT                   /translation="MVPLSCSLSTVSASFPFRFKRLLFLRLSARYRRLAMRAVRALTGG
FT                   QQAVNELEVFLRAVADTQRRWAKRIAAQEAKVRRCMMVEDHCRKRLRRSVLRFTNERLK
FT                   RLVSTDPLGHVEPKLPPASAFGAFDIPPHCVNGFGVFVMAKLHEFPSCVLDAPRVGAIA
FT                   DLLAAWEILPPFKKERYEAYAESVRDVTTATGTASSSGSSTNCEQRTAGVEGDAGTPTN
FT                   ENEAAAYGRFVRCGRRQLEAVLGPVSSAAWLGIATREWESLTLRQKRCYLSKRTK"
FT                   /protein_id="XP_822431.1"
FT   gene            465053..465547
FT                   /db_xref="GeneID:3662095"
FT                   /locus_tag="Tb10.70.6140"
FT   mRNA            <465053..>465547
FT                   /db_xref="GI:71746753"
FT                   /db_xref="GeneID:3662095"
FT                   /locus_tag="Tb10.70.6140"
FT                   /transcript_id="XM_817339.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        465053..465547
FT                   /locus_tag="Tb10.70.6140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746754"
FT                   /db_xref="GeneID:3662095"
FT                   /translation="MNRRVDFICQGKPQLPFPCGWSSSKGTEGEVPGCGFRRHYLHAFR
FT                   HVQDVADRRSALRDTITATGRAPSGHGSSHFGGDSMDDTVGVPSRNFLKTDPSNGVAHV
FT                   EISVGRIFFGSKSVAASPDGQAGPANTEGSDGSEAQLAQRRAPDRLGRQQRPTLLRLCT
FT                   L"
FT                   /protein_id="XP_822432.1"
FT   gene            complement(466229..467023)
FT                   /db_xref="GeneID:3662096"
FT                   /locus_tag="Tb10.70.6130"
FT   mRNA            complement(<466229..>467023)
FT                   /db_xref="GI:71746755"
FT                   /db_xref="GeneID:3662096"
FT                   /locus_tag="Tb10.70.6130"
FT                   /transcript_id="XM_817340.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(466229..467023)
FT                   /locus_tag="Tb10.70.6130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746756"
FT                   /db_xref="GeneID:3662096"
FT                   /translation="MKTENFPRGQSAGPEGSLVEIPDHGERQQEVCHIGAPLQREIEAP
FT                   AAEAGQSSDYKKPHAPHLLPVMEPVKPSSDPQLKDGRKEMPFTSALPIVVPDAPRLATQ
FT                   QRQVQKTKGNGSSAVPGEPDTCEGEPRAPSPGDPRPTQAFPAVEPFKRTASAKLSEART
FT                   DPRSPSASPDNESDGARVGSRQVDEEGSRPLCTLPAVELRKKPAGSTLQEEQAKELNTT
FT                   HAFPVVEPDAVCTEARRSEELEDTRAGHAFPPVASGKQNTGA"
FT                   /protein_id="XP_822433.1"
FT   repeat_region   467339..467361
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(467363..467584)
FT                   /db_xref="GeneID:3662097"
FT                   /locus_tag="Tb10.70.6110"
FT   mRNA            complement(<467363..>467584)
FT                   /db_xref="GI:71746757"
FT                   /db_xref="GeneID:3662097"
FT                   /locus_tag="Tb10.70.6110"
FT                   /transcript_id="XM_817341.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(467363..467584)
FT                   /locus_tag="Tb10.70.6110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746758"
FT                   /db_xref="GeneID:3662097"
FT                   /translation="MHPLARLVHIRPERLFLKGTGADIAHPSCKAWCSGRPLSTVLAWP
FT                   HRLSCRCFVRKVSHTDAEKWQRGTTRVY"
FT                   /protein_id="XP_822434.1"
FT   repeat_region   469054..469088
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    469876..469904
FT                   /note="AT_rich"
FT   gene            complement(473363..473740)
FT                   /db_xref="GeneID:3662098"
FT                   /locus_tag="Tb10.70.6070"
FT   mRNA            complement(<473363..>473740)
FT                   /db_xref="GI:71746759"
FT                   /db_xref="GeneID:3662098"
FT                   /locus_tag="Tb10.70.6070"
FT                   /transcript_id="XM_817342.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(473363..473740)
FT                   /locus_tag="Tb10.70.6070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746760"
FT                   /db_xref="GeneID:3662098"
FT                   /translation="MFAWAPSKSCQKNYATSELFTSEPPPPTSVLFTTSSDQIPPPKRV
FT                   APPTSAHLSGPRLVYSPNQARLRGPLNHAVGHRVVGRGKSFMLALQKHVLVLLITPYYY
FT                   FGGHGNTMMLLNFLCWTHIEE"
FT                   /protein_id="XP_822435.1"
FT   gene            475125..476150
FT                   /db_xref="GeneID:3661555"
FT                   /locus_tag="Tb10.70.6040"
FT   mRNA            <475125..>476150
FT                   /db_xref="GI:71746761"
FT                   /db_xref="GeneID:3661555"
FT                   /locus_tag="Tb10.70.6040"
FT                   /transcript_id="XM_817343.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        475125..476150
FT                   /locus_tag="Tb10.70.6040"
FT                   /gene_family="HOG000257255" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746762"
FT                   /db_xref="GeneID:3661555"
FT                   /translation="MSFSSDEKKPTRTRGGGALTDPHAVKLHGNDFSLDEKLGGLAPEE
FT                   RKVVAEYIEKCEETLLQLSKRGCNTPIIPFNSENHSWDSLYKVNKRHFPLKNYIILAFP
FT                   LLKSICCGPKRESKYIVECGCGTGSTLLPIMNQFKDGVHFIGFDVSTAAVSALLEHPIA
FT                   SDFSAEGRLTVFPYDLCYGRVSASEDCRRTKFKTECGTLKTTLLEKVPGCSKGVDAAIL
FT                   VFVLSSLPTIECMLYALTEIKSILHNDGILLFRDYAVPDHNLFRFVRQQNKKHNDLSFC
FT                   KGDGTLQMFFELNFTRKLFALAGLKEVEGHGLQYHCNRIVNRKNSKRMDKIFINGSFCL
FT                   S"
FT                   /protein_id="XP_822436.1"
FT   gene            476406..476726
FT                   /db_xref="GeneID:3661556"
FT                   /locus_tag="Tb10.70.6035"
FT   mRNA            <476406..>476726
FT                   /db_xref="GI:71746763"
FT                   /db_xref="GeneID:3661556"
FT                   /locus_tag="Tb10.70.6035"
FT                   /transcript_id="XM_817344.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        476406..476726
FT                   /locus_tag="Tb10.70.6035"
FT                   /gene_family="HOG000171951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746764"
FT                   /db_xref="GeneID:3661556"
FT                   /translation="MEEAAAEGMPLSQEQGEQKRFVLKRWNAVALWSWDIEVDTCAICR
FT                   NHVMDLCIECQASSNGPRTNCNIAWGVCNHAFHTHCISRWLKTRNVCPLDNKEWSYQKL
FT                   GV"
FT                   /protein_id="XP_822437.1"
FT   gene            476862..477764
FT                   /db_xref="GeneID:3661557"
FT                   /locus_tag="Tb10.70.6030"
FT   mRNA            <476862..>477764
FT                   /db_xref="GI:71746765"
FT                   /db_xref="GeneID:3661557"
FT                   /locus_tag="Tb10.70.6030"
FT                   /transcript_id="XM_817345.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        476862..477764
FT                   /locus_tag="Tb10.70.6030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746766"
FT                   /db_xref="GeneID:3661557"
FT                   /translation="MVTPQFVQQNSSLASGFWDSFALYFSLISLDVVVEGMMKRTILQR
FT                   CIQNKSLEIARISRSDINSRAHLPFNFDVCYELGSREFTLFSSVGSTSVLVFCNVSSRR
FT                   LRSVKGGQGETEFPPKRLNVKRRRQSGSADRSPVVFSAFVSMPTSGLTIEALCCSSLGL
FT                   LVVDGVSFHQGPLTESMIPQDAHPGPEGHYQGPLLNQRSLAEMVVNTRGCITSVDPFRQ
FT                   QESFFDGHVNPWNARSLRFGHVPVHTAKPGFSDALCHFLEVFGVNDELAFFVEDFAHLV
FT                   HREEETAWTNVLKTMMGGR"
FT                   /protein_id="XP_822438.1"
FT   gene            479252..479944
FT                   /db_xref="GeneID:3661558"
FT                   /locus_tag="Tb10.70.6010"
FT   mRNA            <479252..>479944
FT                   /db_xref="GI:71746767"
FT                   /db_xref="GeneID:3661558"
FT                   /locus_tag="Tb10.70.6010"
FT                   /transcript_id="XM_817346.1"
FT                   /product="syntaxin"
FT   CDS_pept        479252..479944
FT                   /locus_tag="Tb10.70.6010"
FT                   /gene_family="HOG000257252" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="syntaxin"
FT                   /note="weak similarity to syntaxin and t-SNARE proteins
FT                   Curated by Mark Field; go_component: membrane [goid
FT                   0016020]; go_function: intracellular transporter activity
FT                   [goid 0005478]; go_process: vesicle-mediated transport
FT                   [goid 0016192]"
FT                   /db_xref="GI:71746768"
FT                   /db_xref="GeneID:3661558"
FT                   /translation="MSSLQDPFDESVSDVRELIVKARSIREAIQAKGLIASDAVTELGT
FT                   VVDSVKEELMLLNDVLRVIEQKNGRVGEEVLSVNEVVRRQTVVRELEIDLKDICAFREF
FT                   AESRVTENDVSNLDRGPAEGSHGDTFYLRQERVQREEQAQQDVILDRLSHGLQELRETG
FT                   INVNDELQQQDNLLSIIQVDVEGVQARLRVVNAKVDKMLADMSSRSKICSLLGLALVAL
FT                   LLFYCVFS"
FT                   /protein_id="XP_822439.1"
FT   gene            480122..481672
FT                   /db_xref="GeneID:3661559"
FT                   /locus_tag="Tb10.70.6000"
FT   mRNA            <480122..>481672
FT                   /db_xref="GI:71746769"
FT                   /db_xref="GeneID:3661559"
FT                   /locus_tag="Tb10.70.6000"
FT                   /transcript_id="XM_817347.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        480122..481672
FT                   /locus_tag="Tb10.70.6000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746770"
FT                   /db_xref="GeneID:3661559"
FT                   /translation="MEDTAAFSAVLQRSAPVTRRRVLVVLFALGKYAKRENTELSPSAI
FT                   MTLLEYVMVGKPVRFLFASGAGGSVLRSHDRGFTWRVVYRIRDNVTDVVPTRRQPAGTL
FT                   GAVGETKALSETGGNIASKDEVIPPSAVEPENHTSCIATMDDRVAVCGDNGFLAVSVDR
FT                   GLSFSKLAKEAFHPFGEGGSNNESNCSDFRGVEFLSECALVFFSKRHLFRCPLNQKSYN
FT                   SVEFGDISLLQAFSDPIGCVRTFSRAGRGCMRELFVATNGFVHYSHDGGAVLLKIPHKL
FT                   GVIRSIEPMDVVLRHREIPQLPPSLIDAMTAPAVERHLSAEKEKYSYSVVVRATGAQDK
FT                   GVGDSGCDFCEGWVDGISLPHRLGSVCYRVLLVAGCGANILPYDCTALLFVAASSNGPD
FT                   TTPDVLGSLAEHVDYVPYIKSGITEPLSVALTRRPGSGGCVFARSNIAGVSFSSDMGRS
FT                   WSIPKQAYVVSVLASDGGEFVCCNRRNVVNFPNSVCEEVHALQTDLRVPFLTDIAMMT"
FT                   /protein_id="XP_822440.1"
FT   gene            481737..483038
FT                   /db_xref="GeneID:3661560"
FT                   /locus_tag="Tb10.70.5990"
FT   mRNA            <481737..>483038
FT                   /db_xref="GI:71746771"
FT                   /db_xref="GeneID:3661560"
FT                   /locus_tag="Tb10.70.5990"
FT                   /transcript_id="XM_817348.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        481737..483038
FT                   /locus_tag="Tb10.70.5990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746772"
FT                   /db_xref="GeneID:3661560"
FT                   /translation="MGQWLCFRGGSTEGGKECDGDELSVYSEVGEKMSREERYSNADCP
FT                   DSGSSLLPGVMWSEQPVEQARFEDFGGSSCGSVFPPHRKHRDYKLFGGLFDANVSLLSL
FT                   CSCEDAGMPQHILLGGEGGGIVLLNYASGEVVRRWSEAHSGDVNKLTRPLETGMFASCS
FT                   RDSTVKVWDTECNEALCTLRGHRANVTSITQLLNGTFLVSGSRDNSVRLWDIIEGQEVA
FT                   CCDVKQNIVHFVRWVPSLGCVAQGGEDLTVRLWDVRTSSDGMKAIDLSLGFTMACIDYH
FT                   PICCELSPDEGSYTLLTGHNGFNGHGAYVVEWDLRMQDRVRTFKAHNGTVRSIRSCPLA
FT                   KGMPNRHYMSAADDGTVAFFSTADVDGAVEVSVDPANIHKVSGASVKCIDTSSGGDIFA
FT                   STSDGAVIVCCQTQRGSEAVASLYHYRYFGASPG"
FT                   /protein_id="XP_822441.1"
FT   gene            483385..484467
FT                   /db_xref="GeneID:3661561"
FT                   /locus_tag="Tb10.70.5980"
FT   mRNA            <483385..>484467
FT                   /db_xref="GI:71746773"
FT                   /db_xref="GeneID:3661561"
FT                   /locus_tag="Tb10.70.5980"
FT                   /transcript_id="XM_817349.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        483385..484467
FT                   /locus_tag="Tb10.70.5980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746774"
FT                   /db_xref="GeneID:3661561"
FT                   /translation="MTDNQGSYITTTKLEEVRLLAVAGDRSAAVYAAHRRMEDNLAKLP
FT                   AVLADTARYHPTSVDPWVAVFAAVDSLCRDVELCLQLFTIGAQVERSKGLPTVAVLYEQ
FT                   QKKPAARLQSFAATVQSAFTCKGVTIPVPASLMLRFAEAIRPFDSSQATKWLQCSFEEM
FT                   FNRETTGEGAGNNYVASGPTAVAATPAHATQEPKGVVVAMLTLLIKWRAEDGEDVLWAQ
FT                   RKRKELSQLVEENVLESLIRFEVESVAAVARRKQRVQKKGERQATKRQVKPTPATEALP
FT                   GSAVEATVPAQGVSTLGRLRRYVNDLLATNWSQNPSRAACVIIAIILLCILARKALCTV
FT                   SLFGGFAGGTPRGGRKLIDL"
FT                   /protein_id="XP_822442.1"
FT   gene            486115..486660
FT                   /db_xref="GeneID:3661562"
FT                   /locus_tag="Tb10.70.5970"
FT   mRNA            <486115..>486660
FT                   /db_xref="GI:71746775"
FT                   /db_xref="GeneID:3661562"
FT                   /locus_tag="Tb10.70.5970"
FT                   /transcript_id="XM_817350.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        486115..486660
FT                   /locus_tag="Tb10.70.5970"
FT                   /gene_family="HOG000257246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746776"
FT                   /db_xref="GeneID:3661562"
FT                   /translation="MGSEESNNICAYKRTISLAKIYIVLLVKTAMLRYSRLCFPKMGCE
FT                   EIKRKARRVQLQPTEYLAQHRMQVWQLRFKEMGPPFSRVWVALGGKMRRRRVGRQVDVK
FT                   DMRYYWRPIEPQYQRLYMSRLRIRDHSNKLRQPMRLRATNADIGSGSSSIEWERASNRK
FT                   YGAMLAPPKRQDFEFRVV"
FT                   /protein_id="XP_822443.1"
FT   gene            487038..487613
FT                   /db_xref="GeneID:3661563"
FT                   /locus_tag="Tb10.70.5960"
FT   mRNA            <487038..>487613
FT                   /db_xref="GI:71746777"
FT                   /db_xref="GeneID:3661563"
FT                   /locus_tag="Tb10.70.5960"
FT                   /transcript_id="XM_817351.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        487038..487613
FT                   /locus_tag="Tb10.70.5960"
FT                   /gene_family="HOG000257245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746778"
FT                   /db_xref="GeneID:3661563"
FT                   /translation="MTTPGTSGTAKHDVKVFRSSIDTSSVSKTIFSQPTLYMGIVNLIL
FT                   MYATQRFPEEFMTPKYMTMSYNGVRARAMLTIPFCCIGSAYFAVASIITKSSSPLAGHL
FT                   LGYGVSLGVGLTMMTFRRVSWYYPLLGLMYLSFGGFHHYRRMMVYGDNAPIYNWGDLTE
FT                   IWSARRQRKLEGRKKHEAKEVAATEGRN"
FT                   /protein_id="XP_822444.1"
FT   misc_feature    487876..487896
FT                   /note="AT_rich"
FT   gene            488138..492922
FT                   /db_xref="GeneID:3662757"
FT                   /locus_tag="Tb10.70.5950"
FT   mRNA            <488138..>492922
FT                   /db_xref="GI:71746779"
FT                   /db_xref="GeneID:3662757"
FT                   /locus_tag="Tb10.70.5950"
FT                   /transcript_id="XM_817352.1"
FT                   /product="calpain"
FT   CDS_pept        488138..492922
FT                   /locus_tag="Tb10.70.5950"
FT                   /gene_family="HOG000130929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calpain"
FT                   /note="Curated by J. Mottram; go_function: calpain activity
FT                   [goid 0004198]; go_process: proteolysis and peptidolysis
FT                   [goid 0006508]"
FT                   /db_xref="GI:71746780"
FT                   /db_xref="GeneID:3662757"
FT                   /translation="MATTLDDLYQYYCRRKGCKANSCFSRYLIEEFERQGQKRVLETVD
FT                   LSLNYVGRKGIIPVLDLVKNVKTIKKLNLSNNMLEHEELEHLVYCLALHPSVEEVVLAN
FT                   NCFHDASVKVILDLLELNGGITTFDVDGNEISAASVATIGEQLEKNRARRAERESDASH
FT                   PSLRRWSKAQIEGSIDELNSGGHIHFGTWWKNPQYFMRTSAGSQVRIVMDVEDAKEARQ
FT                   VGFFVFRSSGQYRVVELSEGVIAGESACDHSHCYLTMSVEENETYSVMPYTFYPSRSVG
FT                   FRLTAEMCSDDALSSRGWITLEPVDPAVDWCLSTLDGEWTEESAGGSHLEHTWCRNHMI
FT                   RVQYAGSVLTHRMAAPATLIVKLSKGVDPDVNDEKSIGFHVLTPDTEEALLPPIFCKDE
FT                   CVKCFCPHERTTTISASFAVSCTALQLFIAPSTLNPGQVGSYNVTVFSSVPVTLSSSAF
FT                   PHGWHYRKVGGSWDEYNCGGSRNASMSWKANPSIGLSVDSSQEPSDFTVFLEAASPALP
FT                   LVVQEAAVGDGACSRSATPAPGESQEEDPDLVEFLRRHKAHLMEACVSVIEAKSPLYRE
FT                   LLTSGYTNGSFARLMVPGLNKPFLLLVSTRHAGQLGTFALHIFSHRPFVTDGVESLLAR
FT                   EREVHLQQYALENEKRRTLLSAAKTQQISFDGSEDVVVVRNEIIRQCMITGEKFVDRDF
FT                   PRGGSSLFLDPDAKPPPMFPKETHWKRPTELMEKVVFLPDWKCDAPFPYSRREWFASVV
FT                   HAIATKPLWLQNVAVGYNEGEGMAQFRFFKDGKWKVVTIDDYLLFDSTMDLCMGRPGKD
FT                   SADIFFPLIEKAYAKAHRCYETLEPKVTPELGFLELVCQGLMDLSGCATINIPLIGSVR
FT                   MPQEQQDVIWMEMKNAVKPNVLCSLLVRGDSNGASERRGRGILVDHIYPVLDARFLEGY
FT                   RLVKLRHWGQPEEINLCSKWRSSSDKWTDTIRQTLEFREDDRETFWLSFDEVLYYFTNL
FT                   LINEETSSVSWASGYFCDCPPGCNDRLLGSSQFSLQLGEFPPGLKKVNILLGLHQLDPR
FT                   TTVLRDKEAVASYRTGVGLEVVGTADNTVWLTDFSKAEVLSRLEPCMKRDALCPLTVSL
FT                   DSVGGNKLLTLVVFKEEMRAPHVPFLLSAWSETCKVNVVAVERNAAVTVCDEWPREFAI
FT                   GGPSSPFWRDCPQYFIYPSDTTDINFSLKQELASGEIPKPIGFTVHDARACRSYLEYNP
FT                   ETVILSVAANASHKVEGTVRLLGMKARRGMPYIIVPFCTEAAPGGSFTLEAVANRFVKL
FT                   CRINPQLDWCRVTKHASFMLSDGSVGGSLRFSSWRSSPQFAFTFPVGGKGRLLVSLSND
FT                   DAVDTRTEVGMTLLLGDRQWDEGKRRKLVVSQGDIIACSEENIGRSTLDCEIDVEPEQT
FT                   LILVVYASLPYRGADVTFTAYSALPVEVEPVKEWEYVVMAQGSWELGYTAGGGAEEFGS
FT                   WVNNPFVALNTFRRTQIVALLLQYPRGPEKPVVKRAGNKKAFLPPVIVNPNNRMEIAID
FT                   LNCQDENMTRIATTPYTRNSEVALVANVPAADSLPFVFVPHTKYPEGNGEYKLFVYADS
FT                   LVELYPLEKKRVPYV"
FT                   /protein_id="XP_822445.1"
FT   gene            493476..495896
FT                   /db_xref="GeneID:3662758"
FT                   /locus_tag="Tb10.70.5940"
FT   mRNA            <493476..>495896
FT                   /db_xref="GI:71746781"
FT                   /db_xref="GeneID:3662758"
FT                   /locus_tag="Tb10.70.5940"
FT                   /transcript_id="XM_817353.1"
FT                   /product="DNA topoisomerase IA"
FT   CDS_pept        493476..495896
FT                   /locus_tag="Tb10.70.5940"
FT                   /gene_family="HOG000257149" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase IA"
FT                   /note="go_function: DNA binding [goid 0003677];
FT                   go_function: DNA topoisomerase type I activity [goid
FT                   0003917]; go_process: DNA topological change [goid
FT                   0006265]; go_process: DNA unwinding [goid 0006268];
FT                   go_process: DNA modification [goid 0006304]"
FT                   /db_xref="GI:71746782"
FT                   /db_xref="GeneID:3662758"
FT                   /translation="MFRQTVTSLEKLVIVESPNKVIKIEGLLSNPKVIPDWSFKQGHLK
FT                   CVGIGAEKAVAMATTGHFMALKEITWITHPLPPSSAGGKPQEYDGEAFPSSGTLAEYTL
FT                   EWEPLPGRRIQETLERYIEGKVENVSEIILATDPDREGELIAVHALQTIKRLYPKLKVP
FT                   FSRAYMHSITEDGIRKAMKERSLNICDYDLASAAETRHVMDRFFGFLGSSVVRAANSQM
FT                   RSIGRVQTPALILINEREDKISAFLERNKSTFVVEATCQFPVPHGTTFSQVVDIHSDRR
FT                   GAPSQWNTAAEANNCLEHWKLDGCHSFSIPHDPIVTPSKVPPPQPLTMAAAITKLNRQM
FT                   KLSSEMVSGYLQDLFQLGHITYPRTDSTRIDESALKDIYNAVKKNFGKEFLYRLEDRPA
FT                   SGGDGKRGKKQTKKKTAKRGKNSGTPVGNVEDAHEAIRPTNINVQGDSLSLSPETRAVY
FT                   ELVRRQTLAAFMIPQVVEKIVADVKFVSGSGEKLTLTLGGKRVVEPGWTRAFHKGDSGN
FT                   LSLHVGAEEGADAGDEGAPTMCSLSQEEFYAILNLRRVLNSPNQQHLFELRSPTIRENR
FT                   PVPPMPHSEGTLIEELKRNGVGRPSTYPLIVKTLLARGYIQVNAKGRCETTPVGRMLVE
FT                   TAKSTFPSIVDLGFTASFEKQLDTVAKPHPNKRPAFLRSTKISQADYVLSMFLSTFLNY
FT                   VSEAACTQRARIIERSMRLKRDQEGGSGIGDAEFEESVVAARRKVTLASTDLVTLPKTY
FT                   NNFSTLQRNLNEYLRHNFPPSQVNGSPAPSPTVDAPRSRRGGAGTSRGVAGGG"
FT                   /protein_id="XP_822446.1"
FT   repeat_region   496565..496629
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   misc_feature    497173..497199
FT                   /note="AT_rich"
FT   gene            497616..502220
FT                   /db_xref="GeneID:3662759"
FT                   /locus_tag="Tb10.70.5920"
FT   mRNA            <497616..>502220
FT                   /db_xref="GI:71746783"
FT                   /db_xref="GeneID:3662759"
FT                   /locus_tag="Tb10.70.5920"
FT                   /transcript_id="XM_817354.1"
FT                   /product="protein kinase"
FT   CDS_pept        497616..502220
FT                   /locus_tag="Tb10.70.5920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="contains one TmHMM; similar to Protein kinase byr2
FT                   (EC 2.7.1.-) (Protein kinase ste8) (MAPK kinasekinase)
FT                   (MAPKKK). (Swiss-Prot:P28829) (Schizosaccharomyces pombe)
FT                   curated by M. Parsons, P. Ward, J. Mottram; go_function:
FT                   protein serine/threonine kinase activity [goid 0004674];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:71746784"
FT                   /db_xref="GeneID:3662759"
FT                   /translation="MKQEFVRHVDAYDPLSAAQPPVLETTASTLVSDKPPNDSFDVDVN
FT                   NRPNVERCFSPNLLGQPCPVVSNGDSSRRQATSGFGACGVEIHLAEPSVCSTRDSQVFA
FT                   ETHGSRFMRGIELLDRLPHEESRDDCQEEMASVSGAPRNHTKPQPEQQQRLNHEELRSP
FT                   LSVHSVCVWEVDAPRDNRIVITEETEPGWEQPDSQRDAALQQLLCDASKARGIKLTWLL
FT                   CGLLLPFMLVLISMVVGTELLLNVKVAEPRKDVIKLSTRLTLSRLKDMYYDIRRMSQVS
FT                   EVARASSKVAEKRAALDSVCSFLRGAPVVLATYSGVNASLTWTHNCSAGDQTDIALPST
FT                   MRLSDPTSPTPRISRYRSDLLIVTEKYGPEADVFVVILRRDITGLMLLGHSLVDDFTTG
FT                   ISPLVAILLPSFSSSRLTVSLYNNAQWLEDANPQNNPHDDEVLLLFEEWCSSGDTHTWH
FT                   SVGRLLPGGLANTTVGEDVAHFPAPVPRLAGGGFFSVTPPLVMCSTFCVDGTSNTCGKD
FT                   NPSSVWLVTYGSSSYRGLDGLLTTAMVVGYTGAVLFMVMLCFAYISIDAPVSYLKSLIF
FT                   SAAGGTERRKEWDHTVHGWRKIWLGDLRALVNTFQILALCFRLNKKYVPQHILEKQVKN
FT                   LLDVKDKICSADTDGEAAVEVAEGRHNDDDDAVDDKANVGAFVCAATVADVKSSISKRM
FT                   CQGSQSVTSLNRIQPLCGVGDLQATDIAVESGRAAALSGAADGREPVNRGMILVENATI
FT                   LTVHLPAVETAYFTDFGLAVEQHRHIMALLLRSVRQYRGELFQRSGECISAAWNAFDGC
FT                   ADHAIRAAACALRILDRLEAYRRAGFRVGIVLHQGPFVCGVVEDRAEAFTTVFGSVPRQ
FT                   AIVFSELAASLTVFDVLISEPVKESLSSHYECIMVDVIKYHEDDPPITLYELSKERQLP
FT                   MTKGMPRGPSAFAEEHARVFFNFRNHEFGLALAGIEKMKRSFSKTELRLLWRIEQLCKY
FT                   YMHHEKDLPLPYYRRFPTWRIYEVTESVEGSNDFLALSSRGGTVLCGDIPPSVMAHKSS
FT                   FDCDAMKFRQELHDNVLASRRTGSKESGLAFSAVKEADMGTGSPSPAREADGVNRRMSS
FT                   MCLLTDAHSGNLESGLERSLGRPTTSLRDTLGKGRPSTVPGGEFGTLEAEGASALNVAG
FT                   RNAGSFDAMKSTNPQTKTCADEENYGDVELGVGDERRRFSFTNCRPSIIAEGRRRSYNR
FT                   CAESCVSLTSDSMEDAHSFSVVDPGGSLMATYTLPKKIVAKNGITYLRSSRILGKGSFG
FT                   CVYLGMDVNSGRMTAIKFLPMPSGEEEVSKVETEVVAMQKVKSGHVVQFISYAFQSNLI
FT                   IIIMECMMAGSLKGMLDAFGSIPPATACLFIRDVLRGLHKLHSNGIIHRDVKPQNVLLT
FT                   LGGTCKISDFGASAFLSEVVRREMEGNGLQIQGTPVYLAPEAARGKPVEQSDIWSCGIM
FT                   FLQLLTGGLPYADHFLRMPPQVLVYHIGSASAKPIIPDDLDEFCLEFVQICLKSDPNER
FT                   LSAQQLLALPVFSL"
FT                   /protein_id="XP_822447.1"
FT   misc_feature    503134..503208
FT                   /note="T-rich"
FT   gene            503562..505505
FT                   /db_xref="GeneID:3662760"
FT                   /locus_tag="Tb10.70.5900"
FT   mRNA            <503562..>505505
FT                   /db_xref="GI:71746785"
FT                   /db_xref="GeneID:3662760"
FT                   /locus_tag="Tb10.70.5900"
FT                   /transcript_id="XM_817355.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        503562..505505
FT                   /locus_tag="Tb10.70.5900"
FT                   /gene_family="HOG000257151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746786"
FT                   /db_xref="GeneID:3662760"
FT                   /translation="MRPAATCLLTTAASPYLGTACRRMLLFSAGRSLHLSPKRLSGSGS
FT                   LFSDNAFEREEEESLPHQKQRTEDNMTAVLSLLRDTVPLTGSDDVKELLKGCKNAKEVR
FT                   HILETVVYRNPLCYDVLNGHGYRVAVLQALTAGAPRTQCLHEWFECVDRFRRLGFLLTR
FT                   TFAAEGFTLIKQWLSSHFQTEGRSPLLVTEGISHIRELVRICREDRLVFDHVLYTRIVF
FT                   LLTMIVSFFDRQNIYRSVFPENFSKRDGVVVEWVITSERCVDFDECVLQCDAVVEELLE
FT                   MLSEDIPSHPNFSVMYRLIDYYFAADNVEKMIAVMEDAEGYGIGIAESSTAKLMQLACA
FT                   LNYPNVPELFMRWRASLPQCVIATPDMSRLMFYYSRSGGGRPCPVCGEPYNHRNVNVYV
FT                   WQQTPDHQRNCPALMDARRRKGELDENTALPQNQDWSEVAFNLWNMSQGRSIEWGAVEW
FT                   RGFLLCCMYSPRALEARRLLDEHYDHSRMDDFLRATYMRLLRHQLPEDVAATLRGWKKK
FT                   EQRVSPIVLQESLIGAAMAEEPDTRMSALREVWATLLEKDSYVMPFTRRRLQQRLDELR
FT                   SRTPGPTVEEITLLEEMINMQPRHLSLLDMKDSPADFVVGTSKKNVFTPPASGSRAEVR
FT                   LPERRRGRKEMG"
FT                   /protein_id="XP_822448.1"
FT   gene            506419..507456
FT                   /db_xref="GeneID:3662761"
FT                   /locus_tag="Tb10.70.5890"
FT   mRNA            <506419..>507456
FT                   /db_xref="GI:71746787"
FT                   /db_xref="GeneID:3662761"
FT                   /locus_tag="Tb10.70.5890"
FT                   /transcript_id="XM_817356.1"
FT                   /product="serine/threonine-protein kinase"
FT   CDS_pept        506419..507456
FT                   /locus_tag="Tb10.70.5890"
FT                   /gene_family="HOG000257152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine-protein kinase"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:71746788"
FT                   /db_xref="GeneID:3662761"
FT                   /translation="MVDCTVELPNIPYFGIRLDTSDIVGGVGRKSHDETVREIFLKGFT
FT                   HVQQTSSSDTHVTLVAQSEETKEWVHIRVYALERLRRDATLRDRIERSVLVGCKAQHPC
FT                   IVRIMQPFFSRTDLFVVEEYCAGGELLSWVETHCREAVTTKSGFEPPLGLSMGFVKSVM
FT                   RDVMSGVDHLHTRCGVAHRGIKLESILLDNCNRAKLSNLGACAVISTNEGKEVKNNPLK
FT                   VCCASRHYAAPEVVMGLPYDGKLVDVWALGVLLFVLLTCRFPFEEERDNPYESSSDTAV
FT                   RDGGDDELLMERICNADELLLKHPVLAHVSDPLATDLVRNMLRVNTKTRLTVREVLEHP
FT                   FLRMP"
FT                   /protein_id="XP_822449.1"
FT   gene            507816..509951
FT                   /db_xref="GeneID:3662762"
FT                   /locus_tag="Tb10.70.5880"
FT   mRNA            <507816..>509951
FT                   /db_xref="GI:71746789"
FT                   /db_xref="GeneID:3662762"
FT                   /locus_tag="Tb10.70.5880"
FT                   /transcript_id="XM_817357.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        507816..509951
FT                   /locus_tag="Tb10.70.5880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746790"
FT                   /db_xref="GeneID:3662762"
FT                   /translation="MRRVFRKSLSGALSYRWCWSPQPGPSYPTPEALVETIRRQGPKES
FT                   VWNLDFSFLPKRPSTQGEDVPDDVLRSCSVALSESALTVKRLSLTINSPEAVEVAIRFL
FT                   RGAQLPALRTLDLTLHNVAFVQNERMLATLLQSAAGVAGRLAELRVAMITHDIRSGLQW
FT                   GRQQRVPTALATLLSASALESLSLEHLVMSSTSDEETLVLNAAILNSCRGLRQLSLSGS
FT                   ASLLRCDSFLHDTLMGMPRLEVLDLSGICLNDVQIQKLLVSLRVSIGGWHNLQQLNLAG
FT                   CGLSTWALGLMQNDLGDPHPLPSNSSFGLKVLNLSSNGIDDEGAFVLATVCMRCRWIEE
FT                   IYLRHNRITEKGAAAICSAVREGTELRVLSFHSNLLKDEGLLEVLRHFEGWPKLQRFDV
FT                   TRCRLTVRCLPSLCIALLSSKALQELVLDRNDLRLLDTSDVTGTTGGGVHLFAFDSMRS
FT                   GIGSADIKALTSFEVDRRDALEGRQRHKGTGPANEEKKFNSTFIGAAPFERLGSALASC
FT                   AELRSFSASGCSLTDTAFLSLTAALQRCRLTHLNLSSNPLFTHVEGIEALGRLLHCASE
FT                   ALEVLDVSCTGLGNVGIAVLADGLSDSVSEMVGEPPLRSLGALRELHVSHCRIGDDGFG
FT                   ALADVVPFMCSLERLFLDGNQVTSVPVVVSLLGKLSTLPSLVFVGLHGTLSPRSGAEVA
FT                   VCSEYSLLRRKGITVHV"
FT                   /protein_id="XP_822450.1"
FT   gene            510289..512535
FT                   /db_xref="GeneID:3662763"
FT                   /locus_tag="Tb10.70.5870"
FT   mRNA            <510289..>512535
FT                   /db_xref="GI:71746791"
FT                   /db_xref="GeneID:3662763"
FT                   /locus_tag="Tb10.70.5870"
FT                   /transcript_id="XM_817358.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        510289..512535
FT                   /locus_tag="Tb10.70.5870"
FT                   /gene_family="HOG000257154" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746792"
FT                   /db_xref="GeneID:3662763"
FT                   /translation="MSNGYKRERWDEESGDHYHQHAVRYSDLPPNVKLQRRRQERQEKK
FT                   EKERTLAYFTSVHRALEEQSAETLVAFVDGFFVELIKLLRADTSLHLLRNGTVCRTIEA
FT                   ALASSQLLHCKSLLYILLGHVYDLAASPTASRTLEAIIASIVRGVSVFRRTDSSAFSAE
FT                   MEEGGASSNGVPSASTLITCVVEELAERAGEVLLHDAAARAVRSIILFLGGFWNSTGTA
FT                   SSLPHGVKFYAQLDTLGTALMCVVEPTFGVSCGDGVANIWLQVAKTPTASFVVQSLLRV
FT                   CERETKLDASVRQRLEVIHNDGSQLLRQLLMDPLGCHLFQAYLRVPVPASVLKDYDSFS
FT                   SYQCSGTAPTSSGSGKRFIKMLRDVAAEEPPNPDELAHEKTCWDKALAIVVEALDDLLD
FT                   PAGSSVGHAVFALQDLVLFAPTAVHLERVWEQLLERIGLRTLLASPKLVQVLIVFTRKC
FT                   AFSNPLPTVVESEDRSAEAAPLEGGFVGDMVPKDVEQSIYNDLSQGVRYFPTSTEFQKK
FT                   VLTALLRVARELCPKGAAQFLLVDGGLQDKGFELARYIMHFVPAASAVFLHAIERLRRS
FT                   DVETLLYHPKGSLVFQQFLRAGAAHHPQGKKGGEQQQEQQRVETMIPLSFMRRISPLLP
FT                   RLVVNTYAAYVIEVLYDVGSFEVKEELVKALLPIYNEMKRSHEEKQREVREAASRNDPS
FT                   ANPNNFHMSEFITRKVMTKCLVEMYSHRPDDWAKLARRQCQVQRLLQRMSSVAF"
FT                   /protein_id="XP_822451.1"
FT   gene            512911..517128
FT                   /db_xref="GeneID:3663011"
FT                   /locus_tag="Tb10.70.5860"
FT   mRNA            <512911..>517128
FT                   /db_xref="GI:71746793"
FT                   /db_xref="GeneID:3663011"
FT                   /locus_tag="Tb10.70.5860"
FT                   /transcript_id="XM_817359.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        512911..517128
FT                   /locus_tag="Tb10.70.5860"
FT                   /gene_family="HOG000257155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746794"
FT                   /db_xref="GeneID:3663011"
FT                   /translation="MAQPVDLCELYSSYCKEEGCKPNTAVLQYIIDCGRRYPLEKLILG
FT                   NNYLGPRGLRPIVRLVDYCPTMMHLNIDENGADNDTVSLLCDVLMTHKGMQTISLRGNP
FT                   ITATGGKKLLALAEKNPKITHIDLDNTDVFQALLLKIYAATKANRDRIGRGAVHLIPTS
FT                   MDEKELMAIVSSANTKMTHTFTEKPVIRQLPSVKKGEPTPVESSVSPRVVSPVERSTTF
FT                   PKPGRAWGGGQPSCETKSPLARRKGRARPPIPPITSRLPESQRLELQKEYRQRAMILRE
FT                   VNTSQASKVANRVREELMLLERNFRSEPSTQLGWNVEAAGTEAGEGKGDHSFDQDLEAI
FT                   EGYVDTNQEETEHGAQPQMQHVEEGSADNSRPEGLINRSSNGAFGPPPNFREPQQQVLL
FT                   RRDETSPEVPFGNAGGVTSLKSINLSAISPSSNSPDFTGKIVLQSGTPNTNTEKESEDN
FT                   VHTFMESPAWMTLGSGEKLQYLFNSGCRAYVSQKFDTSYMAWKEAMSIATSVKDRQWMA
FT                   VLSNNLQRLSYEMLVREGTEFLDEFKLEDADVAFQRALEVARRANNAKWESDMHKARRD
FT                   VQVAIFHKTDEAALRMFEKAQTTEPRKVTSDDYFVVAGSDVLIQHTEAYVNEWACMLLV
FT                   KEAVELWAAAIRVTERIGGTASHTLQVSVKESLTTVSYFLAQRCFDVEDTQSLSWMSTS
FT                   RYNYHECIMLIKLWTDMTSSADFRENHKLFAAIAAAQIGNLYLATNQLKEAEAQFSALT
FT                   SLGEELRDSILIAAGHTFRALLNWQCARYPAAEEHFRTAVARWGALRDVVRRERLEQNS
FT                   FVGNTTGVNSTSNSSSNVVDSLTKVTTGRYHVDGVSDAVFSRCNELSRLLLLLPRGYVS
FT                   MMECVSYNYLVSSLACKYRYSEALEVLECGLVCKYRDMLFDKLEMNFSTRPTFAQITAT
FT                   PSLVHSPLVYYLTTRRYEWSSTKCSYDVEESLLTWIVPQVGDMRFIEIPLMKEMKVLSV
FT                   DSLVQRVRKSLLLAPLDRLGANNARSGGTSGDSCGGEKAVDAPEIITELPNKTWVEPLK
FT                   TLYNIFIEPIAAYIRSSDPRLLAKNGVVTIIPTDGLWLVPFNALMSRNGNFVIEDFAFQ
FT                   LGFSATQCRLAALSAKRVQQRCLFQNLVLVQKQADATEQLMSHLLFPLDAHRSESEGAV
FT                   VMQTLAQNKRHVRHQCNSYVTSEITSSEVLLHDIEKLKEHLPRSRTVHIAASTTSGFRN
FT                   EDAGGGAICIAGTKGDLQLLRSSDIARMELFAEHVILSNANMSPSGIVGTHDDVLCLTR
FT                   GFLASGVPCVITSQWCTPDMVPAMLFSRFYQHQSAPNKRTRSSLLSRDSIGLLPASGTQ
FT                   QNALSRKEEGSDRCNDNLNWHKALFLAQAIRGLLEDDTFRYSPRSWAGYYCIGYGLMPP
FT                   GEA"
FT                   /protein_id="XP_822452.1"
FT   misc_feature    517142..517180
FT                   /note="CT-rich"
FT   gene            518357..520477
FT                   /db_xref="GeneID:3663012"
FT                   /locus_tag="Tb10.70.5850"
FT   mRNA            <518357..>520477
FT                   /db_xref="GI:71746795"
FT                   /db_xref="GeneID:3663012"
FT                   /locus_tag="Tb10.70.5850"
FT                   /transcript_id="XM_817360.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        518357..520477
FT                   /locus_tag="Tb10.70.5850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746796"
FT                   /db_xref="GeneID:3663012"
FT                   /translation="MTDNKVLYVGCVVVTLKEVRVCGKQLECEATRSGGAQFCVRTAVA
FT                   VAETANHSIHERFCERVNSSIYSFKNSTMMEQMVVPVMLLRSPSTIATMNGSKHNDKVN
FT                   TNGSADRVRNGNSDVTDLGANGEDMDVGLDLFLDISFLHGESMVWSLRRRVEVESLDAI
FT                   ASQNCGVAVARVSTDVLQSNGVLPTSEAVRGGSAACDASDGREDDEWSGLELHVIVRSM
FT                   DMSEPIRLMVAAEREASAFLDLPQREPQTVFLLPLRHAMPYNALPLEVLYQFYCCFYEY
FT                   FFNKPVKVFGHVVNMLRTRQPGGMGDNKTRGGAVTEGRWSELRSADLRPLLLGEDALAP
FT                   VLATLFHCPGLRELLLDQNSLSDITCYRIRSLFYRHRHLETLSIARNNIHEGGGEQLVR
FT                   LIRRNKRLIDVKASGNHFTHSMSSRIQRVASLNEEYIRGDPYNVFSSAYSYVVSPTSFP
FT                   ASIIKQALAVWAMLSAAPVSTVIVDCVPNSTFGIDLMGSPNNMKSNGSLHGSALDNGVV
FT                   EATDKALESSQATSIPHCALSPLLNEVMRTVALRMSSILHDPWALLVFSDIESHWERCT
FT                   ITLREQKEKCSKQDAQAAADGREDGPASIRHGEAALCEVEDLYAISFLHLVVVTMRAVG
FT                   RAMDWEDASSVLRDIGRKQMAIGILEENYRDAIQIFVQSLAVVCGKDEADVEHSAAFLQ
FT                   CLALGVRTAVAA"
FT                   /protein_id="XP_822453.1"
FT   gene            520867..523458
FT                   /db_xref="GeneID:3663013"
FT                   /locus_tag="Tb10.70.5840"
FT   mRNA            <520867..>523458
FT                   /db_xref="GI:71746797"
FT                   /db_xref="GeneID:3663013"
FT                   /locus_tag="Tb10.70.5840"
FT                   /transcript_id="XM_817361.1"
FT                   /product="major vault protein"
FT   CDS_pept        520867..523458
FT                   /locus_tag="Tb10.70.5840"
FT                   /gene_family="HOG000255109" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major vault protein"
FT                   /note="similar to GB:CAC14329.1: major vault protein
FT                   {Leishmania major}; similar to Major vault protein alpha
FT                   (MVP-alpha) (Swiss-Prot:P34118) (Dictyostelium discoideum);
FT                   similar to Major vault protein (MVP) (Lung resistance-
FT                   related protein). (Swiss-Prot; go_component:
FT                   ribonucleoprotein complex [goid 0030529]; go_process:
FT                   response to abiotic stimulus [goid 0009628]"
FT                   /db_xref="GI:71746798"
FT                   /db_xref="GeneID:3663013"
FT                   /translation="MVDKENQVIRLRPYEYIHVMDRNTCEVMLVEGPRSFTMLDHHISL
FT                   HDKVQNHVVVPPGHYCEVENPVVKPTASSSVGTLCNEMGHREVRLSQDPFPLHPGEKLV
FT                   TEPQPMRILAANEAIAVRALKEFTYSVPALGGSNNGEKGDTTGVAVRRRAVGEVWLVRG
FT                   PCEYVPRVEEVVEGNVTPIFLSAGQSLVLRANCNFTDINGVKRSRGDVWAVTTAGMHFP
FT                   DPSASVVRVHEGVILSATEAVRVRALRSFFDRLAAVDRVAGERWLVTHDVVPLFIPTVD
FT                   EEVEEKISLTIVGERQYCEILNVVKGGVCHYGVCEVRHGPCSFFLQPGEVLVGGTVREA
FT                   HILSSDEALLVVAVRAFVDEDGVEREPASRWLVHGPRKYIPPQGVTVVERRKRMVLSGS
FT                   EGVYVRDICTGNVRAVHGEAVLLGPEEELWEKPIDPLVHKLLTARRHSMYASRVCTETS
FT                   VDVGSEGHPRTHKIVMFKVPHNALVQLYDPTTNKSRVEAGPLTVSLGPNEEISVVVLSG
FT                   GQPKRRGHIHSLFLFLGPDFMADKIVVETLEHARLQLEIAYNWEFDTTDVEHIKRIAFS
FT                   VPDFVGMACKTLANRIRAAIASEPFDNFHRNSSSLIRRAIFHSHSGTTELRGDSLYFPV
FT                   NGLVITNVDVRSVEPVEVKMQNALTKSVQLAVEIITKSQENEASHQAMLMEQEEKGALE
FT                   LQLMKDRVSAEEERVKLLRVVAENTAIELCGASKAQALAESEARCVESQGELDVTGIRC
FT                   EAQSLIAAAQLAGLRERVESKLCHRRAMDELAIAKAKALSDIDATKYEKIFEALGKGTF
FT                   EAIARAGPELKAKLLQALGLKGFLVTDGSTPINLLGIADCVLHKNGNDALP"
FT                   /protein_id="XP_822454.1"
FT   gene            523842..525518
FT                   /db_xref="GeneID:3663014"
FT                   /locus_tag="Tb10.70.5830"
FT   mRNA            <523842..>525518
FT                   /db_xref="GI:71746799"
FT                   /db_xref="GeneID:3663014"
FT                   /locus_tag="Tb10.70.5830"
FT                   /transcript_id="XM_817362.1"
FT                   /product="actin-like protein"
FT   CDS_pept        523842..525518
FT                   /locus_tag="Tb10.70.5830"
FT                   /gene_family="HOG000257161" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="actin-like protein"
FT                   /note="member of ARP6 family (curated by B. Wickstead,
FT                   Univ. of Oxford); go_function: structural constituent of
FT                   cytoskeleton [goid 0005200]; go_process: cytoskeleton
FT                   organization and biogenesis [goid 0007010]"
FT                   /db_xref="GI:71746800"
FT                   /db_xref="GeneID:3663014"
FT                   /translation="MLAVTARRATMLVGCYSRHWCLPYVRVVTTNSFCFVLFFYKFFFF
FT                   VFCRMTAGYPVLVVDNGGYMLKALYITSDGKSSFLRGKIAVIPNCVGAASYVGRGIVGE
FT                   QLFKLPHFHGFMVRRPVDRGFIVDAGLQSYIWEYLLQHLAVADESEVELVMTVPFGAPK
FT                   QVGELLHYLVAQRFRFRSVTFVSSSFLTLVSSVSRDWLYGKAPGNGKSNKKVREKSNFG
FT                   SDGVGSESVTGCGMVVDFGFSSTTVVPYVNFIPLQDSIVRIDVGGKLLSNRLKELISFT
FT                   QVNVTEDGWLVNHIMEQACYVALDPLVSLRKAEYAKRFDKGNGAFAGLRYYLPTVPPLM
FT                   PLGCREEQLTQIIGKDVVLQEKNSLQHIVFRHEAFLIPELIFNPVDVGICQMGVVEAIV
FT                   HGTCCRGSLQNMRTLHGAMMRRIIAFGGITKFKNLPERLSTELRKHLKEEGASRVSVPP
FT                   VKGSAPLQEFVQWSRIGRVRIDLQYNGVGYTPSDCELQPLFGALALITCPVLEPQLKLV
FT                   QSRSRVELLPGSTAKGSQNRQQASAGPRTLSAVLSALQNLL"
FT                   /protein_id="XP_822455.1"
FT   misc_feature    523938..523981
FT                   /note="T-rich"
FT   gene            525889..527304
FT                   /db_xref="GeneID:3663015"
FT                   /locus_tag="Tb10.70.5820"
FT   mRNA            <525889..>527304
FT                   /db_xref="GI:71746801"
FT                   /db_xref="GeneID:3663015"
FT                   /locus_tag="Tb10.70.5820"
FT                   /transcript_id="XM_817363.1"
FT                   /product="hexokinase"
FT   CDS_pept        525889..527304
FT                   /locus_tag="Tb10.70.5820"
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hexokinase"
FT                   /EC_number="2.7.1.1"
FT                   /note="go_component: glycosome [goid 0020015]; go_function:
FT                   hexokinase activity [goid 0004396]; go_process:
FT                   carbohydrate metabolism [goid 0005975]; go_process:
FT                   glycolysis [goid 0006096]"
FT                   /db_xref="GI:71746802"
FT                   /db_xref="GeneID:3663015"
FT                   /translation="MSRRLNNILEHISIQGNDGETVRAVKRDVAMAALTNQFTMSVESM
FT                   RQIMTYLLYEMVEGLEGRESTVRMLPSYVYKADPKRATGVFYALDLGGTNFRVLRVACK
FT                   EGAVVDSSTSAFKIPKYALEGNATDLFGFIASNVKKTMETRAPEDLNRTVPLGFTFSFP
FT                   VEQTKVNRGVLIRWTKGFSTKGVQGNDVIALLQAAFGRVSLKVNVVALCNDTVGTLISH
FT                   YFKDPEVQVGVIIGTGSNACYFETASAVTKDPAVAARGSALTPINMESGNFDSKYRFVL
FT                   PTTKFDLDIDDASLNKGQQALEKMISGMYLGEIARRVIVHLSSINCLPAALQTALGNRG
FT                   SFESRFAGMISADRMPGLQFTRSTIQKVCGVDVQSIEDLRIIRDVCRLVRGRAAQLSAS
FT                   FCCAPLVKTQTQGRATIAIDGSVFEKIPSFRRVLQDNINRILGPECDVRAVLAKDGSGI
FT                   GAAFISAMVVNDK"
FT                   /protein_id="XP_822456.1"
FT   gene            528935..530350
FT                   /db_xref="GeneID:3663016"
FT                   /locus_tag="Tb10.70.5800"
FT   mRNA            <528935..>530350
FT                   /db_xref="GI:71746803"
FT                   /db_xref="GeneID:3663016"
FT                   /locus_tag="Tb10.70.5800"
FT                   /transcript_id="XM_817364.1"
FT                   /product="hexokinase"
FT   CDS_pept        528935..530350
FT                   /locus_tag="Tb10.70.5800"
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hexokinase"
FT                   /EC_number="2.7.1.1"
FT                   /note="go_component: glycosome [goid 0020015]; go_function:
FT                   hexokinase activity [goid 0004396]; go_process:
FT                   carbohydrate metabolism [goid 0005975]; go_process:
FT                   glycolysis [goid 0006096]"
FT                   /db_xref="GI:71746804"
FT                   /db_xref="GeneID:3663016"
FT                   /translation="MSRRLNNILEHISIQGNDGETVRAVKRDVAMAALTNQFTMSVESM
FT                   RQIMTYLLYEMVEGLEGRESTVRMLPSYVYKADPKRATGVFYALDLGGTNFRVLRVACK
FT                   EGAVVDSSTSAFKIPKYALEGNATDLFDFIASNVKKTMETRAPEDLNRTVPLGFTFSFP
FT                   VEQTKVNRGVLIRWTKGFSTKGVQGNDVIALLQAAFGRVSLKVNVVALCNDTVATMISH
FT                   YFKDPEVQVGVIIGTGSNACYFETASAVTKDPAVAARGSALTPISMESGNFDSKYRFVL
FT                   PTTKFDLDIDDASLNKGQQALEKMISGMYLGEIARRVIVHLSSINCLPAALQTALGNRG
FT                   SFESRFAGMISADRMPGLQFTRSTIQKVCGVDVQSIEDLRIIRDVCRLVRGRAAQLSAS
FT                   FCCAPLVKTQTQGRATIAIDGSVFEKIPSFRRVLQDNINRILGPECDVRAVLAKGGSGV
FT                   GAALISAIVADGK"
FT                   /protein_id="XP_822457.1"
FT   repeat_region   530634..530667
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            530884..532725
FT                   /db_xref="GeneID:3663017"
FT                   /locus_tag="Tb10.70.5780"
FT   mRNA            <530884..>532725
FT                   /db_xref="GI:71746805"
FT                   /db_xref="GeneID:3663017"
FT                   /locus_tag="Tb10.70.5780"
FT                   /transcript_id="XM_817365.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        530884..532725
FT                   /locus_tag="Tb10.70.5780"
FT                   /gene_family="HOG000257162" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746806"
FT                   /db_xref="GeneID:3663017"
FT                   /translation="MRRALWLTAGAINRWTREDNILLLGHRGSHTEATVQLPTLSPLAR
FT                   VIGCMERKDFDGVVRFYESAFREGNVTLWEFAGGIVHARDMALCLMRTFTELGRMDRVR
FT                   EVFMLGLRDLRPVHTVVSSSITGAREASTSLSCGKTVPFSLVNANFFNAYLEVLTKRKN
FT                   FSSDEVAFVLKEMKAADVSPDALTYHYLVELHIRMGVDPTGLWNDMRQDFTVRPLPCTV
FT                   HTLLLHVVPSVADPSFVVDVTREALRHGSSVMDKRLISEMMEQWLHNAQDYPPEYVLWL
FT                   MFELELRCVVDKASFVQFVQKRHVAELLQRCAKCADADTAGKVLAMMDRHVMTKTADIL
FT                   SLVVWCWAQAQELEKAFDLLELMARKGHLELTDPFRKYTVDCLRQAMDRHFMIALADAV
FT                   SSVSLLDRVISHLRCRRQRGQTVSVHSLDLLVLAASKLGEERRAMALVGSYVAEWGVQQ
FT                   RTNTYNCLLVGLASRRGATLQRTIYDAMQGNGVTPNAFTFRILIRQAVLADSIDEAIEF
FT                   LQKVTSHTGLRVEVEMILPILERAARAGDAETVNRISKFALDCDIGIDSVVLNNVVKLL
FT                   TDAGQDVEVIKGHQPLHEALRSRSKAGRQRARNDIVI"
FT                   /protein_id="XP_822458.1"
FT   gene            533369..535990
FT                   /db_xref="GeneID:3662312"
FT                   /locus_tag="Tb10.70.5760"
FT   mRNA            <533369..>535990
FT                   /db_xref="GI:71746807"
FT                   /db_xref="GeneID:3662312"
FT                   /locus_tag="Tb10.70.5760"
FT                   /transcript_id="XM_817366.1"
FT                   /product="protein kinase"
FT   CDS_pept        533369..535990
FT                   /locus_tag="Tb10.70.5760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="curated by M. Parsons, P. Ward, J. Mottram;
FT                   go_function: protein serine/threonine kinase activity [goid
FT                   0004674]; go_function: ATP binding [goid 0005524];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71746808"
FT                   /db_xref="GeneID:3662312"
FT                   /translation="MRANDIVKGRYSTYQLQDLIGKGGNAVVYSAVDRNTGLMVAVKKM
FT                   EVHDDAAMATCRNEVAILSHLKHPYVIRYIDHAHSGKSFLIVTEFALERSLLQRLKRHG
FT                   RCGELEVARFMFQITSALAYLHKEKIVHRDIKCANVLLGAAEVVKLSDFGLAVNLGAVH
FT                   GDTNDEEDGLLSSSAVCDGDGKSVAEEGIVGSVYWMAPEAVRGEPPAESCDIWSLGCLC
FT                   IELLTGNPPFFDRKPANALYCISETDETPIPTMDVSEECRNFLTQCLDRDASKRPTAAA
FT                   LLKHGWFGGFLAENIVKTLADTQVDGTTSDQVASNSEAIKSWVENNLFNERAEQREEWL
FT                   RSGCLKRVVAVLPKVTPKVSFHIIRTFVFAAQRCRTESSCFLTRLGEADLWDSAQLGVL
FT                   GKAESLGALFVCCCERQDPRVLQYAPTHPGALWFLLQCAEVDVAIMCIDALRALLVGTA
FT                   GEEEENRASFSSRPEVASTNVENITFRRYVSQNRFVSDHAVYAVQRIIEDICYDAFRGD
FT                   KDPAVGWQNIDKLFEILLQVYRKAGDESIILGPSVSGARQDDPQDSPKGGTGGSVAATA
FT                   TAAVAVSTSIVGGGGGAASAMGDPAGSAATATTSAPSSGEAGRKPINPHIHSPCSPNAG
FT                   GVNTSSVVVGIASACGKGGKPAEELWLLALQEASRKLCPNAIELLMQYVHLAARNDLKS
FT                   LNIGGKAIAGTFLVVASNASVDTATRITVLKCLPALQCASPKAANFMRDVRCSVPLLVH
FT                   TAKNIPVPAEARDDEVLKVLFALCEDNRVAAAFASYGAFIAIAIDRATLACERQRWAEV
FT                   TLAVRFVELLLAHATDTSCILESHALLRLLLKLSDGDKFPSIVTSVAQRLLNSLQAQTN
FT                   VG"
FT                   /protein_id="XP_822459.1"
FT   gene            537106..538344
FT                   /db_xref="GeneID:3662313"
FT                   /locus_tag="Tb10.70.5720"
FT   mRNA            <537106..>538344
FT                   /db_xref="GI:71746809"
FT                   /db_xref="GeneID:3662313"
FT                   /locus_tag="Tb10.70.5720"
FT                   /transcript_id="XM_817367.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        537106..538344
FT                   /locus_tag="Tb10.70.5720"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746810"
FT                   /db_xref="GeneID:3662313"
FT                   /translation="MFRGSGARKCCSSSFLYRTAPTSAATGTSPPSLVTVPLLRAALLL
FT                   RWRLLSLQFDGDSNMCVLAEDAADGLPRGTRLEMYGSNVQLVRQLSGAGEALLQPSVIG
FT                   EVTATLEGALTDDTTERRGRQIVAVLSPPHLSSSLGGPEFKGNEDVEVIAQWTLSRKRV
FT                   ENVQRVTDTTKRDGVKNEEPPPLMENGIVFPSPRFAGLRVLRAARHSFALLLENELRER
FT                   TGESEVGKVGPLAVLDVSELDCTFSRVAVQMAVERGLVLEQHMHVNFVPLTPAATATAD
FT                   ETVRSLLRLVAHPTRGAHLDPLRPLQARCFKLGCCTFCSKGRGSAANEGSKKDEASLVS
FT                   RLAGVISKIHSNGTLLVNLVGDGINHEELRQGAEMHLVEALLRADRCGVVIDEVLPAAD
FT                   TRGTAISFVVSLC"
FT                   /protein_id="XP_822460.1"
FT   gene            538775..541675
FT                   /db_xref="GeneID:3662314"
FT                   /locus_tag="Tb10.70.5710"
FT   mRNA            <538775..>541675
FT                   /db_xref="GI:71746811"
FT                   /db_xref="GeneID:3662314"
FT                   /locus_tag="Tb10.70.5710"
FT                   /transcript_id="XM_817368.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        538775..541675
FT                   /locus_tag="Tb10.70.5710"
FT                   /gene_family="HOG000257164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_component: mitochondrion [goid 0005739]"
FT                   /db_xref="GI:71746812"
FT                   /db_xref="GeneID:3662314"
FT                   /translation="MLSNTGGYSRHSHVLGFRKDAATLQCALCPALRAKGRCKAYQLET
FT                   RLRAELAAQKERELRTTAMQLYSLQEEILQRGREQGVDTSEGDKQAVVEKIVGELKKEQ
FT                   SYVRWNLDVEVVERMTLLRTRPCRYSHQRDLLTVLKPRKGTAKLGSKHMEKAQGELGAA
FT                   ASGGAENRLSEEHRRIFEGLSPLQKCVVCLLWQRTFEIPQKVVCDVRRQVEVERGYDSD
FT                   DQEDAAVVDAAIEEEERRVVTVTTCRLSIGSVDLSSLPSVAAYIARHPNEPIIRTETWE
FT                   HFTVWDAKSKSRRSALLPSSLTEKQVDLSTAACAHEVMGAVVWALRTMDEERRLQSDPN
FT                   ERRQERSRQQRHTQGKSAAVVLRTLTLRRCSITAADALVAALRKYKLDTTLLALDVSDN
FT                   RLMCLRFLFALRAHFAERLLRLSLANNPITRKPDYREQVRKSLPKLTSLDGVAIRRPPL
FT                   RFPHPSLLSYTLAGGAATASATSTTVRPKEHSTMSDTELEQVMDAVSRFFYIWETRRVP
FT                   WTAAELRHIRDQGGTRCRGRNKVSKRRRGEGTGLAITSLEDGEEEPCVPPEEDLDDDNF
FT                   HHRYLHPYATFSLSVHEGLSFFASDIMRVDAEVEMDKNYTGMRLSSLDASELRVFDVSM
FT                   KNSSRNLLLGRSVLHRHARGSLSCYTAYKCTLYPPSLSVCHHFPAAVVSASKIICAAVN
FT                   AEPRKQQRQEKQNSHRKQSKGDTGNAHESKTGATVFFPNRTRKPTFYTVTIHGLMTWRA
FT                   PSMKRCECVRAAYDRVMTLVENTVYGEDTVEGRRSAPLLIFNDQLHLRPAGRCDDATTV
FT                   CHVTPTLEYVTRLVVEFGLEACVDGARLVRAVAERSTSDASTHAALTVLVFGSVESCES
FT                   KGEEVGSPNVSASGTVHSTAVDHDDPTNGVEQTLPHFDIYSVLTSENWTVADNGCAVVE
FT                   CPPHRVTLADVDAAVAASNSRYTFSFSVEKGELGGT"
FT                   /protein_id="XP_822461.1"
FT   gene            542011..542610
FT                   /db_xref="GeneID:3662315"
FT                   /locus_tag="Tb10.70.5700"
FT   mRNA            <542011..>542610
FT                   /db_xref="GI:71746813"
FT                   /db_xref="GeneID:3662315"
FT                   /locus_tag="Tb10.70.5700"
FT                   /transcript_id="XM_817369.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        542011..542610
FT                   /locus_tag="Tb10.70.5700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746814"
FT                   /db_xref="GeneID:3662315"
FT                   /translation="MSRKSYLTAVVTRYARSISSSSALDRSLNRNGFKKSAKHETTVPP
FT                   RSFLSSCLKFTPVAWLIRNAMGIAFYQLVLEGILTAVCSLMLLGHYTTTAGIRSRLESC
FT                   HYPFTSFVDWDGGQHDQSFTVGQYHLTAEVLTAAHTAHNIASGLLPLQLVVLALTFPAA
FT                   RRVWVGVSTRSKALWPHKVEEQISNNPYGKRRNYRR"
FT                   /protein_id="XP_822462.1"
FT   gene            543261..544010
FT                   /db_xref="GeneID:3662316"
FT                   /locus_tag="Tb10.70.5690"
FT   mRNA            <543261..>544010
FT                   /db_xref="GI:71746815"
FT                   /db_xref="GeneID:3662316"
FT                   /locus_tag="Tb10.70.5690"
FT                   /transcript_id="XM_817370.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        543261..544010
FT                   /locus_tag="Tb10.70.5690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746816"
FT                   /db_xref="GeneID:3662316"
FT                   /translation="MLWIQICTFVVLSTCLLVPEVVNAWSYGELLPVSFHLRLKRTAAA
FT                   TDIPRGADDMIEVKETKNNQWLITRPLPPDNSPRFAINTRAHQPSTRLFEYATNATKQE
FT                   GGSISDVAVRFQIERGLAKSTAWYPLMKTIIKKITTEKRKSKVEHSKEEHYLAGLNFHF
FT                   GYQSGTFHKITSFRVEPTYSKVKNNDLELHYQWTEHRTYNPHIALCICSLVAVIAASST
FT                   LSLIFTKKTHLTKAFSKKEVRVKNHKQ"
FT                   /protein_id="XP_822463.1"
FT   misc_feature    543972..544072
FT                   /note="A-rich"
FT   misc_feature    544016..544108
FT                   /note="AT_rich"
FT   gene            544479..545525
FT                   /db_xref="GeneID:3662317"
FT                   /locus_tag="Tb10.70.5680"
FT   mRNA            <544479..>545525
FT                   /db_xref="GI:71746817"
FT                   /db_xref="GeneID:3662317"
FT                   /locus_tag="Tb10.70.5680"
FT                   /transcript_id="XM_817371.1"
FT                   /product="elongation factor 1-alpha"
FT   CDS_pept        544479..545525
FT                   /locus_tag="Tb10.70.5680"
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="elongation factor 1-alpha"
FT                   /note="identical to SP:P41166: Elongation factor 1- alpha
FT                   (EF-1-alpha). {Trypanosoma brucei brucei}; go_component:
FT                   cytoplasm [goid 0005737]; go_function: translation
FT                   elongation factor activity [goid 0003746]; go_function:
FT                   calmodulin binding [goid 0005516]; go_process:
FT                   microtubule-based process [goid 0007017]; go_process:
FT                   calcium-mediated signaling [goid 0019722]"
FT                   /db_xref="GI:71746818"
FT                   /db_xref="GeneID:3662317"
FT                   /translation="MITGTSQADAAILIIASAQGEFEAGISKDGQTREHALLAFTLGVK
FT                   QMVVCCNKMDDKTVNYGQERYDEIVKEVSAYIKKVGYNVEKVRFVPISGWQGDNMIEKS
FT                   EKMPWYKGPTLLEALDMLEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVMKPGD
FT                   VVTFAPANVTTEVKSIEMHHEQLAEATPGDNVGFNVKNVSVKDIRRGNVCGNTKNDPPK
FT                   EAADFTAQVIILNHPGQIGNGYAPVLDCHTSHIACKFAEIESKIDRRSGKELEKAPKSI
FT                   KSGDAAIVRMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKAVTKKDGSGGKVTK
FT                   AAVKASKK"
FT                   /protein_id="XP_822464.1"
FT   gene            546352..547701
FT                   /db_xref="GeneID:3662318"
FT                   /locus_tag="Tb10.70.5670"
FT   mRNA            <546352..>547701
FT                   /db_xref="GI:71746819"
FT                   /db_xref="GeneID:3662318"
FT                   /locus_tag="Tb10.70.5670"
FT                   /transcript_id="XM_817372.1"
FT                   /product="elongation factor 1-alpha"
FT   CDS_pept        546352..547701
FT                   /locus_tag="Tb10.70.5670"
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="elongation factor 1-alpha"
FT                   /note="identical to SP:P41166: Elongation factor 1- alpha
FT                   (EF-1-alpha). {Trypanosoma brucei brucei;}; go_component:
FT                   cytoplasm [goid 0005737]; go_function: translation
FT                   elongation factor activity [goid 0003746]; go_function:
FT                   calmodulin binding [goid 0005516]; go_process:
FT                   microtubule-based process [goid 0007017]; go_process:
FT                   calcium-mediated signaling [goid 0019722]"
FT                   /db_xref="GI:71746820"
FT                   /db_xref="GeneID:3662318"
FT                   /translation="MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKE
FT                   AADIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMIT
FT                   GTSQADAAILIIASAQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYG
FT                   QERYDEIVKEVSAYIKKVGYNVEKVRFVPISGWQGDNMIEKSEKMPWYKGPTLLEALDM
FT                   LEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVMKPGDVVTFAPANVTTEVKSIE
FT                   MHHEQLAEATPGDNVGFNVKNVSVKDIRRGNVCGNTKNDPPKEAADFTAQVIILNHPGQ
FT                   IGNGYAPVLDCHTSHIACKFAEIESKIDRRSGKELEKAPKSIKSGDAAIVRMVPQKPMC
FT                   VEVFNDYAPLGRFAVRDMRQTVAVGIIKAVTKKDGSGGKVTKAAVKASKK"
FT                   /protein_id="XP_822465.1"
FT   gene            548535..549884
FT                   /db_xref="GeneID:3662245"
FT                   /locus_tag="Tb10.70.5650"
FT   mRNA            <548535..>549884
FT                   /db_xref="GI:71746821"
FT                   /db_xref="GeneID:3662245"
FT                   /locus_tag="Tb10.70.5650"
FT                   /transcript_id="XM_817373.1"
FT                   /product="elongation factor 1-alpha"
FT   CDS_pept        548535..549884
FT                   /locus_tag="Tb10.70.5650"
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="elongation factor 1-alpha"
FT                   /note="most (but not all) Tryp predicetd proteins have a
FT                   substantial N-yerminal extension (of 100aa); go_function:
FT                   translation elongation factor activity [goid 0003746];
FT                   go_function: calmodulin binding [goid 0005516]; go_process:
FT                   microtubule-based process [goid 0007017]; go_process:
FT                   calcium-mediated signaling [goid 0019722]"
FT                   /db_xref="GI:71746822"
FT                   /db_xref="GeneID:3662245"
FT                   /translation="MGKEKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKE
FT                   AADIGKASFKYAWVLDKLKAERERGITIDIALWKFESPKSVFTIIDAPGHRDFIKNMIT
FT                   GTSQADAAILIIASAQGEFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVNYG
FT                   QERYDEIVKEVSAYIKKVGYNVEKVRFVPISGWQGDNMIEKSEKMPWYKGPTLLEALDM
FT                   LEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVMKPGDVVTFAPANVTTEVKSIE
FT                   MHHEQLAEATPGDNVGFNVKNVSVKDIRRGNVCGNTKNDPPKEAADFTAQVIILNHPGQ
FT                   IGNGYAPVLDCHTSHIACKFAEIESKIDRRSGKELEKAPKSIKSGDAAIVRMVPQKPMC
FT                   VEVFNDYAPLGRFAVRDMRQTVAVGIIKAVTKKDGSGGKVTKAAVKASKK"
FT                   /protein_id="XP_822466.1"
FT   misc_feature    550402..550436
FT                   /note="AT_rich"
FT   gene            550439..551023
FT                   /db_xref="GeneID:3662246"
FT                   /locus_tag="Tb10.70.5640"
FT   mRNA            <550439..>551023
FT                   /db_xref="GI:71746823"
FT                   /db_xref="GeneID:3662246"
FT                   /locus_tag="Tb10.70.5640"
FT                   /transcript_id="XM_817374.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        550439..551023
FT                   /locus_tag="Tb10.70.5640"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746824"
FT                   /db_xref="GeneID:3662246"
FT                   /translation="MSDSFALDDARRIKRRRRLSRMSIEGRRRQLQYRRRHNERDGRLL
FT                   YCDYCDLFVCSSLRSWGEHVISERHMENMECYYAMVEAYEPSWLGSICDDVSRAHVENH
FT                   VRRHQSVSGKGSSVPIPAVVAGRVDDQEIIVGGLPKPSRTAAETYNNSCNIAGTPSVRV
FT                   AGVLVASAAPPVVKVGNKPVTPTPLSVTKRE"
FT                   /protein_id="XP_822467.1"
FT   gene            551184..553913
FT                   /db_xref="GeneID:3662247"
FT                   /locus_tag="Tb10.70.5630"
FT   mRNA            <551184..>553913
FT                   /db_xref="GI:71746825"
FT                   /db_xref="GeneID:3662247"
FT                   /locus_tag="Tb10.70.5630"
FT                   /transcript_id="XM_817375.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        551184..553913
FT                   /locus_tag="Tb10.70.5630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746826"
FT                   /db_xref="GeneID:3662247"
FT                   /translation="MCTGITGSHCRYRFSTLLFPCVCLPLWIQGRVFVKSLTGRGEGAY
FT                   RCVRIIGVLTFLLFVRFPRFVSGMKTNNLERRRQIRQQLRAFYGDNLTAKDEPVTRESG
FT                   EPDHSSVSMNTRVNSIPPGLDMDSDSFDVGEYTTELFRVKSLKGVVETDAWLARTASRL
FT                   ETELRELVYRNYSKFISATDTIREIRSDVTEMGGRLHALSGNVENIDDVSKDVSGKLQE
FT                   HRSRIEKVITKHRMLRKAQFLVGLADTMRLHMERKEHSECVRKWVMGDSFIAKHANIPK
FT                   MAIVHKECKELAMHLYGVLREEVLSVSMENPDASEVIRRIVGELRLLRATSIFGEDKEI
FT                   TPHAGTDGALAPFEEEILSVLKINVREAFVVAVRSFNATIEAALLIPGLSEMHLEERAG
FT                   VLMRPRLQEALAQLKSSLAIFHSGSEQLCSLFNQRDESAFSKYIIEEVEPVLTDTIVAI
FT                   TTPLGNLLVAIVDAIAKDGSSLLGSPATVQTDLSTVFTTLAKHLMHYSTTMKGLGVTYL
FT                   NSAMNQHSEKYAEMVDKSVLGVLLKFVNYLETHVTETNDAQKTKLGDDNASDPQKQQEV
FT                   CFNMCLSRFVLANAAVAADLKSVSAIIESVTSRRSELIDLQKKNARLTRALLRRGIVLS
FT                   GQFFLNSALPAFSPATAVDPSASTASEHGGIAVCLRNTVVRLGELYNFLKQGVVPSVDD
FT                   GNTKCASPPAEKHRGNDSASGSTAGGSQLLYSAPGSGRNAGATRATRLAVCFTRKKEDA
FT                   LQASVERIFSKQSQNNAVLQTMPLEFRAASVVAAIAVYLVKGIVEYVRRVTFTRCGFQC
FT                   VQTSCTFLLHAFTPTALTSSSPAGTSQSLKVTVSLEEWLSDCGDERLLKGLPFLLNECC
FT                   TCAYERCGEKVPLTAVVVERLVRSVLEEMEGVSVSAEA"
FT                   /protein_id="XP_822468.1"
FT   gene            554304..555743
FT                   /note="mitochondrial processing peptidase alpha subunit
FT                   (pseudogene)"
FT                   /db_xref="GeneID:3662248"
FT                   /locus_tag="Tb10.70.5620"
FT                   /pseudo
FT   gene            556368..557012
FT                   /db_xref="GeneID:3662249"
FT                   /locus_tag="Tb10.70.5600"
FT   mRNA            <556368..>557012
FT                   /db_xref="GI:71746827"
FT                   /db_xref="GeneID:3662249"
FT                   /locus_tag="Tb10.70.5600"
FT                   /transcript_id="XM_817376.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        556368..557012
FT                   /locus_tag="Tb10.70.5600"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746828"
FT                   /db_xref="GeneID:3662249"
FT                   /translation="MVGTVLRVYTHRTRCIGELCSVAPLCVILEQRRPGPSFGIRSQSR
FT                   EDNSVHFLPCEGAVDLSLRALSTIEGLRNYREHRLRPQLLVKRAELRQADDVKTRCDAL
FT                   GLRYADRCIAIAVALILIRNVVLFYWVYFLFDWNLVEPITYLLERGAVCLGFLWYGATS
FT                   SDARFESFRQFLVSRRTQRLYAQHNFNAGHWKELVVEVEGLEEQLRGLETV"
FT                   /protein_id="XP_822469.1"
FT   gene            557855..558370
FT                   /db_xref="GeneID:3662250"
FT                   /locus_tag="Tb10.70.5590"
FT   mRNA            <557855..>558370
FT                   /db_xref="GI:71746829"
FT                   /db_xref="GeneID:3662250"
FT                   /locus_tag="Tb10.70.5590"
FT                   /transcript_id="XM_817377.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        557855..558370
FT                   /locus_tag="Tb10.70.5590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746830"
FT                   /db_xref="GeneID:3662250"
FT                   /translation="MDAEEYLHMKEREMMEEYGAVILSQRNEIEQLQRRCSELLHERSF
FT                   MRASVAEDVRQFCVGHLQRQQAQQQRASGRLATSSACVQSIPVLHLLQFLHQYTSGVVP
FT                   VMETEKRKRPRETGTGGICPNTPHQQRLVQRMITRRRLCIREGDSEESLQGIEVQSAEQ
FT                   PICADQVH"
FT                   /protein_id="XP_822470.1"
FT   misc_feature    558513..558552
FT                   /note="GA-rich"
FT   gene            559008..559199
FT                   /db_xref="GeneID:3662251"
FT                   /locus_tag="Tb10.70.5580"
FT   mRNA            <559008..>559199
FT                   /db_xref="GI:71746831"
FT                   /db_xref="GeneID:3662251"
FT                   /locus_tag="Tb10.70.5580"
FT                   /transcript_id="XM_817378.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        559008..559199
FT                   /locus_tag="Tb10.70.5580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746832"
FT                   /db_xref="GeneID:3662251"
FT                   /translation="MSITLFVDFIYFIFRFLSTHHCNLSFTWGRRDDLRFDTAPVLSSQ
FT                   ARGRIEAEFKQKPLLLIS"
FT                   /protein_id="XP_822471.1"
FT   gene            559408..560832
FT                   /db_xref="GeneID:3662252"
FT                   /locus_tag="Tb10.70.5570"
FT   mRNA            <559408..>560832
FT                   /db_xref="GI:71746833"
FT                   /db_xref="GeneID:3662252"
FT                   /locus_tag="Tb10.70.5570"
FT                   /transcript_id="XM_817379.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        559408..560832
FT                   /locus_tag="Tb10.70.5570"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746834"
FT                   /db_xref="GeneID:3662252"
FT                   /translation="MSCGGAWEALIDRAAMEVSKFLSATKDAFHQDSPTAEWMLNLLDD
FT                   NALRDVVMERNFNALCGMVGCAAMPPAAVGRVEGQLRQEAIGTGKNILNRNDEEDTVSD
FT                   GEDDGGDAADAFRRYEKYREQICAGREAATALSGVDMTKCFCSPDCAEQFAAMLAKVPR
FT                   TLVYSREGLVNSVGGLFPNMQFSVLQQLAGAEATVVPDIREKEVVEGQEKKLDLPIPSI
FT                   GNEENKDHKVKLRELLESIQAVQPVWSRGVQEVRPFDTRKGTMQKMPIPLMVYDWLGTV
FT                   STDKTKSIFASVCYSNTRKSDRFPCVGGGRSTNLFVRCMQPVLDACIRKGKELSEGRAA
FT                   DEGCAENPCVDPALQHQRLTLFVRHVFSGETSATLSRLLMYDQATLERAWGAWNSTGLL
FT                   ASLSFPSAVPGDFTCGGGSPARIYLAVVLTAAAALCAPAIWVEWLQEDNGLAEVLEALG
FT                   CTSDDFIACVRALVVE"
FT                   /protein_id="XP_822472.1"
FT   gene            561417..562301
FT                   /db_xref="GeneID:3662253"
FT                   /locus_tag="Tb10.70.5560"
FT   mRNA            <561417..>562301
FT                   /db_xref="GI:71746835"
FT                   /db_xref="GeneID:3662253"
FT                   /locus_tag="Tb10.70.5560"
FT                   /transcript_id="XM_817380.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        561417..562301
FT                   /locus_tag="Tb10.70.5560"
FT                   /gene_family="HOG000257095" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746836"
FT                   /db_xref="GeneID:3662253"
FT                   /translation="MFHNSYQSGFLSILYSIGSRPLQIWDTKVRNGHVKRITDEDIQSS
FT                   VLEVVGNNVSTCYITCPVDPKKTLGIKLPFLVMIIKNLKRYFSFEVTILDDKGIRRRFR
FT                   ASNYQTTTRVKPFTCTMPMRLDEGWNQIQFNLADFTRRAYGTNYLETLRVQLHANCRVR
FT                   RLYFSDRLYSEEELPPEFKLFLPIAQQQQQQQQQQQQQQHMQKQAPPEPQQQQHHQQQQ
FT                   VHSEAHQQQQAPPEAQHQQAHSEAHQQQQYQQQVQHSQFQDAAPPSQQQTHEEMPQGEE
FT                   EEQQQQTSPVEGA"
FT                   /protein_id="XP_822473.1"
FT   repeat_region   561981..562024
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cag"
FT                   /rpt_type="tandem"
FT   repeat_region   562341..562400
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   562833..562855
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   563511..563547
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   misc_feature    563646..563724
FT                   /note="GA-rich"
FT   misc_feature    564309..564332
FT                   /note="AT_rich"
FT   gene            564864..565880
FT                   /db_xref="GeneID:3662383"
FT                   /locus_tag="Tb10.70.5550"
FT   mRNA            <564864..>565880
FT                   /db_xref="GI:71746837"
FT                   /db_xref="GeneID:3662383"
FT                   /locus_tag="Tb10.70.5550"
FT                   /transcript_id="XM_817381.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        564864..565880
FT                   /locus_tag="Tb10.70.5550"
FT                   /gene_family="HOG000257096" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746838"
FT                   /db_xref="GeneID:3662383"
FT                   /translation="MSRVPHPSGVDILFDSKWHQYKIGNCALRSVSKLLDKHFPFDEKR
FT                   ALAAVAKKTGQTTEEVKASWNRQALLGKNIHEYIECKLRGLPPPTWTLLLKKKRRKEDV
FT                   FRHQDIREGSKKKKKDKKSDGDSEGSEGSDGKKHASRGSKSLIDTLLHGEEEAYMVVAD
FT                   RVVETIECNYDIIAVEQVIASVPWGIAGTVDLIARNKRTGRLLIGDWKTSGTVASSFRF
FT                   SPFETPCTGCLLHLPNSRFHRYAMQVAIYGEILKNDQYLEKGFFGKKIEPLNKDIGEIN
FT                   LSPAMVNEALEYGIVQMQKNDAGSVCVEFKEVKESTVMPVDATDCTFLQLLHSVMRG"
FT                   /protein_id="XP_822474.1"
FT   repeat_region   565895..565929
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    566441..566486
FT                   /note="GA-rich"
FT   misc_feature    566900..566936
FT                   /note="AT_rich"
FT   gene            566942..568930
FT                   /db_xref="GeneID:3662384"
FT                   /locus_tag="Tb10.70.5540"
FT   mRNA            <566942..>568930
FT                   /db_xref="GI:71746839"
FT                   /db_xref="GeneID:3662384"
FT                   /locus_tag="Tb10.70.5540"
FT                   /transcript_id="XM_817382.1"
FT                   /product="ubiquitin carboxyl-terminal hydrolase"
FT   CDS_pept        566942..568930
FT                   /locus_tag="Tb10.70.5540"
FT                   /gene_family="HOG000257097" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin carboxyl-terminal hydrolase"
FT                   /EC_number="3.1.2.15"
FT                   /note="Curated by J. Mottram; go_function: cysteine-type
FT                   endopeptidase activity [goid 0004197]; go_function:
FT                   ubiquitin thiolesterase activity [goid 0004221];
FT                   go_process: ubiquitin-dependent protein catabolism [goid
FT                   0006511]"
FT                   /db_xref="GI:71746840"
FT                   /db_xref="GeneID:3662384"
FT                   /translation="MGGSYSTVKTQRELRNADLKVSPKSPNSFGRGDVRPTPSKALPSA
FT                   ARGTLPTRVAQVKVQREQGQDEGASRAQESSFQALPHLPTSRSQSFSNVAQKCGPLSGT
FT                   PNTPSTSLYRSNILSPSSTTVNGGVFGSPSTTAIPTRSSPSQTQYLEISGYPVGLENYG
FT                   NTCYFNAVLQLLYHCSPLRMRMLELNAIYEKKKGSSRFDSSTILALTADLFAKMHKVNN
FT                   NKKRQKGVPTPRGLLNRVRQLNSMFNNNHQHDAHEFAMFLLNELVETESHLMSDERNRT
FT                   LFMRDEGKESKTSQWFSSLWSRRQKETKKGAERSQSDVKEANESCTTVDCLELPRIFSE
FT                   GEVCAMKLPSLTRLKSSDFSDGVGGTSLYSTSGWDWGAPPSLEKILTGQFVSLTGCCEC
FT                   ENVSVTREAFIDIGLNVVQGSSLRRCVEELSVTEVFDGENKMNCERCGKKVAARRAMWI
FT                   NRLPEYALLVHLKRFHYDEKTGKMRKRSEHIALPREIDVVEYEPCGEKCNEAAGDGSFC
FT                   CEEDTSGPEFRRPLTSSPVQSTLAGIASSNDAGCSNSCIGSSCGDINSTTTTSEPHFRL
FT                   LQKLHVMPRCKGRFALSGFVAHRGSGLSSGHYFTCVRHESAWRCFDDNNVTELTDREMQ
FT                   RFWGTPVDLGEVVTTTTAYLLLYERVA"
FT                   /protein_id="XP_822475.1"
FT   repeat_region   568976..569040
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    570172..570203
FT                   /note="AT_rich"
FT   gene            570564..573872
FT                   /db_xref="GeneID:3662385"
FT                   /locus_tag="Tb10.70.5520"
FT   mRNA            <570564..>573872
FT                   /db_xref="GI:71746841"
FT                   /db_xref="GeneID:3662385"
FT                   /locus_tag="Tb10.70.5520"
FT                   /transcript_id="XM_817383.1"
FT                   /product="PIWI-like protein 1"
FT   CDS_pept        570564..573872
FT                   /locus_tag="Tb10.70.5520"
FT                   /gene_family="HOG000257098" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PIWI-like protein 1"
FT                   /db_xref="GI:71746842"
FT                   /db_xref="GeneID:3662385"
FT                   /translation="MMRRTLRCMIPAASSSSTSIAAIRRRQQQQRHHSQGQTNWRCAPT
FT                   FNESNVLTETNASAAVRSGSSKSLWLCEARQVTLSDVKRDYISKRLLDKKTRFVVRQRL
FT                   REGGATSNFFPLLFSQPIVLYSYEIEATRRPLHALKAPSGEEVPPQCSGGKTGKTRKGK
FT                   SKITAPEKISSVPVRRVECSRAWRAVQRYLRRCLPNAPPLVNLRQQIYTTAPLPVVALQ
FT                   LPPECLDLGWVECKLHFRGKTKLTEMDSAEMQETVNKIVLWALRNGGSNQKGHQFCVAR
FT                   EANGKVVHIHDAVSVDGLRVFKGTLIRATFVSSGDDAEDVPSPAVVLPPSTAVLKTLAA
FT                   GDYGAKKLRFVVEEFVRGFVFKERNVHSYKIADASGTTQASLWDATEETKLKVGCIYEV
FT                   TDYRVRVFESHNGMRLVEMTVGKTGFNVVMSQQDEVTTGEEADDNGKAKSKESRKDVKK
FT                   LRSKCGKEASAGEERKHQHQQIEKDEAKRTMKNTSDCGSLPHCTGKLTLKIDTKCTVAT
FT                   ELSLWEEVKQHFGRGPYDPAMEERIARSVQGTPVVISTTLRHSIVRLVRFNMVATEVNL
FT                   EPTLQHLIRELEPGQPYAVLVDYSVVPLQALHCCYDPRTRSWQDTSVTACSFMPSQRLE
FT                   ILELFRAKLESAMQPWGITVAPKPLLSKALSLLPAPQKVSPFAKKQTNDTSIVNDNSNG
FT                   RLRSVAPSGSVPLRHPPPPSSPTTTAVVGIIASHASEEESSRVKQTTQAIGRYCRSTTV
FT                   ITVPDEQEAVRYLVQQLISAGTEELRDPNTAAVIVTNERETRLVRWMQAECLTRGILPL
FT                   FVPPCASPKQQQLRCENIRLRLRTVFATDPLRGVDLQREVPAVAQRRVLLVGVDSCHTP
FT                   TVSTGSVVGILCTAERNHLLPFFWKHERRGQEVELVSEHFEVLISRAMELYDGLDDVVV
FT                   FQDGDVYSEMSAMQAHLPVGCGFTFACLHKRSDVRFVHEFRGEANTSGSKVAAGNVVKG
FT                   TVVQALTIQRASEDPLLGNAVNSFYLQNHDCETSTARTVQYTLYCTSPTLDVSDVQQLS
FT                   HVLAHAMATRATKLPMPTRCAHRLASIVERLIDAVPPLQCSMIPKPLNERLWFF"
FT                   /protein_id="XP_822476.1"
FT   repeat_region   574503..574523
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    574767..574788
FT                   /note="AT_rich"
FT   gene            575089..576891
FT                   /db_xref="GeneID:3663046"
FT                   /locus_tag="Tb10.70.5510"
FT   mRNA            <575089..>576891
FT                   /db_xref="GI:71746843"
FT                   /db_xref="GeneID:3663046"
FT                   /locus_tag="Tb10.70.5510"
FT                   /transcript_id="XM_817384.1"
FT                   /product="adrenodoxin reductase"
FT   CDS_pept        575089..576891
FT                   /locus_tag="Tb10.70.5510"
FT                   /gene_family="HOG000257099" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adrenodoxin reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: ferredoxin-NADP+ reductase activity [goid
FT                   0004324]; go_process: electron transport [goid 0006118]"
FT                   /db_xref="GI:71746844"
FT                   /db_xref="GeneID:3663046"
FT                   /translation="MLLRRSHMRRCLKPGVPRHPPLSCASASPLQHTDVTSAPMKTQIA
FT                   VVGSGPSGCYVAQQLIKKRDDIHVDVFERLPVPFGLCRYGVAPDHPEVKNVEQQFLSMF
FT                   KSGRVTWIGNVDVGRQLPIDTLLNNYAAVVLATGVDSGKKLNIPGEDLGGVVRAADFVR
FT                   YYNTYPFPHGSPRFCPFQLGMAHEAVVIGNGNVALDCTRVLAASYKYFCPTDMNCAAIK
FT                   EFMKNHIHRIHVVGRRGPEHSAFTIAEFRELTKYQQDTVRVTVDAFNPEEARRASTENP
FT                   RARQRLFELMGRHIVKSDDPESQEVRGPTIPKGTRGPCHIRFRYNMRPLRFLPHRERKG
FT                   QVGAVVFECTAAETSSSTDCAAATETQAYDANCGEGGNKGGGTGVKAPKVITVPCDLVI
FT                   TSLGYYGDSIPGVEFDHARGVISHVGGRVKGQPRLYCAGWAKNGPKGIIAHALMDAQVT
FT                   AATVLEDLDNSALPTGGSDGAFCGKYGLVDYFVEKRMEPVSVAGLERIMHVELERGVDM
FT                   GKRLEKIDDVRAMLDVALGGAVGKKANNAIRGIMNERPDALLYLNELLDDTTDLAPLAR
FT                   QLARDLPPVMAEQHPPGRLHPSQL"
FT                   /protein_id="XP_822477.1"
FT   gene            577452..579218
FT                   /db_xref="GeneID:3663047"
FT                   /locus_tag="Tb10.70.5500"
FT   mRNA            <577452..>579218
FT                   /db_xref="GI:71746845"
FT                   /db_xref="GeneID:3663047"
FT                   /locus_tag="Tb10.70.5500"
FT                   /transcript_id="XM_817385.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        577452..579218
FT                   /locus_tag="Tb10.70.5500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746846"
FT                   /db_xref="GeneID:3663047"
FT                   /translation="MSITQSALGREWGVVACGFLVTYYREFTKEGEPLALLDMYADNSH
FT                   VVYAEYNENVAQIVRGRHEILQHLEKMDAALGRRKVEVRFADFSPIAGGSVLIVTQGIM
FT                   YVRGSRKVFTQSFVLAPTPNRSNTYHIASEYFRVLHVEMERIPEGSIIMTPVQVAQHLL
FT                   GEQERRKREEEAREHFLFLQKQKEEQQQQQQQMLQCADAEMVKQQENDRALAAENQSEA
FT                   WDKHPRGQDRRMGRKDYRNRAPAGARSEGVEERKERAEWEMGKPTESRTNEAEDDTAGE
FT                   GNERNRWEQPRRSEPHKRPERVKRNEGGRRAEGNDQNEVGRPERKDRRDAEREPRDGES
FT                   RRGHWGRNEEKVDNVDTADNTRVTEGDAARSTGAAGAASERTRRNTFNNRPRDRFRNRE
FT                   LQQEQQPAAPADSAAAVPATSSAADNKGDAGRNDHKPLPRSEANRRGPGGSKEAKNNKK
FT                   EAWASEKNDANNGGAAPDAAAAEENVTPAEQRKKFPRSRADKKIAGEGTRLEHRKGPTD
FT                   HVRLIDAPKGQNEQISAAIKRITGEEPKKVVPFGRGNDIVCQLSTESAAEALLEKPPVV
FT                   NECALRVARFYP"
FT                   /protein_id="XP_822478.1"
FT   misc_feature    580478..580522
FT                   /note="AT_rich"
FT   misc_feature    580615..580700
FT                   /note="GA-rich"
FT   repeat_region   580994..581017
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caaag"
FT                   /rpt_type="tandem"
FT   gene            581199..582098
FT                   /db_xref="GeneID:3663048"
FT                   /locus_tag="Tb10.70.5480"
FT   mRNA            <581199..>582098
FT                   /db_xref="GI:71746847"
FT                   /db_xref="GeneID:3663048"
FT                   /locus_tag="Tb10.70.5480"
FT                   /transcript_id="XM_817386.1"
FT                   /product="ubiquitin-conjugating enzyme variant Kua
FT                   homologue"
FT   CDS_pept        581199..582098
FT                   /locus_tag="Tb10.70.5480"
FT                   /gene_family="HOG000257103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ubiquitin-conjugating enzyme variant Kua
FT                   homologue"
FT                   /db_xref="GI:71746848"
FT                   /db_xref="GeneID:3663048"
FT                   /translation="MSIDVVPATETAAAATTTATYMDNIISVRKANAKKLAGGYTQTKR
FT                   IAEICYFSLAVCLWMRNVAIVVLYLLHSSESSSNQLLWSPLMILSAMVLSDFISGVAHW
FT                   SFDTWGTPETFLFGNFIRSFREHHVNQMAMTKHDFIETNADTTLPLIPVLLIQLYFLGC
FT                   NSKNNSTFRYNIDNDNAGFHVFFLTFALFIGMTNELHKWAHLPAPHPFARLLMSCRIVL
FT                   TRKSHRRHHRGSYDRSYCITTGWLNAPLDRVDFWRKAEAVVTALTGAVPRANDRELLGV
FT                   RHKEETDGEGCNEEFGGL"
FT                   /protein_id="XP_822479.1"
FT   repeat_region   582308..582388
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   582572..582595
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    583069..583153
FT                   /note="GA-rich"
FT   gene            583859..586213
FT                   /db_xref="GeneID:3663049"
FT                   /locus_tag="Tb10.70.5470"
FT   mRNA            <583859..>586213
FT                   /db_xref="GI:71746849"
FT                   /db_xref="GeneID:3663049"
FT                   /locus_tag="Tb10.70.5470"
FT                   /transcript_id="XM_817387.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        583859..586213
FT                   /locus_tag="Tb10.70.5470"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746850"
FT                   /db_xref="GeneID:3663049"
FT                   /translation="MSSREPTAANVEATEVCVVVSHAARKFQITLPAATATVGDIKNRI
FT                   EQSTGVPVERQRLLFGAHTLKQYRNGDIENVRLIDIVVKPSGRANEKGIKAPAGTNDNP
FT                   KEGRDDNSSSGNGTVTLTSGSVITLPVMLLGTAASAPHVDEEVTAQLHRLVTTTLEHDS
FT                   RWFRCSYGKGYARQTAFVCRTCVDSGAADPSHAICYACAEVCHTGHDVEEWGVRYFMRC
FT                   DCCTPVCWRDIKVNGSKEEWDKKAVNDHSSEGNRGQGDENSKMSRGVLPLIRKAEETRQ
FT                   LKRCCFILDSETSEPPVSREAVPLNGRNIYPRSSYAWCFCCCEDDYPPDGTNESAGVVC
FT                   MLCATCFWSAHITRLHTGMLNRLPCHGNLVEGDVVAFYCETCKGVVCGPCRLRCHADHE
FT                   VQKDVVVAPYEQHGKGAVANSRDHTFKCECGCFSSDKSAGDDGLNDRNASLLPPNTAVD
FT                   IMNSDSLIGFICAYCMQEHPWLADRDYRYCYGGKLPDPVPKEQHKPIVSCNFPPDAECP
FT                   DDRYPFHGMLFSVDAFTEKMTCKCAPCRQAYERFAPRTTTTAQDEMAVELHEACDHCGR
FT                   NIRDENAFMCQTCELCCGKAFFVCRRCNSLRLGLNLPTPSSTNDESVHGNTQEGNTVSS
FT                   TEQEDEPASWDHPSDHVFLEDTCENLFNLCGMCVAHHLGPQAEDLSSMDAESIAGTVMT
FT                   VLQRTFGEAPLTFDPKDIAQHHQLLQQQKKKPNASANTQSSSNERTGRRVSPASIAKGC
FT                   KRPRIEESEDDSDVRNGVSSGSGAHDGDDQI"
FT                   /protein_id="XP_822480.1"
FT   gene            586981..589782
FT                   /db_xref="GeneID:3663050"
FT                   /locus_tag="Tb10.70.5460"
FT   mRNA            <586981..>589782
FT                   /db_xref="GI:71746851"
FT                   /db_xref="GeneID:3663050"
FT                   /locus_tag="Tb10.70.5460"
FT                   /transcript_id="XM_817388.1"
FT                   /product="vacuolar protein sorting-associated protein 35"
FT   CDS_pept        586981..589782
FT                   /locus_tag="Tb10.70.5460"
FT                   /gene_family="HOG000257106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar protein sorting-associated protein 35"
FT                   /note="go_component: cytoplasm [goid 0005737];
FT                   go_component: membrane [goid 0016020]; go_process:
FT                   retrograde transport, endosome to Golgi [goid 0042147]"
FT                   /db_xref="GI:71746852"
FT                   /db_xref="GeneID:3663050"
FT                   /translation="MYGHVVVEEPPTVLSLQGPLLTPQQEQEKWLCDSLETVKEVEAEM
FT                   KLYIRRREQRNVWNAAAKMLAEMRTDVLAPQYYYELYLKVFDVLQVLHQFVEDEYREGC
FT                   SLEEMYDVVQHTGSIVPRLYLLITVGSVAIKSGEQPAVEIMRDLVEMCKGVQHPTRGMF
FT                   LRHYLLTVTKNRLPGEGGYTGSKSTEGGGGTVDETIELLLQNFKEMNWLWIRMDLKGQQ
FT                   RTGDQQRTQQRARRDRKELCVLVGMNIVRLAQLDGVERETYQTSILPRLLQIIVGYRES
FT                   LAQQYLFEVVVQVFPDEFHLFSLEQLLAALGQLQSKVDVSAILSALLQRLGKYAELMNE
FT                   GVAEAGSSTEKELLMTMFDTVKTRLDDMADATKTALQALHGGDVNTQGKDGVEGVSILS
FT                   GKSKHPYMLTFFSYIKSMYSLAELALKVNPATAPQNIGLIFTGIANRLPPALEQNIMLG
FT                   VGRLIIRVIECLKDPSVVLDLEGIDVLVQPLCASTRRSIALALCTACLHSPSYRISTIK
FT                   LAARLFELIAPLVYDEGDVAGGSNQPEKPVQEGTTFTGETQIDEKSAEEQQLVCRVLHL
FT                   LQCDDVGIQAKIMNGVRKQLTKGGPQRIVATLPTLLSMYMQLALRVMKGATVTLDPDTA
FT                   EAGEEERGSGGEGKPTENVEKTKSVTTFDMEEARALCSKIFHFVHSGDGKGVLEVLAGE
FT                   APQQAFYLYLSSAATADVCELSEVIYEHFVSAFQIYEQSGVDMSEQIAMVGYAVAQLHA
FT                   LHSLPEETYELLATKVCQYSSKLLRKSDQSRLVALCAHLFWKKDLSQDSNNRIVECLQR
FT                   ALKIANHAASQQSKQQQQLFVELLNLFLHYYAGRAPGVTARHVTGLLDLAQDSLTKLKQ
FT                   QDDGEDNENEDEKDRSVKGETSEEVRRYYDNTIQYIRTRQEVDERWKEIGMTEGEGEAA
FT                   DNE"
FT                   /protein_id="XP_822481.1"
FT   gene            591366..592889
FT                   /db_xref="GeneID:3663051"
FT                   /locus_tag="Tb10.70.5450"
FT   mRNA            <591366..>592889
FT                   /db_xref="GI:71746853"
FT                   /db_xref="GeneID:3663051"
FT                   /locus_tag="Tb10.70.5450"
FT                   /transcript_id="XM_817389.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        591366..592889
FT                   /locus_tag="Tb10.70.5450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746854"
FT                   /db_xref="GeneID:3663051"
FT                   /translation="MESLIKNIQSDLDLVRGALARAAFNQNPTSASKEGIGGESQEDAK
FT                   SCQRSPQRGGDTVLVQPVDDREPEALAVASAAELSALREQVAALSAVELQRSKLEAQLA
FT                   ARDAALRHYTQSHLALSTKEQKQRRELEQTASTLKEAEAELVMWRERHQRLQREVQVLQ
FT                   HELEALAAQCDRLQSSVLELRELSRRAIDDNNALRKEKRELREECETLQSVRAALNDSV
FT                   AREEALTQELQALRDASTESEAYFKAAVAEVEARRQYWAAVQGQHESLLEALALTQKTA
FT                   QMWEDRFASECTPKVFGVNEVPADLPVDDFERPKEELLISTTEDGGSQREVNKGGDEAV
FT                   DRESASLVAALEAKVVDLALHLQEQRAEAEAAKDAYNTLAAVVERESCDLLELRRKLAA
FT                   QRPECMNLIDTNTRLQAALLARESYVEALQDFVVAILDDLTGLTFHCYELEVQLAISGA
FT                   ATPVTVSGDGREPVARRSTALNLIQSKQQRCQESWRITVPRGKRGSKGI"
FT                   /protein_id="XP_822482.1"
FT   gene            593667..594917
FT                   /db_xref="GeneID:3662844"
FT                   /locus_tag="Tb10.70.5440"
FT   mRNA            <593667..>594917
FT                   /db_xref="GI:71746855"
FT                   /db_xref="GeneID:3662844"
FT                   /locus_tag="Tb10.70.5440"
FT                   /transcript_id="XM_817390.1"
FT                   /product="chaperone protein DnaJ"
FT   CDS_pept        593667..594917
FT                   /locus_tag="Tb10.70.5440"
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chaperone protein DnaJ"
FT                   /note="similar to SP:Q9QYJ0: DnaJ homolog subfamily A
FT                   member 2 (mDj3). {Mus musculus;}; go_function: unfolded
FT                   protein binding [goid 0051082]; go_function: chaperone
FT                   binding [goid 0051087]; go_process: protein folding [goid
FT                   0006457]"
FT                   /db_xref="GI:71746856"
FT                   /db_xref="GeneID:3662844"
FT                   /translation="MVKETEYYELLGVAVDATENDIKRAYRRLALRYHPDKNPDNAEAA
FT                   EMFKQISHAYEVLSDEDKRKLYDQHGKDGLSGGGDEGEFDASDIFSMFFGGGRRQRGER
FT                   KPRDLVHELAVSLEDMYNGRVKRVAVTRDRLCSQCDGSGVRPGAQQQMCEACNGQGIQV
FT                   LVQHIIPGVRQQVQLTCQNCGGCGKYVRESDVCRRCHGKQMVRDEKVLEVPIERGMKAD
FT                   DAIRFEGEGDEVLGVRLKGDVLIILAEKPHDVFRRVGDHLIMNYRITLQEALCGFELPV
FT                   QHLDKRMLLIKIPAGQVIDPEAGWVVHREGMPLPNTGGIERGNLIIHFEVEYPTKLSSR
FT                   QIDLIADAFHVSEGFPHVGGQKVVLRDETARRQRRNTASARQAQQRRSRDTRGFDNPDV
FT                   FSMGFGGGQTAHQCTQQ"
FT                   /protein_id="XP_822483.1"
FT   repeat_region   595857..595906
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            596141..596719
FT                   /db_xref="GeneID:3662845"
FT                   /locus_tag="Tb10.70.5430"
FT   mRNA            <596141..>596719
FT                   /db_xref="GI:71746857"
FT                   /db_xref="GeneID:3662845"
FT                   /locus_tag="Tb10.70.5430"
FT                   /transcript_id="XM_817391.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        596141..596719
FT                   /locus_tag="Tb10.70.5430"
FT                   /gene_family="HOG000257108" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746858"
FT                   /db_xref="GeneID:3662845"
FT                   /translation="MFSRHSLWVPAASHFPKFVEHFNRFLKASPHNVELQKALCYKEEE
FT                   TQLLIIQDPKARQPIFAMAFPFTVTSALCDGSRMGLGTFTSLVDTTTSLHVAAALLPTN
FT                   DMHVSVSLQTNCVQPITAGEKVVMISRMDKFGKRLAFLSARLLRLDDVYENTVAPTAGR
FT                   ELEELERQLSQYQTLANGTHVKCILTGKS"
FT                   /protein_id="XP_822484.1"
FT   gene            597069..598514
FT                   /db_xref="GeneID:3662846"
FT                   /locus_tag="Tb10.70.5420"
FT   mRNA            <597069..>598514
FT                   /db_xref="GI:71746859"
FT                   /db_xref="GeneID:3662846"
FT                   /locus_tag="Tb10.70.5420"
FT                   /transcript_id="XM_817392.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        597069..598514
FT                   /locus_tag="Tb10.70.5420"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746860"
FT                   /db_xref="GeneID:3662846"
FT                   /translation="MNRNAAQSMTNVVHATDVLGSALTAIDAIVADAQQHQRKKEQREG
FT                   TGPALAGIKRQRGGEVFAVMAEPHFRALQTIVLLYGVQLMPSLDAIMRRVLICVTSPVL
FT                   VSSDCWELAAMLGTYFRAGAARLLEEVLALLLAERSPFLLGSPCVVVDVVASQGLPANT
FT                   NGSTDISGKDRNAVDQEKVYDGSSTQRNLRAFDDLLVALGPFLPSSTMQQVALRYAEEV
FT                   VVNGMLNAQASAGCSTGQLASYQERQQQQVEPQQTSVEAVLRPQCVSLLTTLLTLCRPL
FT                   PSNTAACAVRAVKELPMRSFSLYGGVEHHQLLRSVMRLSVTLTALRHPYAIPFYVPPRD
FT                   VVERPTRRVTMEEGSDGHKVESAQVYPNNEKMPAVGLPIPISGGIKGNDGHSKRREEEG
FT                   NIKAAYQSTTPMESKTVATPQRQPQQFEGTAEKYCESSVSPAVSQKQKPQAEPTASQAP
FT                   LTLTVSADDDDDDVEIPEIDMED"
FT                   /protein_id="XP_822485.1"
FT   gene            598941..600086
FT                   /db_xref="GeneID:3662847"
FT                   /locus_tag="Tb10.70.5410"
FT   mRNA            <598941..>600086
FT                   /db_xref="GI:71746861"
FT                   /db_xref="GeneID:3662847"
FT                   /locus_tag="Tb10.70.5410"
FT                   /transcript_id="XM_817393.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        598941..600086
FT                   /locus_tag="Tb10.70.5410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746862"
FT                   /db_xref="GeneID:3662847"
FT                   /translation="MMALELLAQQYLPISPRHLSLLTLDGGSPAAVVAVSPAYDNFNRV
FT                   FFLEWDYPTETGNFRLIHTEMPGVGVNALSLMLSQDGVVHCVVQCASKGKEESPKTYLL
FT                   RRTEDAGNSDSDTSDNGNEEDTAVKYKILPKVMEDDSRSWTVATRLYRGNGGVRDSNNS
FT                   SRVVAACGGERGEPNALKMMYLSGTRLSVQQSVELPVLSTFPLLRLCEIDGDVSSLLAL
FT                   CHHAVLEIDPRLKQQESVVRAWKWTPRDPLTAFAVKDNSIVAGTEDGVLVLWDLRFAAV
FT                   HEKGSKAVDHSVSCGAPITGLHMPHSSSVLSCQADGAVLTWERCSTSSINNINEACFVP
FT                   RRIPALPPTFVGTPGCVGMAAEDNIAVVADESGVLSIFSMS"
FT                   /protein_id="XP_822486.1"
FT   gene            600529..601359
FT                   /db_xref="GeneID:3662848"
FT                   /locus_tag="Tb10.70.5400"
FT   mRNA            <600529..>601359
FT                   /db_xref="GI:71746863"
FT                   /db_xref="GeneID:3662848"
FT                   /locus_tag="Tb10.70.5400"
FT                   /transcript_id="XM_817394.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        600529..601359
FT                   /locus_tag="Tb10.70.5400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746864"
FT                   /db_xref="GeneID:3662848"
FT                   /translation="MENKDVATSWDYNSAEIGEFVPNSCTGTHFPNGIACAPWFQQQVT
FT                   SQPHLCSSEFASSVESVGGPACRVGSEGSDYCFMNKSVCRNEEEGAEEVEGNEGESNLR
FT                   WGMHIHPAALRAVQASSREVVQGLIRDKELLCSQFGTMQQNIPLAITWHDTTAPSPNQT
FT                   LASTFTPLPHKKRSRDLVTLLSGISPDWEAAEEVGGASAAAHVGGLEIQRKRFRVDNPT
FT                   IGSAAYEVSKAATAASPKPWIKARQKRVREEGDEDVNVNVEWGRGRDGNENSGR"
FT                   /protein_id="XP_822487.1"
FT   repeat_region   601519..601547
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   602124..602144
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            602691..602984
FT                   /db_xref="GeneID:3662849"
FT                   /locus_tag="Tb10.70.5385"
FT   mRNA            <602691..>602984
FT                   /db_xref="GI:71746865"
FT                   /db_xref="GeneID:3662849"
FT                   /locus_tag="Tb10.70.5385"
FT                   /transcript_id="XM_817395.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        602691..602984
FT                   /locus_tag="Tb10.70.5385"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746866"
FT                   /db_xref="GeneID:3662849"
FT                   /translation="MSKQELQLTDAVSEQDRLLGELHNSVLNTRQYALAIGEDLEEQNT
FT                   MLDDLQTDVERATDESRRQNYNVGQLLWESESRGFWTLFIVLSLILVVLLIL"
FT                   /protein_id="XP_822488.1"
FT   repeat_region   603031..603062
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   603172..603206
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   603300..603321
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   repeat_region   603589..603623
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   misc_feature    603821..603852
FT                   /note="AT_rich"
FT   gene            604043..604825
FT                   /db_xref="GeneID:3662151"
FT                   /locus_tag="Tb10.70.5380"
FT   mRNA            <604043..>604825
FT                   /db_xref="GI:71746867"
FT                   /db_xref="GeneID:3662151"
FT                   /locus_tag="Tb10.70.5380"
FT                   /transcript_id="XM_817396.1"
FT                   /product="dihydrolipoamide acetyltransferase"
FT   CDS_pept        604043..604825
FT                   /locus_tag="Tb10.70.5380"
FT                   /gene_family="HOG000257114" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydrolipoamide acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="go_component: pyruvate dehydrogenase complex [goid
FT                   0045254]; go_function: dihydrolipoyllysine-residue
FT                   acetyltransferase activity [goid 0004742]; go_function:
FT                   biotin binding [goid 0009374]; go_process: generation of
FT                   precursor metabolites and energy [goid 0006091]"
FT                   /db_xref="GI:71746868"
FT                   /db_xref="GeneID:3662151"
FT                   /translation="MRRSLAFLVNFSPIYMPALSPSMDSGIIVEWKKKVGDLVKENDVF
FT                   CTIQTDKAVVDFTNTFDAGYLGKIFRQNGETVAVASTIAAMVEESQDVAKLADYTLKDV
FT                   EPGNVDEEAVAAPVSTTTTTTKTPKPAGGKIRYGGSLDEAVAASGPGVMRIAARLDKAA
FT                   LEAITPTGRGGRFTKADFVGQPGFDYEKAAPAPKGSSSSFTNASRECCAENTNGAVGSS
FT                   AVVKSFPVYNFKVSDTTLLQQLLNSMPTPKAKGAAVGK"
FT                   /protein_id="XP_822489.1"
FT   repeat_region   604398..604422
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   misc_feature    605134..605182
FT                   /note="AT_rich"
FT   gene            605241..605810
FT                   /db_xref="GeneID:3662152"
FT                   /locus_tag="Tb10.70.5370"
FT   mRNA            <605241..>605810
FT                   /db_xref="GI:71746869"
FT                   /db_xref="GeneID:3662152"
FT                   /locus_tag="Tb10.70.5370"
FT                   /transcript_id="XM_817397.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        605241..605810
FT                   /locus_tag="Tb10.70.5370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746870"
FT                   /db_xref="GeneID:3662152"
FT                   /translation="MYFGFAHLPMSASLWLSLFPHIHSPSTYKWKEEGKRKKKERNTVN
FT                   VAEMQNEYSPPHHHQEEEKRKRKKEKASELGDERRCKYPTSRVESSKRYNIFAPCWLFA
FT                   QRLPSFSVPCDHVFLFRLLREFISFFFVCVCFIYKFLYVSTRRATSHTVTSGGWGGNCK
FT                   GMCVRGGVWEIKRKSKKKGKRLHHIK"
FT                   /protein_id="XP_822490.1"
FT   misc_feature    605852..605904
FT                   /note="GA-rich"
FT   repeat_region   605936..605980
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            606492..607499
FT                   /db_xref="GeneID:3662153"
FT                   /locus_tag="Tb10.70.5360"
FT   mRNA            <606492..>607499
FT                   /db_xref="GI:71746871"
FT                   /db_xref="GeneID:3662153"
FT                   /locus_tag="Tb10.70.5360"
FT                   /transcript_id="XM_817398.1"
FT                   /product="La protein"
FT   CDS_pept        606492..607499
FT                   /locus_tag="Tb10.70.5360"
FT                   /gene_family="HOG000257112" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="La protein"
FT                   /note="similar to La protein homolog (La ribonucleoprotein)
FT                   (La autoantigen homolog). (Swiss- Prot:P40796) (Drosophila
FT                   melanogaster); go_function: RNA binding [goid 0003723];
FT                   go_process: RNA processing [goid 0006396]"
FT                   /db_xref="GI:71746872"
FT                   /db_xref="GeneID:3662153"
FT                   /translation="MPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLE
FT                   TLLTFKRVNSVTTDVKEVVEAIRPSEKLVLSEDGLMVRRRDPLPESIQTDHQTVYVKPV
FT                   PPTATLEQLTEFFSKHGTVQAVWRRYFAGKKDAPPESRTKPSVFVVFNSSEEAEAFQKA
FT                   PPMYDDVQLTAEMKTTYLERKAEEIAAKKSSKTKNGGATDRAEKKTPPMPLGSSYRVSG
FT                   CGEMESFATVKNLWPVEEQKGIRYVFMPDKESALLIFQDTQTGEKMVADLKSRGTTLNG
FT                   KQPDIKKLEGDDEQKLLENVEKEIVDRAMQSANNRSGRGGRGGRGGRGHKRSRE"
FT                   /protein_id="XP_822491.1"
FT   gene            608113..611286
FT                   /db_xref="GeneID:3662154"
FT                   /locus_tag="Tb10.70.5350"
FT   mRNA            <608113..>611286
FT                   /db_xref="GI:71746873"
FT                   /db_xref="GeneID:3662154"
FT                   /locus_tag="Tb10.70.5350"
FT                   /transcript_id="XM_817399.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        608113..611286
FT                   /locus_tag="Tb10.70.5350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746874"
FT                   /db_xref="GeneID:3662154"
FT                   /translation="MPYFSAWAFCYHESVVSCRSLPIYWRYSSCTPPAHILATGSDNRR
FT                   VPTSASVRCLRECHTHFLLRLLTNAGFFRRFLYFLCPIRQRLITLAGRLLNTPVADLLR
FT                   SSVNIDFLCFLLFSTTHIITLMRAYTFPVYCNAEKITMTTEVSNDGMDIVNHMDIKVHG
FT                   IQNVPPSWWSDGKHPTYPEHPFRYEVSFTIDGNQTFTLANGRLLQYLPQYRDYIENAAL
FT                   PPLSSTAKDVLRQMHEVPEAPTKGKSISTTKTTGNSQAVEDDAQPEARIIWITPPTSER
FT                   APTPSEELLGKRRKKTAGNSVGEDLTPVAVPEDDDTPPCMIRMPLDERHIMALEGMMLS
FT                   GRPLELKFTRVLRPGLPTEWEDKQEWYFRAIIPVDLAPLSDPGSRELSADIQLQPVKAA
FT                   VRTEEVKKTSKRSKNMAQGLRHEEIDTEGEHPYVTCKTSAVVSIELEKTLVQLPKDRIR
FT                   PAVLPTNLIPKRPPPRKEFRDSTRQFSDMVASIAERMMHDCAALQDADSERKEEEILEV
FT                   FENSGRLESYKEQLLPLVVNVVREKFLSDKDASPDVISRLTNELYVHLLNSIHCTLHNM
FT                   VEGMSTPEQENANRVATAKPSTASPQGPDDGIDYVWLERAEEAETIRDYARATRCHQAR
FT                   IASCACAESFPDVWYDAASYFVRIGETTRAEQCFREAISHDPTHAPSLMAYGALLLTFD
FT                   RFDEATVYLQAAVDAKPSSLSWGLISLLCDMHVLNLERGPRYESQRAHWEHEGTIAMRE
FT                   ALSFSTDVDHTSVSKEVADYLLKLQHPGLANISLTRCSRGGHTEVLYARLFALGEQYNE
FT                   ALETLKNGEGLEPYIEEVTILRGDCYAALGRSDEAIREYKSVLCAKDKEPRRRFGPSYI
FT                   HLGNLLITAGCYNDALGAFTIGIQAWPCSLTWLGAGIAYYRLNKIDAAEECLSESNTLN
FT                   NTNPRTWAYLSLVCLRKERVELKTVLRQAIMQGLADPGLLTELGRDLVRACMGELGESC
FT                   LRKALAVERECGREDSAVCCTAMYYLAGAVEGNNAEEAWMLYTAVANKTMDEVLRAKAE
FT                   EQLAALGKS"
FT                   /protein_id="XP_822492.1"
FT   repeat_region   611489..611527
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="a"
FT                   /rpt_type="tandem"
FT   misc_feature    611806..611831
FT                   /note="AT_rich"
FT   misc_feature    612229..612250
FT                   /note="AT_rich"
FT   misc_feature    612551..612578
FT                   /note="AT_rich"
FT   repeat_region   612700..612756
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            612827..613966
FT                   /db_xref="GeneID:3662994"
FT                   /locus_tag="Tb10.70.5340"
FT   mRNA            <612827..>613966
FT                   /db_xref="GI:71746875"
FT                   /db_xref="GeneID:3662994"
FT                   /locus_tag="Tb10.70.5340"
FT                   /transcript_id="XM_817400.1"
FT                   /product="protein kinase"
FT   CDS_pept        612827..613966
FT                   /locus_tag="Tb10.70.5340"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="curated by M. Parsons, P. Ward, J. Mottram;
FT                   go_function: protein serine/threonine kinase activity [goid
FT                   0004674]; go_function: ATP binding [goid 0005524];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71746876"
FT                   /db_xref="GeneID:3662994"
FT                   /translation="MTDVSLRPLTTHKSHRHSHNTGVLECQTILQGRFRLNGLLGKGGF
FT                   GEVYAGVTVSTGEEVAVKIAPNRKRHVLAHEADVMRSIQSAVGNADPPGIPTLKFFGHD
FT                   GDNTILVMSVHGPSLEKLRSEMGRLSLKTVVMLGMEMIDRIQFFHSTGFIHRDIKPGNF
FT                   LMGVGKHAHEVYLIDFGLSTRHSHSGAWHRGRPTASKFVGTSWFASLRTHQGYAQSRRD
FT                   DLEQLVYSLIYLHRGKLPWTELRHTDRTERTRAIAAAKENLSTAQICVCCPPQFEVLLT
FT                   YVQKLKFDEIPRYEMCRNIIWSILHPSSAGPKPSLTYEWLTPERECETPKCVFPALRGS
FT                   ETKHGTKNDEVARNDSEAKKSLRRRMPTASSTSHTAGKG"
FT                   /protein_id="XP_822493.1"
FT   repeat_region   614073..614101
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttc"
FT                   /rpt_type="tandem"
FT   repeat_region   614193..614252
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    614509..614545
FT                   /note="AT_rich"
FT   misc_feature    614546..614606
FT                   /note="GA-rich"
FT   misc_feature    614752..614786
FT                   /note="AT_rich"
FT   repeat_region   614850..614870
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    615004..615063
FT                   /note="A-rich"
FT   repeat_region   615201..615227
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    615405..615428
FT                   /note="AT_rich"
FT   repeat_region   615452..615480
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    615620..615645
FT                   /note="AT_rich"
FT   repeat_region   616633..617049
FT                   /rpt_family="ingi"
FT   repeat_region   616633..616881
FT                   /rpt_family="RIME-A"
FT   gene            complement(618652..619197)
FT                   /db_xref="GeneID:3662995"
FT                   /locus_tag="Tb10.70.5300"
FT   mRNA            complement(<618652..>619197)
FT                   /db_xref="GI:71746877"
FT                   /db_xref="GeneID:3662995"
FT                   /locus_tag="Tb10.70.5300"
FT                   /transcript_id="XM_817401.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(618652..619197)
FT                   /locus_tag="Tb10.70.5300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746878"
FT                   /db_xref="GeneID:3662995"
FT                   /translation="MTISTPVGIFEYKFLLFLPNFHLWVPELCFTAVVLHSNATNVHIK
FT                   MCMCVRKGCTRNKKKKTGGTGESYIVTLLFFKLRIVHLLLFIPPLQNFFLLLKMVVAAI
FT                   ATGFALFLLTFCLTVLLEKFVPQCVPPFPPLSPPSIGFWRFLMFVRTPSRKTRSLANAA
FT                   EPLHPLLWIPSVAQPFLG"
FT                   /protein_id="XP_822494.1"
FT   misc_feature    619307..619329
FT                   /note="AT_rich"
FT   gene            complement(619946..621721)
FT                   /db_xref="GeneID:3662896"
FT                   /locus_tag="Tb10.70.5290"
FT   mRNA            complement(<619946..>621721)
FT                   /db_xref="GI:71746879"
FT                   /db_xref="GeneID:3662896"
FT                   /locus_tag="Tb10.70.5290"
FT                   /transcript_id="XM_817402.1"
FT                   /product="major surface protease GP63"
FT   CDS_pept        complement(619946..621721)
FT                   /locus_tag="Tb10.70.5290"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="major surface protease GP63"
FT                   /note="identical to:GB:AAO72980.1: major surface
FT                   protease-like protein C {Trypanosoma brucei;}
FT                   PMID:12707278; go_component: membrane [goid 0016020];
FT                   go_function: metalloendopeptidase activity [goid 0004222];
FT                   go_process: proteolysis and peptidolysis [goid 0006508];
FT                   go_process: cell adhesion [goid 0007155]"
FT                   /db_xref="GI:71746880"
FT                   /db_xref="GeneID:3662896"
FT                   /translation="MTQLLGTAIFWCIFAAFVSHHLRAHVHVEASATHLEAPEEQWGEE
FT                   GTGDTPRGWCGSHHSAINPDDVPIVGTMPPESEAKGTTGGDLISARTASVDKKPKYTNN
FT                   VDDYGQGEIDSRWKPIRIRAYTQDLNDPSRFCTMAGDVRSILVSGKTTVCTAGDVLTVR
FT                   KKRVIVQVAIPKAIKLHTDRLLVRRYHRRIVLPSSYAGYCSLFKVPKGHYTNGFEGDVS
FT                   IYVAARPTIGNMAWASVCAMLTDGRPVSGVVNISPKYVAETDFFVRVIAHELGHALGFQ
FT                   ADILIRRGIMKQKGGIRGLKTSWLVDSEVAKRVARKHFNCSTAPGIEMENEGGPGVFAT
FT                   HLEQRNAVEDVMAPYGNLNYLTVMSLGVFASMGHYRVNFSRAEKTRWGLNRGCSFLQEK
FT                   CLQEGKSKHPDTFCDHLWKSRLFTCTHDRLGLGQCSLGTHRTELPAEFRYFRNSRVGGK
FT                   SRFMDHCPMVVQYNSGNCVNGQSKFLRGSEVGKGSRCVKGVNLKFSNKDIGDVCVRTNC
FT                   TGKELQIRFLLDHSWQTCKPGATVQPLGRHLWKGSIICPTREEVCFDDEDYKLRLTPLP
FT                   KLPTDDNAAVNPRQM"
FT                   /protein_id="XP_822495.1"
FT   repeat_region   623683..623726
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            complement(624104..627832)
FT                   /db_xref="GeneID:3662897"
FT                   /locus_tag="Tb10.70.5260"
FT   mRNA            complement(<624104..>627832)
FT                   /db_xref="GI:71746881"
FT                   /db_xref="GeneID:3662897"
FT                   /locus_tag="Tb10.70.5260"
FT                   /transcript_id="XM_817403.1"
FT                   /product="receptor-type adenylate cyclase GRESAG 4"
FT   CDS_pept        complement(624104..627832)
FT                   /locus_tag="Tb10.70.5260"
FT                   /gene_family="HOG000063251" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="receptor-type adenylate cyclase GRESAG 4"
FT                   /EC_number="4.6.1.1"
FT                   /note="go_component: integral to membrane [goid 0016021];
FT                   go_function: adenylate cyclase activity [goid 0004016];
FT                   go_process: intracellular signaling cascade [goid 0007242]"
FT                   /db_xref="GI:71746882"
FT                   /db_xref="GeneID:3662897"
FT                   /translation="MHESTVGRRAQQRRRFSTRPGTEGSVGTGSVGHLRIFPGVMLHLW
FT                   ILLSLCVPCSLAQGGHEVRMTVKVLSLMFNSAGATVDIINSLNVGFNASLAAQNWTVVP
FT                   GIDVTVIRPPSYNVSAAEYLENYVKNADDSESLLVVFGPMGEGNIRKSYKVLKEHNLVA
FT                   FAPLTELTESRKFLPNLYFLRPEPSAELVALIRYAVNHMRVLRLGFMYTESLAGAPSAH
FT                   SRATELMSQLGYELCCLFTVPNDVEETASGEAFEAEWEKFAQNLPQAAIMFTRINDYTK
FT                   QIVGRLVSDQRTATTVLLAPSLLQKSLVAVWRQALEASNVSFVPHRLIQTGTNPLAKTT
FT                   YFGAIRRFQNEARDYLTRHPEWSGLSDSNHFLTNDVDGELMVYGWIAGEVLMRALRSNT
FT                   KLGDRISFINSLYDQRRYVIDDLVIGDFGGECATGAAAQGAVCDCNRGGKKVFMKEVVK
FT                   GYHFQHVLPGIFSTSRDHCYSNAIQLHPPLSGVIMRMADNLTMLRAALEFYHGISSTAS
FT                   LLNVGELNRLIMLQVGSTTEQSMNDLVELRKNSIITAVFGVVVEEMLTVKNLTFIDPIV
FT                   MDPRLNKFRSNVIHLSPTLEQQLYVLVSYLSKNRQGPVHLAVYSREGAEIAEVLTRTLV
FT                   TFRANLSSSKIFRDVGELEKYLPAKGDVFLLGIGSGNIPIVKEYLRTHQDVRIFVQFSE
FT                   VMLMYDEFVGVFNGSAGAERVLFATNLPHWGDTDSKSKTVRKFHKVVKPPHRTPLALLG
FT                   FATERLMQRNIRRMEKVTSQLLVDLFFEEASITVDDMRYGTYDRESCLISGFAAAANCI
FT                   SNFGATNISVWSMARVMNSSVPVLQDPVTPQMFYVDPNANGLTAAQLAGAIAGSVLLFF
FT                   VLLFIAVPLYFATRSGRDNDNAPKELTAPVTIVFTDIEGSTAQWAAHPEQMPDAVATHH
FT                   RLIRSLIVQYRCYEVKTIGDSFMIACRSPLAAVQLACNLQRSFLLHNWRTTLFDQSYRQ
FT                   FEEQRAEVENDYVPPTAHLADEAYSQMWNGLRVRVGIHTGLCDIRHDEVTKGYDYYGRT
FT                   TNMAARTESVTNGGQVLLTRATYLAMSGMEREQFDVTALGALPLRGVPEPVEMYQLNTV
FT                   AGRQFAALRLDRDVDVLNDGTDGSVLSTSDHSSSRAELSESSQVIVTSLNALLGTFARA
FT                   QRQKALLPFCERWRVVLPRKPPAIWDDSYYQEVIRRIAVKVGHVVDYCASSGADHTFST
FT                   LTSASLIVITQPRGSSS"
FT                   /protein_id="XP_822496.1"
FT   repeat_region   629737..629762
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   gene            complement(629974..631035)
FT                   /db_xref="GeneID:3662898"
FT                   /locus_tag="Tb10.70.5250"
FT   mRNA            complement(<629974..>631035)
FT                   /db_xref="GI:71746883"
FT                   /db_xref="GeneID:3662898"
FT                   /locus_tag="Tb10.70.5250"
FT                   /transcript_id="XM_817404.1"
FT                   /product="metacaspase MCA4"
FT   CDS_pept        complement(629974..631035)
FT                   /locus_tag="Tb10.70.5250"
FT                   /gene_family="HOG000260670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metacaspase MCA4"
FT                   /note="curated by J. Mottram; go_component: nucleus [goid
FT                   0005634]; go_function: peptidase activity [goid 0008233];
FT                   go_process: proteolysis and peptidolysis [goid 0006508];
FT                   go_process: aerobic respiration [goid 0009060]"
FT                   /db_xref="GI:71746884"
FT                   /db_xref="GeneID:3662898"
FT                   /translation="MGGCVSTALKVGAETVAEGHIDLISFAINYFKNAVPYIVKYLGRQ
FT                   QRPKEVDMEATLTEAKESKGFQPWKISCQPKGAVRGLFIGVNYGNTEAQLSGCCNDIMM
FT                   MIGALQKRNFPLTEVVILADKEDVPGRTGEPTRANILRYLAWLAQDAQPNDVLFFHYSG
FT                   HGTRANARDDDCEEYDQCIVPMDYVENGCIVDNEIHEILVSQLPKGVRLTAVFDCSHSG
FT                   SMLDLPYAYVCDSSKDGSGSCGMKRVREDNDVQADVLMISACADDEAALGVDNTQDFYE
FT                   SGKDSGGAATFCLTAMMMREEPLTFLDLLVHTREMLKSRGFTQVPHLSASKPINLMQRF
FT                   SLEGLFPQERTLL"
FT                   /protein_id="XP_822497.1"
FT   gene            complement(634795..635163)
FT                   /db_xref="GeneID:3662899"
FT                   /locus_tag="Tb10.70.5240"
FT   mRNA            complement(<634795..>635163)
FT                   /db_xref="GI:71746885"
FT                   /db_xref="GeneID:3662899"
FT                   /locus_tag="Tb10.70.5240"
FT                   /transcript_id="XM_817405.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(634795..635163)
FT                   /locus_tag="Tb10.70.5240"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746886"
FT                   /db_xref="GeneID:3662899"
FT                   /translation="MCTCICRSTSIPDQAFSSISSTKRMNEPCHPLRQLHVISPIFAFP
FT                   YLCRRNATHKRRTKSPMYAMPDSVRQKKKNVVDMGTDSDAYGKKNRWDLRSTAASTFAT
FT                   HDGSTGRCFNITNKNVTT"
FT                   /protein_id="XP_822498.1"
FT   gene            637302..639455
FT                   /db_xref="GeneID:3662900"
FT                   /locus_tag="Tb10.70.5230"
FT   mRNA            <637302..>639455
FT                   /db_xref="GI:71746887"
FT                   /db_xref="GeneID:3662900"
FT                   /locus_tag="Tb10.70.5230"
FT                   /transcript_id="XM_817406.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        637302..639455
FT                   /locus_tag="Tb10.70.5230"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="weak similarity to chaperone protein DnaJ"
FT                   /db_xref="GI:71746888"
FT                   /db_xref="GeneID:3662900"
FT                   /translation="MLVSQRKVDYGVYNTWHSIHLLLPTFQGNVVLLLDHLLLNCTVLH
FT                   ISPWIICSTGYSYRRHMFLRSDQHRGVRERVAGGAKTTGPGCPKLSPGRNALENNHEFS
FT                   AFVDRMKAINYSFATKKKRGTEVEIITIPNIVCDGEASEEELAEHFEAESRWLDCCLRE
FT                   FTHRRGRYGSVSFLLVRIIIVLTFLLPALWYFWPLWEVLIDVESELHYSILGIPQGSDA
FT                   RAIKRAYREAVRRWHPDRNPNCDSCRVHMMKIQHAHDVLLAKGSERYELVDRYGEELAQ
FT                   LRSLVFFRLYNIAFYAAQDIYYLIQAFNGDAHINGSKEFSWFLQVMCRTLTMGVFTVYD
FT                   TLFISGFRVIVLLQVLFYCVSCAKSSAEEWEIIGMVKRSYVDLYREAMFFAGGPLILHC
FT                   LQTYQSGRILCWADAFEFFLQLAFGVIYVLSHLYHMTPNLLDNIFMKKCSIPLSYIKLP
FT                   TRRLSYLNFICTEFGLLLDDLFAFSCRVPSVYRLTVIVVHTVFLCELLWFPWEPPILSV
FT                   PDRKDKGKNVHREEEGKHTDTAPHREVMEEPPRAISSEEMALLKGVDNEAVNWFDVVST
FT                   RFAKQMRSAIHRCAQQRRAYINFDLVPTVNSQEVAFVAVTREHPRAPSKVDVLFRVRDE
FT                   FANRMLTTLRPPLEHILGVRLTDATHSEIVSRHARLWEENKRKNPSDTWRRRCTDSEVK
FT                   VSFDLPMLSATVISTIVLLYHFL"
FT                   /protein_id="XP_822499.1"
FT   gene            640049..641701
FT                   /db_xref="GeneID:3662901"
FT                   /locus_tag="Tb10.70.5220"
FT   mRNA            <640049..>641701
FT                   /db_xref="GI:71746889"
FT                   /db_xref="GeneID:3662901"
FT                   /locus_tag="Tb10.70.5220"
FT                   /transcript_id="XM_817407.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        640049..641701
FT                   /locus_tag="Tb10.70.5220"
FT                   /gene_family="HOG000260196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746890"
FT                   /db_xref="GeneID:3662901"
FT                   /translation="MPQNMEVRDDARRPNEKPSWKVLLTRGLLVAFIALALKNLGMFGW
FT                   VDRGSETVPDVPQHAYYSQKGDTYDVEIMSVEPGLFKRDSFRRIVVGGTEGISRNYTVN
FT                   LQSCFKRNCSATLKVVMRLYDLVYTQEFPMVRFLPSRRAAELHNLFTENVPLSRDEEET
FT                   EANTTWKAYFQPVLTLSPVVDLPSPIPPEIRHLYAREEASGKYLPLLYINNIWVLRSHL
FT                   MELNKTTAEFPLNFTIRISPITSWKLGIQYNFDRSLKQNQDKGLMRSEDAEEIKRIFLE
FT                   TNPYFLALTLLVSILHMFFEYLAMSNDVMFWRRRKDFRGLSLRTIIMNCYSQTVIFLYL
FT                   YDNDETSWAILLPSGIGVLIEYWKLAQTAHFVRGEGGRLRLQFGDGYDKKTRKHDDVAI
FT                   RYLMYLLTPVLACYTVYSALFNTHRGWYSFFIGTQVRFIYIFGFAMMTPQIFINYKMKS
FT                   VAQLPWRTFVYRALNTIIDDLFAFIVTMPLLHRLACLRDDIVFIILLYQRWIYPVDTSR
FT                   KEDCEADDDDGEERCVGDKGKKNVEGPTREKGD"
FT                   /protein_id="XP_822500.1"
FT   gene            642841..645699
FT                   /db_xref="GeneID:3662902"
FT                   /locus_tag="Tb10.70.5210"
FT   mRNA            <642841..>645699
FT                   /db_xref="GI:71746891"
FT                   /db_xref="GeneID:3662902"
FT                   /locus_tag="Tb10.70.5210"
FT                   /transcript_id="XM_817408.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        642841..645699
FT                   /locus_tag="Tb10.70.5210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746892"
FT                   /db_xref="GeneID:3662902"
FT                   /translation="MQSCMMHMELRIAGIDSLSLFDAESFVRMHQLSQNSPQVLYANNS
FT                   LVRLPRGGVNASDHFKPQVKVQFVFENLVRIESSTVEAVSDRRQHEEQIKSKWDASEIR
FT                   TKRFHCNYSQAIIASLPRIVVERYVKIRVLQLAPLLSKEETIAVGATFPHYFNNDEPSL
FT                   CVGVAKISLRDLIATSSGVSVTLQPKRSMIAAVESLNLNAVATNAMFGKDAGGSGVLTF
FT                   QVVSVVFSQKTLSSMLCCPDYNDNATPTSVLANGRRMDNASDGAVLSTIGPELVTDDLM
FT                   ALHQQMNSGAVRFVLVPYMVLADAVLRFHDAFSWRNPLKTLLLLCIICVVISVEVVDMG
FT                   LVFAIVSEALTMVRTMVFFYRVPPRTNMGPNAVQFLAERKGTFQAVLYGSHNHVINSLI
FT                   RARLFFTQGLQPDCYFELVYLFYRLKKLKRGVSIFIAALVSGSILFSFETFVLFGMLFA
FT                   FLVYPLLLRFSHSRLRKTWRRQLTSGTLWKTISLSRSMPVARVVQVIGPHERCVPTQNF
FT                   VASTSRFSTRRDVDELKISKDHSTLLGIERPAALAKDDEEKVLDPQGDVQGPRPPVNYN
FT                   PAENSFSCTGGRNAGVFGCNSLQPLACRQKLAPRKSEMIKHEPQQPLHLTFVTIVIGSE
FT                   VAPACHSRTTSINGTTTNSTLVQRLWRVFQRAGALGRPPPSHLLNSQYQSYFNSVLTFL
FT                   QFVGRQCTLDAYMSVDASTTLAELAGGTVKLDQVAPLCNLLEVGKDDGITSTLLAHSGQ
FT                   QIVLSKLQLPNSAESSARALALLAAYLLQGSRLSVYSEPGGKVCSVIIPLKMDDNDIET
FT                   ATEPHPCPAPLQKALVGFWKGLAGGDCSIDISPDVVLTVITTYKDTWNGDNAATNPAHE
FT                   YNHISGQNDDNSTNREVSKRLMQTLNPTQMNKRYSMASAELPPLDTEDKALFFRHAGGP
FT                   VRPDDSAGISPRNYHRATRTWA"
FT                   /protein_id="XP_822501.1"
FT   repeat_region   645812..645847
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            647479..649155
FT                   /db_xref="GeneID:3662692"
FT                   /locus_tag="Tb10.70.5200"
FT   mRNA            <647479..>649155
FT                   /db_xref="GI:71746893"
FT                   /db_xref="GeneID:3662692"
FT                   /locus_tag="Tb10.70.5200"
FT                   /transcript_id="XM_817409.1"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT   CDS_pept        647479..649155
FT                   /locus_tag="Tb10.70.5200"
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="go_component: cytoplasm [goid 0005737];
FT                   go_component: glycosome [goid 0020015]; go_function:
FT                   glucose-6-phosphate 1-dehydrogenase activity [goid
FT                   0004345]; go_process: pentose-phosphate shunt [goid
FT                   0006098]"
FT                   /db_xref="GI:71746894"
FT                   /db_xref="GeneID:3662692"
FT                   /translation="MDGDLSQLGFLQEVDRFFDVLREKTLRDRPDNIPEYVMQNCRKVA
FT                   DTLRKDSCDIIPDAAAPELKERALTIVVLGASGDLARNKTFPALFQLFCNGLIPRTINI
FT                   VGYARTKMPDVEQWKKESLAKHFPRTKDRCPHIEAFLKTITYISGSYDGAEDFFRLNDV
FT                   ITKFEESFPGKQKGGNRLFYLALPPSVFMHACTGIRTHVMQKPGLGWVRIIIEKPFGHD
FT                   TESSNELSRQLEPLFEESQIFRIDHYLGKEMVQNIVVTRFANRVFSALWNNNNIACVRI
FT                   TFKESIGTEGRGGYFDKAGIIRDVVQNHLTQILSLLAMEKPRSLSPEDIRDEKVIVLRH
FT                   VNPVTPADCVLGQYTRSEDGSIPGYLEDPTVPRGSKCATFVVLRLFINNDRWDGVPFII
FT                   EAGKAVERRYLGIRIQFKDEIRPFGVAAQRNELIIRAQPSEAMYLRLTAKTPGVLSDTH
FT                   QTELDLSYEHRYNITLPDAYESLIHEALLGRSTNFVRKDELDAAWRIYTPLLEAIERGE
FT                   TTTYPYSAGSKGPAEAQKFVDDTGFKPLTGDIYQQRKLHHL"
FT                   /protein_id="XP_822502.1"
FT   gene            650728..651792
FT                   /db_xref="GeneID:3662693"
FT                   /locus_tag="Tb10.70.5180"
FT   mRNA            <650728..>651792
FT                   /db_xref="GI:71746895"
FT                   /db_xref="GeneID:3662693"
FT                   /locus_tag="Tb10.70.5180"
FT                   /transcript_id="XM_817410.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        650728..651792
FT                   /locus_tag="Tb10.70.5180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746896"
FT                   /db_xref="GeneID:3662693"
FT                   /translation="MKPFPAFLTLFLVALSPLTTPSQSAGDDVQHNLFSWSSADNMTDG
FT                   DVGSARVPEEEEKERTSVSNESKDAQCKGKYGLYSHYVLGHNHCSWEPPYGVAMSPLYL
FT                   PPDISADADRCSFMWLLREMLFTASKEGIALVPHNVKRGDSTPLQCGRVALHPWIVVRG
FT                   EPKEWGPIRGVSTHKVMVSSDPSDGTDMLWPLLLLVSLGVLAAFLLLILVFMMKTIRGG
FT                   TLLEERTTSMTAASPDENDKKLHDNGSVTECRSVREGKGNEEDKEGGREGEKEEQIEKN
FT                   EIGEEVVEAETASEGHTSEITALHSLSGSWHSEGSDQLLTSNDSPLPQPPIELVASPLE
FT                   TPKEGDVKAPHGHL"
FT                   /protein_id="XP_822503.1"
FT   misc_feature    651497..651595
FT                   /note="GA-rich"
FT   gene            652723..654300
FT                   /db_xref="GeneID:3662694"
FT                   /locus_tag="Tb10.70.5170"
FT   mRNA            <652723..>654300
FT                   /db_xref="GI:71746897"
FT                   /db_xref="GeneID:3662694"
FT                   /locus_tag="Tb10.70.5170"
FT                   /transcript_id="XM_817411.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        652723..654300
FT                   /locus_tag="Tb10.70.5170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746898"
FT                   /db_xref="GeneID:3662694"
FT                   /translation="MDLPIELLLGSAPERQRYLRAVHILFNSVGDALKANARQQLLMAT
FT                   ANDLTRGLSVADFCQFRRKCFENEDWCKCVYPLLEQDENVVADRAEAAVQEALSAVRFP
FT                   GGGESSTEPVLVFLSTSKRSRSEIAEEFEIPGKLRLAEVFANVGDYGAMYDTLTHLFVP
FT                   LQSGLQLTARSHRLPLLLLQLQVIKRTTELWLGAGNVEAVRGYVGESTSTVLTDAVQAI
FT                   AVENGSGSVYFPSHQVTVEAVTDEIEQLLLFFSIVRALCLFESGDFCGFVCSFTPEGLR
FT                   GTNWAQAAGDMLVERGATQVAASFGGRISRPGVLPVIHNLRRVVEESVTTGVQLGAMLL
FT                   LSAVATRPRAEAMELVTRIDIMQLWEDIPEAHTLVHALQQANFADALHAASVLAFVYLK
FT                   TDLFAYKHCECLLYQYKQTVIMRYVSCFISLDLKRAAMHLSIPLRELVHIVRELIEKEH
FT                   ISAKIDLVAYMLVSADAFSPTDTAATDRNLLFDCINRSRKCAEELEQSLRLLSAQRDNA
FT                   SSGVEFGP"
FT                   /protein_id="XP_822504.1"
FT   gene            654532..656730
FT                   /db_xref="GeneID:3662695"
FT                   /locus_tag="Tb10.70.5160"
FT   mRNA            <654532..>656730
FT                   /db_xref="GI:71746899"
FT                   /db_xref="GeneID:3662695"
FT                   /locus_tag="Tb10.70.5160"
FT                   /transcript_id="XM_817412.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        654532..656730
FT                   /locus_tag="Tb10.70.5160"
FT                   /gene_family="HOG000260201" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746900"
FT                   /db_xref="GeneID:3662695"
FT                   /translation="MGPKTQEARPPLPGTPMPPIDPIFAITGPSAGVLHVNTADLLPDQ
FT                   RNKLDDNISRAISDCLKSVVVPLDRYWRAASQHHTLLCSTSEDGAVDSSNTEGATPSHW
FT                   PAAERIPDPENIPYTFYSTRMEAIIRRSYQKDRGEVLVAADVRSGNSGKIFNTLRRREI
FT                   ASFVNAIPLVPQRNLYVMIDKDAAVDPFFDIDCSPPFEWLNFPTEVAEGENLPSNGSRA
FT                   KDSSSQPPVHIDTAVVERCLLQILQYLRDVVEEYAGAKLEHCLVLTGSVLVSESSVGPS
FT                   AHTGATRRHNLLSSKDTKLSFHVHFRLEKNVVFSNIRELHKFMMKIRGGIDDSFNKAGD
FT                   RETRSFYHMLQCCIDFGVYSRWRAFRLPYNVKASSDGLNTMNAASFNSAIDAATKSPFR
FT                   TALIPNLSVGEASHSIVHEIDLSTLQDSLLYFEPTKKQQEHHALLTKLFGVFRFLLPVV
FT                   PKVTAIGNAELAKFLLAHQPPFPPTEESVNPSYRDDLARVVFELALIQRDASNLMNEGD
FT                   DKNTFNFIMWSDSAEDERDNALIQGPFGINRPPLRDGARAPVRDSRIKKLIAEVFHCLS
FT                   PAFGGGLKSNLQAQSSDILRQSGSYITADSLSVDYQDGVRFYYVRQKSSKFCIRLGREH
FT                   RSTYPQLYLTYGSIKIRCYSNDCSGKCHCLKWSPNDNERICGSSAVLLSVDDNGYPKYD
FT                   RLAEIRDLLFPPLSQEELIRRYGITSVASGDEDIVQQW"
FT                   /protein_id="XP_822505.1"
FT   repeat_region   656786..656819
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttccc"
FT                   /rpt_type="tandem"
FT   repeat_region   657088..657132
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            657223..657891
FT                   /db_xref="GeneID:3662696"
FT                   /locus_tag="Tb10.70.5150"
FT   mRNA            <657223..>657891
FT                   /db_xref="GI:71746901"
FT                   /db_xref="GeneID:3662696"
FT                   /locus_tag="Tb10.70.5150"
FT                   /transcript_id="XM_817413.1"
FT                   /product="adenylate kinase"
FT   CDS_pept        657223..657891
FT                   /locus_tag="Tb10.70.5150"
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="go_function: adenylate kinase activity [goid
FT                   0004017]"
FT                   /db_xref="GI:71746902"
FT                   /db_xref="GeneID:3662696"
FT                   /translation="MKVIFLGPPGCGKGTQSPFVAKRYDICHLSTGDMLREAVEKKTEY
FT                   GLKAKSVMDVGGLVSDDIVFGIVKESIKQPRCKNGYLLDGYPRTLRQAEMMEEAGEKVN
FT                   KVIHFDAPDDVIISRVSGRWLHRASGRIYHEVFCPPKVRGLDDVTSEPLIQRPDDRKEV
FT                   VEKRLVGYHRQTKPLIDYYRARGVLATLDATQSVNVVRESLRRVLDPVARLIGAKIHGN
FT                   "
FT                   /protein_id="XP_822506.1"
FT   gene            659912..660601
FT                   /db_xref="GeneID:3662697"
FT                   /locus_tag="Tb10.70.5130"
FT   mRNA            <659912..>660601
FT                   /db_xref="GI:71746903"
FT                   /db_xref="GeneID:3662697"
FT                   /locus_tag="Tb10.70.5130"
FT                   /transcript_id="XM_817414.1"
FT                   /product="adenylate kinase"
FT   CDS_pept        659912..660601
FT                   /locus_tag="Tb10.70.5130"
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="go_function: adenylate kinase activity [goid
FT                   0004017]"
FT                   /db_xref="GI:71746904"
FT                   /db_xref="GeneID:3662697"
FT                   /translation="MHVFLTGPPGSGKTSVSTVLKERYGFCYVTPIEAVSHAVEYSDTD
FT                   VGDKLRRYVDEGEPIPDDLLARAVADATRGPDCTNGFLLNDFPKTAEQARHLKAEGIEP
FT                   DAIVVLSVPDSLLVDRHAGRWVHPSSGRVYHTFYNPPNVKGRDDVTGQPLVQRPEDTEE
FT                   AVHQGLVKYYESIRGLRAVYGDPRLWHTVDGFASLDSVHVSICRVLDPIIADKTRRWWS
FT                   KLFWWSS"
FT                   /protein_id="XP_822507.1"
FT   gene            660876..661949
FT                   /db_xref="GeneID:3662698"
FT                   /locus_tag="Tb10.70.5120"
FT   mRNA            <660876..>661949
FT                   /db_xref="GI:71746905"
FT                   /db_xref="GeneID:3662698"
FT                   /locus_tag="Tb10.70.5120"
FT                   /transcript_id="XM_817415.1"
FT                   /product="malate dehydrogenase"
FT   CDS_pept        660876..661949
FT                   /locus_tag="Tb10.70.5120"
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="greatest similarity to plant glyoxysomal MDH;
FT                   go_function: L-malate dehydrogenase activity [goid
FT                   0030060]; go_process: tricarboxylic acid cycle [goid
FT                   0006099]"
FT                   /db_xref="GI:71746906"
FT                   /db_xref="GeneID:3662698"
FT                   /translation="MVIFFGRAQTRRVTGKVVVFGATTNVGKHLSLLLTLSPQVKELCC
FT                   FDPLNDVTLRMTETRVRGIVKDLSHIDTGVVLRAVDDPQQWEPAMRNAQLVLICTGSIP
FT                   NPSRLQRDLALAECAPEYLVAMELVARAAPHAIVGIASGPVNSLVPLAREVLLRHSAFD
FT                   PRKLFGITSRDVMRTRVLFAKELHMNPYDVNVHVVGGKGDATVCPLITQTGFQLPHQRM
FT                   VQLCEEVQRPENFTAGDHNSTGCRVDSQNVQGQEKFTCPTLSTANAAYEWVTSIMKAQR
FT                   GDRGITECSFVESSIKRETPFFSSRVELGEEGAAQLLPLGALTPYEEELVAAAVPLIVE
FT                   DVEAGLRLSKTGVDAVS"
FT                   /protein_id="XP_822508.1"
FT   gene            662390..663346
FT                   /db_xref="GeneID:3662276"
FT                   /locus_tag="Tb10.70.5110"
FT   mRNA            <662390..>663346
FT                   /db_xref="GI:71746907"
FT                   /db_xref="GeneID:3662276"
FT                   /locus_tag="Tb10.70.5110"
FT                   /transcript_id="XM_817416.1"
FT                   /product="mitochondrial malate dehydrogenase"
FT   CDS_pept        662390..663346
FT                   /locus_tag="Tb10.70.5110"
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="mitochondrial malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="mitochondrial; identical to GB:AAC27101.1: malate
FT                   dehydrogenase {Trypanosoma brucei;}; go_component:
FT                   mitochondrion [goid 0005739]; go_function: oxidoreductase
FT                   activity [goid 0016491]; go_function: malate dehydrogenase
FT                   activity [goid 0016615]; go_process: tricarboxylic acid
FT                   cycle [goid 0006099]"
FT                   /db_xref="GI:71746908"
FT                   /db_xref="GeneID:3662276"
FT                   /translation="MRTSATLQFKVAVLGAAGGIGQPLSLILKTNPLVSHLSCYDIHGV
FT                   TGVAADLSHICSPAKVTGHLKDELHKAVDGADVVIIPAGTPRKPGMTREDLFSVNATIV
FT                   RDLVSACAKQCPKALIGVVSNPVNSVVPIASEVLKKAGVFDPARLFGITTLDVVRARTF
FT                   VAEAAGKSPYDVNVQVVGGHSGPTIIPLLSQAGVSLTEEQVKAITRRVQYGGDEVVKAK
FT                   GGAGSATLSMAYAAGEWMSSVLKGLRGDKGIVECTYVQTDIIPGVNFFGCPVELGKGGV
FT                   EKIHKPVFDAYEQSLLEKCVADLEKNIAAGFAFGSRQ"
FT                   /protein_id="XP_822509.1"
FT   misc_feature    663748..663810
FT                   /note="T-rich"
FT   gene            664018..667011
FT                   /db_xref="GeneID:3662277"
FT                   /locus_tag="Tb10.70.5100"
FT   mRNA            <664018..>667011
FT                   /db_xref="GI:71746909"
FT                   /db_xref="GeneID:3662277"
FT                   /locus_tag="Tb10.70.5100"
FT                   /transcript_id="XM_817417.1"
FT                   /product="lysosomal alpha-mannosidase precursor"
FT   CDS_pept        664018..667011
FT                   /locus_tag="Tb10.70.5100"
FT                   /gene_family="HOG000007676" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysosomal alpha-mannosidase precursor"
FT                   /note="go_component: lysosome [goid 0005764]; go_function:
FT                   alpha-mannosidase activity [goid 0004559]; go_process:
FT                   carbohydrate metabolism [goid 0005975]"
FT                   /db_xref="GI:71746910"
FT                   /db_xref="GeneID:3662277"
FT                   /translation="MLTLGMHTLQLLSLILYFAATVFVPALKVPSKAVVHLVAHTHSDL
FT                   GWLKTVDQYTYGLNNSIQFADVTTIINSVVEGLLANPERKFTYVEIGFFSRWWSRQSVS
FT                   MREKVRGLVANGQLQFANGGWCMHDEATTHYIDMIDQTTLGHRWLLRELNVVPLVGWQA
FT                   DAFGHSATQASLLTSRAGFNGTFFARIDYREYEDRVKRGGRQFWWDASPSLPDLKTFAE
FT                   ANLHATYCSAAGYKWDLADQLESARTFTQADDIIDDNASERYNVPVVLKHFKDEVARSL
FT                   QATRGANVMWTMGCDFTYMVSEFWFGKMDKLIKIANDDGEFTVRYSTPYEYMMAKLDEA
FT                   VNAKIKYETSTGDFFPYASAAHEFWTGFYSSRPTLKRLIRMLSSYWVASRQLQFLAGVP
FT                   SGDLPLLSDALAIAQHHDAVTGTARQHVTFDYVKRLVAGYNDDFSVRLRTALTGRLFNL
FT                   SNVSHCLLSNVSACDATATGLAKKGSKLTVMVWNPSVHPNVNTFLQIPVPRRDIRVEGN
FT                   GVKSFSVYGSPTQVSDYSNVNANWQPYTIGIILSLGKTSSLTLSTPGKYDIPRKESHVG
FT                   YSLKSVVSRDRRGGFTLTSDHLKVRFGVNGRLKSIEVLSVGQEVLVEHDWCYFKSSRGE
FT                   DPSGISGGAYIMRPVSDNVCEPISTDKVESIIIDETIGIVEQRFGNDLVQRVILHGDTV
FT                   DLEFTSLGIPVKDGFGRELVARFSTSVNNSGIFYTDSNGREMQRREVDKRRNYPFVQTE
FT                   SVAGNYYPVSSLIFINDTETQFNVFTDAAMGGTSINNGEVLLTTHRRLLLDDQKGVSEP
FT                   LNETEFITAYEGDPSMNEKGRGKHYGNPLRVRGTLTISVGRSGPSAMRRVREQLDEKYF
FT                   SPIAVYSTGSTPNLNCSLELTQISPSVQIITTQLLNKTTLLLRIAHRYAVGEDDERSKS
FT                   VEVELRSLIPNELDYNVESIDEVSLTTNTLLRNGLDTVVLKPMDVRTFLFHMREHKWRG
FT                   MSMSCTGV"
FT                   /protein_id="XP_822510.1"
FT   gene            667903..668787
FT                   /db_xref="GeneID:3662278"
FT                   /locus_tag="Tb10.70.5090"
FT   mRNA            <667903..>668787
FT                   /db_xref="GI:71746911"
FT                   /db_xref="GeneID:3662278"
FT                   /locus_tag="Tb10.70.5090"
FT                   /transcript_id="XM_817418.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        667903..668787
FT                   /locus_tag="Tb10.70.5090"
FT                   /gene_family="HOG000260202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746912"
FT                   /db_xref="GeneID:3662278"
FT                   /translation="MNRSTSLEDSDAGGRGGKKKREKKGFKVDRYENYRQRFAKGINGK
FT                   NIPKNNSGSVTKRVKAITFDEEDRREYLSLHKRKNERRVKAFVEAKQKTKRDNARTRRA
FT                   QREEARQAYNKFAAVPILPNFTYRLPVEGCSDNEDDDEGHMDEGNEEMVQSRGINDAQK
FT                   QRRLLAAEKTVHTMPATMSGGALAESSIGDAGCRLDDEFVTVEVKVLGSGKDSAGSGTC
FT                   GSNSLPVNDFSDLPSVVEEELLRLKKEMKGPARTKSRVYMMKELEKIRKIKKHSRKGHG
FT                   KKSAKGKRKNRRR"
FT                   /protein_id="XP_822511.1"
FT   gene            669071..671506
FT                   /db_xref="GeneID:3662279"
FT                   /locus_tag="Tb10.70.5080"
FT   mRNA            <669071..>671506
FT                   /db_xref="GI:71746913"
FT                   /db_xref="GeneID:3662279"
FT                   /locus_tag="Tb10.70.5080"
FT                   /transcript_id="XM_817419.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        669071..671506
FT                   /locus_tag="Tb10.70.5080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746914"
FT                   /db_xref="GeneID:3662279"
FT                   /translation="MRIATSPTGRGKNSSVLPLLRRFSWGNGMCSPYYTEHRRQSTLTS
FT                   SALSSPANHNQQVVYRSIRDCRERAFHLIQELVSSPIPGCGLSYSTNGSFGGPSLTVNA
FT                   VSGVASLLELYDKAYYFLHLLHRTILVPRNVVRDTDDFTEFLLRCFRRPSDSLLKGDEE
FT                   LQMSDTAIVDGFVEWMETSLMSAGQFVSFVEVLQLVGSYVRYHKGVRWGARPSEEEWYR
FT                   CGYRLHPWHDTYCPSSRAEQMPYVHLLQWLMRAKPTKLEEKIDDKEGAHGASSLFSTAA
FT                   KESAMRAWYATEEFSPPSWHTVVGNSNRLGFTALDCGCHSGYMTELLLKAGAQEVLGVD
FT                   VSPHHLGNAEATLSEHLRERRSSSYSRKTVQFVRCDILPDLPDEARQTKTPPLGPEGST
FT                   NSAAAENRRRLARCHHMPSDSDGLKTETEVTGPFDLLLFHPPLPLLFPTWPLFHDLYES
FT                   VDQLAYDAGRRHPHCRLSVLNEFLQRLLGSSNGEENNSERRRNAHQQLNHQRRLVAPLI
FT                   KDNGYVAFILPRNFDTRAILQRMSTSSAGKNCTSCGSDGLAPLVPLSDVVTMTLEGSYT
FT                   LVLKRSHSLSSLLNRMDYIQKSISAFIRAFVSPQHRSRVEQEVRDFYSNHQAIDLIVMR
FT                   KIARQKTNEDNDNKDCSVRAVLQKVSEPIAYEDSFEYEEYIPAGGSPLAHHWTEMTPSF
FT                   SYLEDEFFGCADSVGTNGPPNGASFLAVGHPLVPVTRQLVGVDRFGAGGRDATQGESGS
FT                   FDKMFAKEMRRRGGRMRKMALTPLEKQEWYIDEKLVKSEAAKVDLMNELSRFELKDFD"
FT                   /protein_id="XP_822512.1"
FT   gene            671889..673643
FT                   /db_xref="GeneID:3662280"
FT                   /locus_tag="Tb10.70.5070"
FT   mRNA            <671889..>673643
FT                   /db_xref="GI:71746915"
FT                   /db_xref="GeneID:3662280"
FT                   /locus_tag="Tb10.70.5070"
FT                   /transcript_id="XM_817420.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        671889..673643
FT                   /locus_tag="Tb10.70.5070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746916"
FT                   /db_xref="GeneID:3662280"
FT                   /translation="MVGEEVELTVQPQRSLNLVSAGSAHKRGSICLSVLQRVQTMCVSD
FT                   KTGDVMNGGVATENDRVGGYEVLWSAHRLGKSLLLMDRGCNDVYPMMEADRAELKAIID
FT                   MWQSEDVELLPSRQTQWKMAAPNLREELLAVVRLLVSSASGQCHRLSLPLMPIPNAVCP
FT                   SDCTLNTRSYGACPLTQREAWPAACLHFAGVLMLCGLRSYRDAEELLSTSFSSLGGTLQ
FT                   RFVVQSLQEEFAIMRREVMELCVSCRRSNKSEPELTTLNTGKGGSIPSSRGFYYYARTV
FT                   PARCAGGVKPYASATSCDKTSPLVFTLLDEWRDDDRACGALQCQCRSYQDLTRITCRKS
FT                   DLVLFSLAVVEALSTAVVEELRQQCEKPLDFVDFIGDVVSVCAVLVYPFLVRQLRCLRY
FT                   LMHSLTDANVSKSEAPLLAADVQQYERYVSAVEKFLLNFDPSFVTSPGPSFSCADRETL
FT                   CTIKAGPNKGPGGVRVVSNLECNEAATPLSPRRCEEKFQQCRPLWEPVAPALAAHLSSR
FT                   PHAGGMMAWGDVVALFTEVKQSREAELLSLWNYWVQLRRETRALSAEVTYLMGERMAPT
FT                   SQKIPRET"
FT                   /protein_id="XP_822513.1"
FT   repeat_region   674156..674175
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            674213..675667
FT                   /db_xref="GeneID:3662281"
FT                   /locus_tag="Tb10.70.5060"
FT   mRNA            <674213..>675667
FT                   /db_xref="GI:71746917"
FT                   /db_xref="GeneID:3662281"
FT                   /locus_tag="Tb10.70.5060"
FT                   /transcript_id="XM_817421.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        674213..675667
FT                   /locus_tag="Tb10.70.5060"
FT                   /gene_family="HOG000260205" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746918"
FT                   /db_xref="GeneID:3662281"
FT                   /translation="MTELVPEAEVTFNCGSPSFPYVRVYRCFKTTNSGMLYRLEDDKGR
FT                   WAFYNDTPLTVFNVYVKFNADSVVTSDTDVALEMTQGEWDYWATTVVLPGHTQRFVEGT
FT                   ISSFLLNFASEGELAKDVTFVNGTPTVGYDRVYRCFKQNANGMLFRLVKVERPGNECVW
FT                   NFYNDSRELSVEVELTLIEKDSAKPLGDTQVIPPPDGVGVALYKIVVPPLKTVPFLRGH
FT                   PRFSKQSYVAKSMYDENMLDASEITFENGQPDRAVIDYPRTKVFRGFNNNGNGLAFLLV
FT                   DPEEKKWAFYNDTTNYNVTATVRFAAGSVYKAAANTRVEVDPAVEGGTVCTITVMPLAT
FT                   ELFITEGNPEQYQISLSAECSTGPKPEENPDYQNGQPDTKVMLRWEKVYRCFKNRGNGL
FT                   LFRLVGDNDRRWGFYNDTTDFIFTVTVSFENGETVKTLGNTSVSEDPELGKVFTLEVAP
FT                   LSTEVFVFGDLSGYKTRFAARSVRCA"
FT                   /protein_id="XP_822514.1"
FT   misc_feature    676995..677015
FT                   /note="AT_rich"
FT   gene            677172..677750
FT                   /db_xref="GeneID:3662282"
FT                   /locus_tag="Tb10.70.5050"
FT   mRNA            <677172..>677750
FT                   /db_xref="GI:71746919"
FT                   /db_xref="GeneID:3662282"
FT                   /locus_tag="Tb10.70.5050"
FT                   /transcript_id="XM_817422.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        677172..677750
FT                   /locus_tag="Tb10.70.5050"
FT                   /gene_family="HOG000177563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746920"
FT                   /db_xref="GeneID:3662282"
FT                   /translation="MTNQSDAIFPNILWAQRAELVLITIPLQDATNVVVEIKEGRVLHF
FT                   EAEAGGEKYRCDVELFREVVSEESRHAAQPRQIDIQLRKKAPLTESGEEEFAQSRSWLR
FT                   LTRDKSKNSHIQVDWSRWRDEDEDEDETGGLGMDYNDLMSRMMTQKGLGEDDCMDCGNH
FT                   TDEDGVGPGADKANHSDSDDYDDLPPLEP"
FT                   /protein_id="XP_822515.1"
FT   gene            678965..679798
FT                   /db_xref="GeneID:3662283"
FT                   /locus_tag="Tb10.70.5030"
FT   mRNA            <678965..>679798
FT                   /db_xref="GI:71746921"
FT                   /db_xref="GeneID:3662283"
FT                   /locus_tag="Tb10.70.5030"
FT                   /transcript_id="XM_817423.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        678965..679798
FT                   /locus_tag="Tb10.70.5030"
FT                   /gene_family="HOG000257944" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746922"
FT                   /db_xref="GeneID:3662283"
FT                   /translation="MSSFWSKKSTAFNPNKLKANLRMAITRLRMQQNKLVNGIKIQRRQ
FT                   VAELLALQKYESARVRVEQVLRDDVSIEGYEVLALFLDLLSNRVHLITNISDECVSGSS
FT                   DNRKKGLALCPPELKESITSVLWAAAQLGNVVPELQNVSKCFEAKLGADFVAMSVSNAE
FT                   FSVNQKIIERLGFNTPSNARCIEYLTNVATEYSIEGYDEQRLLDPSGLVPSVSTTENVG
FT                   TSLGVDVDTTTLGSVIDPTGVPEGGIIRTPSGFLLPALTQARDELECRLLQLKRG"
FT                   /protein_id="XP_822516.1"
FT   gene            680486..682708
FT                   /db_xref="GeneID:3661884"
FT                   /locus_tag="Tb10.70.5020"
FT   mRNA            <680486..>682708
FT                   /db_xref="GI:71746923"
FT                   /db_xref="GeneID:3661884"
FT                   /locus_tag="Tb10.70.5020"
FT                   /transcript_id="XM_817424.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        680486..682708
FT                   /locus_tag="Tb10.70.5020"
FT                   /gene_family="HOG000260207" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746924"
FT                   /db_xref="GeneID:3661884"
FT                   /translation="MRQNPPKEPSEEEVLQYIVDNVNKLLSRHYSLVEFDAIQGTDLLQ
FT                   ILADIFGTLSPAQQIDMGVAPTDEAAASMLEFLTKTLGYRVPPMLADSFPTSFSRAEPT
FT                   VIYPTLYWVLSNMQQNEKRVYLARFLQRLEIPEAMLAQDEDVRALYQQYVNLRGMFVNT
FT                   HRRVDALRTAHADPADARRAVTVLEEECDRLRGYIQVAEKKLAGVPDKEALLNACKSLR
FT                   AALEEESRLAEKGVELQQQLISSRQRSTEMHNRLQNLRRDAADGRVDVIVRRLRDEIQT
FT                   NKMIIEEQLPKELQQKQRENAEFDRLISEPLDMQALTTENQQLDEALKKLHQQVKERQK
FT                   PGEDGSTIATIKQQVERVAKRKVEVMEQLTGLQADNSRTLNDIRERENRIEQLREAHHM
FT                   LKDDDFREFSKQVLAKKAATESMRTHLSEQRVEYGVLNFTENVLRSQFTSLDAEIGDLE
FT                   GKLGLQGYSRTVETLSKLTHEKDAIEGLKGKTLEELSRVVQDFTMAIRERRTKLAPLIN
FT                   ELRSVRQTVAEVDQEWAEKKTQYEYQESVLMEDITKIEREVQSLHEETSTDESVYHRLQ
FT                   AQHLLLKAHVDRIEAEKDFAEIVRRGAEAADAAEKEGVVSGSGSLKCAHCAKACANKGW
FT                   LLYHLCREHGLTVMAEKAFESAIEDLQIRLRDLQQKQRDIQENYEQNVQQVEWFGNLKR
FT                   VLEAKLRTLHNEGSRCRNALDSDIKEIMGSAGAGGANVDMLVLPGD"
FT                   /protein_id="XP_822517.1"
FT   gene            683582..687109
FT                   /db_xref="GeneID:3661885"
FT                   /locus_tag="Tb10.70.5010"
FT   mRNA            <683582..>687109
FT                   /db_xref="GI:71746925"
FT                   /db_xref="GeneID:3661885"
FT                   /locus_tag="Tb10.70.5010"
FT                   /transcript_id="XM_817425.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        683582..687109
FT                   /locus_tag="Tb10.70.5010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746926"
FT                   /db_xref="GeneID:3661885"
FT                   /translation="MISQPTGTTHDDVNEPVVDGSNAVAGNLEGTRLDTKKYEQVTPLA
FT                   SFSPDELSKLRHVFPDAYQALLQYEQLCRHSSAIVQVKETELQRSIDVGQEVLSRIDAL
FT                   QLRCAQLAKERDDALAMGQEHESHLRENIEELQQLLEEREKEISHLKAMQHDVEDEGRR
FT                   LQSKLSVMSLPAAAQIVVLHNQLVQLIERVEQVCNNKRSSSSVASTARMSVASIPTDGN
FT                   EAETVVLLEQWLADSLDQTIQRTNELTNAVHLLDEQLQHAKHQVEQSERKCQESENKII
FT                   TLRHENDQLQGELVALQKDVQALDRQAEELNAAGFHRHMDAVNSKQHELEEVRRQHSAQ
FT                   LLLLREQHGEELRSLEEETRSLRAELSRYRDGTAVPATYNSPSKPLEVQMSDHQKQQLQ
FT                   ELVNDFESEKHRLVGVIEQLENALLDGKSSYQRLVAQYEEELQQQQLRAAELVRTAAEN
FT                   GRLKEQLEHATASISVVGELTKALETKELYIATLNQQIRELSMEVTKLKGAAHSSKNQG
FT                   VARGSISKNYEDMEMELKQERENSQQLGASLAAVRSQLDELTVLFSEQKRRVRDCLRCP
FT                   PPQLGMDRERVTSLLQASASRAATRFFNCLEQQHRHLNSLSHHAFTLYGGVEPMQTKEE
FT                   GAANRKASGVAAAHYSSSISSFPGMANGLKKPRSRQQVQLEQIQKNASRFSSPARSPLL
FT                   EDECSAPGYVVLQNSETAAALSTAMVRFLNDLTEAVVQQLLQPYTGPLEALQRLHSAFN
FT                   PLMGAHNEHWTRKGDTISSDIVHHSVSLDNIEVSADENASMLRLPTSLAQQEKVSPNDI
FT                   IWTTVTEGIIDAFVDACTVVFQRVYRAAGSQLQQCEERLKQANRQVQANCEERIRRTAL
FT                   SMVEGEGNLNAQLQVAETKIQSAHQALDILQGKYEKEASRCCELSAQVKRLEGRLTEKQ
FT                   RELETERLQWRHTVRELQDACGIAKEQHAEQGTRHQHQVQELQELLRNVRQQLQAARDE
FT                   GHRLRLEVESVQAEHQQKIQWLEQEQQKTRSSEGKAEHALQNLREQLAASNTALQVKLN
FT                   EETARVQRANANVESLQSVLRDAQSAYQLLQSALSDEQDRREMAEERVEGLNRELALLR
FT                   SRLQVQQQRVAEMQEAERLQQCQLDAEARKNEALLRVNRALEGRLSEVEGDREPLRQQL
FT                   QSLLLLKHC"
FT                   /protein_id="XP_822518.1"
FT   gene            688240..688806
FT                   /db_xref="GeneID:3661886"
FT                   /locus_tag="Tb10.70.5000"
FT   mRNA            <688240..>688806
FT                   /db_xref="GI:71746927"
FT                   /db_xref="GeneID:3661886"
FT                   /locus_tag="Tb10.70.5000"
FT                   /transcript_id="XM_817426.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        688240..688806
FT                   /locus_tag="Tb10.70.5000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746928"
FT                   /db_xref="GeneID:3661886"
FT                   /translation="MKRDTNNHNGSACAFHEGSSQMVDTSFHSTGDGSGAPTQNVQQQE
FT                   QLPHRTGTGKRRVGGFSPSVAPFALDTQDPTPQQRRTLLGRGGVEAMRRNRQDQMNLSC
FT                   NEYPDPPPVGVRAPLRHVVRPGSAKHQEQSTTCIDEDTLRRAKARCPQSAQQRMPSFIF
FT                   GEDPQGPRRTGRAMHAQSYKPTSLW"
FT                   /protein_id="XP_822519.1"
FT   gene            689749..690114
FT                   /db_xref="GeneID:3661887"
FT                   /locus_tag="Tb10.70.4990"
FT   mRNA            <689749..>690114
FT                   /db_xref="GI:71746929"
FT                   /db_xref="GeneID:3661887"
FT                   /locus_tag="Tb10.70.4990"
FT                   /transcript_id="XM_817427.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        689749..690114
FT                   /locus_tag="Tb10.70.4990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746930"
FT                   /db_xref="GeneID:3661887"
FT                   /translation="MEQKENEITTVYASNNPDIPTLTEAATLILAPEEMVKLRRNMTAE
FT                   KVAHARYLREHPEIDAIMRYAMRKLIMERSEDPVKVLLEFFSTADLRAALAEENPEAEG
FT                   RAAMLREKRGLTIVLPA"
FT                   /protein_id="XP_822520.1"
FT   gene            690566..692293
FT                   /db_xref="GeneID:3661888"
FT                   /locus_tag="Tb10.70.4980"
FT   mRNA            <690566..>692293
FT                   /db_xref="GI:71746931"
FT                   /db_xref="GeneID:3661888"
FT                   /locus_tag="Tb10.70.4980"
FT                   /transcript_id="XM_817428.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        690566..692293
FT                   /locus_tag="Tb10.70.4980"
FT                   /gene_family="HOG000260211" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746932"
FT                   /db_xref="GeneID:3661888"
FT                   /translation="MYLPKQPVKVKESPFAVQKSRRFIAATGVAAFVTTAVASYFTLEK
FT                   VRERQRRPDGVLLQHRNGKRVVIVGAGAAGCALAASITSACPDVHVTVIEREKKHVFHA
FT                   VVPLAHVGHRSYDLNTTGGVDFLRSPATWNVTREAALVRGEVLRVDTTKNEVVVREDQE
FT                   ALTVTARAETSEQPSKNVLTWPMGLPSWLLGASLPPVNEHRYPYDVLVLACGAARSLGP
FT                   LQKFLTGEQVDRYRIAVNPGITRDCLVHLYKGTVLHVKVPPTSFAEGATGVRSISTMRY
FT                   VSRQHDGTFIGTVNTVWRYLFFFNKQKFCPYMAVTADRGPSDALPIEVNERVMDFWKQR
FT                   SVNFMPCTYITHLDPRRSEATLYNYQTQQKQVVNYQLLLLDLPLVAPEFIRKSGLSRSE
FT                   AAEGFAEVNPHTLQHVNHANIFAIGDCAALPTVKSYGAVFAQVPVVSHNVQQQLLHGAH
FT                   GTGEMSNAAVRSRFARYDGYSSFHIVMTTWRAMWPEMTYGDWRDNLSFPTITDAPLSLT
FT                   NNHIWDNLAWADVRGFLNAVYYQWFLYEVMFYFVFTRGAWYPPKWFSVPSFGDDGTML"
FT                   /protein_id="XP_822521.1"
FT   gene            692751..694763
FT                   /db_xref="GeneID:3661889"
FT                   /locus_tag="Tb10.70.4970"
FT   mRNA            <692751..>694763
FT                   /db_xref="GI:71746933"
FT                   /db_xref="GeneID:3661889"
FT                   /locus_tag="Tb10.70.4970"
FT                   /transcript_id="XM_817429.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        692751..694763
FT                   /locus_tag="Tb10.70.4970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746934"
FT                   /db_xref="GeneID:3661889"
FT                   /translation="MMNLGETLDTGSADGRPGPSPTLSVGSGVTPAPLNSSTVHLTRTV
FT                   DSELGDTNIGYDIAVSPLNAETESLATRRPSALDIFPPAGLNRTDDGKPSSSHPASKPY
FT                   VTGGDEGKKQSECWDADENFLLKHTKHVFILTSAGKPIFSRYGNENTISELFGVFQVLI
FT                   TMAQQKQDGGTLHWINAADLTIYFHVDGGLYYVLVTRGGESPYSCRRQLKQLHYQLLSL
FT                   VPNVNDILSRCPSYDLRRLVSSTDGGVLRQLIKRNSREECYMFRCLAASPLSVASRCHL
FT                   TSILTQHYRSGFSKGDISSEGGVAADCHLFSFFFFRGRVVCMVGLADGKVSLHIDDTLI
FT                   LLNFVRCLPLSQVGEIWAPLCLPRYNDTGYLWCYCTDMGAMVNELDSSESGYVAKDDHH
FT                   GVEKPTAKEPFAETKRSELLLVQVASSQLAFAPLSMQAHCIAQMLQTSFTPLIDELEAR
FT                   ENIPLSLALPNVVAQRQQEVHEKISRLLTRAEQQYPECLPSASHAPSSLQLPPVPVHPY
FT                   GLQWFALILKQPSNVIYSEPSPAMKLDPRLKKRQLRLLVRLRYELALRTNQNEQLLVLN
FT                   TEEVNVVVMKPTPNLLTSLVQQFGSRDECVNNVSLSSGNATALCSHLQELLLLFSPHVP
FT                   KHQMLLCAVSVAVGVMARECELSLQQPRSSKSRVW"
FT                   /protein_id="XP_822522.1"
FT   gene            695131..697221
FT                   /db_xref="GeneID:3661890"
FT                   /locus_tag="Tb10.70.4960"
FT   mRNA            <695131..>697221
FT                   /db_xref="GI:71746935"
FT                   /db_xref="GeneID:3661890"
FT                   /locus_tag="Tb10.70.4960"
FT                   /transcript_id="XM_817430.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        695131..697221
FT                   /locus_tag="Tb10.70.4960"
FT                   /gene_family="HOG000260214" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="contains WD40 repeats, similar to U3 small nucleolar
FT                   RNA interacting protein 2"
FT                   /db_xref="GI:71746936"
FT                   /db_xref="GeneID:3661890"
FT                   /translation="MLAKKRAERQHAITATAGGERKKELQKLKRRREESNEEAKRDGRS
FT                   SERKHRLSGSERLSEDPMLLSAEDPTSVLRAIGDHVNTRLKELDFDDDIDADLFDERQR
FT                   QLREEAELAAGTRSRLLASHIAEFLHKQQKKGTIESEKVESPSATDVSAVFVAHNSNAV
FT                   TAVCSLGNEIVFLGDKTGAVYFVELRDNAGSTRKELLSPCLSAAVLSIAVSDTRGVRPS
FT                   QRTLFERTTADVSVTSYVAVGAADGTIGIWVTDTRRHLGTLTMHRSAVTGLAFRNDTLY
FT                   SGGYDEALRVWALPQMSCEDKLFGHTGRVFGLHCLRRERCATVGDDGTMRFWKVDAATQ
FT                   QEFTASAHFGGKVVLECVVMMNDFIVLCGAANGALLVFDVGKRKPVAVREGAHGYGFVG
FT                   DGTGLESEAIAMRQKLDGSVVSETRIPNPITAVAAIPYSDTAASASYDGVVRLWRVGAA
FT                   SESSGKTGTGSGVPATPVVQPSSLDCLASIPVRAIVTSLYFPPTSDVLLIACSKEPRLG
FT                   RWVVQRSALNSVYVVPLNQETRFKLSSRGRVEHLPTLLYGIDNDGASDEADRMEDATEG
FT                   LSDAGGRGGSYRSHDEVGNGGEEGDDGTETDNSTGMFTVGEEGQMKFSMPMSNGDRYHG
FT                   TKKKSKKRTPGAKGEVCAPKTSSKRSSTEAAEEERRKRKKKKDKKKGAGGGKHSTAGEE
FT                   DK"
FT                   /protein_id="XP_822523.1"
FT   gene            697398..697592
FT                   /db_xref="GeneID:3661891"
FT                   /locus_tag="Tb10.70_v2.40"
FT   mRNA            <697398..>697592
FT                   /db_xref="GI:71746937"
FT                   /db_xref="GeneID:3661891"
FT                   /locus_tag="Tb10.70_v2.40"
FT                   /transcript_id="XM_817431.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        697398..697592
FT                   /locus_tag="Tb10.70_v2.40"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746938"
FT                   /db_xref="GeneID:3661891"
FT                   /translation="MDGKERCFLRSSGICMNEQANEIAQAHNPCTRGRVQSSGTFLCNG
FT                   EETTVLTEGGRGRVVEAKQ"
FT                   /protein_id="XP_822524.1"
FT   gene            698633..699838
FT                   /db_xref="GeneID:3662229"
FT                   /locus_tag="Tb10.70.4940"
FT   mRNA            <698633..>699838
FT                   /db_xref="GI:71746939"
FT                   /db_xref="GeneID:3662229"
FT                   /locus_tag="Tb10.70.4940"
FT                   /transcript_id="XM_817432.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        698633..699838
FT                   /locus_tag="Tb10.70.4940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746940"
FT                   /db_xref="GeneID:3662229"
FT                   /translation="MNSEEYSNIYFPPSLAPSRPTLEEVGFLGTKTAGGAATNANGNGN
FT                   DATAGSKRQRLCEKEGGNSNGEVTACCTEQNNLEGNTSQTCQRSDTIDDTGGGNNNGGD
FT                   SPQKFHDGLFEKMLVFHTIPESAMQVVARYRVTPQRLEHARNIFKLFEGTHSYHNFTPG
FT                   GKASDPSSARYITSVTVSEPFVVDPSDDAMLSALQLWAPSRYYSPDDERLVSGEVKDDD
FT                   EVEQERERMRERMIRIYGTPAAEGTGDINRNMGDRNRVGLEVVRIELSGQSFLFNQIRK
FT                   MIGTVASMCAAGLPPDYLRDHFLNKAVRCGTPMVPANGLFLTYLDFQRYNYRLDRIQLE
FT                   GENGKGKGGIYVDRVDEQAVETFRRKIVAVVLRNEMVTDAIGRWMRSLRHVMRLACKIE
FT                   LP"
FT                   /protein_id="XP_822525.1"
FT   gene            700304..701188
FT                   /db_xref="GeneID:3662230"
FT                   /locus_tag="Tb10.70.4930"
FT   mRNA            <700304..>701188
FT                   /db_xref="GI:71746941"
FT                   /db_xref="GeneID:3662230"
FT                   /locus_tag="Tb10.70.4930"
FT                   /transcript_id="XM_817433.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        700304..701188
FT                   /locus_tag="Tb10.70.4930"
FT                   /gene_family="HOG000260216" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746942"
FT                   /db_xref="GeneID:3662230"
FT                   /translation="MWDVVSRVGKAAYRTAALTGLAAGTEQPPYPCALPLKTVSSDSDV
FT                   DSMREVLNSAFDASKDMLENNGEHQWQLVDYVDPEEGGDLHLFTRPRVGPFNFVKATLS
FT                   FMGVSPQNVLDTMHSDNADDRKRYSANLSHFEVLAKPMAGCAIELHKYWAPPPVAGREF
FT                   VFAAEKKYVESENVYYVHGCSIDYTPQMETSKGFVRAACLWAWKLMPVGDNTLATYVSC
FT                   MNPRGWTPPFIFGWLKSEIGKELVACRRVLYGETVKVERTTLQGMGLSDEVNNLTDEER
FT                   KRMSEGEPQPEAS"
FT                   /protein_id="XP_822526.1"
FT   gene            701334..701672
FT                   /db_xref="GeneID:3662231"
FT                   /locus_tag="Tb10.70.4920"
FT   mRNA            <701334..>701672
FT                   /db_xref="GI:71746943"
FT                   /db_xref="GeneID:3662231"
FT                   /locus_tag="Tb10.70.4920"
FT                   /transcript_id="XM_817434.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        701334..701672
FT                   /locus_tag="Tb10.70.4920"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746944"
FT                   /db_xref="GeneID:3662231"
FT                   /translation="MRRPMGNEKADNMNMEGNRGMDYTDITGERKEVVKVFWRIRGDWR
FT                   EWETDKSRSGEEFEVRSQVPSGRTFGGLMFFFRWARSALSCSFPVRSVLKRWRLWYVID
FT                   KLERWENK"
FT                   /protein_id="XP_822527.1"
FT   repeat_region   702542..702571
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="catata"
FT                   /rpt_type="tandem"
FT   gene            703311..704696
FT                   /db_xref="GeneID:3662232"
FT                   /locus_tag="Tb10.70.4900"
FT   mRNA            <703311..>704696
FT                   /db_xref="GI:71746945"
FT                   /db_xref="GeneID:3662232"
FT                   /locus_tag="Tb10.70.4900"
FT                   /transcript_id="XM_817435.1"
FT                   /product="deoxyhypusine synthase"
FT   CDS_pept        703311..704696
FT                   /locus_tag="Tb10.70.4900"
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyhypusine synthase"
FT                   /note="go_function: deoxyhypusine synthase activity [goid
FT                   0004171]; go_process: hypusine biosynthesis from
FT                   peptidyl-lysine [goid 0008612]"
FT                   /db_xref="GI:71746946"
FT                   /db_xref="GeneID:3662232"
FT                   /translation="MAELAKSAVLVSSCTDDLLGDAKQVVVGPNQEDLHSAEAVLNRYS
FT                   TVGFQASNLARAFSICEMMLTPQSPSPSLMPTEGDQASESPVMVQPTLFVGVTANLFGT
FT                   GCREAIRFLCTECVPLPNGVEPATPLDDMAGISCDGTGALKPSPCDSRALIHVLVVSGG
FT                   AMEHDIRRACESYKLSRDGAEEEGEQFHHPVERDRSRSKGTDCHFGNVRYNSSGVASRN
FT                   LFSCVMRCLVKRLAEAQRKEKANREAAPIPEAYYDVCSWAITPSTLWYMAGLWMADIFT
FT                   EALQETGEVTDEKVASEEGLKRAKSTVLYWAARNGVPIFSPSLTDGDIMEFILTAGDTG
FT                   VPLLQLDLVADIHRLNRLAMRSRRTGMMILGGGVVKHHVCNANLMRNGADYAVFLNNAQ
FT                   EFDGSDAGARPGEAVSWGKLRLDSTAVKVYSEVTIVFPLIVVHVFVAWVRMMRSKGKEN
FT                   IRS"
FT                   /protein_id="XP_822528.1"
FT   misc_feature    705131..705153
FT                   /note="AT_rich"
FT   gene            705258..707426
FT                   /db_xref="GeneID:3662233"
FT                   /locus_tag="Tb10.70.4890"
FT   mRNA            <705258..>707426
FT                   /db_xref="GI:71746947"
FT                   /db_xref="GeneID:3662233"
FT                   /locus_tag="Tb10.70.4890"
FT                   /transcript_id="XM_817436.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        705258..707426
FT                   /locus_tag="Tb10.70.4890"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746948"
FT                   /db_xref="GeneID:3662233"
FT                   /translation="MEGRHGFNFHSLGGAVDSHNIFSALSGRDDGNVDSNGAAMWDIAT
FT                   NLVLTLLLTALSKYVRRFLMETWPAWVSKQFKRLLGTREEGVVAAADVFRSQPEEFAFD
FT                   NEILVVAMERYISWVLFSKGKPKLNKGSATGANIPAEGVSEQSIPLLRHAQYLYTPLNL
FT                   SPYRGRKDMFNVLRRYYRVLLVPGDGDVLEVEPGLTICFHQQFVSTSSLKSGKPVSLRG
FT                   NAEVLREYPPVNFDATPLDPGAKNEDVSQSGSDDSQLHDDGKTTRQSGNERDAYLRTRK
FT                   VIVRRALLRCTDADKGRERILNFARRAYEWYISTVGDVVERYYFHPSRSELQCAITSKW
FT                   LDESVMPLRFPMRRYMIPTGRCGFESLFFRQKSDLITCLTEFKEKRGRFGVPGVAQQLL
FT                   ILLHGPPGTGKTSVIRAIAGYLNRSIVAVPIEYFQTNSKLQEILSGGTVKLEGYSAPVA
FT                   GNECDLEVRKIVYVFEDFDVVTQLIPFRMSLTHQRCPPSSVSSPTSFDGVEVGCGTPTS
FT                   AFEAGDDDLSTEIPQTLHEDTLLPDEGPNSPPNVDADASVKGRTSEAESKKESINDNLL
FT                   EGACDESDAISEVSVSEMRRFQRRLARDFLSPEGLLRTLNPCFAQPDRVIVFTTNHVEL
FT                   LPAELFRPGVLTMDIHMSNWEAKTAFEFIAHHFRNSLTTELQQRFETFFLRCEKEGRQV
FT                   FMNPSSLEHLLLTYDSAEDLLLELERQY"
FT                   /protein_id="XP_822529.1"
FT   gene            707798..708946
FT                   /db_xref="GeneID:3662234"
FT                   /locus_tag="Tb10.70.4880"
FT   mRNA            <707798..>708946
FT                   /db_xref="GI:71746949"
FT                   /db_xref="GeneID:3662234"
FT                   /locus_tag="Tb10.70.4880"
FT                   /transcript_id="XM_817437.1"
FT                   /product="eukaryotic translation initiation factor 5"
FT   CDS_pept        707798..708946
FT                   /locus_tag="Tb10.70.4880"
FT                   /gene_family="HOG000260218" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="eukaryotic translation initiation factor 5"
FT                   /note="go_function: translation initiation factor activity
FT                   [goid 0003743]; go_process: translational initiation [goid
FT                   0006413]"
FT                   /db_xref="GI:71746950"
FT                   /db_xref="GeneID:3662234"
FT                   /translation="MTSSMIPVDPDKRDDIYYRYKMPAIQTKVEGSGNGIKTVFPNIHD
FT                   VCLAINRPEEVLMKYFQSEFGAQRTVSEKDDKFLIMGSHTEERVQEKVYDFIRQFVLCR
FT                   SCRNPETQLSVERNKKGAPQVSMSCGACGKSMKLEDLGARYVTALATHFAKNPQAALRK
FT                   GAGTAEARKKDKAQQEEAAAAAAAKLAVPVEKHVIMKSDLQDTREAPQEVLARFMRQCE
FT                   GDYEEILRHSMELMSTYNLKDKMGPLLVLNAIVIAEKEFMAGLRRHTALLKRFSTLPDS
FT                   VLYDASADETTKTERQKRKMQLQVAAMEECARICVQHLKPEQLVVALFVLFIEGVLEGE
FT                   SIKNWHNEGKPPSKVDPAVYAEMREAVEPLVVWLDGNKCVAA"
FT                   /protein_id="XP_822530.1"
FT   gene            710164..714756
FT                   /db_xref="GeneID:3662235"
FT                   /locus_tag="Tb10.70.4870"
FT   mRNA            <710164..>714756
FT                   /db_xref="GI:71746951"
FT                   /db_xref="GeneID:3662235"
FT                   /locus_tag="Tb10.70.4870"
FT                   /transcript_id="XM_817438.1"
FT                   /product="DNA-directed RNA polymerase III largest subunit"
FT   CDS_pept        710164..714756
FT                   /locus_tag="Tb10.70.4870"
FT                   /gene_family="HOG000222974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase III largest subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   DNA-directed RNA polymerase activity [goid 0003899];
FT                   go_process: transcription [goid 0006350]"
FT                   /db_xref="GI:71746952"
FT                   /db_xref="GeneID:3662235"
FT                   /translation="MLKGGSSTSFLLPQQFVEPLPHAPVEISALHYGLLSRNDVHRLSV
FT                   LPCRRVVGDVKEYGVNDARLGVCDRLSICETCGLNSIECVGHPGHIDLEAPVFHLGFFT
FT                   TVLRICRTICKRCSHVLLDDTEIDYYKRRLSSSSLEPLQRTMLIKTIQTDAYKTRVCLK
FT                   CGGLNGVVRRVRPMRLVHEKYHVEPRRGEGPRENPGGFFDAELRTACAYNKVVGECREF
FT                   VHDFLDPVRVRQLFLAVPPGEVILLGLAPGVSPTDLLMTTLLVPPVPVRPRGCAGTTTV
FT                   RDDDLTAQYNDILVSTDTMQDGSLDATRYTETWEMLQMRAARLLDSSLPGFPPNVRTSD
FT                   LKSYAQRLKSKHGRFRCNLSGKRVDYSGRSVISPDPNLDVDELAVPLHVARVLTYPQRV
FT                   FKANHELMRRLVRNGPHVHPGATTVYLAQEGSKKSLKNERDRHRLAARLAVGDIVERHV
FT                   MNGDLVLFNRQPSLHRVSMMAHRARVLPFRTFRFNECCCAPYNADFDGDEMNVHFVQTE
FT                   KARAEALQLMSTARNIISAKNGEPIIACTQDFLAAAYLVTSRDVFFDRGEFSQMVSHWL
FT                   GPVTQFRLPIPAILKPVELWTGKQLFELIVRPSPEVDVLLSFEAPTKFYTRKGKHDCAE
FT                   EGYVAFLDSCFISGRLDKKLLGGGAKDGLFARLHTIAGGGYTARVMSRIAQFTSRYLTN
FT                   YGFSLGLGDVAPTPELNKQKAAVLARSVEVCDGLIKSAKTGRMIPLPGLTVKQSLEARL
FT                   NTELSKVRDECGTAAVQTLSIHNNTPLIMVQSGSKGSALNIAQMMACVGQQTVSGKRIL
FT                   DAFQDRSLPHFHRFEEAPAARGFVANSFYSGLSPTEFFFHTMAGREGLVDTAVKTAETG
FT                   YIYRRLMKAMENLSVRYDGTVRNTKGDVIQLRFGEDGLDPQLMEGNSGTPLNLEQEWLS
FT                   VRAAYARWVVGLLAGSKTASDGNAIRDNENYFNEFISMLPTEGPSFVEMCLNGDQEALK
FT                   VCEEQESREDALHNSNGKTNDRESRPRTGRLRRAVLISHLVKVCSRKFKDDIQDFFVKK
FT                   VREQQRIRNLLNLPNTSRERTEGGGDNSGPIANKRTKKRAPSLKVKDSKEGGRVSELRD
FT                   LEMLQTELLPLTRGMVTRFIAQCASKYLRKACEPGTPCGAIAAQSVGEPSTQMTLRTFH
FT                   FAGVASMSITQGVPRLVEVINANRNIATPVVTAPVLLMEGEENHCEIFRKRARFVKAQI
FT                   ERVLLREVVSEIVEVCSDTEFYLRVHLNMSVITKLHLPINAITVRQRILAAAGHTMSPL
FT                   RMLNEDCIEVFSLDTLAVYPHFQDARWVHFSLRRILGLLPDVVVGGIGGINRAMISSNG
FT                   TEVLAEGAELRAVMNLWGVDSTRVVCNHVAVVERVLGIEAARRVIVDEIQNILKAYSLS
FT                   IDVRHVYLLADLMTQRGVVLGITRYGIQKMNFNVLTMASFERTTDHLYNAAATQRVDRD
FT                   LSVSDSIIVGKPVPLGTTSFDLLLDGSISNDVLPPQRCVKRGMGPNFHTAKRHHLVPLA
FT                   AEGVFRLDLF"
FT                   /protein_id="XP_822531.1"
FT   gene            715544..718750
FT                   /db_xref="GeneID:3662236"
FT                   /locus_tag="Tb10.70.4860"
FT   mRNA            <715544..>718750
FT                   /db_xref="GI:71746953"
FT                   /db_xref="GeneID:3662236"
FT                   /locus_tag="Tb10.70.4860"
FT                   /transcript_id="XM_817439.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        715544..718750
FT                   /locus_tag="Tb10.70.4860"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746954"
FT                   /db_xref="GeneID:3662236"
FT                   /translation="MDNSEAVRKGGIRPGVTSGDVGRIEKRNSEPQHSIFGTEVAGGLT
FT                   TERFVSSTRNFATTRKVQKLLDVTVNDNFRELVLYMNDVVPEFLEGLYFQRGDLPSGGS
FT                   EKTTPLQRPQQHNSAVASVNANGVTTATTTTTTGTASSLSSHSSAALRAALEGRVVDVH
FT                   QRFLQEWSTLNEVFEEVYSLVTKLHRESEVLEATLGAHAAQAEDFSGLMTTLQAELTLV
FT                   HQREREIKEFQGRYHFTAEEQRILEEGSVDTTYLDVLSSVQATHRECRQMLLSRESYQS
FT                   AAAVMDSTYIAIIKGTEKVARHLKTLSGRSTSGPTSSCGEAPELTNFYLRCMNFLREEN
FT                   KAQWASVVEEVARLRRAAVLRQYFHLLTTGSTTTASRTYHMGGGERHNSAGGGEGSSAG
FT                   IRPLEAEIGNPVFFFSSLFAWLHQAIVDEDDFFSTFFTSPVLEPRQPPLSGGKGECTDA
FT                   LEGGRGSPCSATVANHFDEPVGEDLMLSKSSVLDSVFDVLCKHIQSVLEGVLERFLRTA
FT                   SNLQDADGVGSNTGEAGSPGTEDFSSKAGSSRMGPSGPIGLTGGIARLLSAAAGRPLSL
FT                   VSGASKAENRYQHVMNRSQLEALVATTVSSLTSGLQTTHALLQLFTYCSTSTFTALLGR
FT                   DAALTRLIADDGKMQLLRVYHTIAKHLSDHSLDSVAGVVSRSAILRRLASAEALEWKLG
FT                   GTARYFVVDFLLEYKVEDERGLDGSSFHEDQMKAQERSASTQGLKPSSFSGRPASCNPY
FT                   LRSGLSKHQAQAAELLRTLETMVLPVPPEVAECLRVLQATMVEAQKHAEIMESLHVSPS
FT                   YGLVQEVSGGAEAASAAPPCSEQFFAVIVQHLMSFPTVLAHQPVLSSGVDEPCKLVIQL
FT                   NTMNALYETLVPHTGSSASGSKLAHYTMPLLSTVMERIEDLIKELVAALSQCVARHYLG
FT                   EATNEGDEMEKAICTPEAAKTIESTGGGDGEGGVAAKEFDTRTVMDKLNEFYSVVAASG
FT                   RLYVPIVSSLASPPLRDRVMQGVLDITLAVYERRYEQLLNLSSEGGSDITTTLSSDLPG
FT                   RTSVEDLHPDKLRILLDTTP"
FT                   /protein_id="XP_822532.1"
FT   gene            719410..719892
FT                   /db_xref="GeneID:3662399"
FT                   /locus_tag="Tb10.70.4850"
FT   mRNA            <719410..>719892
FT                   /db_xref="GI:71746955"
FT                   /db_xref="GeneID:3662399"
FT                   /locus_tag="Tb10.70.4850"
FT                   /transcript_id="XM_817440.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        719410..719892
FT                   /locus_tag="Tb10.70.4850"
FT                   /gene_family="HOG000260224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746956"
FT                   /db_xref="GeneID:3662399"
FT                   /translation="MVFYSFVLVMKPRQRRFTSQALREIGVAVYSNGGLIRSITNEGIM
FT                   RPYSRFRDADNTPLTYARYIILQLDMGEEEMGKVDKIIREHQDVLMALKLNNLERPVGI
FT                   RSGNKELQAAYFPLDTFTRLEEEINWSPQTSADIYTQLEMNWKEFSRTRWSSFLRN"
FT                   /protein_id="XP_822533.1"
FT   gene            720186..721202
FT                   /db_xref="GeneID:3662400"
FT                   /locus_tag="Tb10.70.4840"
FT   mRNA            <720186..>721202
FT                   /db_xref="GI:71746957"
FT                   /db_xref="GeneID:3662400"
FT                   /locus_tag="Tb10.70.4840"
FT                   /transcript_id="XM_817441.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        720186..721202
FT                   /locus_tag="Tb10.70.4840"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746958"
FT                   /db_xref="GeneID:3662400"
FT                   /translation="MCNDDARQEGVQWPSSQQLAALADIEGDVQMKAAQLGLLSSEYRA
FT                   NIARVLHHYEPQAATFRTIIYASEQKRKAVERELVWTERIALLQEQRCGTTIVSTRDLM
FT                   VLEREPLHPVECSLKECYQKLENVAYNELCVLRNYEYPPRQAVATMRMIMRVRGEEDLS
FT                   WENVQVVLSENYFYTFFVSRMRTLLQKRLPDDVLEELEQYCLNPEHAPEALAVVSVPLG
FT                   VIGSLLHAVRDYFQVMDLVKRPVEPMSVEERRKKAGELRRALQTLKEDAATATEGMADL
FT                   KARIASKFVTVRDEYDDTMCPLHDDLEKKTEDFLKVLSGDIPAEEGATGEGECPDAM"
FT                   /protein_id="XP_822534.1"
FT   gene            722183..723673
FT                   /db_xref="GeneID:3662401"
FT                   /locus_tag="Tb10.70.4830"
FT   mRNA            <722183..>723673
FT                   /db_xref="GI:71746959"
FT                   /db_xref="GeneID:3662401"
FT                   /locus_tag="Tb10.70.4830"
FT                   /transcript_id="XM_817442.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        722183..723673
FT                   /locus_tag="Tb10.70.4830"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.4830 by DGPI
FT                   v2.04 with cleavage site probability 0.702 near 476"
FT                   /db_xref="GI:71746960"
FT                   /db_xref="GeneID:3662401"
FT                   /translation="MPATREGTKSVTAETFAVEIVHLVRLHQIHTVTLCCPTEELRVEP
FT                   AALPMASTITVEARLLSSLDWNCDTAKNCTFDAVLAKSNGTVFTYHILFATAVTSRDSA
FT                   GAAISERQGTQLSAHWCSQLQRRLAICSALTGVPSHLSVLLLPYVPHLSWNRDRDGILG
FT                   AIHSATMMSTITARDLDDNDTSEARYDVRVAALLNAAVPLGPRVGYHTVALFLNAIDGD
FT                   ACFREALSPNNLRESRKRVRQSQKGCIKPGKDTSFCFPLLAEFNEKYLLPALSWGALHA
FT                   STLEGKGNHYDVCGLGKDMGCSVYLRGTLDALRVRSVTVIVDGPRDLWYRVISPYEDTA
FT                   APVASMKPSLLQLAGKLAETVEAALCRLVAENSDSFVHRAMVSPSREDGAACVAAGPEI
FT                   EVGTIVPIGQSCPLLIQSIADSLAHIVRTSQNPLFVADVQRLLQLHLMEGDTPSHVMEL
FT                   NADGGVVAESRGDAATQSSVGSTAAALQWAVETRLLKL"
FT                   /protein_id="XP_822535.1"
FT   repeat_region   724036..724077
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            724257..724667
FT                   /db_xref="GeneID:3662402"
FT                   /locus_tag="Tb10.70.4810"
FT   mRNA            <724257..>724667
FT                   /db_xref="GI:71746961"
FT                   /db_xref="GeneID:3662402"
FT                   /locus_tag="Tb10.70.4810"
FT                   /transcript_id="XM_817443.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        724257..724667
FT                   /locus_tag="Tb10.70.4810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746962"
FT                   /db_xref="GeneID:3662402"
FT                   /translation="MHPRVAKLYLDFMQLAPHATTFCGSTTAYRAAVQEGFSATRVVPG
FT                   TPEFAHSLAKGRSVLGRLQDLITVRKYRAMMKRYSWSSYKNKQELVALLGETKAQSELL
FT                   GLNNRDVYGYDDHYCHHAPSKPMGGEGDFSEK"
FT                   /protein_id="XP_822536.1"
FT   gene            725184..725525
FT                   /db_xref="GeneID:3662403"
FT                   /locus_tag="Tb10.70.4800"
FT   mRNA            <725184..>725525
FT                   /db_xref="GI:71746963"
FT                   /db_xref="GeneID:3662403"
FT                   /locus_tag="Tb10.70.4800"
FT                   /transcript_id="XM_817444.1"
FT                   /product="ribosomal protein S25"
FT   CDS_pept        725184..725525
FT                   /locus_tag="Tb10.70.4800"
FT                   /gene_family="HOG000203673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S25"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71746964"
FT                   /db_xref="GeneID:3662403"
FT                   /translation="MPPKKGGKDTKQAPKKGKMENLNKGAKKAAKKWSKGRTREALQNA
FT                   VMFDKETMDKLMKEVPKYKVITPSIISDRLKISVALAGKGLQHLCRQGLIRLVSCSSKF
FT                   RVYTRAATA"
FT                   /protein_id="XP_822537.1"
FT   gene            726090..727226
FT                   /db_xref="GeneID:3662404"
FT                   /locus_tag="Tb10.70.4790"
FT   mRNA            <726090..>727226
FT                   /db_xref="GI:71746965"
FT                   /db_xref="GeneID:3662404"
FT                   /locus_tag="Tb10.70.4790"
FT                   /transcript_id="XM_817445.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        726090..727226
FT                   /locus_tag="Tb10.70.4790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746966"
FT                   /db_xref="GeneID:3662404"
FT                   /translation="MERVTLSAPFNGRRLLSNESLVESQEARKGGLSSNKFPGRGRSVE
FT                   PPLQSQDKDPTIKKPTALVMAPLGNTGLALPRLPTVPVPNVRRRIFKRPSLHIPVGTLE
FT                   PVINLRQLKKVGEQVGRRHGEHTLSRNTEVGTEWKTGSGVGELANAKKSLRPRTALESP
FT                   TAARRRAQSETIADPFTIRREGCVSLGLSQGLKSGSVLAHTLSSMRPRSTVVDGLVCSS
FT                   LRQQEQPEGVFASECGGIMGYGATATTNALFSSSNSPNKITDETSGMCMSDSFSGGSSS
FT                   GDGSDIEDLDDEGNSRPHSCFGDRIVISVSSGNNRGGRYFTHESKIRDISRRVAYNNFL
FT                   DEEDIPVVSTRSLVRRPNGTRVTMKEGIKEDGIPSTTQ"
FT                   /protein_id="XP_822538.1"
FT   misc_feature    727299..727321
FT                   /note="AT_rich"
FT   misc_feature    727955..727977
FT                   /note="AT_rich"
FT   gene            728394..730736
FT                   /db_xref="GeneID:3662405"
FT                   /locus_tag="Tb10.70.4780"
FT   mRNA            <728394..>730736
FT                   /db_xref="GI:71746967"
FT                   /db_xref="GeneID:3662405"
FT                   /locus_tag="Tb10.70.4780"
FT                   /transcript_id="XM_817446.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        728394..730736
FT                   /locus_tag="Tb10.70.4780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746968"
FT                   /db_xref="GeneID:3662405"
FT                   /translation="MSTPKCTKQSINRKRGQGTSGLKASALVATADQGDPPPFSPSLEL
FT                   TFRGHRSTVLAASFRPTAVSYSYSSLDGRGSPENVWSSPCILSGGADGYVFMWSARPTV
FT                   RALRFVGPHSPVRDCAWSSHGQLLASAGHDGFVRLWLPMLRRTSGLTGSSSSGGGCVGS
FT                   GGENCYLWRAHEGPVRALAAAPYDDYLYTAGDDKSVKCWDLNYSPTRSSSSGKSGGHKF
FT                   VCGFVGGHQNWVRTVAVSNGMSALPSHGPLVASGGDDRTVQVWDPRSRRPTHTFYEHTD
FT                   SVRSVDFHPDGCSIATGSSDHTINVYDLRLNRLLQHYGAHDGAVNEVRFAPTGSWLLSA
FT                   SADGTAKLWDLKEGYLYCTLSAHEGGVYTSRFSDDSRHLVTAGQDGLVMMWRTGLLRTQ
FT                   PVYATHFYAGKCPPVGAATEPLPLPAATSINTEPRPEDGFDHTHLADSTVVNREGRRCG
FT                   SRDAKELGTCLARSRRNSTDVVSGHRTSEGKRPNVGVAKSKLGNRATFSVASSQNSAVS
FT                   SQRPPLAQPSLQAGGSAAAAAMAVSAEIDDCPFAACLRNDVCNGVGSGNSIAQSFSRSE
FT                   RRERTPVKPKTETHNGSEEFSVPNEAFHTVSMKVSVSDGGHQQGEENQRRLQPQERHHP
FT                   LPTNAQVTSAVGVEGSLRGNTSGVGEEDEEMCVVEYIDDASGEARYNGWMNCAESASHH
FT                   VDHSMLSRKGDEHNMNARLERLEKAYARLAEEVQVSQRHTVEVVQKQQENWELQRQQQR
FT                   AEMEQLRVMMAGLVAQQDALLEALRKA"
FT                   /protein_id="XP_822539.1"
FT   gene            731881..734370
FT                   /db_xref="GeneID:3662218"
FT                   /locus_tag="Tb10.70.4770"
FT   mRNA            <731881..>734370
FT                   /db_xref="GI:71746969"
FT                   /db_xref="GeneID:3662218"
FT                   /locus_tag="Tb10.70.4770"
FT                   /transcript_id="XM_817447.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        731881..734370
FT                   /locus_tag="Tb10.70.4770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746970"
FT                   /db_xref="GeneID:3662218"
FT                   /translation="MDWALFSRAVEDSDEPTPAYIYREVARWTMHDLRLQRKLIDALFT
FT                   ELNTTSSPRVMCKVLRIIKAVCEMGHDGFQQEVQKGSRVAVVKRFVSHGAVPGNAQHSQ
FT                   LCEKVRQTAREAMEAIFGDHQEIRKAAMTSYGSGSSVDVKHCRSGIASAGGGVKQPTES
FT                   TTGTTGVLISTVAEKVVSSLGILTKREEVLRRAHAKEQLYSDIIRATSSNSGEGLLSEA
FT                   DMRVLHCHDSGVAFEPPPSSNCESNHSTDSAWGFISGNQKVGDGSVACVKGAGVSGHSP
FT                   QPPNPFQICVQRLCQVKNTPQRVELYGFVTQCLEIGEKMMQQQGNFVGGVSEKGTEVSC
FT                   WSLLAEAVDEQMTPVRPWQRRLNALTALEALLLARGDDPMTSPMRRDVADYFCKNPQGV
FT                   ERNVSVVQATLREQARRLVELLCLPAVISNSSVTGDLVTISTAGIPVVPKEGQLVKGVF
FT                   DNFKGSSSPESLVGGMEHVVSTENVTTSRGLDVTGMTLRGARHRSSNRTTLRRRAPVLE
FT                   ARRGDIDGKGVFSGDRGPSEISRSAGCGGASTDAFPAGTDADLCPFHYVDEKLRDGGAT
FT                   RDKFFTEQGASPPIGNSVLDELFGGTTMCSTVCQAPSGCALPAGGTSLWGGGTEINGFD
FT                   PFSETSGTSGDRTTLPTATSQQQLRSSQSWACFEPAKQTIDSDGDGRTPKTASFVSPEV
FT                   FTGTIAHAVATSGSSYQIAQPQQRMEWLTGNPQGSHSPAGVSHFQAPQAQQQHLMHLIS
FT                   QPQQLQPADRISSEADGLTPTVTVDHCPNTTTVHTHSHFMMGEVPDSANAVRETLLKLQ
FT                   ADMKASISAAKLQYQSE"
FT                   /protein_id="XP_822540.1"
FT   gene            736188..744269
FT                   /db_xref="GeneID:3662219"
FT                   /locus_tag="Tb10.70.4750"
FT   mRNA            <736188..>744269
FT                   /db_xref="GI:71746971"
FT                   /db_xref="GeneID:3662219"
FT                   /locus_tag="Tb10.70.4750"
FT                   /transcript_id="XM_817448.1"
FT                   /product="calcium channel protein"
FT   CDS_pept        736188..744269
FT                   /locus_tag="Tb10.70.4750"
FT                   /gene_family="HOG000260229" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="calcium channel protein"
FT                   /note="go_function: ion channel activity [goid 0005216];
FT                   go_process: ion transport [goid 0006811]"
FT                   /db_xref="GI:71746972"
FT                   /db_xref="GeneID:3662219"
FT                   /translation="MAEPPPPQPLRKGFFRADPHGLRPPESPRDAEEPENHDIVEDPPL
FT                   PSSRNLPPPRLRPMGGGPPLAGAEAAATSHSNNRPSPGEVPPLPRPGTTTAVTSAQYNS
FT                   LTPRQELFSSPQTAVEENIPAGYDNQMNVTSNDFSHSQDTGIKRIGDGATGSSAKTRST
FT                   IAHAPSGRFSEVVQERPPIESVEQLCQLQTLAHPVERFFVEYQPMATRGCRSTQVPVEE
FT                   DEALFNHLAEYTDDDSFFSSGSAVLEEDTRRLQNDPLRGRAIRSVFETLSLRSLTKGRI
FT                   PYELEDQERSSAPWLKQVHQRAIALHHSSFFIFPAGMKARVIAYNILHHWLTEMLLMLI
FT                   ILVYSMMTAAWSRDTWPTLEKPSFMFFADVFFLCIYAIEFVARLFTSGAVSHSRAYFRS
FT                   PWHCLDAAVLLLMILNCTNLQSMWNFSAFRLIRVLKSSTYVPIPINMKLLAKSLLRSTS
FT                   NVVKVSTILFYVLLFFSLVGLQLFSGVLQHRCVSPTTKNVTNQLCRFNHSEKNESYYHG
FT                   ATCPSPHLCVADTYGNPHHGYRSFDSVGHSFLSAFQIMTFQGWTSLLQETSDTTSVAAI
FT                   LYFFLAILICAWIIPSLYLGVFIEKIEKTRRLFVQKQLQLFDGMLLEQRQRLNEAIKLR
FT                   DFVERDESGKLRRHPIELIRSASRRIQRSKLSNSQTSIATESESGEPAVVVKKPIGDTT
FT                   KGRSRWTDEQRVQLHLSLTRQRDIASGGERRRRVVIKNDGEISGGTAGLHSQRKGSESI
FT                   GERAMMVTGDFALGGRVGVVQHHPLTHTIGAAHGTDLPLAVRLDNEEEQLRFLKDYQNP
FT                   IDNDIMRRTNTFEDTNGNLHPSFVLTSTQRRGGSFDEASNTIRTTTEAAGVIPSRHSAT
FT                   LNGHNTSRMDSNGSLDEPTSKTQTVSKRGSPMPRLSSGQVPEVIIHDPEGGDFRFAETR
FT                   SQKWGIVRNILHMFTEGYPRIITQYIREHRRMQRRFGLTPLNYVNKYEDDVLRKLRQRR
FT                   VLQVKEPGAPSQTSRASGDEELVEVNGNKVILTDSDDIGDLSPIQMATNIVRNVPVTPF
FT                   GAVMLVIVIVNGIFNATRYFQQPEYWETALFVLGIIFTSFFVLEIVVRVIGLGLVSFLL
FT                   DFNNLLDVTVTILGFVELAYARSNVVTVLNWVRLLRLFRTLPFAPMRRVSRVLLLGFAD
FT                   MLYALFFFSIYMFMWILIGMSFFGGPNGMVDHTFQDYYTRGNFDTFSGASFAVSQAFSY
FT                   TREEWVYLTWNGMQSRGEYTVLYFMAVVGVAFIARYFFVAVFAWAWQSEEEEEENYAAI
FT                   AKGGSGGRREVTRLRWFDFTVWRSFKHIHGGFERRDVAPDEVFHLNEDMRKQLRIAEAK
FT                   ERFTKEALAQTDLAMSQRRMGSPMASPSATMGYNTDGYAPAAQVGTAPRYVNVGGQLQR
FT                   HINPSVDFVDAQVPPLNAPISQFQAENAQLRFARRYSTVPASVYTPVIQDDGIDRPSPS
FT                   ARSSPSDAGERSGELGGESQQNGQEEGDGQYSPRGVSPNGTGGRATSTGLQRKSSVLGR
FT                   FPRLGYDRAAGKKDGGSRSVSASAMQQTGDGNELRGDYVNEGEVNGGSMVYEHILYPGP
FT                   RLRYKHVMRNQYVRVFERCLDCNTYQQMPLRAPPNVQQRTPEELHAEHCHMAAVRSSRQ
FT                   LVLNAIMGYVRLQKDINQPPTRDAVETVLGQAWSCGMLLFETIEYLSCSDIEQREYRTW
FT                   DRTLEALQLQQWLIGLHVGEEQVGRATLAYTLAHRKREKLAVEHKSFELSWRQRSFFFI
FT                   SPSNPVRRLSTRIIQSRWFDIFILTVIFIASFCLCFHIPGKANDPETGFVVLRAFDGIF
FT                   TCIFLVEMIMKWISMGVILFRPEAYFWHWWNVFDFVIVIVSLIGLADQHSALRSIKVLR
FT                   CFRILIPMRVSNFNRSLSKISSALLDCLPTVANILLLFFINYFVWAVLAVRLLNGLTHS
FT                   CSDPSFVDITACEDAKHEWLPKVRNFDSFFQSLLTMIEVSVGSKWLDVIYTGVNGRTSE
FT                   HAPMDDHYLARGFFFIVYYYVSHLILFSLFTASMIYSYLLTKNAAEGVLGITFEHQLWI
FT                   RMQRMTLQLKPRVKLVPLCNHVSQFLHNVVIRPIFEVVGASVLLLNILTMALHWYGETK
FT                   SKASVLAAFQYVWMFYFTVEAAMKIGAHGMRAFSRWAFSFDFFVLLLSFIGLIVDAASS
FT                   EGMPFNVNVLRMLRLGRFFSAAKVFKPMRKQFSLLHEVLIRSAVSLANVTLILFLGVFV
FT                   FTVLGLHLVGGVPVGEGGYFDDRYTNFNNFGNSLMMTFRLTTLENWSPSLREGMNVTRK
FT                   CTEDDCSVNYGSAFYCLLLLVFLGLIVLSFYMAVIVDHYVTAARMNTSITRIEDLRRFR
FT                   DLWSEFDPNGALVLHTHELPKLLESLRPPLGLTSRHNRVELLRLLREYDIPNHRGKVHY
FT                   HEVLLPLARRVLAMAFSRDTMDYRTTFDTLWRHSEKSLRALPTVLGKRSHATAAQHFAA
FT                   SYVQAVCRRKKACREVQRVRSELWHEGRAVCDELGLPYADYGFGNLLLEGPDPMRDLVP
FT                   RSASAASSGGKGTRKGASEAENAASSPLWRAGQAESPSSPRSEGETIDGRAPAARLPGA
FT                   YQPAIEEREKRFGPDVPNALRRHETRSEKLRRKDEERMLQSTPDDAVSSPVSNVRSNSQ
FT                   RVNVGEYQPPLGTDPTSWLGSNVNRGSTVGGPTTESRTSSVMPAPQGPTAPE"
FT                   /protein_id="XP_822541.1"
FT   gene            745416..746705
FT                   /db_xref="GeneID:3662220"
FT                   /locus_tag="Tb10.70.4740"
FT   mRNA            <745416..>746705
FT                   /db_xref="GI:71746973"
FT                   /db_xref="GeneID:3662220"
FT                   /locus_tag="Tb10.70.4740"
FT                   /transcript_id="XM_817449.1"
FT                   /product="enolase"
FT   CDS_pept        745416..746705
FT                   /locus_tag="Tb10.70.4740"
FT                   /gene_family="HOG000072174" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="go_function: phosphopyruvate hydratase activity
FT                   [goid 0004634]; go_process: glycolysis [goid 0006096]"
FT                   /db_xref="GI:71746974"
FT                   /db_xref="GeneID:3662220"
FT                   /translation="MTIQKVHGREVLDSRGNPTVEVEVTTERGVFRSAVPSGASTGVYE
FT                   ACELRDGDKKRYVGKGCLQAVKNVNEVIGPALIGRDELKQEELDTLMLRLDGTPNKGKL
FT                   GANAILGCSMAISKAAAAAKGVPLYRYLASLAGTKELRLPVPCFNVINGGKHAGNALPF
FT                   QEFMIAPVKATSFSEALRMGSEVYHSLRGIIKKKYGQDAVNVGDEGGFAPPIKDINEPL
FT                   PILMEAIEEAGHRGKFAICMDCAASETYDEKKQQYNLTFKSPEPTWVTAEQLRETYCKW
FT                   AHDYPIVSIEDPYDQDDFAGFAGITEALKGKTQIVGDDLTVTNTERIKMAIEKKACNSL
FT                   LLKINQIGTISEAIASSKLCMENGWSVMVSHRSGETEDTYIADLVVALGSGQIKTGAPC
FT                   RGERTAKLNQLLRIEEELGAHAKFGFPGWS"
FT                   /protein_id="XP_822542.1"
FT   repeat_region   747225..747255
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            747790..750390
FT                   /db_xref="GeneID:3662221"
FT                   /locus_tag="Tb10.70.4720"
FT   mRNA            <747790..>750390
FT                   /db_xref="GI:71746975"
FT                   /db_xref="GeneID:3662221"
FT                   /locus_tag="Tb10.70.4720"
FT                   /transcript_id="XM_817450.1"
FT                   /product="importin subunit beta-1"
FT   CDS_pept        747790..750390
FT                   /locus_tag="Tb10.70.4720"
FT                   /gene_family="HOG000260230" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="importin subunit beta-1"
FT                   /note="go_component: nucleus [goid 0005634]; go_component:
FT                   nuclear pore [goid 0005643]; go_function: protein
FT                   transporter activity [goid 0008565]; go_process: nuclear
FT                   import [goid 0051170]"
FT                   /db_xref="GI:71746976"
FT                   /db_xref="GeneID:3662221"
FT                   /translation="MSSLTELLTALGSPDPSVRIPAEEQVNRAKQGGLGGFLCSLLEEF
FT                   RDESKPLFARNMAGTLLKNAVAPNLRETAARRALEREWKNLPVALRTEVKQCVLSTLGS
FT                   PKKDIQNVAANIIGNLSRIELPAGEWPDLMDILISATESQSEFHQVAALTAIGYVCEEG
FT                   HDHEDVEAALINYTGGILNAVVCGMNSGKEEVCYCATNALCNAMEFIHDNMQQQNQRDL
FT                   LVDTLCRTVASSHNSRTREKAMESLVKVADMYYSTLPNYIDRLHAITTGAIFGEEEGVA
FT                   LQAMLFWISICETELDMKESADPRCLFYAQKGASMLVNICLQTIVRQEEGQEEGDWNIA
FT                   IAGGKLLQSLAMCIQDPVVDLVMPFVYSNIEGATWREKEAAVLAFGCILNGPNADKIQD
FT                   TVAQAVPGLLQYIRHDHPLVADTAGWVLATVCELFGDVFLLQPWNLQQLINIVTPMIGE
FT                   GTEKAIRGCHIVHNLSLTYEEEDCQPTNELSRYFAELLNVLLLAIDKGVDYTVKSVAQE
FT                   ALNALIDAAAVDCLQFLNLLVPELHKRIYNVLGERQQGQVGEMEASSLLGLLCGSLGST
FT                   ARKLMLAFNEHLQPSMEIVLKILENPQGTVLEEVLTMLGSFAHAVKQGMAPYLDRITGH
FT                   VVKALQCVDEPDLVTVAVGTVGDLSLGVQKDLAPYVEGILGALYGNLQNPEVDRCVKCI
FT                   FLNCIGDIVLNVGEANFAQYVNIFMPFVHSMFEQSCGVNVTDDPDNEEYVMSLWESIST
FT                   LYTSVCQSFKGNEIPLAPYLQNMLQFVLYTAPLAKSHGYVEVFIAIITVIGDMASVLKS
FT                   VSLKELRQQAQSALLSSEVVAIVKVAAELNDGRDGFREQVRWVESQLQQLSKVV"
FT                   /protein_id="XP_822543.1"
FT   misc_feature    750841..750884
FT                   /note="CT-rich"
FT   repeat_region   751210..751242
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   751296..751315
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   752435..752462
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            753100..754236
FT                   /db_xref="GeneID:3662222"
FT                   /locus_tag="Tb10.70.4700"
FT   mRNA            <753100..>754236
FT                   /db_xref="GI:71746977"
FT                   /db_xref="GeneID:3662222"
FT                   /locus_tag="Tb10.70.4700"
FT                   /transcript_id="XM_817451.1"
FT                   /product="splicing factor PTSR1 interacting protein"
FT   CDS_pept        753100..754236
FT                   /locus_tag="Tb10.70.4700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="splicing factor PTSR1 interacting protein"
FT                   /note="go_component: nucleus [goid 0005634]; go_function:
FT                   RNA binding [goid 0003723]; go_process: nuclear mRNA
FT                   splicing, via spliceosome [goid 0000398]"
FT                   /db_xref="GI:71746978"
FT                   /db_xref="GeneID:3662222"
FT                   /translation="MDAIPPEYDKDTKERIYRQEWLEYFNYIGWDRAVSEHPEQYYSIF
FT                   PGGHHHALHNMNNGGSVMGDIMGKQENIGSIGVSAPILGNQRPAGGASYRAGILAPPVM
FT                   TTASAAAKMFLDDGSSSGSDGDSRYSSRSSSSSSDASSLDGSKERDGEVNRGQRRYERA
FT                   AEAGASEADTKKSASNRRRHRSGSGTKRRSRSRHRHRDKSRRRSTNNDKKSGRKRERSK
FT                   DAEESRARRDDKPPRNEQKTGRRDERRERDNKHRSNDRDERRHHHHRSDKPHGSEHGRN
FT                   RDRERDRERERDRDRGRERERERDRDRDWDRRKEKAPAGGGSSNGSRSHKGHYILHEGN
FT                   DKFRGRGDGSISAGGDRYDDRREDARQRRQRDEGRYRR"
FT                   /protein_id="XP_822544.1"
FT   gene            755626..758796
FT                   /db_xref="GeneID:3662223"
FT                   /locus_tag="Tb10.70.4680"
FT   mRNA            <755626..>758796
FT                   /db_xref="GI:71746979"
FT                   /db_xref="GeneID:3662223"
FT                   /locus_tag="Tb10.70.4680"
FT                   /transcript_id="XM_817452.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        755626..758796
FT                   /locus_tag="Tb10.70.4680"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746980"
FT                   /db_xref="GeneID:3662223"
FT                   /translation="MTNPPQDTSGMKEQTCWWNAGLPATPLSCFDRSPSLSNAIRSTVS
FT                   STPPSHGYALAINIAPAETRDGNRLRSCMCANPDCKNIISFPQSGSTCIYTCCGNQSKA
FT                   VGMCDGAIAMTPSFCQSQNTSDFVCGSVLGCGNRVDATPCNLHAHDNWTGALGSHPAVQ
FT                   VPTASAPAHTQIGAKNCVESIDAQNETCEEVMEPFESRFPTSSCDLHAHGEECATQSGE
FT                   SDKKVMIDLLFHMWRHGKTDESTSAQTCRSKCSAVETHSCAPSKVDHDSQWGKPLPWRA
FT                   CESSPPSHDCSNACSHCTVNNQHINASSQDAVAVGREADPHCSASGRNPPSTGSRLEQH
FT                   ALLNHLKKTVEKLQQNYNELYWNCFSDRSTDQNTSQPTSGSAGSEKPICSAGKRKEEFG
FT                   TRTSCPVRNLTVEPGDDHMGSAPKIDARSRLSGDCVPLHTTSREADVPKPKEYAAHISA
FT                   PPDVTPFYTGHSLATYIDNDAEVCVDKDQISAAPGIDTVDRINRCKEADINDLPSSFCP
FT                   FPPATLTASSPPVSGRSANEGEVCNYGTDNGLHSESAKDEKVCRKLEERSPHDSFASFL
FT                   VCSPDSSLTRPLSNSRPRRSIPLTSPGDPVATGSDVYNVSPRLSDRRIVSSDDWRPLTR
FT                   NAGAAQRGFERRIVSPSPRGGTATRPQGERISSHASVGSERDPSGLVHTDNSPPRRRTA
FT                   NLTLPGSIATTFAGNDRRSRWSPRRRIARPSSPLAASSRYVSPIPHEVRTVLQRDESLT
FT                   MLDAHRRNIGKLSPQPPKDNSIEHVFARPWTDEQEVTEGGRRAPTWIRYQRGFNTSLSN
FT                   IPPDTFRPSRALSSRDYMSPSTASWDASTWRGNYVGSRKCVSAERRPRGIGNSHGSVDL
FT                   DKYNLAQRDTYWHNSPTLFCKKESEEVLRSWKKLVSPEGTNEIERNASPPSVRSTKQGR
FT                   NTKSPGQKSSGRSSVARIKNKDKGKSSEKANCCPAPQKLNTSTRRSVSNDGAGTKPESH
FT                   ALVSTEKRCRSRSARRYGILAAALDVSGVSTVEAIKGLRRRGRSRDSSVSHRFGIRRMS
FT                   VSPRNVKK"
FT                   /protein_id="XP_822545.1"
FT   repeat_region   759748..759772
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   759997..760021
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ggaa"
FT                   /rpt_type="tandem"
FT   gene            760193..762442
FT                   /db_xref="GeneID:3662985"
FT                   /locus_tag="Tb10.70.4650"
FT   mRNA            <760193..>762442
FT                   /db_xref="GI:71746981"
FT                   /db_xref="GeneID:3662985"
FT                   /locus_tag="Tb10.70.4650"
FT                   /transcript_id="XM_817453.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        760193..762442
FT                   /locus_tag="Tb10.70.4650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746982"
FT                   /db_xref="GeneID:3662985"
FT                   /translation="MGNCLCCRDKHKHEPEPEVVMDVMDVKEKQEIGHHNKTQVSTPPT
FT                   CQSDYPPPSGLPTSPPDDTQSSVSPRDNVQFATAPPDDSSNAASPRYDEQPVTTLSHDV
FT                   VSSTPPRVETPPTSSPREEVTDVVPAIEEFTPAVSLGEEVVVSEASPAENPFTASPHDD
FT                   TTATGSRGDNPFTASRDNAEYDFSPREDVNHPPQDKPEVVLAYDFSAPVASVYKNAAVW
FT                   TFTAPKEEKSGNRVVGFASAERGPRGDVPPSTERVSEKPSGRADEDFDTDETTTGRSSK
FT                   PVDAADDRAPKLRAPLLAPPVDDTVMESEEAAEEREAQVFTEAAKEGNESVGKEPPGGE
FT                   GDTYQVSDAVELGDAMESTNEPEVKEIGQADVEKLKGAGTPEKADDEEESPRTSGRRDN
FT                   NVLSPLLEDKAPAVLAVAGENNDETNAFVHSAERALEQSKVGKDSEENSELEGEHPSEE
FT                   GLGDVSYANTAGDLPESVAYTTHSSAELQTRKTEGSHAITDGETVRKSDSNDNALAGII
FT                   RRQRDMERRSSTGVLLPTQSDALGFLETHSSGVAEHDLVNTGVEGEDNTDGKMQYLQGE
FT                   LSLDFGGLETFNADNMSENRVHSWSSVESNGGAEDRGERGASGLNNEGNDRTVGGCVDS
FT                   GSSDGGSERRRLADIVQPKDWGREIHEEEEVTEKYSVEEVVADKEKSAEDRVSYNEDFG
FT                   VNRSNELFNGREAFFQDEKTESKSRSTSVPYRTIPIISPPLATPQNREDGDESLM"
FT                   /protein_id="XP_822546.1"
FT   repeat_region   762949..762977
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   repeat_region   763618..763641
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   763977..764015
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            764682..765746
FT                   /db_xref="GeneID:3662986"
FT                   /locus_tag="Tb10.70.4620"
FT   mRNA            <764682..>765746
FT                   /db_xref="GI:71746983"
FT                   /db_xref="GeneID:3662986"
FT                   /locus_tag="Tb10.70.4620"
FT                   /transcript_id="XM_817454.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        764682..765746
FT                   /locus_tag="Tb10.70.4620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746984"
FT                   /db_xref="GeneID:3662986"
FT                   /translation="MSTGAFTEADSLMASAKKHLKTGLFKRKPDWGSAADDYERAGGLY
FT                   VSDGNVEKACEAYNSACEAYEKVGSLVSASLIKSKLAQFLAEQARKGCGGKSLDKKLMD
FT                   SAVESYRGAARYYALDGKFDRMAETLVKAAELIDPTTHCAFASPLAAKSNVEGDREKVK
FT                   QVCALLEEAADAIEENEDNNNSYIIRLPDIYRKWMLACLRSGDVLRAIAVLERQLGITN
FT                   GSGDGTSKIKGKCAGGFYARLNQPHNVAKTGLEIIVLCLSLGDLVLARMKLDGLRGISG
FT                   FANTKEESTVRSLLEAFGERDTEMLQETLKDSTLMFITNDISRMAKKLVIRSTEAKPDT
FT                   CEGGEVIDGEEDLR"
FT                   /protein_id="XP_822547.1"
FT   gene            765890..771493
FT                   /db_xref="GeneID:3662987"
FT                   /locus_tag="Tb10.70.4610"
FT   mRNA            <765890..>771493
FT                   /db_xref="GI:71746985"
FT                   /db_xref="GeneID:3662987"
FT                   /locus_tag="Tb10.70.4610"
FT                   /transcript_id="XM_817455.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        765890..771493
FT                   /locus_tag="Tb10.70.4610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746986"
FT                   /db_xref="GeneID:3662987"
FT                   /translation="MFKAIASGKSDAVWYCRCFNAFIFFLFFPHLQTKYCSFHIPCMRY
FT                   AKFFFKSMFVFFYANRLLHTHTRSKEKKRRKDLWSMGDADVATDQQQQRLKQVPNRGDA
FT                   INANAANSFDDEDGNQCLWHRRSREVHAHLKRRVAGILTQIRCTSSANHFDRHRVEVDE
FT                   LLRCDAPMGFTPSMILAGVPDIIHLLTDAVRDRRVLEVGRENRQAISALTPICQSSNFL
FT                   ITPNPFFVKEIASSIWRDSSKFKGDRGNNTPSNAMSSVGSNGAKGDNIDCFLPPLVRHA
FT                   KGSAPQEYPHTTSASPTREGKRLVARIGKSNEVTTAAGTAAGSRKCVRDGSSSPLDKSG
FT                   PTLPRIDANRQSANRHVNGTGQGNQPLQQQSNGFPSACAVSDAANAKCAPLLCDIPSTV
FT                   EAMMYHCAFPLVCITPEDYESRASATHILVSTLSSIIRKTSDNNLHTECEGISGVDNVA
FT                   SQSTSDDGKPGSNINGDYNCNAPRPTNAEQKNCDLEHKNMLYRLRRAALHTLHALLSIM
FT                   DSENASLVNKHFAERDRQLYDAFGDINFSTDNTIMDMCSPMDETRENDNERVESVSVKV
FT                   LSGGTMGSPRAVSPRRRLSTACVKVMQRTQRNMLVRRVAPLSVYNNAVDVNVLIPLLER
FT                   WTFILDKGTGSNGVLDSARFLTQRPGAWEVEERSNKMANKKLAMASITRCGQEGHHVIP
FT                   AEMHSEKITTGGGRDETVGAVVRMCEKDVEEIYLLLRICLQLSLYKHHLNVSARMADTF
FT                   GGTGNNTFKSIPVLVCLTMARCMEGDRHLPLCVECLWNMLDVIPEEAAKEILHHTGDES
FT                   GAHFQQEGKKQSEYATTNSPLSRLSATEALLHCLLQFLVSGHRLEYRELRNDIIVLMLI
FT                   VLRTHTAGLRQQEETLLYNSELEHPALPPGSTIEAITTMAKTVFDLVCGPELQVFGTTA
FT                   ELTLESPELFRRYHTVLSPTTRRENLQFKVLGWRFLEAFHEWQNVRLTLELRCRPHMSR
FT                   TTLSTRAPAPSGYVFDTSNTVFDVCGAGFVDLLLMYVDTECSNELVLAWSREDLLTLQE
FT                   ESWRVILAMVEPHAEHSVTKAFEGVGADHTWQNGKEVNLFSGNPGGGLWVEGVGEEWPL
FT                   LQADLAFVGTNGIACAMRYIQETCNGDTEMIGYLAIHVLSVLSRFPIHREALLALRTPA
FT                   PTTGEPVPLLLATTVQVIQRLFNQVENSAKINSNSNGTRGMPKPDGISRAESVQHVVRD
FT                   ATVSKGNYGSSVRWQKDSEGRKKTLKESQSVQTRPVHKGSSLFAFSNAGCSSTQRTYGM
FT                   LQLSNTHVYFPAQTISVFLKCLSLLHNVADGSRDEVVATQRAFILMDGITHILRLVWNS
FT                   LTPSTSNSKFSRFQVEERNKELLAAALNCVRVFLIGNEAGQAQFVRGDGVNTLLTVIEA
FT                   HLGEDSGQLFDTVEGGHPPALHLTLTILADLLRENAEARDAFLKWFNYTSQVVEKADDG
FT                   KVNAVQLLLRLWNEGAPSSETHDGSQRVESGCDVSSVATTVGREPRLRKRDFDYLKIST
FT                   TSTTLTKTYDVCDEDIDDASAGRPAVATELRPSSWGLNSLGLQGRELVTAALWRRYADL
FT                   ERMDRFNTEASSSGELASPRGFRELLSAPICKVLGLRVGVYACLAALGFERISEVKASP
FT                   SERVKLLHIAALEALCKDEVWGAIAESVDLAGRVVIRAEKRPCTSTMGSFYGGKHRNSV
FT                   SFRNSTLLVPIIPDADKLVSVLADVDTRAREMKRFEAVTLDMQGVHNFEDLHRSLLAFV
FT                   RHDDKVPACTIAEQFRNGCKKASAVRLISPPLTVHTGSEGAEAMNDLVTIDQYPTLSGN
FT                   NAPTTPMGSWRPYLTMPTGFSEKKRKKEAMIKNSFKSSKAQCKKSMTSTCHM"
FT                   /protein_id="XP_822548.1"
FT   gene            771965..774271
FT                   /db_xref="GeneID:3662988"
FT                   /locus_tag="Tb10.70.4600"
FT   mRNA            <771965..>774271
FT                   /db_xref="GI:71746987"
FT                   /db_xref="GeneID:3662988"
FT                   /locus_tag="Tb10.70.4600"
FT                   /transcript_id="XM_817456.1"
FT                   /product="GTP-binding protein"
FT   CDS_pept        771965..774271
FT                   /locus_tag="Tb10.70.4600"
FT                   /gene_family="HOG000020624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.4600 by DGPI
FT                   v2.04, no cleavage site predicted; go_function: GTP binding
FT                   [goid 0005525]"
FT                   /db_xref="GI:71746988"
FT                   /db_xref="GeneID:3662988"
FT                   /translation="MRLWNRFSRLGNLLCACAACGCSFTPWRCSSSPLLSSFSAYNMSS
FT                   GNRVTSSVGGSSGATEVCPSHTPLSSSTLLRYTIAPSEPTMGSPWQTSEESASRRLAAL
FT                   TSYPPSNIRNVAVVAHVDHGKTTLSDVLLRRTGVLKGSVNAGAYTDRLLVERERGITVK
FT                   SQTCSMFLKYGGSEFLLNLIDTPGHVDFQYEVSRSVRAAQAVLLLVDVAQGIEAQTMSH
FT                   FHMALDQGLAIIPVFTKMDCVLNDTTVDAALQQLEDSTGLLRSEVVFTSAKEQLGVEAL
FT                   LQAIIERVPSPSGAIGLSDVCQLPPLLPGSTARVAMEAEMVPLRAILLDSWTRECGGGL
FT                   YRPPSKTSSALSGNVKIDEDKDTVTCLVSVIDGTLTARTNILLYHSQKRYEAREVGVIH
FT                   PELRPTGALTVGMVGYVVFTRVQREDFSVGETLYTLPTRKFTRGGIAPVPGFRRVHPVV
FT                   FAGFYPDEGEYVTQLREAVEKLRMNDPAVTVEPLECQALGSGLQLGFLGVLHMQIFQER
FT                   LLSEFGQRVLVTPPVVQYKYREAAGGDDQPPKPLSVHTWRWLHEGVSCYMEPHVTATVV
FT                   TPSEYAQIIDGEAQRHYRGKQLDMRVMDDARVLLRYKMPLADMVRGFFTFVKSQSHGYA
FT                   SLEYDELVYEEADLVRVDIVVQKARISALAVICPRHEAPSVGKRIVASLKSNLTRTAVD
FT                   IPLQALVGSKVVARETVRAYRKDVTAKIHAGDISRKQKKWNDQKKGKERMARRTVGGVT
FT                   LDQSVLAAAMGATAL"
FT                   /protein_id="XP_822549.1"
FT   misc_feature    774749..774778
FT                   /note="AT_rich"
FT   gene            775230..775577
FT                   /db_xref="GeneID:3662989"
FT                   /locus_tag="Tb10.70.4590"
FT   mRNA            <775230..>775577
FT                   /db_xref="GI:71746989"
FT                   /db_xref="GeneID:3662989"
FT                   /locus_tag="Tb10.70.4590"
FT                   /transcript_id="XM_817457.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        775230..775577
FT                   /locus_tag="Tb10.70.4590"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746990"
FT                   /db_xref="GeneID:3662989"
FT                   /translation="MLPLRVLPFIAAGGYASQLRFYSEGKPTEGHRKINLDDDERWIEA
FT                   EFDEKLRSPEERYALERQRETMKGLIKKIRNEHKQHMHESVRERDAQIDNLKEQIQTME
FT                   KKLQQLTNEKQ"
FT                   /protein_id="XP_822550.1"
FT   repeat_region   775641..775662
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            777374..778291
FT                   /db_xref="GeneID:3662990"
FT                   /locus_tag="Tb10.70.4570"
FT   mRNA            <777374..>778291
FT                   /db_xref="GI:71746991"
FT                   /db_xref="GeneID:3662990"
FT                   /locus_tag="Tb10.70.4570"
FT                   /transcript_id="XM_817458.1"
FT                   /product="proteasome regulatory non-ATPase subunit 11"
FT   CDS_pept        777374..778291
FT                   /locus_tag="Tb10.70.4570"
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome regulatory non-ATPase subunit 11"
FT                   /note="Curated by J. Mottram. identical to GB:AAL72634.1:
FT                   proteasome regulatory non-ATP-ase subunit 11 {Trypanosoma
FT                   brucei}; similar to 26S proteasome regulatory subunit
FT                   rpn11. (Swiss-Prot:P41878) (Schizosaccharomyces pombe);
FT                   go_component: proteasome regulatory particle (sensu
FT                   Eukaryota) [goid 0005838]; go_function: endopeptidase
FT                   activity [goid 0004175]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]; go_process: cell growth
FT                   [goid 0016049]"
FT                   /db_xref="GI:71746992"
FT                   /db_xref="GeneID:3662990"
FT                   /translation="MFHPQLVAGGANRAAPAEELRDTAETVQISSLALLKMLMHGRAGV
FT                   PLEVMGLMIGELIDDYTVRVSDVFSMPQTATGQSVEAVDPEYQVHMLDKLSVVGRPEKV
FT                   VGWYHSHPGFGCWLSGEDVMTASSYEQLTPRSVSVVIDPIQSVRGKVVIDAFRTTKDPH
FT                   TGPRIMFQEPRQTTSNIGWLTRPSPIALTRGLDRDYYSLPITFRKKNHELALLLNVYKK
FT                   GWQEGFRLENMTRFDRNTVREKMRALASLAVQSERFIVQGLDEDDVGNVGRANPIAHLQ
FT                   SESEGLINASLNQSIGAMINGVVF"
FT                   /protein_id="XP_822551.1"
FT   gene            778750..781764
FT                   /db_xref="GeneID:3662549"
FT                   /locus_tag="Tb10.70.4560"
FT   mRNA            <778750..>781764
FT                   /db_xref="GI:71746993"
FT                   /db_xref="GeneID:3662549"
FT                   /locus_tag="Tb10.70.4560"
FT                   /transcript_id="XM_817459.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        778750..781764
FT                   /locus_tag="Tb10.70.4560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746994"
FT                   /db_xref="GeneID:3662549"
FT                   /translation="MYAMPGNSGDLQCDDGKKRHIPPLSLLLSGYGSSEGRELDTSYTP
FT                   KQWLWFLYVTSWARPFFTYASSGGASEATEGSSDNRSGSAYWGRLSFDELLKLSGSPIP
FT                   PAMVSLWMGLCMPTDDVVQELRIMTEGKAEGRQRIYPFLPRVAESTFGRALRSLAVRQH
FT                   ISSWMPSHAGDVCAALDVLVRDTLEVIQNSADVRKTARVRCEERDASGEEALEGAFRSM
FT                   LSASTTAPKVVEATTYRPLFDVKASIPEGGTAQVLIRVANAARLFAALSVEAFGRVKSE
FT                   CAVLLLAHINQRDAPEHVDARAYGVVTGVVEYAMAYRYCRDDGTGRCPLTCAALLLHRL
FT                   VELQGIVEKDTAAGDRCMGMAVSASRFANMTVACIQELLFCVVAGDTVRWHREHQPDGV
FT                   SVCPTAARTLTLHETDCLLQVFIPALLQQVGFEWPWSESLRHAKMLDRARTQHIVMEDG
FT                   VRLDSRSVFEELLVSVARRTYGLRLRAILPQSFDVIAENIFVSIHDVPNEGKSSGGNPE
FT                   KVADNSSSRFALPLYYRTAGEVLLEYFDRCGPSGITAEETERVLRRATDVQPMVVQLQA
FT                   LGGDTNGGITDCVSYCGELSRTVYFSAREKERLLQRYRCEVLLASLVVYTQLRTVSVVQ
FT                   QLTRQLAPLFEQLLLPLAHERTLSRCPVIASRKGDGVDDNGTPLVDLTPEFKMLVDEIH
FT                   YEFYPLEWVPEAVDAHIRQECGVREKEGAPYHEGGNGPPCFAQYSLFAAIAHQFGLVLE
FT                   GNPRGFRGGDGSSSEVRTKAYRFFTLMLLNNLGDAVSSSCELDGAAALAATRRVKDCQD
FT                   GSENCKQRQAAVRQRGGASFHSVVSACDVVVTMTQCLLPAHLSSHPRMATTGSMSNEWM
FT                   RRVGEWTRSAYSKYTAYQQQVHGLDLPVPLISLYNSLTFDSVPLARETIRAVRSRLLEK
FT                   MSVVTASPPGDVETAGKQLLEQHLSSLTVTLTAVGLLPLCVRGGSHVPCATQLLWASPF
FT                   FSHELLHCGRYEVSV"
FT                   /protein_id="XP_822552.1"
FT   gene            782122..784479
FT                   /db_xref="GeneID:3662550"
FT                   /locus_tag="Tb10.70.4550"
FT   mRNA            <782122..>784479
FT                   /db_xref="GI:71746995"
FT                   /db_xref="GeneID:3662550"
FT                   /locus_tag="Tb10.70.4550"
FT                   /transcript_id="XM_817460.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        782122..784479
FT                   /locus_tag="Tb10.70.4550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746996"
FT                   /db_xref="GeneID:3662550"
FT                   /translation="MNSFVSHSSPPLSAGINEMSLAELRLGIHEFLRSSGALGSLKTQL
FT                   RGVITSELLKRRRTKDITAGECNSRELDAGADVSNKDGEGESAWIQRLADAIVEQHLRQ
FT                   TGRAFSLAIFSSEADVSFRATGDDALAVLLHLDNPVLTTAGWRAGPDSTPANAKVAHHR
FT                   SSSFLQILTAAHLRHVGDSRGQRPRYAVGTQTDSDFGSEFSGESAKPPVEVRLAAVDAK
FT                   YALCFARMEHSTREELDRHMETYREELKLQMEQTYQQRLRAFEQQKLLEVRREAEEHFR
FT                   LLLQHKMEEQREIERLSAQRVEAERVRLSQAREDIQLQRVELERRQREIQLLLDERDKA
FT                   TVEMEGRLHDAKQQIRVLTSQLQQFEELCASRLAEAEAARDREMRRVGDIRRLQAEHVA
FT                   ELQLKDEEICRLRFRLKSLAASNTGGSWHHNALNTTENGVIMVHEVPSGATRQHKQGSR
FT                   QQASHEATYLASTPVPREAAWQSIWHSTDVVGPTEVVTAPWRGEEGVVERRSHLVDPSL
FT                   HSSDVHRQGKRGSRDTNDAAIESQERSMSIQPRRAATTESGSTVTTTSSRVGSRVLLAD
FT                   AAVAKSAHESATAEKQETPVPQECGSSERSGRAGNDEKDEVAHSKSSSGSTKVTRSNTT
FT                   GEINGEVDRSHPPVVQGSHSEGPLSLNASEGNTAIASSSKMSSVRSHKSQSVTTPRAAA
FT                   SHALSDLVGRINAEEEDKRKEIEKEEETNRGGIKWAATSQHNLLVQRQTAMEEFSGREE
FT                   SNVVLLDRTTISDDGSEDDILYRKGDDSDDSI"
FT                   /protein_id="XP_822553.1"
FT   gene            785441..789112
FT                   /db_xref="GeneID:3662551"
FT                   /locus_tag="Tb10.70.4540"
FT   mRNA            <785441..>789112
FT                   /db_xref="GI:71746997"
FT                   /db_xref="GeneID:3662551"
FT                   /locus_tag="Tb10.70.4540"
FT                   /transcript_id="XM_817461.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        785441..789112
FT                   /locus_tag="Tb10.70.4540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71746998"
FT                   /db_xref="GeneID:3662551"
FT                   /translation="MPLPSTLPSPAPPSPPVATSKLDLDINGLQKILQQIDESFHASDD
FT                   DVDRRLRLQHLERQQVALQQLCDAALQQQDGQAVPPALDNSTDVRPITYKVLDTDVVST
FT                   PRSIDAFNPSHNTRETLQSIARKTETCLRSPHAPLVAPPRLLSPSRVTSMPHMGAGTTA
FT                   QGEVKTPDHAGVATAKIFPLRSPELPPTYHDGAAVQEDRDLVESFLGDGRAKAQHPYAV
FT                   EEGGVHRVRGSTGGWQQRGIHTLRGVRSCRLMAPRMSSGTDRTASPEHFDIGEDEKLIR
FT                   QLIGRNETRVKGSTNRNNHCFQTAPTKGENVAAHSCGTEGQIHRHSTVPSASGRQPAQG
FT                   DAHPTSTSMAHNPHKEDCAARNGHWVRGKSVKELTQKMECLARHLVKCMRDRLQLQYRV
FT                   DRLEGMLDVANTEVGRLRRTLEQREEGTLTESAWRATINAKERELRVCEDEIRRLRILV
FT                   EQQVTRQGCGLARQNEAAALQQAKADLECMMQELGVAHMRRREMEEEFERTKQALDAAE
FT                   SHIQMLDKRLAQAERAAALARVWDVSGDLNVQVGDVPSAPASTALQKGLPEAKLKLQAN
FT                   VGNVDSWTHDAQREIARLTAHIENLALKHAESDRHAELRLSNARKESDVLRRQCNELRV
FT                   EVRSHEVQIETLRRDRVAVGLREGQLRQQLLDLRDDAVLLADLLQATTKNAKGMLQILG
FT                   TDDVEHRQSKAAVERFVAGVLCDFDALGRFFGALQCIDIGESRCQMEERVSVSEATAAR
FT                   RDFVLKAVEDAMERPSQGFGPATLSSSKPPCVETLQAAHESHRPSVAADCILATGTRPP
FT                   EDRKPPTTSSTPSPAHPVLRWVADQNISLEGVTAPDEGNQPQNGAKMAESRASVMEGCT
FT                   GRNLEQQSSNDFYALSGTNTDTEPKISLFPTTSWPSPQGARRGSPPSRLSDQAESHVLI
FT                   QDSARSRISTGISFLSKAPDGSGTVASEGIPHLQQPLSHSMVSSQSHMVEETSDERSSG
FT                   PMLSVVAATTRHVDTLSAQAVANRVDDVDLKGVTLELLRAEDRTSVKVHPAVSWNTGAE
FT                   NSAEKDGVGGEQTDLNDVPVTEVMRHLQPRDDSPENRKQTPPRLMPHYVVTHASSTATA
FT                   TREERSGAPVGRRPAVQQAADPAPLRRAVVGGGRDGRGRGRAVALAEPQRPTAARPGAA
FT                   LLPSVNDVGPEPRNNTVTATMVSGEAGTAHRHHLPVGTEFLSLRQPALANAQSKPKD"
FT                   /protein_id="XP_822554.1"
FT   gene            789475..791796
FT                   /db_xref="GeneID:3662552"
FT                   /locus_tag="Tb10.70.4530"
FT   mRNA            <789475..>791796
FT                   /db_xref="GI:71746999"
FT                   /db_xref="GeneID:3662552"
FT                   /locus_tag="Tb10.70.4530"
FT                   /transcript_id="XM_817462.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        789475..791796
FT                   /locus_tag="Tb10.70.4530"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747000"
FT                   /db_xref="GeneID:3662552"
FT                   /translation="MSGRRVTVENTASPSPHSSASQQPLQDIISSPERQCHSFHGYYGV
FT                   GGQCGTHYPLVEATAMNFSAALGEGTSSSNAVSPEQDPLLEGLREKERQFDARVAALDK
FT                   MLICAQQGCTQRDSLIDRLNTEVGRLRKQLQESKGTGSKPKEMRGSALEGDTTALEEAR
FT                   AKIEEMSNRLREKSRRLMALERQLGSRGVDTEEGAVVGRTAPRKNLVEEQGQQKRARYA
FT                   ATLRSLQKEVGLLEQKYRVMMKEKESLAEENQSLRRRVDRIQEDAEAELVGAVRATHKA
FT                   LGEKKDLETQVMATRLSMARLLHVLSEVPEMSRYLRVDGVTGDLLFIGYAALPLKETAD
FT                   GSEVGRSHRGGLSLSAMGTGVDDGIYGGSAKAQSHNIYLNGKWCNRLREIVDDENCFFR
FT                   RAKVHTGELEDVTHSLVGESVPRVPLPSDVLQGRQRDRDFWIPYGVFVEAQKFKNRYFP
FT                   SMNVECFYPFLFSINVLWNKRMMQRVTTATKRVSEQQERRRKQMLRCMKRGGEHYLGSL
FT                   SPSTGSFSPSPSVVALRRQLQLLRREVQRRVIGRSSLDLFHRYDLLVRRTLQCLEKTHR
FT                   GYITPLNQAQQSGTAGSVSSDTDFTGEHVNVSPLWRDESPEEMKMNNGSDVSGSKESHY
FT                   RCSPSIPLAGLLNISQRASTHVLASCRHLRELLEALRKKHRWFSLSDHHYEGDEGVRLA
FT                   CGAERTCVPVSTLHHLIEGVVDFVGEVQQEVLKAHNAVEKYCTHQRDGNDVVLSALNNQ
FT                   RASRIIEGVWNDIPCEGVSE"
FT                   /protein_id="XP_822555.1"
FT   gene            793617..794534
FT                   /db_xref="GeneID:3662553"
FT                   /locus_tag="Tb10.70.4510"
FT   mRNA            <793617..>794534
FT                   /db_xref="GI:71747001"
FT                   /db_xref="GeneID:3662553"
FT                   /locus_tag="Tb10.70.4510"
FT                   /transcript_id="XM_817463.1"
FT                   /product="proteasome regulatory non-ATPase subunit 11"
FT   CDS_pept        793617..794534
FT                   /locus_tag="Tb10.70.4510"
FT                   /gene_family="HOG000183690" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome regulatory non-ATPase subunit 11"
FT                   /note="Curated by J. Mottram; identical to GB:AAL72634.1:
FT                   proteasome regulatory non-ATP-ase subunit 11 {Trypanosoma
FT                   brucei}; similar to 26S proteasome regulatory subunit
FT                   rpn11. (Swiss-Prot:P41878) (Schizosaccharomyces pombe);
FT                   go_component: proteasome regulatory particle (sensu
FT                   Eukaryota) [goid 0005838]; go_function: endopeptidase
FT                   activity [goid 0004175]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]; go_process: cell growth
FT                   [goid 0016049]"
FT                   /db_xref="GI:71747002"
FT                   /db_xref="GeneID:3662553"
FT                   /translation="MFHPQLVAGGANRAAPAEELRDTAETVQISSLALLKMLMHGRAGV
FT                   PLEVMGLMIGELIDDYTVRVSDVFSMPQTATGQSVEAVDPEYQVHMLDKLSVVGRPEKV
FT                   VGWYHSHPGFGCWLSGEDVMTASSYEQLTPRSVSVVIDPIQSVRGKVVIDAFRTTKDPH
FT                   TGPRIMFQEPRQTTSNIGWLTRPSPIALTRGLDRDYYSLPITFRKKNHELALLLNVYKK
FT                   GWQEGFRLENMTRFDRNTVREKMRALASLAVQSERFIVQGLDEDDVGNVGRANPIAHLQ
FT                   SESEGLINASLNQSIGAMINGVVF"
FT                   /protein_id="XP_822556.1"
FT   misc_feature    794860..794888
FT                   /note="AT_rich"
FT   gene            794943..795350
FT                   /db_xref="GeneID:3662554"
FT                   /locus_tag="Tb10.70.4500"
FT   mRNA            <794943..>795350
FT                   /db_xref="GI:71747003"
FT                   /db_xref="GeneID:3662554"
FT                   /locus_tag="Tb10.70.4500"
FT                   /transcript_id="XM_817464.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        794943..795350
FT                   /locus_tag="Tb10.70.4500"
FT                   /gene_family="HOG000259553" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747004"
FT                   /db_xref="GeneID:3662554"
FT                   /translation="MFSRSFVGRMGNGTYGGWPWPVKLPLKRGWHHELDRHQSIAEESR
FT                   RYILFGDALLVSIVLYSVYRLYYLALCSDAYRTHLSHLSGAPPAIIANSFDFANLENNR
FT                   TVPRAVLDEYREAVVDGKVKRAPIESIIFKY"
FT                   /protein_id="XP_822557.1"
FT   gene            complement(797072..797551)
FT                   /db_xref="GeneID:3662555"
FT                   /locus_tag="Tb10.70.4480"
FT   mRNA            complement(<797072..>797551)
FT                   /db_xref="GI:71747005"
FT                   /db_xref="GeneID:3662555"
FT                   /locus_tag="Tb10.70.4480"
FT                   /transcript_id="XM_817465.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(797072..797551)
FT                   /locus_tag="Tb10.70.4480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747006"
FT                   /db_xref="GeneID:3662555"
FT                   /translation="MLKGDLLLVCAFLRTTVSCGGLFKRKSLHRRKCWVQGTGAKEEHE
FT                   VKRGERVTPVQSMEKGMINVGWHGVQGKHTTAKKVHDHRQPNVVCEGSSCRPSECSTLR
FT                   ELRAGCGLIDPKGRILSTGVKLPRFPPSHYSANDETGTLLVENTSPSKKRKHNFV"
FT                   /protein_id="XP_822558.1"
FT   gene            801387..802331
FT                   /db_xref="GeneID:3662556"
FT                   /locus_tag="Tb10.70.4430"
FT   mRNA            <801387..>802331
FT                   /db_xref="GI:71747007"
FT                   /db_xref="GeneID:3662556"
FT                   /locus_tag="Tb10.70.4430"
FT                   /transcript_id="XM_817466.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        801387..802331
FT                   /locus_tag="Tb10.70.4430"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747008"
FT                   /db_xref="GeneID:3662556"
FT                   /translation="MRILVCWAVGVKKGRMMAPPLIFCLYVLSEIIDRFLFFIPDCSSF
FT                   VWHIFFRFKYFGRTLIDGTICYWWSSKVAVVMDAADATGGGSVKPLAELIQLIRVRGGV
FT                   TKECARPRRTNDHSNDLCAVPFSLPVWKRARGHSPPRAALPVKESVSRRPELSTTVRRR
FT                   RRRMEGCHAVTTRNVSTCSADFQIMEKLSVGAYHLTYVHVDLYHHGLKRLMDDAVLRTN
FT                   PKKIVGRKCCYLKPGTDLVVTGCVIEFTKNDLSVQVAPDKGIDVDVEWVKLEDVYVPEN
FT                   IDKVRVRVSDEVRSGLQKVKEAPKEMRRRFASQ"
FT                   /protein_id="XP_822559.1"
FT   gene            805160..806344
FT                   /db_xref="GeneID:3661502"
FT                   /locus_tag="Tb10.70.4420"
FT   mRNA            <805160..>806344
FT                   /db_xref="GI:71747009"
FT                   /db_xref="GeneID:3661502"
FT                   /locus_tag="Tb10.70.4420"
FT                   /transcript_id="XM_817467.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        805160..806344
FT                   /locus_tag="Tb10.70.4420"
FT                   /gene_family="HOG000257086" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747010"
FT                   /db_xref="GeneID:3661502"
FT                   /translation="MGIVRVQRPLLWLLGAVFLLWVLRRQRRCSRFFASLKTSILKKLT
FT                   CKRLGRKQPRVAVRKVDLFVEKVLAQGGLQDVDKIVGIFPRHFELVGHVVVVKLNRGIA
FT                   RDVFAPYARALAESFFPRVIDVVLLDTMGIVGELREPHLEVLWSSATSHFSVNDSLLKV
FT                   TKERVRKASTFTSEDAELLGSCAEAVTFTTHVENGVRYSFDACKVMFCSGNVTERMHFA
FT                   SIIAKDEVVVDMFAGIGYFTLPLAINGGVKIVHALEKNKYSALYLAFNAVQNKVSDLIV
FT                   IHCGDNRDVGSELCGRCDRVIMGYIPSCESFLPRAISFLRRSTRGEPMGVVHYHLLSEK
FT                   DQVINTVTHHVRSTLDEATTSLMRIVNFRMVKSYAPKRFHFVVDMHFSSLQEPE"
FT                   /protein_id="XP_822560.1"
FT   gene            806528..809029
FT                   /db_xref="GeneID:3661503"
FT                   /locus_tag="Tb10.70.4410"
FT   mRNA            <806528..>809029
FT                   /db_xref="GI:71747011"
FT                   /db_xref="GeneID:3661503"
FT                   /locus_tag="Tb10.70.4410"
FT                   /transcript_id="XM_817468.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        806528..809029
FT                   /locus_tag="Tb10.70.4410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747012"
FT                   /db_xref="GeneID:3661503"
FT                   /translation="MRSLEVQKDSILAAIVMECVKNKPSNTSYHSSVLYQRLSAPETRN
FT                   LVYQCCLELVDDSQRRRDIGQLLLNYISSFPPSQTTLQAIASKCKPHAASRSPYSSIYQ
FT                   ELKVVVETYLNHKPLGYMLGRTLQPEKESITFRQSELSINPGYIQKCNLQPPVTQGTEK
FT                   GKHVVPFSGWSDDDITSTAREKNKTRSRLWTVKYQVVGCKDYVNQLPLECTETLIEQQV
FT                   RVLNSFWEKYNTSVEVVRATSFLIKLMCDAYVSKIPLQSNYSFFRAVSICYLPTLFEMM
FT                   SSTYACVRSHVYDILLTLGMHFQLVDTQGLFPGCTEALEEELIWLLLTVLRKQSMCEGD
FT                   DEMIWTIAAKCTIVVIPRHKHHLIDCRALYQLMKLPTVITFHPHLYTTFAEAFAKRVLR
FT                   WDPSGDDAEDMIALDEDEFNKCGNQPVAKLLFLYRQAMTLGARLAFFQVLFTHTVMVLQ
FT                   SRATLPRLYPRILRRCYSELVRVGFHWHLHSLLFYQSRQVFRELPGHITYDMDVEVVRD
FT                   YKMEVTAIVQCMLQTVEDNVRLPDVIRSAFRNAVGTRVEERTALARVVSECVTLIPAML
FT                   KEDTDGVLYNIGWHTALYCMRLSREKLDSDESVALLDKLATNLVSFSEFKDRTELTKIK
FT                   GACPDILAALMFLGRKHPNQAVEPFSILIEKFLHDTAVVDSQSVMQLYYRLFGSLAIQN
FT                   GPFKGAQRADISQLLCSEQLVTAQPIIDGIGSRVLWALYRSLCTVQTASACRARHVLAS
FT                   FLEELDTSGGSSHSYSWKTIMDDPYPPVALIGAQRILQMCGRTAYDRFDEAMNTPEKSE
FT                   KCDSVYVLALKVIQLAESRKE"
FT                   /protein_id="XP_822561.1"
FT   gene            809451..811547
FT                   /db_xref="GeneID:3661504"
FT                   /locus_tag="Tb10.70.4400"
FT   mRNA            <809451..>811547
FT                   /db_xref="GI:71747013"
FT                   /db_xref="GeneID:3661504"
FT                   /locus_tag="Tb10.70.4400"
FT                   /transcript_id="XM_817469.1"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT   CDS_pept        809451..811547
FT                   /locus_tag="Tb10.70.4400"
FT                   /gene_family="HOG000257084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /note="go_function: acyltransferase activity [goid
FT                   0008415]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:71747014"
FT                   /db_xref="GeneID:3661504"
FT                   /translation="MEGKSVVGGSHKLADGSSSCGTIGANPGYAGTSTPLDASSSLYFG
FT                   KVVEDAVPVRVEVGETTTRHTDPQGASVPLTRKATAKDRIAVEKTSDFVFCDECGQNIP
FT                   VSEWADHREHPRVVEHVTSWVGRLNKLLIRLFIDFFMWVLMNIYFREVVVVNEKSIPKT
FT                   GGVVFYGNHQNQFIDAMMIRANCGRPVRFVMAEKSFQRPIIGLFGHMTDAVPVIRPQDA
FT                   PLNSGEGRLIRMDGDMIYGEGTKFTMCLSDRDVIIWYREDVKCTAQVLKINSDTVLQLT
FT                   MPVAACDAVTKPVGFQVSRRIDHSEMYASVYQTLQSGQCIGIFPEGGSHDRTSLLPLKA
FT                   GVALFSLGAAVRGIDVKVVPCGLTYFYGHKFRSRAHVEFGEPITPSAEVVALFNTDKRK
FT                   ATGIFLEQLNEELRGFTINVPNMSALNFLHGFRQLYQPQNCILATRDHLRLTRRLSVIM
FT                   EEQKGNPEFIDYRSRVENYQDYCNALLVRDSQAATLGKLGSNEARQLHLMFRRCFTLFL
FT                   MGVILVPFFVVGLPIGILAKSLSERHRKKALSQSNIKIVGTDVMGSYKLIVGFISVPVV
FT                   FSIVSIITYVYTDLRTALTVSVCLPMTMYVSLLILQEAAIEMRAALPLFMSLISKHKQF
FT                   CKLYERRRALVALTKVLVKKWDPELEEELQHYVQESKQSMKLREPSLFSLRHGGLRRLA
FT                   DIKN"
FT                   /protein_id="XP_822562.1"
FT   gene            812275..814008
FT                   /db_xref="GeneID:3661505"
FT                   /locus_tag="Tb10.70.4390"
FT   mRNA            <812275..>814008
FT                   /db_xref="GI:71747015"
FT                   /db_xref="GeneID:3661505"
FT                   /locus_tag="Tb10.70.4390"
FT                   /transcript_id="XM_817470.1"
FT                   /product="DNA primase large subunit"
FT   CDS_pept        812275..814008
FT                   /locus_tag="Tb10.70.4390"
FT                   /gene_family="HOG000257083" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA primase large subunit"
FT                   /EC_number="2.7.7.-"
FT                   /note="go_component: alpha DNA polymerase:primase complex
FT                   [goid 0005658]; go_function: DNA primase activity [goid
FT                   0003896]; go_process: DNA replication, synthesis of RNA
FT                   primer [goid 0006269]"
FT                   /db_xref="GI:71747016"
FT                   /db_xref="GeneID:3661505"
FT                   /translation="MQAIGTSPKAPLEGERDLLKGRTAMISMPDWSTMYTCNPAGNKTL
FT                   FELEAIVVKRLELLGWIDQLLNSPNMKNLSQLLDEVGAHLPLERRKQSTQPAADHVVLG
FT                   RDSVDGSTSDTPGSRAPRHSSRSLTAMLSTQNVFVFEGDEDLLSHRLARFVFCMSEKWR
FT                   KWFVRTEEMLLRARLRLQLAKCEADFLPNLMRLNGLPCDALTDDQQQDPRLQKYIIYHT
FT                   AVQGKGQLRRADEYFLVPLSLATRLIKARSVLCLRGHAILHRDQVQEVFVTMFLSKLNK
FT                   GLHEAYLARMKLSSHEDHDERETVMKMLDAFLEYFIEDTMNEVQEASAGAVGAGDVRHL
FT                   AQTHFPLCMRQVDEHLRREGHLKHQGRFTYGLFLKAIGLSMQDSMVLFSSLMTLKAGAA
FT                   GKGDPESFAKTSYGYNIRHNYGMEGKKTSYSSLSCTSLLGLPPVVDKFDCHGCPFRFKN
FT                   ESAFRGVLLKEQLHPLGKGHSSIRLAASDIEDIIQDCKGQHYTRACYKYFMATHPGARR
FT                   DTLFRSPHEYYVTSREMTDKVGDSLSDSTPAHETPGRDNLKRSIFTPTLREDVVRPRDS
FT                   L"
FT                   /protein_id="XP_822563.1"
FT   gene            814611..815309
FT                   /db_xref="GeneID:3661506"
FT                   /locus_tag="Tb10.70.4380"
FT   mRNA            <814611..>815309
FT                   /db_xref="GI:71747017"
FT                   /db_xref="GeneID:3661506"
FT                   /locus_tag="Tb10.70.4380"
FT                   /transcript_id="XM_817471.1"
FT                   /product="cytochrome C oxidase assembly protein"
FT   CDS_pept        814611..815309
FT                   /locus_tag="Tb10.70.4380"
FT                   /gene_family="HOG000264965" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome C oxidase assembly protein"
FT                   /note="go_process: aerobic respiration [goid 0009060]"
FT                   /db_xref="GI:71747018"
FT                   /db_xref="GeneID:3661506"
FT                   /translation="MLRSPWTMLCGVGPPGLAPKRKPKIRIESGYERENQKYYEERGHF
FT                   FSAFASISILSLGCTFLFVPLYRMYCAPTGRGADPKFYTPQAQRDREQLNEMYPVPKKL
FT                   LKVRFLSDVGNTMPIAFVPLQKEVEVLIGEPALAFYSAYNRSNRTLLGVSSYTIAPPEA
FT                   TNYLNKIQCFCFEEQRFKPHELVEMPVFFYIDRDFLNDPMVNWLDEVIVNYTFFNLEKT
FT                   KDIIFRSNLA"
FT                   /protein_id="XP_822564.1"
FT   gene            815930..818284
FT                   /db_xref="GeneID:3661507"
FT                   /locus_tag="Tb10.70.4370"
FT   mRNA            <815930..>818284
FT                   /db_xref="GI:71747019"
FT                   /db_xref="GeneID:3661507"
FT                   /locus_tag="Tb10.70.4370"
FT                   /transcript_id="XM_817472.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        815930..818284
FT                   /locus_tag="Tb10.70.4370"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747020"
FT                   /db_xref="GeneID:3661507"
FT                   /translation="MNVLIGKRELFAFAERYSECRIKEYAELADGAILCSLFAAVFPNM
FT                   RIRTATSQTHTRSQLAHANWSALRKALSAVGIPPSLLNRERLQCGDAESGFSALVLFYF
FT                   LFHLSRRSDFSAEFAADVSEELTEFLQSVDSIAALVAGGAMSLSAVPLPLQEQLRGAIM
FT                   RTREGCGLPEGGKESGRSCGDTGLDTACPSSVVLAVQMDGGDNENNEKTTSDDLKRPPS
FT                   FSSPEKFAERKDDRVPQETGGNEREVHSGYSVCRKWKQDDRECEEAYDTIDHCDSCRGG
FT                   DAGYRRMAAGVAEEVGDELMAPIFQQNRDLQELLMVKEKKCEELKAQNLELLGHLTKLR
FT                   IQYSMEKALPWQGDDTANESTKVEKGELLASEEVQHLRSVLQTTRSERRRLAAKDGVPI
FT                   DELLGGIVDAETGEVIDVENEATLLNGVLADVLRDIPRDRREAQRCLWRIVSAFNVLEE
FT                   RLAVAVGTQKPNCERVKREANTIFGDDGGECGSPASVFRPPTTPCTTAKLVESCDDSSM
FT                   FDLKAPADPSLSPENIFSRLKEEMILRQRRFERQLIQLHDNEARLQKRIHVLQNKICHL
FT                   CQRSLERDLTWKSLCAAICEAERTSLLVADAESEEAVERLLEQRNACYIRADEVSASLM
FT                   RDQEEQGDALIMPGGHENDCHDVCETMKVLLESVTQDRDKLLKELEALQDVGETGRNQR
FT                   TEHQQRLSKGDLRKSVRTLLQEEGHSSNGEWFAQTSTFFPFASSPSKLVLKNSVSAAQQ
FT                   EDGRPLHGGRCPLPPGENLSALLSLPGVIGR"
FT                   /protein_id="XP_822565.1"
FT   gene            818779..820671
FT                   /db_xref="GeneID:3661508"
FT                   /locus_tag="Tb10.70.4360"
FT   mRNA            <818779..>820671
FT                   /db_xref="GI:71747021"
FT                   /db_xref="GeneID:3661508"
FT                   /locus_tag="Tb10.70.4360"
FT                   /transcript_id="XM_817473.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        818779..820671
FT                   /locus_tag="Tb10.70.4360"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747022"
FT                   /db_xref="GeneID:3661508"
FT                   /translation="MYTVAPAPGCLSRQLHVSGRNKNIKDIDLGAVFFTHEDKETLALI
FT                   TSFDLSHNCIEKLLHLDALVSLTSLDVSHNRINVVGTLPITITRLNLSNNGLVTLDNVG
FT                   ALRNLRELDVSHNRLDSFIGLRSISTLQILRADNNRIFSVSELGCMTSLHFLSLDHNVI
FT                   RNVNELVFLTSTKHLEMLSLCGNPVSNMKGYKKLITQLCPGLLSLDGLPLASDTSECVV
FT                   DVPDDDEEDEELLTPVARLGPCPAPHPLLKTNRAVHGGNVRVNGFLLVEGQGGESATGK
FT                   GGRADSSVRRSVVATKCCGNKQSAATETGKPPENDLSSIKVASSDTSVSSKQRDSLNVG
FT                   PEGSERPQRGMQKQRKLQQLQTRGSGVEAPTISKTTSSYASKIASKVSHHSSEEKDGSS
FT                   SFSGSQPSRDTERLLRETQVLVEELRKENGYLRARNKKIEAQLREVRRVVTHQLDDITD
FT                   LRKRCAAAESLVAASKEQMEKVKRHARATGKYTHSAVDAMALEQERLRAGYEAQIADLN
FT                   VQLRDAQMRSKKATMCPIQQSRSGKVLTLNTEDINGACTEIEISLGEGMSSPTREGCEL
FT                   SLVLSPTDTTTSDSERSVTRDFCDDAGVLNGSVNTSGIHKPKGTRDTEESACLE"
FT                   /protein_id="XP_822566.1"
FT   gene            821310..821927
FT                   /db_xref="GeneID:3661509"
FT                   /locus_tag="Tb10.70.4350"
FT   mRNA            <821310..>821927
FT                   /db_xref="GI:71747023"
FT                   /db_xref="GeneID:3661509"
FT                   /locus_tag="Tb10.70.4350"
FT                   /transcript_id="XM_817474.1"
FT                   /product="N-acetyltransferase"
FT   CDS_pept        821310..821927
FT                   /locus_tag="Tb10.70.4350"
FT                   /gene_family="HOG000238056" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-acetyltransferase"
FT                   /note="go_function: N-acetyltransferase activity [goid
FT                   0008080]; go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:71747024"
FT                   /db_xref="GeneID:3661509"
FT                   /translation="MVSNGKTNGNERSITGRELRPVEGLQIRVLDDPRLVERIRVLDGY
FT                   CLPIKYGDHYYDTYVRPCAHRYSQIALFHDMLVGSCTCRLERTEDEDEFFLYIMTIAVL
FT                   EPYRRLGVGSRLLESVLRAVASETKVRVRQVTLHMQVSSPVIEFYKTFGFEVMERVPDY
FT                   YTNLDECDAYLLRKVIDQPHLESKQHQNRKAKGGAGKGGKAK"
FT                   /protein_id="XP_822567.1"
FT   gene            822336..822728
FT                   /db_xref="GeneID:3662187"
FT                   /locus_tag="Tb10.70.4340"
FT   mRNA            <822336..>822728
FT                   /db_xref="GI:71747025"
FT                   /db_xref="GeneID:3662187"
FT                   /locus_tag="Tb10.70.4340"
FT                   /transcript_id="XM_817475.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        822336..822728
FT                   /locus_tag="Tb10.70.4340"
FT                   /gene_family="HOG000130928" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747026"
FT                   /db_xref="GeneID:3662187"
FT                   /translation="MRYYPTGLDRDSHISGVRPGGGAPVSHDVNKRRDNLPDHVFASIR
FT                   EEVLMEERMRHVNAEARARAQLIQASGTHGKRMAGGSVGDDRRELERVSSAEAVNARHR
FT                   ALLELYSLEMEGWKEELAERGLSIEM"
FT                   /protein_id="XP_822568.1"
FT   gene            823194..825365
FT                   /db_xref="GeneID:3662188"
FT                   /locus_tag="Tb10.70.4330"
FT   mRNA            <823194..>825365
FT                   /db_xref="GI:71747027"
FT                   /db_xref="GeneID:3662188"
FT                   /locus_tag="Tb10.70.4330"
FT                   /transcript_id="XM_817476.1"
FT                   /product="ABC transporter"
FT   CDS_pept        823194..825365
FT                   /locus_tag="Tb10.70.4330"
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter"
FT                   /note="go_component: internal side of plasma membrane [goid
FT                   0009898]; go_component: integral to membrane [goid
FT                   0016021]; go_function: ATP binding [goid 0005524];
FT                   go_function: ATPase activity, coupled to transmembrane
FT                   movement of substances [goid 0042626]; go_process:
FT                   transport [goid 0006810]"
FT                   /db_xref="GI:71747028"
FT                   /db_xref="GeneID:3662188"
FT                   /translation="MDLAQAKTILDAHDPRVVRVFQESVPELGLRRLDACVLEYLLRML
FT                   EGQMNPASYLPEKTIEQTLRLYLNEFQVCPDENAVDSAVVSICNAMETSGLVQKPKEDS
FT                   SRLVNAVSIGRQYEENLKKATMIRTVGRAAVVNTNADWTWETKRNAAKETRKKRKEEEK
FT                   KSMLAEEYEEFLQKRGIASATAIVKIHHKSDGVQYTTDIRCENIRIHMGKQVLLDNTEL
FT                   TILSGHKYGLVGRNGTGKTTLLRALTEREIEGVSPFVQILHVEQEVVAGGETPLEVILS
FT                   ADVEREQLLREEQELLKRSDDEANNRLKDVYERLYAIEAHSAEARASAILSGLSFTREM
FT                   MTSPTKNLSGGWRMRVALARALFVEPDVLLLDEPTNHLDLFAVLWLEQFLRDWKHTLVV
FT                   VSHSRSFLNNVCGEIIHLDDKKLHYYTGNYDQFEITRVEQLRQQQKHHDAQERQRAHMQ
FT                   KFIDRFRYNAKKAKMAQSRIKTLERMEVVAAVKYDPQFSFKFPDPEPISGSYLQLVDCE
FT                   FGYKPGTTLFRDVNMGIDENSRIGLLGANGAGKSTFMNICCGKLEPRQGHVVRNQKIRV
FT                   AHFAQHHLEALTPQLSSVEFMRSKFPQVEDQQLRAHLGSLGLSGDKALQPIYTLSGGQK
FT                   SRAVLAWITFTRPHLLLLDEPTNHLDIDTLDALIESLLDYKGGLVVISHDEHFITSVCD
FT                   EMFVCGNETIKRFDGDFSEYRDIVMKQMR"
FT                   /protein_id="XP_822569.1"
FT   gene            825678..827024
FT                   /db_xref="GeneID:3662189"
FT                   /locus_tag="Tb10.70.4320"
FT   mRNA            <825678..>827024
FT                   /db_xref="GI:71747029"
FT                   /db_xref="GeneID:3662189"
FT                   /locus_tag="Tb10.70.4320"
FT                   /transcript_id="XM_817477.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        825678..827024
FT                   /locus_tag="Tb10.70.4320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747030"
FT                   /db_xref="GeneID:3662189"
FT                   /translation="MTKQQMCLRDFFLKGKKGMIKDACSDVIDLHVAVKGDELVDAFSS
FT                   KEKHEFLDSMPPMKHSTDVSASCYLDDNVPESSSSNHGEGSTLARPSGVTAFPFQTKHV
FT                   GKYGALTTRSSKRPRSGAQTCLDFGQSDIGGVTTCRICGMIYNAVMPEDIRLHRRFCRP
FT                   QALSNKRRKELDAADGHCVWLASRDVIVQLDRLAGSQRQNLAMQRRYRAGAAPVCLKVQ
FT                   ESTADEFICYVLECGARGLARSAVVSRFVEALQFDDVTLQGESDYCLVAVVQVYLERLV
FT                   CVVAGRPVARTHEPTLLPYKNHCETALGGKQYLETSQKTLCDVPYIWLQSELVLATTWR
FT                   GCLQQQIAPAVKSQRDVTRDFFKCRGMASEKKFEDLQQTRSLGDAALSRALSTLGRHVT
FT                   YGCALCPRRQFSYDSSVVNESVLHRVAGVMGCDDVSTLYTHTGASSHFQ"
FT                   /protein_id="XP_822570.1"
FT   gene            827246..827815
FT                   /db_xref="GeneID:3662190"
FT                   /locus_tag="Tb10.70.4310"
FT   mRNA            <827246..>827815
FT                   /db_xref="GI:71747031"
FT                   /db_xref="GeneID:3662190"
FT                   /locus_tag="Tb10.70.4310"
FT                   /transcript_id="XM_817478.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        827246..827815
FT                   /locus_tag="Tb10.70.4310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747032"
FT                   /db_xref="GeneID:3662190"
FT                   /translation="MEGALFLEGRNVVFFFVPFKNLFVVAVKHDGVEEQMRCVLVWEDE
FT                   KGLFNVITADGGGKWYRLMGRGRIRVMFRVVATVAGRDFFPPLLVHKFKRPSIFPFPLF
FT                   SWELPPSFFLPTRPYFGPQRCGGVSYPFYPFPFSFLFVLFTDLYFKGVGVLEYNKDAMY
FT                   LLLRCFLPLFSFVHVICLPFSYGGGG"
FT                   /protein_id="XP_822571.1"
FT   gene            828558..829301
FT                   /db_xref="GeneID:3662191"
FT                   /locus_tag="Tb10.70.4300"
FT   mRNA            <828558..>829301
FT                   /db_xref="GI:71747033"
FT                   /db_xref="GeneID:3662191"
FT                   /locus_tag="Tb10.70.4300"
FT                   /transcript_id="XM_817479.1"
FT                   /product="U2 splicing auxiliary factor"
FT   CDS_pept        828558..829301
FT                   /locus_tag="Tb10.70.4300"
FT                   /gene_family="HOG000178619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="U2 splicing auxiliary factor"
FT                   /note="go_component: nuclear speck [goid 0016607];
FT                   go_function: pre-mRNA splicing factor activity [goid
FT                   0008248]; go_process: mRNA processing [goid 0006397];
FT                   go_process: RNA splicing [goid 0008380]"
FT                   /db_xref="GI:71747034"
FT                   /db_xref="GeneID:3662191"
FT                   /translation="MYQDRCIFFSKMGACRHGDGCTKVHVRPTTSPTVLFPFMYPNPAA
FT                   IEHIQDREWNFHFERKYLRRHFEHFYKETWRTFMELGRIAELRVVSNLGDHLLGNVYIR
FT                   FEDSHDASRIVRELKAKKLNDIVLLPELSPVTNFAEACCKEDLEGKCERGPQCNYLHIM
FT                   KVSRKLMEKLEKEQAKFWKKKEKHSSSSSSSRKRERSKERGGERSKERSKERGRDRQKS
FT                   PRGYSSDMCHICGKSGHISRECPLK"
FT                   /protein_id="XP_822572.1"
FT   STS             829112..829647
FT                   /db_xref="UniSTS:190403"
FT                   /standard_name="fb33b12.x1"
FT   misc_feature    829321..829348
FT                   /note="AT_rich"
FT   repeat_region   829628..829650
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            830608..832293
FT                   /db_xref="GeneID:3662192"
FT                   /locus_tag="Tb10.70.4280"
FT   mRNA            <830608..>832293
FT                   /db_xref="GI:71747035"
FT                   /db_xref="GeneID:3662192"
FT                   /locus_tag="Tb10.70.4280"
FT                   /transcript_id="XM_817480.1"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT   CDS_pept        830608..832293
FT                   /locus_tag="Tb10.70.4280"
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.5.1.-"
FT                   /note="similar to Delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase, mitochondrial precursor(EC 1.5.1.12) (P5C
FT                   dehydrogenase). (Swiss-Prot:P30038) (Homo sapiens);
FT                   go_function: 1-pyrroline-5-carboxylate dehydrogenase
FT                   activity [goid 0003842]; go_function: aldehyde
FT                   dehydrogenase activity [goid 0004028]; go_process: proline
FT                   catabolism [goid 0006562]"
FT                   /db_xref="GI:71747036"
FT                   /db_xref="GeneID:3662192"
FT                   /translation="MLRRTLPFAFAFVKSPPAVNERMDSFQPGSDSARGTLEACKRLRC
FT                   GATDCPIVIGGKEYRTDNAINRMIPSSHQQQVAKGYNATPELAQKAIDTALGAAKEWSQ
FT                   MPFKDRAAIFLHAAHLISTKYRHELRAATMLGQSKNPFQAEIDVIAESCDFLRFSVKYA
FT                   EELYNQQPISPASGPVWNALDYRPLEGFVSVIAPFNFSAIAANLVACPALMGNVILWKP
FT                   SPNAVLSNYLLYKVFEEAGLPAGVVNFMPCEPKVMTEVVNSHPELAGVAFTGSTNVFLS
FT                   INKQIYSRLEEYRNIPRISGETGGKDFHLIHPTADMKMTAALTVRGAFEYQGQKCSATS
FT                   RIYVPQSRWEELKGYLLELHGKLKMGQPDDFQSFMCAVIDETAFDRNKKYIDIAKADSS
FT                   AYTIIAGGGCDKSEGWFIQPTIIVAKDPNAQLLREEIFGPILTVHVYDDSKPDFWSEAC
FT                   NLVNNATKYALTGSIFAQDRKAIRDATEKHLRYAAGNYYINDKCTGAVVGQQPFGGARA
FT                   SGSNDKPGSALFLTRWVSARTIKENFDHSAQVSYPHQLPDYVTL"
FT                   /protein_id="XP_822573.1"
FT   repeat_region   832725..832745
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   833276..833300
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            833668..834114
FT                   /db_xref="GeneID:3662193"
FT                   /locus_tag="Tb10.70.4270"
FT   mRNA            <833668..>834114
FT                   /db_xref="GI:71747037"
FT                   /db_xref="GeneID:3662193"
FT                   /locus_tag="Tb10.70.4270"
FT                   /transcript_id="XM_817481.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        833668..834114
FT                   /locus_tag="Tb10.70.4270"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747038"
FT                   /db_xref="GeneID:3662193"
FT                   /translation="MAKGRDSTAHMREFIKRLRARSNVSESPQPQEGEAPPRYARSAIT
FT                   GEVRVVGQKGPLTTSFPSPHRRLLSHVENITATTTSKPEEPPLPPALQIVPDAAEWEQN
FT                   TGTKQQSCREKPVNPAAKSEPRHGAKKVSKSGNASDVLERHKKR"
FT                   /protein_id="XP_822574.1"
FT   repeat_region   834137..834169
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   repeat_region   834376..834472
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    834791..834874
FT                   /note="GA-rich"
FT   repeat_region   834981..835016
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    835841..835868
FT                   /note="AT_rich"
FT   misc_feature    836052..836105
FT                   /note="T-rich"
FT   repeat_region   836287..836337
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            836752..837873
FT                   /db_xref="GeneID:3661486"
FT                   /locus_tag="Tb10.70.4250"
FT   mRNA            <836752..>837873
FT                   /db_xref="GI:71747039"
FT                   /db_xref="GeneID:3661486"
FT                   /locus_tag="Tb10.70.4250"
FT                   /transcript_id="XM_817482.1"
FT                   /product="protein kinase"
FT   CDS_pept        836752..837873
FT                   /locus_tag="Tb10.70.4250"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="curated by M. Parsons, P. Ward, J. Mottram;
FT                   go_function: protein-tyrosine kinase activity [goid
FT                   0004713]; go_function: ATP binding [goid 0005524];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71747040"
FT                   /db_xref="GeneID:3661486"
FT                   /translation="MNSNAPLIFDVPPVFKVESIIGQGSYGVVCKALYGIDQIAIKKIP
FT                   NYTKSDETARRVLREIEILQNLQFCEQVVECRLLFRPTSREKDVYVVMNFLPSDLSSVI
FT                   KNKSVPLNEKIICYITCQLLLALRAMHRCNVLHRDLSPRNILVNHDSQVFVCDFGLSRF
FT                   FDPDEQLSFGVVTQWYRAPEIILDAEYDAANDIWGVGVIVCELVLRRHLFPGKWNDSAD
FT                   QLNHIFHLVGTPPASVFEQGQPFARASANARKYALSVVEKKPCSPMLQELLRSSPLFQS
FT                   NEVESHSVIDLAVKLLSFNPRDRPTADDALRHPWFDQFRSFIGEMIETQDGHGVGTMQL
FT                   SACGTLPVEDVVKRIEELVPIFSQDLLVSDDED"
FT                   /protein_id="XP_822575.1"
FT   repeat_region   837897..837954
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   837967..838020
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctttg"
FT                   /rpt_type="tandem"
FT   misc_feature    838367..838399
FT                   /note="T-rich"
FT   gene            839080..840003
FT                   /db_xref="GeneID:3661487"
FT                   /locus_tag="Tb10.70.4220"
FT   mRNA            <839080..>840003
FT                   /db_xref="GI:71747041"
FT                   /db_xref="GeneID:3661487"
FT                   /locus_tag="Tb10.70.4220"
FT                   /transcript_id="XM_817483.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        839080..840003
FT                   /locus_tag="Tb10.70.4220"
FT                   /gene_family="HOG000254939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747042"
FT                   /db_xref="GeneID:3661487"
FT                   /translation="MRCSCAFLDKSVFAAKRRVIVPIHPTPNFPAHFIKSAFTTDPLKE
FT                   KQKARFSSGGEAMREVQDIPKNLEGERSRRDLASRGDTEFQALVEFIEGASYDQLISGR
FT                   RFKKVYDVLSENDDMFIWLCHTAMSVLNPGDMRSRLIYNHLRILAESVASGEMTQRTAF
FT                   RFFESAVRSPAYREIAKRQLEGGAATRLAGISAAADVMRRMGLTRRPMSSYFELYQRIV
FT                   ERSEAMTPWGFPPLFQFEERLSLEPRLKFFSRASQQSLERRRRGHVMTPHTALHGRRIF
FT                   WIPPTWNRAGRFLGPHVTLYPGMTPD"
FT                   /protein_id="XP_822576.1"
FT   gene            840586..842697
FT                   /db_xref="GeneID:3661488"
FT                   /locus_tag="Tb10.70.4200"
FT   mRNA            <840586..>842697
FT                   /db_xref="GI:71747043"
FT                   /db_xref="GeneID:3661488"
FT                   /locus_tag="Tb10.70.4200"
FT                   /transcript_id="XM_817484.1"
FT                   /product="fatty acyl CoA synthetase"
FT   CDS_pept        840586..842697
FT                   /locus_tag="Tb10.70.4200"
FT                   /gene_family="HOG000254845" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fatty acyl CoA synthetase"
FT                   /EC_number="6.2.1.3"
FT                   /note="similar to Long-chain-fatty-acid--CoA ligase 4 (EC
FT                   6.2.1.3) (Long-chain acyl-CoAsynthetase 4) (LACS 4).
FT                   (Swiss-Prot:O35547) (Rattus norvegicus); similar to
FT                   GB:AAM68991.1: long chain fatty acyl CoA synthetase 6
FT                   {Leishmania major}; go_function: catalytic activity [goid
FT                   0003824]; go_function: long-chain-fatty-acid-CoA ligase
FT                   activity [goid 0004467]; go_process: metabolism [goid
FT                   0008152]"
FT                   /db_xref="GI:71747044"
FT                   /db_xref="GeneID:3661488"
FT                   /translation="MGGCVASLIESRNTKSLVDNDDILQYNKLPCQIRVVAGTEREDAS
FT                   PVYRKFDVTDEDFEKMSHDAYHGEPLIQLIREICGLRGEKVAMAYRNMQRVERNVVKDA
FT                   SGKSKTMDMYVFSPGRRNISYKQLWETVENFSKGLCEIGLQERQCLALFEETRWEWYAS
FT                   LLSAWCHNMIVATVYANLGEDALRYALREAQCGCIICNGKNVPVLLDKVKLKEMGNPVV
FT                   IYLDDLPTNVDIMDLRVYKWSTVVEMGAKSEKAQLNIPTCENCDDTALIMYTSGTTGDP
FT                   KGVVHTHGSLASGVYALSIRLSEVFGDPRDDETYCSYLPLAHIMELAVLSILMLRGCLI
FT                   GFGSPRTITNTFSKPHGDLVEYRPFVLSAVPRVFDTIKKNVEAMLPSPGSIKRTVFERG
FT                   YQARLKALRDGKETPYLNEKVFNKVRQATGGNVRLYFSGGAPLSPATQEFINVVLGTVI
FT                   QGWGLTETVCCGGTQFPGSLESESIGRMIDTVELRLLDTPEYRHTDKPEPRGEILLRGP
FT                   FLFKEYYKQKALTEEVIDSEGWFHTGDVGCVSKNGTLRIIGRVKALVKNSNGEYLALES
FT                   LEATYGQNKLCTPNGVCVLVHPQRSYIAALALTTEQLIMPFAKEHKIRGTYPEILENVE
FT                   LRKKVCESFQETGRAAGKKSFEIVRDVRLLSDEWTPENGVLTAAAKLKRRIIDERYKEL
FT                   IEEIFRNDV"
FT                   /protein_id="XP_822577.1"
FT   misc_feature    843191..843282
FT                   /note="T-rich"
FT   repeat_region   843673..843692
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ga"
FT                   /rpt_type="tandem"
FT   repeat_region   844523..844546
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   844666..844698
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   844836..844863
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   845067..845099
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            845394..845858
FT                   /db_xref="GeneID:3661938"
FT                   /locus_tag="Tb10.70.4170"
FT   mRNA            <845394..>845858
FT                   /db_xref="GI:71747045"
FT                   /db_xref="GeneID:3661938"
FT                   /locus_tag="Tb10.70.4170"
FT                   /transcript_id="XM_817485.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        845394..845858
FT                   /locus_tag="Tb10.70.4170"
FT                   /gene_family="HOG000254940" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747046"
FT                   /db_xref="GeneID:3661938"
FT                   /translation="MLRRVRPLRAWNNRQHSDRERDRIARERQRHILYDNAGNVKLYGI
FT                   LFLLWEEFRVPIIAVATGFFVLLAYNKIVLYYSARQLAGERELDQKSESEARLSGKLKG
FT                   DRYLIKPWRQVEDPDFLNIPSYAGKGVYSSKLFEDDVASTDPLFSERRRN"
FT                   /protein_id="XP_822578.1"
FT   repeat_region   846067..846088
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    846475..846503
FT                   /note="AT_rich"
FT   gene            <846547..>846795
FT                   /db_xref="GeneID:3661939"
FT                   /locus_tag="Tb10.70.4155"
FT   mRNA            <846547..>846795
FT                   /db_xref="GI:71747047"
FT                   /db_xref="GeneID:3661939"
FT                   /locus_tag="Tb10.70.4155"
FT                   /transcript_id="XM_817486.1"
FT                   /product="60S ribosomal protein L38"
FT   CDS_pept        846547..846795
FT                   /locus_tag="Tb10.70.4155"
FT                   /gene_family="HOG000188979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L38"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71747048"
FT                   /db_xref="GeneID:3661939"
FT                   /translation="MPREIKNLKEFLAICSRKDVRCVKVKHNPKVTKFKVRCSRYLYTL
FT                   VMADKKKADKIERSIHPTVKKITVTARSHAKKNTPSK"
FT                   /protein_id="XP_822579.1"
FT   gene            847036..848052
FT                   /db_xref="GeneID:3661940"
FT                   /locus_tag="Tb10.70.4150"
FT   mRNA            <847036..>848052
FT                   /db_xref="GI:71747049"
FT                   /db_xref="GeneID:3661940"
FT                   /locus_tag="Tb10.70.4150"
FT                   /transcript_id="XM_817487.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        847036..848052
FT                   /locus_tag="Tb10.70.4150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747050"
FT                   /db_xref="GeneID:3661940"
FT                   /translation="MCPSLFAYTKWAVLVHLVTLCVTLTWRFCHFFFSPFPFNYGTCRL
FT                   RVRFIKVQHTFARRNKRDFIMRSLRSICASEPRCSRFNTHSFRLRAAGTSPGAGVSASR
FT                   TTDCVTALFDVGVGSVEEIFSLPAPQLQKNCGDVVGSVFRKELKNARVGNQDFSEVLWM
FT                   ATTRGELLSDIRKLFRHAGVEEAYADPNVTTHPSGVPIGIRDEHNGWYSQQPHYSPPVF
FT                   PSTAAVSPRSPWAAGMDVFSYAFAYGFWQQRRESLQLAHHQMQKLSSDIQYVKEALDGD
FT                   HRNRLRLSLRLWCMFLFPFSLLVLLLLSTDQILYVAELKRVGLCDYDAWQRRYPRGR"
FT                   /protein_id="XP_822580.1"
FT   gene            848519..850144
FT                   /db_xref="GeneID:3661941"
FT                   /locus_tag="Tb10.70.4140"
FT   mRNA            <848519..>850144
FT                   /db_xref="GI:71747051"
FT                   /db_xref="GeneID:3661941"
FT                   /locus_tag="Tb10.70.4140"
FT                   /transcript_id="XM_817488.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        848519..850144
FT                   /locus_tag="Tb10.70.4140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747052"
FT                   /db_xref="GeneID:3661941"
FT                   /translation="MTEVAVDCFPTPTVSSHSLSNEVNNNGRGGVSSGGMVAVEDKVAL
FT                   LLAGARKLLEEPTPSLSCHAEEVLPCDDEEECRRRLRFLEAAHAFVEQQHVTQRYLKRA
FT                   VVSSRSIGVNAWTSEQTRGGLPHCSARDLPAVAVMIDGELTDCETEECPTRHNLCFSTV
FT                   LHIKPRGLWAKDAAVRRQGQYCKQCLDPLHRYKIPLPVWKEARFCYFTGMYYCNMCNSS
FT                   RYSVIPAFVLKKWDFKPRPVCNDAYEFLKYHHKHPIYRVCALNPRLYERVALLRVARNL
FT                   RSQLMKLRDVGMKCAVLRHLLYLHDAPVELERDSNRRPSRTTTNASATNHVATFVASDG
FT                   DAASFAADCYVPRTRRYLLENCELWSLSDLEDVRRGQLLFRQESAGRTMAFIKDTSLIS
FT                   QLAAYSKGTAALCGECDTTVYLKQVRSRILRHILVHSCATCLVNSVDVCSICCPAEVAQ
FT                   KLECINEQTRGGTPFGTCEHFFGSLIKDVSVLPFLVYVFDTLHVFCCTGCGSAYHRRCF
FT                   KEMQHTKGDLTCCPRCRATQLIKE"
FT                   /protein_id="XP_822581.1"
FT   repeat_region   850275..850334
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   gene            851199..854039
FT                   /db_xref="GeneID:3661942"
FT                   /locus_tag="Tb10.70.4130"
FT   mRNA            <851199..>854039
FT                   /db_xref="GI:71747053"
FT                   /db_xref="GeneID:3661942"
FT                   /locus_tag="Tb10.70.4130"
FT                   /transcript_id="XM_817489.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        851199..854039
FT                   /locus_tag="Tb10.70.4130"
FT                   /gene_family="HOG000254946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747054"
FT                   /db_xref="GeneID:3661942"
FT                   /translation="MSTENEGESKENPSYLTVELEHVGHVSIDAIEHHYMELQKELAME
FT                   PHLRPLREEYEKIHRLLRKSHDGEKRLMAKIKELDHDLITHAANVESALKLARQDEDVI
FT                   EALRREIEKAWSLADSAHAREKETREQIQELRQQVVRLNGLVDKNTSSTLGQENFLRDL
FT                   IKAKKEFENERLMAQAKAERLVDERLFAQRKMHKLREDSECVRHSLENTLKNYEGCLRN
FT                   LSDTKRDRESLEQQVREYRVEADEHLKEIASVRQSVAELAKEEEKLKALALSERDSVGQ
FT                   LAKQLEEQQDRFKKEADKLAAVEAHNAEMKQEIPKMRMTLKGRHAEVERLALSLRKARK
FT                   GAGVQQTEIDKQMQTRASLMEQTEKMHTAIEELLRTLDDHVKALHDEEVRLKGAMPIKT
FT                   KLLTENSRVDSEKAMMEGQRMLEEGKRRNLTQQLEKLLRDNETMRKKIFELEQNQAKIL
FT                   DNGQREALQYHRVLEQTRKQQGQAKLLQQQLEDNEKRLKAQQDLLDRVSADRARTEKRL
FT                   KESELECSGLKQRYNHNGEEIQLLKMQIIGKEGALCRIHMVRKQLQRDIANAEERASHL
FT                   KEDGTSATNRYETLKGEVKQLSHLIAECDAEKSKYQSKFAALVNERNVLATQLVRRNEE
FT                   LRLLHSKIRLQECSIEKGAEDYNKRVRAVMGKRSELEELRLRCRVALARMLHAEKLRRR
FT                   KQKIERDLFTEKRRSRALADELQRPVNVHRWRRLEGNAPEILDGIYKVHTLERQILKKQ
FT                   DLLVEKTKQLAARNAEYETVRKKLAELQGPEVAGELSLYDENLQCRREQIRGLDTELQE
FT                   VEQHVDVVAEEVKQLTVELCEVKRRYYNAKHKNDLLRREQGAFRAMWGGSSAVARTALA
FT                   AIENASERRQLQQQGSISSRRQPLWRTRAQKRREQIKQEEQIVQVLSTGAPAPSFPLQV
FT                   PPGQRIFLGGGFALTR"
FT                   /protein_id="XP_822582.1"
FT   repeat_region   854538..854576
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            854850..856520
FT                   /db_xref="GeneID:3662537"
FT                   /locus_tag="Tb10.70.4120"
FT   mRNA            <854850..>856520
FT                   /db_xref="GI:71747055"
FT                   /db_xref="GeneID:3662537"
FT                   /locus_tag="Tb10.70.4120"
FT                   /transcript_id="XM_817490.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        854850..856520
FT                   /locus_tag="Tb10.70.4120"
FT                   /gene_family="HOG000254947" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747056"
FT                   /db_xref="GeneID:3662537"
FT                   /translation="MRGCAKGIGAIFAADASNHVRGKSVNADESCFGVFQNMHINPFPV
FT                   RAAIDIGTGGMITMVVARVDAAANAVRNFMYQTQLPLHLESVAAGLGDSSSFVLSEATR
FT                   ADIRNKMRVFHGALRRDNYDGLSERAAVMSWPLCEAADALALAEDLTREFKVDVRVLGK
FT                   TFNVSMPFCGSVGLSANASQESMEVDVRRGRRCSNACTTAVTGGSESGSVQSFLHHTNR
FT                   RRKERQAKLDSQREVRTVTDGDRVPNVPAAQQMEQLAFLAHAAVSKCVAPQRLLILAED
FT                   CHKGICVLGADTAEPEEVTDDETAANTKGINNNSKDAVTHQGVGSPTGLLVHALPVDLA
FT                   MAHRLLVTTVQRRSQTTDEGANQRSPNPVLREEFRRLRCLLEEAMHHTLPQWVLDKSNT
FT                   GGVICGSSFNGGVLNVAARIAQRSSVSLDHLETHAEMHYCGLTDVLMSVNYPNAATVIP
FT                   CAALASALLRSLDAQRFEYLPEVHIPAALLLQPSLWTYTRRDQVRKALKQKPFYAAGSL
FT                   RRTFQRPHARENPTAAPTASWQKNKEWNALSYDNSTKGT"
FT                   /protein_id="XP_822583.1"
FT   gene            856871..857920
FT                   /db_xref="GeneID:3662538"
FT                   /locus_tag="Tb10.70.4110"
FT   mRNA            <856871..>857920
FT                   /db_xref="GI:71747057"
FT                   /db_xref="GeneID:3662538"
FT                   /locus_tag="Tb10.70.4110"
FT                   /transcript_id="XM_817491.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        856871..857920
FT                   /locus_tag="Tb10.70.4110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747058"
FT                   /db_xref="GeneID:3662538"
FT                   /translation="MLLIVFVVGFLLLLTAFVALQLRRSQQFPTFSDATPSRVAARRSE
FT                   TRRSQYNDGDYWSNESSDEGSDDDDNDDCEVGHKREERRKLRGGTSGSAGPLRHRRTRR
FT                   GAGNAAEADGDGEEDKNGSQTKLSRLQRKKQEKERERQERQQAQEALLENRRVKQEEEQ
FT                   RQQKDREREEREREIAEEAALQELREEKKRQEDEEYAKWVEGIGVVERGEIGDEERKKH
FT                   DNLVKYLITMAGNGGERQQQRVIDAENFGEGEKVGDETITRGTESSSRGNILILNDVAR
FT                   THGLSVEVTVQVIEKLLEDGVISGVFDDRGKFVMLSEEHYKQIAEFVKLRGRVSMKELA
FT                   RECNRIIML"
FT                   /protein_id="XP_822584.1"
FT   gene            858529..861204
FT                   /db_xref="GeneID:3662539"
FT                   /locus_tag="Tb10.70.4100"
FT   mRNA            <858529..>861204
FT                   /db_xref="GI:71747059"
FT                   /db_xref="GeneID:3662539"
FT                   /locus_tag="Tb10.70.4100"
FT                   /transcript_id="XM_817492.1"
FT                   /product="protein kinase"
FT   CDS_pept        858529..861204
FT                   /locus_tag="Tb10.70.4100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="curated by M. Parsons, P. Ward, J. Mottram; probably
FT                   only fragment as end of contig; similar to GB:AAM69001.1:
FT                   serine-threonine protein kinase 2 {Leishmania major};
FT                   go_function: protein serine/threonine kinase activity [goid
FT                   0004674]; go_function: ATP binding [goid 0005524];
FT                   go_process: protein amino acid phosphorylation [goid
FT                   0006468]"
FT                   /db_xref="GI:71747060"
FT                   /db_xref="GeneID:3662539"
FT                   /translation="MSSQDSESWGNSRQHYQYSDASEEHRPEATKLKSECFQNAGRTSP
FT                   NRRRDSPAIQQESSDFATTSDSPVPCHYSQRGPASQNAQQKGKDRGDVFCSTVTSSDLF
FT                   PTVELGPRMLPTNSTSMKGGRYAAGDRLPQTQETDKTDKPVRNRSERSEGTPLPNCGTA
FT                   LRDGSRHSHSPASSCRGNDSLVTNGTASQRETNEESCDVCGSCSTHYVSVSLGLSEWET
FT                   LSPNQIKLRQCFDAPIDSIAVPSSETHRSLAHEQQRQLLETIMQKHSRKRIKRVTDYIL
FT                   GPICGEGTLSTVRDAINISSNNVDPFRFQRVAIKCYKQSDSKLSEGAGSSDCSQLSSLA
FT                   SATRRQQDELQRLREAEKRNLQCFYSTNIVRSIDVFSHEGKQYIVLPAAICNLEQLVQL
FT                   AKCQNRCASCDSVRGKRNMIPSSKDGVDGRFELMPSLGKPAGKLPQNDVSLCTGAASLQ
FT                   KMSPYRKVTSLFAAEVVRSIMNQLLRGVAYLHRQGVAHNDLKPQNILLFADGLVKIGDL
FT                   ASVSVNYTGHGTPMYLSPEICRYFYDAGNETNGRVAVVDALKNDMWGCGAILYYLLTGN
FT                   TLWEDGANCQNVYQLYRIIAERNTPVSLSHINIPAETEDELISRLTESENISFRATGGL
FT                   RRPTAFPHTSLLHLAAGLLDVNPATRLTAEEAVRHPSLQAPPVDDVHDAFPTDMTQGDV
FT                   MKVMLESPYYQQLIKWDRERHLQFAAECSHVLGLQIPEEICVSAQKRAADGCGMEADVT
FT                   DPLLRLPSSIYRLVGTVNPSLFLPTDEFHHYLRKLKVPNYDVSSLRANPSAVKMMEDYL
FT                   HTVMMECGYTGSVNTRERSGSKEDQNGIKLSTSQLTTRSREDTSHGLATFKDDDQPETL
FT                   DRVLTDMPSDGRPNFCCIIM"
FT                   /protein_id="XP_822585.1"
FT   repeat_region   861306..861332
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    862658..862679
FT                   /note="AT_rich"
FT   repeat_region   862726..862752
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   repeat_region   862818..862851
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttcc"
FT                   /rpt_type="tandem"
FT   misc_feature    863544..863565
FT                   /note="AT_rich"
FT   misc_feature    863612..863634
FT                   /note="AT_rich"
FT   misc_feature    863827..863886
FT                   /note="A-rich"
FT   gene            863910..865547
FT                   /db_xref="GeneID:3662540"
FT                   /locus_tag="Tb10.70.4090"
FT   mRNA            <863910..>865547
FT                   /db_xref="GI:71747061"
FT                   /db_xref="GeneID:3662540"
FT                   /locus_tag="Tb10.70.4090"
FT                   /transcript_id="XM_817493.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        863910..865547
FT                   /locus_tag="Tb10.70.4090"
FT                   /gene_family="HOG000254954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747062"
FT                   /db_xref="GeneID:3662540"
FT                   /translation="MCQTLTTDGLSGEVRPAFTEEEQNPNRCSDDSGDGVNSMETRMKG
FT                   DPWRFAVAAIFCLLSISNAMQWIAFASIFDETRTYFNMTAVQVNYLATTYVIAYVVAVF
FT                   LSCKLFEVTGLKAGILIAATANAIGASIKLVAVYAWPHMILLFLAQAFNSVTEILTIAT
FT                   PPLIANRWFPVEERVAANAVMTICLNVGCGLGALIPVFFVSPEKQEQRHFAALFWFQFG
FT                   LCAGTFALTFIIPQLPRQSPSYAADRQQKMEAKRLRTLRERQNRQSGAGAPAETQPPLE
FT                   VVEDDRLNMYDDDDVESVAEPINVFSTLGDTFRAMRTNSSFVFLSIASAAELGLIWSVA
FT                   TVLPQCLVPFGVTGSESGWISFLNLVLGSVIAPIVMHYFGQNWRHKQSLLVISIILVVN
FT                   VCALCLCYYFGPSGDDHRIYYVVVVFLLWGGVAGLCQNFMLPIMFDFVVELTFPMREST
FT                   SAPVLTWAACLSNLVLTVVFGEVLGENPTRTDSAKVLLGTVIVCIIGCVALVLVRPLKR
FT                   REEFEHRMEELDRAALQLPQDASHERVR"
FT                   /protein_id="XP_822586.1"
FT   misc_feature    865588..865626
FT                   /note="AT_rich"
FT   repeat_region   866027..866097
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   866571..866627
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttta"
FT                   /rpt_type="tandem"
FT   misc_feature    867128..867152
FT                   /note="AT_rich"
FT   gene            867908..870730
FT                   /db_xref="GeneID:3662930"
FT                   /locus_tag="Tb10.70.4080"
FT   mRNA            <867908..>870730
FT                   /db_xref="GI:71747063"
FT                   /db_xref="GeneID:3662930"
FT                   /locus_tag="Tb10.70.4080"
FT                   /transcript_id="XM_817494.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        867908..870730
FT                   /locus_tag="Tb10.70.4080"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747064"
FT                   /db_xref="GeneID:3662930"
FT                   /translation="MPRLLLPCGVELINSSTSQPHNMLVNEEQRGLEERSVLNAEMDFF
FT                   TDEYLSAHAGATRPHTTISGNTRETCNGEQGSCVSQERTTEGSIAAIDCDVSLQLIQSG
FT                   RGSGHSVVYTVRVPAAVSFSSPSTESELAANGSATSLRLQQIVNSEWRNRKEEMTNMGG
FT                   AWEGRESTPTAATCCCDAFDCEEAAAGPNYPADRFRGRRLATPKATPYGTGADPSATHF
FT                   EETFRNTAFSISETGINPVSHLPPVCAVRLPPDFVFGLRLPPDTERRLVELYNGGSVTL
FT                   REVKTPKIPKWLTAFFYTSGVRCQLSTPLPSTPETRLVGGLMNKLSAVSVLEGFCIAAL
FT                   HVVSHMGELRLHNGGQKLHVSETAGVDDAQRCLLDEGGIFAHTQEEQIRLWLHRYVPQE
FT                   AYTNGRDGDVAQRDADSTSVYPSAVAVVYYIAIELARGLFPCILSGLEATILTALQPLV
FT                   SAQTLIPEVSGCRSSRLPRPASHNRAISLLTQSPMSLWWWWRQRDSHSDAVERECNGKN
FT                   KALSSLPIRCPNAVATARGYGAVRFLKFFSFFCVEQITAETRHVEEAREFFEVAQFLAS
FT                   SSALFSELLLDREVMSVLERTTTEVGKLTRKEAEDCGHGRANAEPTQVTRILMRCFVVL
FT                   ICWMAFRPSGYSRSLARTYFAYILRPASCLCELSMKRGMISDAAKKDGVNSALVACVHD
FT                   YFSKISSLLHAVRGFSRPQRRRRQQADFPSRNPWRPLGCTEEVSVLGNGDCGCNDDQTT
FT                   ITSRSHASASSFLPTHSSNGIATNPAHHLLTRGLSCATSEDELIFSSHSLRLLRHAIRH
FT                   ARGVLQSLRSDVLGTSECTAAFDVVTGSKRFRESSGTSTLEGAYDQCAPQCEMKCACAK
FT                   TPQLHHFLGECEDPSLYVGGVLWSVSSEDEEDSAGIFTTSTTTNPTTPTTASDSGTGSA
FT                   IEATSWHFVE"
FT                   /protein_id="XP_822587.1"
FT   misc_feature    871126..871168
FT                   /note="AT_rich"
FT   repeat_region   871618..871690
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   gene            872109..872453
FT                   /db_xref="GeneID:3662931"
FT                   /locus_tag="Tb10.70.4070"
FT   mRNA            <872109..>872453
FT                   /db_xref="GI:71747065"
FT                   /db_xref="GeneID:3662931"
FT                   /locus_tag="Tb10.70.4070"
FT                   /transcript_id="XM_817495.1"
FT                   /product="60S acidic ribosomal protein P2"
FT   CDS_pept        872109..872453
FT                   /locus_tag="Tb10.70.4070"
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S acidic ribosomal protein P2"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412];
FT                   go_process: translational elongation [goid 0006414]"
FT                   /db_xref="GI:71747066"
FT                   /db_xref="GeneID:3662931"
FT                   /translation="MAQSINPADTLACTYASLMLSDAGLPITAESINSACKAAGLEVRD
FT                   TLPILFARFLEKKPIESLLAAAAAVAPQEGALPAAPAAAAAGGAAPAAADDKKKEEEED
FT                   DDDMGFGLFD"
FT                   /protein_id="XP_822588.1"
FT   repeat_region   872341..872391
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   gene            872732..873076
FT                   /db_xref="GeneID:3662932"
FT                   /locus_tag="Tb10.70.4060"
FT   mRNA            <872732..>873076
FT                   /db_xref="GI:71747067"
FT                   /db_xref="GeneID:3662932"
FT                   /locus_tag="Tb10.70.4060"
FT                   /transcript_id="XM_817496.1"
FT                   /product="60S acidic ribosomal protein P2"
FT   CDS_pept        872732..873076
FT                   /locus_tag="Tb10.70.4060"
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S acidic ribosomal protein P2"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412];
FT                   go_process: translational elongation [goid 0006414]"
FT                   /db_xref="GI:71747068"
FT                   /db_xref="GeneID:3662932"
FT                   /translation="MAQSINPADTLACTYASLMLSDAGLPITAESINSACKAAGLEVRD
FT                   TLPILFARFLEKKPIESLLAAAAAVAPQEGALPAAPAAAAAGGAAPAAADDKKKEEEED
FT                   DDDMGFGLFD"
FT                   /protein_id="XP_822589.1"
FT   repeat_region   872964..873014
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   gene            873482..877300
FT                   /db_xref="GeneID:3662933"
FT                   /locus_tag="Tb10.70.4040"
FT   mRNA            <873482..>877300
FT                   /db_xref="GI:71747069"
FT                   /db_xref="GeneID:3662933"
FT                   /locus_tag="Tb10.70.4040"
FT                   /transcript_id="XM_817497.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        873482..877300
FT                   /locus_tag="Tb10.70.4040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747070"
FT                   /db_xref="GeneID:3662933"
FT                   /translation="MSGRGGSRAQSPCVTPSRCFLTNPFKISPAQTPKTTYLMRILGES
FT                   IRRSSNVVATVAATVVLLEDDGFSTNSEFLMKWWRMLERCLGELAGVVNSCEENIREKD
FT                   MRVLLALSHGFALAAQLSSLERRFLACLHRFAEVCEGAETVGAGEKLSGALSDITSLLK
FT                   GEETILVAIRRQEANYIEKAIALQEEVFRVGEEGEPFFGKVEEPETRRTYLGSLWHALT
FT                   APFDDSEEVNNEQLVAADGGDWSQLISTFGSGGGASVCNWDDSMLLNSIVECAFASAEQ
FT                   QHTLLSERNFAVALFLFSTKCNVLEELVEVCFQLRLGNGGLFGFEKLMYTDVSSQRERT
FT                   VDWLSTILSPLREDVLHLELCDGNPKPPYFVAVVFLTLLWNTTYCMWKRGCIREAYEWL
FT                   RVVDLGQLRRMAKAEDERGMKREISPESGVNSEAEDVGNVQEELKYTGSLSWDYIVHRA
FT                   AGCPGPDRAKQVHRHSEVDFRHDRSGQLMWFVHHISCLRNACALALLCSTPHDVMYIIS
FT                   KFHHSRRWQWRQCVYLHESAKDAGANLSAEFGVVDSKFEVLSLTNFIVENYLARRSVRM
FT                   YHFRSPPSPRKATSSDTTIEGSVVHVCDELICSMSYGRFSGVKEMEEAMFSELFGACCE
FT                   GEIGEETGGEATTEGDDGSQRRLNWLEVHVAKVAVAFARDFRGNIYFQNAWVGTERGAR
FT                   SEKHSGGGAEEASWSSVLPLVKGLHGSAAHPPMPTDAGGGNQPINACSQGTTHHEFEKE
FT                   PQGLLRHVSCMVPVRMTPPRVEHQAENERCTLWLPSRKGVGLLLLPEETDVNGEYDSFG
FT                   EVALRLLVIACRYCDSMKLLPLHSRFSHHAVPEAGRVDAENNDHLSGWDSCHALLPSVV
FT                   HELNVGLSLITDELRSSAGGDVLSVWHQQRDSSISRFRLNHLVSVTLHGLCSDALTSIE
FT                   LQMREESSVISARCTISQAVGAVQESDQGELTVIDSCSTPRDLLLDSSTRKSNELFMPS
FT                   PTSPFHLGDKRQSSSAFAPDLSFDFSAFNSETLYATKQLVRELTEREEKWRRATEDDSL
FT                   PPNTEECGISVLPWGARKLLHDRLPLMWQFAPWRLIYGTRFHGYSYSNMINACQREVNN
FT                   AKRDGKQPKMILLLELDMSAVCLEDVVTEEGNEKKGGFVIGVCMSHPLSLDNRRFYGGS
FT                   TTFVFQIRIPPSPQEPAIRTFHATGRNEKFINCTPQRIAIGGGGGCSLFLSNSISSGST
FT                   AACVTFDSPPLTHWRDPSLPSLSAGPSTSDSVSSFDIRTVEVIVVGE"
FT                   /protein_id="XP_822590.1"
FT   misc_feature    877334..877383
FT                   /note="T-rich"
FT   repeat_region   877651..877671
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    878413..878448
FT                   /note="AT_rich"
FT   misc_feature    878635..878671
FT                   /note="GA-rich"
FT   gene            879336..880697
FT                   /db_xref="GeneID:3662934"
FT                   /locus_tag="Tb10.70.4030"
FT   mRNA            <879336..>880697
FT                   /db_xref="GI:71747071"
FT                   /db_xref="GeneID:3662934"
FT                   /locus_tag="Tb10.70.4030"
FT                   /transcript_id="XM_817498.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        879336..880697
FT                   /locus_tag="Tb10.70.4030"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747072"
FT                   /db_xref="GeneID:3662934"
FT                   /translation="MEASVTTNEITAEPAANQMQLSNEYASSRFSLAVAEKVGNRSQEG
FT                   SESRDVVDHWGQSVLQLSIVGLGGSRGSFGNFSIASELLSLGERNEEEQSVMQQRAPLT
FT                   NPVGEVVHATSGARGFAFSPVQRIPSGVSQRNEASIGYNDDISRSSSCSSGSEVMRQEM
FT                   RRGGVQRTEVKLHLSHSNADVDAEEEDISTIRATPTGGAVDTLNELYGIDRYFTFHYNP
FT                   ERVVTPIDCGDQCSGGGSGVSTVATAAGLESQRESDDNRVAMTHEEDEIVGVTAEGEFI
FT                   YRRDIVEGPDRQRWQSFYQPINRRSSELGVNECVPSLIPSMTINSAPTRVESGPATTTE
FT                   PYPQDQYNNRFHPLQSFERVATQLPHLSREAPHEGFTERESEWTEEERESYRLLMRYRL
FT                   CENEEEFEYEKLLNSVSTLRETLHRKPIEMLQRRLEERQQFARSGLGMPLALRW"
FT                   /protein_id="XP_822591.1"
FT   repeat_region   881770..881790
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttc"
FT                   /rpt_type="tandem"
FT   gene            881806..882129
FT                   /db_xref="GeneID:3662650"
FT                   /locus_tag="Tb10.70.4020"
FT   mRNA            <881806..>882129
FT                   /db_xref="GI:71747073"
FT                   /db_xref="GeneID:3662650"
FT                   /locus_tag="Tb10.70.4020"
FT                   /transcript_id="XM_817499.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        881806..882129
FT                   /locus_tag="Tb10.70.4020"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.4020 by DGPI
FT                   v2.04 with cleavage site probability 0.408 near 77"
FT                   /db_xref="GI:71747074"
FT                   /db_xref="GeneID:3662650"
FT                   /translation="MQHFVGGTVIHVLFFNFLRKCCACTVKVRKRIQCRICRKLIAVVW
FT                   RRRKEKKMMIMMMGDTLTHIFIYLYIYIQAHGGGEKTKERKMVVWIRKVAQHIELSVNV
FT                   FAT"
FT                   /protein_id="XP_822592.1"
FT   misc_feature    881996..882024
FT                   /note="AT_rich"
FT   misc_feature    882195..882223
FT                   /note="AT_rich"
FT   misc_feature    882466..882489
FT                   /note="AT_rich"
FT   misc_feature    882675..882700
FT                   /note="AT_rich"
FT   repeat_region   882995..883044
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   gene            883204..883671
FT                   /db_xref="GeneID:3662651"
FT                   /locus_tag="Tb10.70.4010"
FT   mRNA            <883204..>883671
FT                   /db_xref="GI:71747075"
FT                   /db_xref="GeneID:3662651"
FT                   /locus_tag="Tb10.70.4010"
FT                   /transcript_id="XM_817500.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        883204..883671
FT                   /locus_tag="Tb10.70.4010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747076"
FT                   /db_xref="GeneID:3662651"
FT                   /translation="MNLNCEGRDVGRNLLMEGKGKKKKIAHLFIYIYLYICATNRWGEM
FT                   KISLILFVVFVHLHSFFFLIYGLINSFVSVTCFFFSVVVEEPALFWCIQLDMTILPFYA
FT                   INFFIIVIVLVPFENVARTLLSLQIIARLNTFFFFFFLLSFFLKKNIYIYL"
FT                   /protein_id="XP_822593.1"
FT   misc_feature    883283..883307
FT                   /note="AT_rich"
FT   misc_feature    883608..883643
FT                   /note="T-rich"
FT   misc_feature    883644..883672
FT                   /note="AT_rich"
FT   repeat_region   884103..884133
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   repeat_region   884287..884316
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   misc_feature    884409..884437
FT                   /note="AT_rich"
FT   misc_feature    884621..884662
FT                   /note="AT_rich"
FT   misc_feature    884750..884805
FT                   /note="T-rich"
FT   misc_feature    884917..884957
FT                   /note="AT_rich"
FT   misc_feature    885443..885520
FT                   /note="T-rich"
FT   repeat_region   885703..885733
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttttg"
FT                   /rpt_type="tandem"
FT   misc_feature    885981..886055
FT                   /note="A-rich"
FT   repeat_region   886578..886612
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            887329..889182
FT                   /db_xref="GeneID:3662859"
FT                   /locus_tag="Tb10.70.4000"
FT   mRNA            <887329..>889182
FT                   /db_xref="GI:71747077"
FT                   /db_xref="GeneID:3662859"
FT                   /locus_tag="Tb10.70.4000"
FT                   /transcript_id="XM_817501.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        887329..889182
FT                   /locus_tag="Tb10.70.4000"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747078"
FT                   /db_xref="GeneID:3662859"
FT                   /translation="MVMACGAWYVMRFNLFMQLLAVCLITCGTTTADTTAFCHELEPFL
FT                   VQTLPQASAHLLETAIAKEAAGDNVNVTCALTPGKSVVVLLGSSNVHRFSPLRNPPPVI
FT                   KLDTADGEFTHEVRGTFMFRYFRSWVNGFRAYSWTDPASVERFFFKRHIFLRFRVSDST
FT                   GNPNADIHLSASEVLTMAGLHSIRVTSFAPVAVEIRLRGGKEPKECSDATCSKYVDAFA
FT                   EHSDKSAGLTRLEVLPQRFTCSPGYGANGWGSGVSGGPMDGEVYAFEEIGPYRGSNLWI
FT                   PQWLSAWLGRRPMMTVSEKVVLDGMGRRKFLFHAEIPAVKPVCLRLSAVKNDNLIVELE
FT                   ESTVFDTFWLKIMLLFVLLVFIKPWVEEIPALQIFIAGLGSVTLLFVVTILYVLKRLQG
FT                   MTIGKVGLVAMATLGGTALLAETFLSAVVALYYAFVHYDNEAEMIFYGSAMLLVFGLTC
FT                   GLLSRHYCATYLTELTRWTLRLLQLAVLACAIMQNREATFASFVAALLFHPPRILRLIQ
FT                   WFSSSSSLVNNENEPQETFPSEALREVTYVTPLCMEGRTGRVSTMDSRERLDLYRISGN
FT                   EYTHRALEDLACRVNSNPDRYASKVNDAGGVLNWAKGYQYS"
FT                   /protein_id="XP_822594.1"
FT   repeat_region   889915..889962
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttg"
FT                   /rpt_type="tandem"
FT   gene            890338..891018
FT                   /db_xref="GeneID:3662860"
FT                   /locus_tag="Tb10.70.3990"
FT   mRNA            <890338..>891018
FT                   /db_xref="GI:71747079"
FT                   /db_xref="GeneID:3662860"
FT                   /locus_tag="Tb10.70.3990"
FT                   /transcript_id="XM_817502.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        890338..891018
FT                   /locus_tag="Tb10.70.3990"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747080"
FT                   /db_xref="GeneID:3662860"
FT                   /translation="MLSPIVDMKSVGTDDGFDIYLPGSDAFYFKRQLHYQPYTPCAFPV
FT                   EWLGHQGKMHKTSVHMRISPSNLEEACASGSLGYVIMFWAQGQNIKGCESVVGGGDTLL
FT                   MTAAYKGHIHVVRFLVDAGADINATNSAGFSALHMAASAINYHIVRFLSTTVLIQQRRT
FT                   TKGIVRIVLLCRTQVFLFCSCWQNIVPLISMREMKWATHCSIGQHTTILLPYVSTLLRC
FT                   ARWI"
FT                   /protein_id="XP_822595.1"
FT   gene            891231..892763
FT                   /db_xref="GeneID:3662861"
FT                   /locus_tag="Tb10.70.3980"
FT   mRNA            <891231..>892763
FT                   /db_xref="GI:71747081"
FT                   /db_xref="GeneID:3662861"
FT                   /locus_tag="Tb10.70.3980"
FT                   /transcript_id="XM_817503.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        891231..892763
FT                   /locus_tag="Tb10.70.3980"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747082"
FT                   /db_xref="GeneID:3662861"
FT                   /translation="MAAGDGLLGNQSLVNGGYVTAHNMRCRGTFSMLYHEPFFAAMSVL
FT                   GAVHVLLAHYSLMLLPPLFSYAPFGMFFFRNTLWMAVFGYPVQGGKPELTILQQSGIGR
FT                   SFSDTIRGTWRFRDRDAASLFALTTFMLLQLRAWALMGFEPFLPFLSTSNSVVKLNASL
FT                   NTTDKDLHDGGSRAVNFMQPVMCFLTLFLLVSVVLCKLLSMRSVYKPEFGSLVTSPVWN
FT                   IIKHRAYNWLHPRIIFMERHLVLPLRAFYCYEKDVVMERYDGYSAVMDCPVAASNHAWF
FT                   FIAVFCFMVLQWLIFISGWRQARVMLKCPRSDSLGEYISSSAWNLLVHALPCRDPTTID
FT                   VTGKSYFWVFMFRYIIPTTTNRLGVWLLHYSLIAAIISTYCFYRQLVAAAIGATRMELA
FT                   NRTATSGNGGLVSIFPPSFVPFKDTNSAAATWTPPEGHCEGMLTIVDDLAAGNVAHRKV
FT                   GSHCIYADSRFSILNIIYFLLGISGRRWRGAVAVSSFNSPISSVSLLEGPLA"
FT                   /protein_id="XP_822596.1"
FT   misc_feature    892971..892991
FT                   /note="AT_rich"
FT   gene            893350..895416
FT                   /db_xref="GeneID:3662862"
FT                   /locus_tag="Tb10.70.3970"
FT   mRNA            <893350..>895416
FT                   /db_xref="GI:71747083"
FT                   /db_xref="GeneID:3662862"
FT                   /locus_tag="Tb10.70.3970"
FT                   /transcript_id="XM_817504.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        893350..895416
FT                   /locus_tag="Tb10.70.3970"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747084"
FT                   /db_xref="GeneID:3662862"
FT                   /translation="MIKGSDPLHHGLSEGAGGNSRGDENDTVVNSNVEVMCLDMSRSSL
FT                   LANSTKPPSSSCSDTPSSCSDSNMSGIDFYCRQVPIFSQGVGVDYFVNGMGGYEGHLHQ
FT                   QPQGGELGFDQRNKQGGKSSSSPSNFHHNVNEECSATVATRLAGGLSDDCSGNNTRRRN
FT                   FNHSMCNSPELRSCGDEYAAEARRNVPGSSRGVMAAVSQTQSLGKRKIAEGNVQANLPL
FT                   LRVSDCGTKTVHIIPLGNTNVTSQFKCSCCDHVFELSFVTNHADSSAKEKDQERGRNTE
FT                   VGLTCTYGNGLDSNTGEATAVDRSAEFLFRQQPDRESTSLSLLGMKFDKGFRVSAGSVR
FT                   GNYGSHPVQNETNASQGAVRHSLEDRRRRYQSGRFSQGTPKEIKANDSLFPSLPTFSPT
FT                   SFVRAYVGEGNLPWEATLDNVPAVTVSCCVAALNLIAVQFLRHHVIDTRDHFCLFATGT
FT                   YMIFASYFVAYYFLGHYTESFRRISRDKQFYIIANLIKAGILASLVPFATLHLSRIILF
FT                   DEWDTNTLRNLGCIYTIPDFVSMLIVKRMSWSTWTHHLCVLLFNFFSTMNDYTQENVCR
FT                   CVVVYAAFSTFAYCVNVLLASRFLGVKPGVARILSHVSVVAYLFFCGLNWVWQTYYIHR
FT                   LLYGGNGHWTVYVYIALVGLVMYDDVTLCQWLIHNARNTAFAAAHHKEQRRRQ"
FT                   /protein_id="XP_822597.1"
FT   gene            896238..898121
FT                   /db_xref="GeneID:3662863"
FT                   /locus_tag="Tb10.70.3960"
FT   mRNA            <896238..>898121
FT                   /db_xref="GI:71747085"
FT                   /db_xref="GeneID:3662863"
FT                   /locus_tag="Tb10.70.3960"
FT                   /transcript_id="XM_817505.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        896238..898121
FT                   /locus_tag="Tb10.70.3960"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747086"
FT                   /db_xref="GeneID:3662863"
FT                   /translation="MRMIDSEDVAFFFAVMTWNPELLEIMLEKAPNPLYVERAAATEAA
FT                   RFAAAYPLPEETSKPVVSRCRPSARRQRRARKTKRGCGVRLSIPCAFFCEYEAPDFDEE
FT                   DDFYCEDDEHAMQEKKGEGDPDSSVAEVEHDHEPDPNSYSPVEGWGRNAGNCIGRVVSD
FT                   SVDSGDKPLGYSMRDFLQIFFQSFLIVSLSQVQSQRVQNEFPLSLSPLERKACEIVHRY
FT                   KDPFKEILRKYVISGDCEVERHGAQPLFVDGFCIKAVQHEEGEKWAPPHEQLFIAGKDP
FT                   VYQPLLMEMLGITRVVQCYAEKGANYPATLHACATAVGQAASGNRDRTVHTMQSWHRLL
FT                   TQHPKLSKSSDGGTDIATANEDFDLPCPSEEEWEKLQGDISRCVTPLQWKTYTVFGPYL
FT                   VFSATLPFSNGCVTKLVVPAEDKDTYDLSVHFQEGVFRYIHGTPLFPVDVGPALVPKER
FT                   TRMEDQRSPLLAKSCLLHCSAGMHRSSALVIGYLLWLVALSGGKLPMEGKPTLAFVPGR
FT                   YASYTHRQGSVFAESYLTVVLRSQQRGSFPTEEVSASPMHAGAAVVSVAPTQEPEREIQ
FT                   EEDVRAKAQLSDEKSILHYCADHVRQQRSMAVPIATALQQLHRYARHLHLA"
FT                   /protein_id="XP_822598.1"
FT   gene            898806..901442
FT                   /db_xref="GeneID:3662864"
FT                   /locus_tag="Tb10.70.3950"
FT   mRNA            <898806..>901442
FT                   /db_xref="GI:71747087"
FT                   /db_xref="GeneID:3662864"
FT                   /locus_tag="Tb10.70.3950"
FT                   /transcript_id="XM_817506.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        898806..901442
FT                   /locus_tag="Tb10.70.3950"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: RNA binding [goid 0003723]; go_process:
FT                   RNA processing [goid 0006396]"
FT                   /db_xref="GI:71747088"
FT                   /db_xref="GeneID:3662864"
FT                   /translation="MGRDSRGDRYGRRDDVVDPHGGSRGGGEASSSRYSRYARTKRSRS
FT                   PRGGRRNSSEERKHRRRRSESVSRQRRRREVSGDSGKKGHRRSRSRSRSRSRSKPSSRR
FT                   KEGGELSRFKTVDVNELLQSPTPDPSAVPSNSLQTQILFQLLQQQQQHAGLLSDPLPAA
FT                   VAIPPVETTPMISVGTVAGAVQSAYPLQTDGEVPQETLIDQPAPAKVLPSVADFVPVIP
FT                   KSLVGLLTTPATGSNVESGGADVSAASGGGANGGTCGVLTTATGALAVLQAPKLSPEAE
FT                   RRAREARRAHISCFPRGTTQQELLDYFRTIIPIVRRIRVQREMDRLTEEARAKLGNDAE
FT                   AENIERREIPPNAVIDVDRVIDLAVNSAKSKPFGFLEVSLADLVTELVEESVRDPDRFT
FT                   FVAADGKPYPITIRRPRDYQELPGVDHRKVVMLGFPPTLPLEKLRLVFEQFGQLLAFDV
FT                   KEGMAYGEFEKEEDAVECVRDLQGEVLGNRVVVLMPLYDWLKVVCTHADIDVSLDPDDP
FT                   VAGTSLLAKTNQNDGAIVPLLAEDVEKKEEPVDHMKELLELTVHLPDVILHFSKTFPHL
FT                   RSLYGSTVPIFPTRILVLMNLFDEEELVLDETYERLVEEVSEEVEKHGRVKSLIIPRRT
FT                   PPPLPPKLPKNVLASRTGATKNSEMGQPKHSQNDDSDGSRKDYEFAADPTAPPMPSNIS
FT                   VGREDVQSFRGDNDGIKHDQGDGSNLNTNNDSINDDEDEEAKYEREKAEYLKAREAYTE
FT                   NILHPIHGGLGRVFVEYESVDEAAIAQREIAGRLFGGRTVVTSFMFEDVLYPPTTEEEE
FT                   ARAEEKVQLYLESIGAGDGDEGENVGNGEAQPHGGTEDGTQTGAFEEGQNLPLKTEGDD
FT                   GIAGIDG"
FT                   /protein_id="XP_822599.1"
FT   gene            902396..907804
FT                   /db_xref="GeneID:3662963"
FT                   /locus_tag="Tb10.70.3940"
FT   mRNA            <902396..>907804
FT                   /db_xref="GI:71747089"
FT                   /db_xref="GeneID:3662963"
FT                   /locus_tag="Tb10.70.3940"
FT                   /transcript_id="XM_817507.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        902396..907804
FT                   /locus_tag="Tb10.70.3940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747090"
FT                   /db_xref="GeneID:3662963"
FT                   /translation="MLFTCSSRRLVGRTLTLYLLRRNCSALTASVSRTVPSDESVATSG
FT                   GRIVSAAPAPNLARKETQRKQVRRSKPSTAATAKGESTGEEGTESVEHILSLVSASQVR
FT                   ACIESHEPEVSSSFAASPQTPVTQALQLHRRLASEKQQPHIGIGETTVSSSASIASERV
FT                   ERRRKKWTVAESEFDAGITERLLPEIRRLAALHELHYGDAVMREVDSSTYFASLGGATA
FT                   SVADMRADDDINDADLTDDEFLKFEAEQVEVAGGPVLYNTSSSGIIEKCQKKEEITNAA
FT                   NDEEKVCAHSLQTPWFVPAGGVVRLEPLPPEDVLCLLKFLMHLRQQTLDQLPVPLQAKV
FT                   SATERVLRSVHQEEKSKEIPIVPRAVADGGTTCISFEDVMVYLDKAPSPILGFTENLPP
FT                   GESPAFVFVLYTENVSLQNAIGHMSALFEIPQRAFLTCTAVSKMSCGAVLCAVTPNQVR
FT                   REHLLLLNTMRHPGFVIRVGSIQEVKDAERIASLFGDLARWQPLHEVEVLLRRVSCRSR
FT                   QELEHRLRAIKEVGAVFFCSNREASLVRAATDLLHGFYRSALLSALHRRHAPLELRQFI
FT                   KRPNVITAARARRASTDPTIRQALKNYELTQGNWEQTVARIPYVWRRRWLNALRSSVWN
FT                   VMASRRLSLDGASRRVIPGDIVFRPEYRADVHHRMIPTVKAEHVMVVRDEEEAALCSVE
FT                   DICIPFLRGTYPPELFAPEETKHPIMTNTSMLAILRELHAPQLLLGMNDACRQLMDIRC
FT                   DCAPLLFRRLIIRPIAVSFTVLEDKPPVKSVHFDAARLLLNDRLMHQNALRRNPLQKSD
FT                   PSKRCGVGADGEASLPSCSSLANQDVVLDQTTIGARLMSGVLAEEFFTTPDRSDYVTLG
FT                   HVTRKLHGNFVAAAPQTPEDALGTVDRLYSVHIHAVLRYGVGAMSQLLREYFILGGVEA
FT                   ESDSALQHKVHRMRRELDNETQYLTAPTFCTACYSRCHDALNSCAEYQHKHGKHLGRKR
FT                   REETLQQLQFMGKTLPSVADTSPLSSREAATVPGGGEISAVSGVNGSAVETQQTTKGVT
FT                   NASHTQLELELLLRRRNGEQKWGVHLTSSLCLANIDDVSVVAGGRLRCVCGDVTSAISP
FT                   KQLCRVLLQGSVEDISSTSNEINKHHMLALRRFVAVSTGEKVDTIYESSNKTWDNGCEA
FT                   ASILDENSDGVKLTKVAEVFSVSSPRHPQTLTTESRGEIDTVVGDSRTLLHNCRWALKG
FT                   INDAEVADRKQVAAVFVTIGKQREVRLRFRTTIDLPLSHINEHGNDSNNAGGTERCELP
FT                   AVAELTLSIAEGNGSCGKSGWGVMIDKSSLALLNLSELLQQRQVGVSGRLNPPIPSYIN
FT                   PSAADGMYVLHALDGIPVASQQEVSLHMGKRRQALKGVSNGKCSSLRLQLRRLQGHPQK
FT                   GVATVETAKLPGATMKTIVAAGVEADGKRDKVTTVVNSTTTVEDVSDAAESESGLTPLL
FT                   PCSPQCVPLTSVQLRRSVFTIAINRSAGAPRGRWGIRVQRGTRRLQYIQHNQYFTFQVY
FT                   TAKQNQAVRIADNLRLHTHQLKSSGTSEPDDGTVASETEEKERTTAASFSYFIYMIAGV
FT                   NYRHVGTNEELRASLTEAGRSHEESVILHVQQYRLAYIALSVKRKEVAGGGALEPVGLC
FT                   ISKDMVIKSVVAGSAVARAIIAATHEDCSLRGLIVEDPSSSGGNFSSPNQTWRFDLDED
FT                   EEGQHIQTNSPVGDAGARNVPGNSNSDAVLGRRVAHWNMVDGVALCATHDKVESSAGGE
FT                   SRNRFVWRILYAARAGPLRTPQDVARTFASNIQEDTIFVQQCVMDD"
FT                   /protein_id="XP_822600.1"
FT   gene            909084..910283
FT                   /db_xref="GeneID:3662964"
FT                   /locus_tag="Tb10.70.3930"
FT   mRNA            <909084..>910283
FT                   /db_xref="GI:71747091"
FT                   /db_xref="GeneID:3662964"
FT                   /locus_tag="Tb10.70.3930"
FT                   /transcript_id="XM_817508.1"
FT                   /product="protease regulatory ATPase subunit 4"
FT   CDS_pept        909084..910283
FT                   /locus_tag="Tb10.70.3930"
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protease regulatory ATPase subunit 4"
FT                   /EC_number="3.6.4.8"
FT                   /note="Curated by J. Mottram; identical to GB:AAF91246.1:
FT                   proteasome regulatory ATPase subunit 4 {Trypanosoma
FT                   brucei}; go_component: proteasome regulatory particle
FT                   (sensu Eukaryota) [goid 0005838]; go_function: ATPase
FT                   activity [goid 0016887]; go_process: ubiquitin-dependent
FT                   protein catabolism [goid 0006511]"
FT                   /db_xref="GI:71747092"
FT                   /db_xref="GeneID:3662964"
FT                   /translation="MQERQEEYASLSEREQLRQDVIAKTIRRNESRARVREVAKAMEAS
FT                   ERELMRVVDQLSALMSIGHFVGEILHKVDEERFIVQSVSGARHLVGYKKSIKPEKLKIG
FT                   TRVALEITTLTIVKVLPREVDPQVYNMQVMENEKNISFQEIGGLQEQMRQMREVVELPL
FT                   TNPELFVRVGISPPKGVLLYGPPGTGKTLLAKAIASNVDAAFLKIVASSIVDKYIGESA
FT                   RVLREMFAFARDHEPCIIFIDEVDAIGGKRIEGSSSDREVQRTLMELLHQMDGFEKLGK
FT                   VKVIMATNRPDTLDPALMRPGRLDRKIEIGLPNEAGRLDVLKIHASKITKQGDIDYDSI
FT                   VKLSEGFNGADLRNVCTEAGMFALRAGRDYVINEDFNKATRKVADSKKLESAPHQYSEQ
FT                   "
FT                   /protein_id="XP_822601.1"
FT   gene            911945..913093
FT                   /db_xref="GeneID:3662965"
FT                   /locus_tag="Tb10.70.3910"
FT   mRNA            <911945..>913093
FT                   /db_xref="GI:71747093"
FT                   /db_xref="GeneID:3662965"
FT                   /locus_tag="Tb10.70.3910"
FT                   /transcript_id="XM_817509.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        911945..913093
FT                   /locus_tag="Tb10.70.3910"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747094"
FT                   /db_xref="GeneID:3662965"
FT                   /translation="MDPLDDWDVVGADDFTPRVSSGDKNEDPSTKKDADDSLLNHEENA
FT                   VSSKDSVNVYNTPSFVKSKCRIPSEPQVVRNDSTPSNNYNIVASPGNEGEPSVQRPPAH
FT                   REITGASVLQARGILHESFDNSNAQEVVHRCQYVKHAVEPQQNSVSAVSNSRLYNLIGK
FT                   LLCAGQLLGLATPISDGEEQNCWALSVKLWSHTSCIIKQMGSAGQLMCFMAFLYFVSAA
FT                   PVGRNKTEHCSPSINCCSLFKDGVRYFCYLLFLVGPLLRIAEFAVQKRSFGKALHGCEV
FT                   GGRAHKIVCKAVTWFGKCILTTALIVPQEPKGGAAVSYVTAKETVGSCKTKVSDTTECF
FT                   ARVNSASEKSVLGVNRLLFVVVCISLVSIMRDAEERCTPSSR"
FT                   /protein_id="XP_822602.1"
FT   gene            914434..915114
FT                   /db_xref="GeneID:3662966"
FT                   /locus_tag="Tb10.70.3880"
FT   mRNA            <914434..>915114
FT                   /db_xref="GI:71747095"
FT                   /db_xref="GeneID:3662966"
FT                   /locus_tag="Tb10.70.3880"
FT                   /transcript_id="XM_817510.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        914434..915114
FT                   /locus_tag="Tb10.70.3880"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747096"
FT                   /db_xref="GeneID:3662966"
FT                   /translation="MKLLKFVNCDAPNVSPEALHFSMSRQRVSLHSGDTSDRRSGSRSS
FT                   ATEGNASIGKTWRIAEGGTPITGGYWLLGDNNEPIGPVQEVILAVPEVKEADVTPRGIN
FT                   ESVVKNVEFFSKFGRSMQRTRETFGDTYLSAPKSVIPLSDAERTFAKRAERARMPLKRR
FT                   AEAVDAEGGPGGEVVAAAATATAAAANPTACVEPSPRPVKKEKKSKKITTPTLTPVRSI
FT                   KKET"
FT                   /protein_id="XP_822603.1"
FT   repeat_region   915302..915335
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   repeat_region   915477..915526
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   915723..915753
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="gaaaa"
FT                   /rpt_type="tandem"
FT   gene            917103..920273
FT                   /db_xref="GeneID:3662967"
FT                   /locus_tag="Tb10.70.3870"
FT   mRNA            <917103..>920273
FT                   /db_xref="GI:71747097"
FT                   /db_xref="GeneID:3662967"
FT                   /locus_tag="Tb10.70.3870"
FT                   /transcript_id="XM_817511.1"
FT                   /product="DNA repair helicase"
FT   CDS_pept        917103..920273
FT                   /locus_tag="Tb10.70.3870"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair helicase"
FT                   /note="go_function: DNA helicase activity [goid 0003678];
FT                   go_process: DNA repair [goid 0006281]"
FT                   /db_xref="GI:71747098"
FT                   /db_xref="GeneID:3662967"
FT                   /translation="MYAAGRFTVPFPFEPYPLQLHAMEAIREGLSAGDVVVLESPTGTG
FT                   KTQILLNGVLSHMFEPVVTSVEHGIAESHEVTGESRPTGEVCADSGDGCPSFEEHRKHQ
FT                   RKRRKREREKRRKETFNFGGTSSSRDPFLVDQDVREEAQELSRCGALADCLSSSSSSRS
FT                   SSVSHLGGEGDKSDEDVEVQPLRKPKVYFSSRTHTQLQQVTDELRRTVFCQNLVRRRSC
FT                   NSVEKDGLASKVFEDAHKSPFVEPRKLRYVHVAGRQQLCLNASLKAAAGGSNERLNELC
FT                   LEAMAYEYSKEGKTARKQKLQRGCADSSLPDIEDSLGSSTVSRRGCGYCQKEKLKILRD
FT                   YVNIEPRDLSQMRELGQRVGACPFLVTREVLRGADVVFIPYSYLVSSEMRNALLAGNAT
FT                   NEHPTDLTPQTQVVSQGLSSTCRAGSTSTHSSYPTVPSKQRWEIQNGRRVPILPPDFSG
FT                   DVIVVDEAHNLVDYCRNVTTAEVTLPELQVIRRLLDGYRLRYEKRLLTRNKQRLREMVA
FT                   FVDKLAQHLQEAGKKSTPTATASTFINFTFDAEVDTVNVHLFLSFLDESRLLPKLHGLL
FT                   AQMVAQVEAQISQPSGKTTKWRPTSSYSDENICSDTTNEYADPIEALLHSPAEDRRSIA
FT                   ATLYRFETFLRWYGLSDEYTRVILRRLPSENGSREMCRVTLELLQLELGTHTMFPVLQQ
FT                   AHAAVLAGGTMKPLALTCDLLLKQSAPTKELSVLKNISSLPCGTREEEAGEQAKKIRFT
FT                   EEGHVVPPSSIAVFTLATGPGGQRLEFQHARRQSWPKIFEGVGTALLNFCRVIPAGMIV
FT                   FFTSYEIEELFVNTIRSSGMYDTINAVKRIFREPGSARNASSTPGYSSGCQAAASTTVD
FT                   SMLEEYASWIRSERSSGALLFAVIGGKLSEGINFNDDLGRAVVVVGLPYANISEVDLQL
FT                   HLRHVADTRVRTLLPSSANIATGSITTDSTDQVTVVPDGEFPASPSSAMEWGLLTDLCM
FT                   RSVNQSIGRCIRHASDYAAVILLDARYVERRDIRRRIPSWMQPSIHVAQNFGDCFRRVR
FT                   DFFIERRK"
FT                   /protein_id="XP_822604.1"
FT   gene            920933..922237
FT                   /db_xref="GeneID:3662968"
FT                   /locus_tag="Tb10.70.3860"
FT   mRNA            <920933..>922237
FT                   /db_xref="GI:71747099"
FT                   /db_xref="GeneID:3662968"
FT                   /locus_tag="Tb10.70.3860"
FT                   /transcript_id="XM_817512.1"
FT                   /product="arginine N-methyltransferase"
FT   CDS_pept        920933..922237
FT                   /locus_tag="Tb10.70.3860"
FT                   /gene_family="HOG000259471" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arginine N-methyltransferase"
FT                   /note="go_component: histone methyltransferase complex
FT                   [goid 0035097]; go_function: histone-arginine
FT                   N-methyltransferase activity [goid 0008469]; go_process:
FT                   histone methylation [goid 0016571]"
FT                   /db_xref="GI:71747100"
FT                   /db_xref="GeneID:3662968"
FT                   /translation="MQQFFFLTLILLKKGGEDDYEVYVRSIRTDEIFGTRAGLKGVKIE
FT                   MSPKKNSASRPSNNGGGGKTGGGNGNVSHRTDNEQSGNNLSERIIANESLLATESERHA
FT                   TSKSLYGDCTARISGNLSCIHDRVRLRAYESVLRSIKGKSVLHLGCGMGLVSMIAARSL
FT                   ASAVVAVDRSAIVDAAQVVAKKNGLNNISFFRGALVDVVQNFPVRQFDVIICEWMGPFL
FT                   INDPLLEEALYARNNLLASNGVMCPDSSSIHVVGVSDYCFHMDTVEFWGNVYGFKMEPM
FT                   KALVQREVEMCRVPTSSIVTTTCLAHTVNIASINNLDDKSSLNDFVVPFSVRATKDTTV
FT                   NFLTFYIDARFTNPHDPGANFVLGVRPGGTNPWTETSVALHEPLPLKGGEVLSGELKVC
FT                   LLNPTRGITTVEVTARTSGNVVNIETKGTYNYQRY"
FT                   /protein_id="XP_822605.1"
FT   repeat_region   922457..922490
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   gene            923635..926358
FT                   /db_xref="GeneID:3662969"
FT                   /locus_tag="Tb10.70.3850"
FT   mRNA            <923635..>926358
FT                   /db_xref="GI:71747101"
FT                   /db_xref="GeneID:3662969"
FT                   /locus_tag="Tb10.70.3850"
FT                   /transcript_id="XM_817513.1"
FT                   /product="RNA editing 3' exouridylylase MP99"
FT   CDS_pept        923635..926358
FT                   /locus_tag="Tb10.70.3850"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA editing 3' exouridylylase MP99"
FT                   /note="GB:AAO63566.1: RNA editing complex protein MP99
FT                   {Trypanosoma brucei;} PMID:12649499; go_component: mRNA
FT                   editing complex [goid 0045293]; go_process: RNA editing
FT                   [goid 0016547]"
FT                   /db_xref="GI:71747102"
FT                   /db_xref="GeneID:3662969"
FT                   /translation="MLRRSRLHLLADYRTSSKISDEFNNVLNRSGWGFDHVAVDVGSLS
FT                   GAAGRLTRDLIGQERDAETVKIIHKQITNVILRRIQPKKSLAIFIDGSEPLWKVRHMRL
FT                   YPGKKFEGKFYRSAASPMVYSLEDKLRCVGPDLRTPPKEFIVSGPAAPGPVEAKLSAWM
FT                   LDLATRALPDGAVTTPTVTGAAAAASASAGPPEVTFNDTFCLIGGNDAFLSALGATPFH
FT                   NITTVTLQQGEMKSLSLSEALEWFAMDHLLKGETSIGSGGNELQKRLASVRTDIVLLYL
FT                   MANGISATDLPGLGVNFKDLMEAYTAEEANKLYLFGKTSEERCLRMCPLNLERVLTHAT
FT                   RRTSTPTRFCQQSADYLEILLQTHSMICDGGIKNFRWTPNDNDAVPEKQPKIPIERFIG
FT                   HLKHLAAQGGETTAVADVGSTEPGLAASVDWTFALTGIETLLLSAPKAEMIDQIIPVFT
FT                   KGHTLPDGVAQDIVDTKNVVEALHKVRRVLQVVVTSDNSGNDDGRIEHPAFNHYPTHYF
FT                   VRTPGSRGPPPGWTYKSVNLGVRAVALGVRHRVASGMLTAASRVLDSGGVSSKNSLFVF
FT                   HVKDGITTPSGGGNEDGWLETPCHELAGSSANPASKEISTLRVVTWNVQFSRHSGERTP
FT                   LGRDGIDWCTSTRYVALAQTLEGLDADVIGMQEVEPAWCKYLSQQPWVREKYAMTCCEH
FT                   SHAIQPWGVMLLVRRSLCVTSTHHANVPAFSGHTSVMPEVTVVVSEGVPVTVGSMHLLA
FT                   PYNQNNISNRTTQLDNLTKRLRTRPPINGKQAGLIVMGDFNDCAKNYFTFPPEMGFKDA
FT                   WLLLHPDEGVSSKSGHTIDGDRNPYAAQIIEKEFYGRADRVLFSSRNLQPIQTEIIGTT
FT                   SVREMGITKQVDIDKDVPEYLYPSDHFGLLVEFQVV"
FT                   /protein_id="XP_822606.1"
FT   gene            926540..927724
FT                   /db_xref="GeneID:3663025"
FT                   /locus_tag="Tb10.70.3840"
FT   mRNA            <926540..>927724
FT                   /db_xref="GI:71747103"
FT                   /db_xref="GeneID:3663025"
FT                   /locus_tag="Tb10.70.3840"
FT                   /transcript_id="XM_817514.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        926540..927724
FT                   /locus_tag="Tb10.70.3840"
FT                   /gene_family="HOG000259469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747104"
FT                   /db_xref="GeneID:3663025"
FT                   /translation="MRLGDYDSTHQILRSYHFTLELRLYFPLLPLCLFRSRYFVVAQSG
FT                   NCTRSRNKEKPLVPPCSLFFLSICAMSFRYTNNLIGALKHRLLLESSYREIASRKFIGN
FT                   CRGVEVVCSGYGTVLAVQLTDKAVWEPFYRKGGRPTVSGGGDVSGDAETGTQGSATTTG
FT                   ATGSLDLDKLAESIKTALWDATRKIRSAKEAALHRSLSHNTRMRASADLKHWYEEDANT
FT                   LRPLAFEALKHEAATPWMQLVQHGKKEEAAALLKEFEQKGDAAEATPTRVKDDRVKGTR
FT                   TELSNREQPPLASTLKAEDSNPATIPIGSVHPLFTPALVQIEEAGSGSVSNEAVCRAQL
FT                   WELSRDEQLFWERVELIRKGQVASIGSSHKRGYADEAAFAKDDTEEKVQLRFTQ"
FT                   /protein_id="XP_822607.1"
FT   gene            928001..929680
FT                   /db_xref="GeneID:3663026"
FT                   /locus_tag="Tb10.70.3820"
FT   mRNA            <928001..>929680
FT                   /db_xref="GI:71747105"
FT                   /db_xref="GeneID:3663026"
FT                   /locus_tag="Tb10.70.3820"
FT                   /transcript_id="XM_817515.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        928001..929680
FT                   /locus_tag="Tb10.70.3820"
FT                   /gene_family="HOG000259468" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747106"
FT                   /db_xref="GeneID:3663026"
FT                   /translation="MFRRTSRCLVEVGDTCVPNNFVHATDLAFYFSRFQPRSHLHPHGI
FT                   PELRDAVELLQPPEGKPCSRWSAPRLFSPAALAAPAAVAEWKKKREKAMMLLSRGEEIM
FT                   ENVSGVRSAAVADVVRPLYATKFELLNGLEHLPRSEFATRIDVHRFIVKHAGRLLYFND
FT                   SWDKSDVKHLDTTCVILAHFIRSFCALHQRPFHVKQANVSDSKADRNPSSWTMAVVGGE
FT                   SGDAMISLQTVMDRLDELLALSEKITERQMGEMPELRWNKPKLLLLKGTLTIPLTGNLT
FT                   HAQELVNQAAKTVYEFHQRKKPIVDGLVARKQEHELGLFMLVQAEMAARVFDWTINTGE
FT                   VDMEVVEMFEAAAKFYSFPCNTPLDADGIMSAELLDERRFEVDAYTSCMLSFGNFLLGA
FT                   PRPAAKTRRDAPVFLPKQLFTISPITTVASSSDLIYADVQRRAPMTVEVARKRAGEALE
FT                   RGLKLNRELYPDQKQNPKAGWTLLAMASLYADMRDYLYATGLFASAEKTVIENYGGVSL
FT                   ERLLVSKLRYEFLAGVGSEEEAKASAHEIVQLLKQMDNMPHG"
FT                   /protein_id="XP_822608.1"
FT   gene            930555..932174
FT                   /db_xref="GeneID:3663027"
FT                   /locus_tag="Tb10.70.3810"
FT   mRNA            <930555..>932174
FT                   /db_xref="GI:71747107"
FT                   /db_xref="GeneID:3663027"
FT                   /locus_tag="Tb10.70.3810"
FT                   /transcript_id="XM_817516.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        930555..932174
FT                   /locus_tag="Tb10.70.3810"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747108"
FT                   /db_xref="GeneID:3663027"
FT                   /translation="MSTNGGVECSNAYITEGVKLSPISSEKAENTQNNDGVTLLQPSWF
FT                   PREELKEAVNGSTQANPLKGPSPTDQPPPPQVLSPAQPQSRNAPASLSESVRRLHERFR
FT                   NTSWLEMICIFVIITVVIVGHFIEIISIKYWHSKFPNGKTPGTLATLVLPSILLAAFMV
FT                   TVMLLFIFFTTPSLRFAFCCQSLVMLFRIGCIDAIQSGVGVYSVIKTPNALAALVKPAA
FT                   PLFATLFTKMFLKDKRSYGSPWLLISLAFVIAGILVASIFDLKHGFNKIGKNSWWASIY
FT                   LVAVALSSLVNAMQAVYMLKFTYDPKFDELYKIRARGGTAVPSMGSQSTLLSAQNVLAL
FT                   GVGNGNHQLAVEMGNIPAAQEPEDVARTALKRLRQGRGTSVKIVMLTIMLLFRFAGTLA
FT                   FLPLDGVKPWGESNSIGDAWNNLIAGGRCVATCDNNLPPFVMYTSGVLLSYVGSAYLNQ
FT                   YSVTMCSIIKQIAWPLAALILVFVPRWSIDPVVTPWYFSLVSIFILLLAVLLYMFWECS
FT                   TGDEKDKNERQLKERMMYHLAK"
FT                   /protein_id="XP_822609.1"
FT   repeat_region   932495..932537
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    932795..932820
FT                   /note="AT_rich"
FT   misc_feature    934090..934144
FT                   /note="A-rich"
FT   gene            934179..935675
FT                   /db_xref="GeneID:3663028"
FT                   /locus_tag="Tb10.70.3790"
FT   mRNA            <934179..>935675
FT                   /db_xref="GI:71747109"
FT                   /db_xref="GeneID:3663028"
FT                   /locus_tag="Tb10.70.3790"
FT                   /transcript_id="XM_817517.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        934179..935675
FT                   /locus_tag="Tb10.70.3790"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747110"
FT                   /db_xref="GeneID:3663028"
FT                   /translation="MAVGAGVRQRAAAAARHWRRVSVKTLRSRLSTPHVCDIKLPLISN
FT                   EAPVGSGPALNIRLGTNNEEIMRWCQLEYFGFLKPADAATDSHTSNTSDVCIHSGPPGQ
FT                   LGYPYALTAEVDNFTDAVRRDEESAEWQNISGAESAHPSRWLTQLLLDGFISRRVAAHV
FT                   GLSADHLMDTVRMARQLKVPLAPSEVSPHYFSNDLLSTWGVFGELKSGDTDFVGDYVHR
FT                   VLQLAHASSVISACHSVWLKGTAICNGNGGAVIILGPRASGKTTLALHCLATSTPKIRL
FT                   IGLEHFHIAPESVIQGASISSGGARALLMSIPSPASVGIGALIGSLKPNPSLVEAAHTF
FT                   TCSAATINSLMRNSEETIWFMGRRHVVNINEAFGPHRWCPTWFGTVKGIVLLNWDVHEL
FT                   SRPTSSAGTQIIHWTEKEDCFKALNAFATNAGAALFKGHYLIRSMYNELNAHRQLEEML
FT                   FSGGEVDGKVGVPPIFEVRGAVHFDAVVKLICDRLLNETN"
FT                   /protein_id="XP_822610.1"
FT   repeat_region   936171..936204
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            936295..937221
FT                   /db_xref="GeneID:3663029"
FT                   /locus_tag="Tb10.70.3780"
FT   mRNA            <936295..>937221
FT                   /db_xref="GI:71747111"
FT                   /db_xref="GeneID:3663029"
FT                   /locus_tag="Tb10.70.3780"
FT                   /transcript_id="XM_817518.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        936295..937221
FT                   /locus_tag="Tb10.70.3780"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.3780 by DGPI
FT                   v2.04 with cleavage site probability 0.684 near 286"
FT                   /db_xref="GI:71747112"
FT                   /db_xref="GeneID:3663029"
FT                   /translation="MMFHTFTALFITATCVSCSRASAAAAAVTDAEPAATSGSTSRCTL
FT                   LQQLLGVGRSVNFTKRYVKELVDQSVRAEQECTYYLWTARGNITFSSKVLYDGRRSRGS
FT                   SNVYVKLAERAFEEAKLDHEILRETVYSVERNLLVIRSQSAEMNRNGYEAVKESKKAVA
FT                   KLVRSANRYMGRYHGGDDDISETCKLAPASGVTFASLEHAMRNITDEMVDSDALEGARK
FT                   VFRSLVEVEEARKKAMRVAQEIKEGKQLAQGAEARVAGHANAVFSVMRTSKQSMTINHS
FT                   RGGTNASQFLWNWIKFLLLSLISAAAP"
FT                   /protein_id="XP_822611.1"
FT   repeat_region   938000..938062
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   939083..939110
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(939844..940494)
FT                   /db_xref="GeneID:3663030"
FT                   /locus_tag="Tb10.70.3760"
FT   mRNA            complement(<939844..>940494)
FT                   /db_xref="GI:71747113"
FT                   /db_xref="GeneID:3663030"
FT                   /locus_tag="Tb10.70.3760"
FT                   /transcript_id="XM_817519.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(939844..940494)
FT                   /locus_tag="Tb10.70.3760"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747114"
FT                   /db_xref="GeneID:3663030"
FT                   /translation="MVSIPFPLQRAGIVSCAEAEGNGDNHCRANPVVIEPHNEDGPNVT
FT                   SGAEALVAHSVVHNPLVRTVVERIFEDVEENQRPALRHCFRLIPCELTCCPILPEMRLG
FT                   LEKLRIEHFPASSASDQQLHKVGFSFSVKNNTNVDSKKAYLQAALQTTFPANRFVVIPS
FT                   GRVKSCGGGVEAMFCVVVVHSTCVMGVQRRFSDRGEFNIHALGVKHLELSTSV"
FT                   /protein_id="XP_822612.1"
FT   misc_feature    941033..941061
FT                   /note="AT_rich"
FT   repeat_region   942390..942428
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    942466..942638
FT                   /note="CT-rich"
FT   gene            complement(942829..943683)
FT                   /db_xref="GeneID:3661723"
FT                   /locus_tag="Tb10.70.3750"
FT   mRNA            complement(<942829..>943683)
FT                   /db_xref="GI:71747115"
FT                   /db_xref="GeneID:3661723"
FT                   /locus_tag="Tb10.70.3750"
FT                   /transcript_id="XM_817520.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(942829..943683)
FT                   /locus_tag="Tb10.70.3750"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747116"
FT                   /db_xref="GeneID:3661723"
FT                   /translation="MEGFRYFTQRVPQSLWNPVAMKHAFIIALVVAPLWAFLLKPLLEK
FT                   YHQQSEPLHLFLWALLRGVVMQFPILTSVKLRAQAEPKPSRGRERPSGHTPELGSAKRY
FT                   ATGGKPITAKALDDLFRSPDFEVWYGQHRQSLLEKVRIRCSQQLWASIATLAVLVFGAF
FT                   ALPLFSFSNEEKTLYAVLRPFLTVPTFKVSIFTSGKDKKEIMYSVIAQLTALGHAVVVL
FT                   VAAFALFTTSFMPVGLKQTAAAALVAFLALVAEATRVEQMAVGAGFVLLFAPVAWRIAS
FT                   VFV"
FT                   /protein_id="XP_822613.1"
FT   repeat_region   945026..945058
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(945455..949153)
FT                   /db_xref="GeneID:3661724"
FT                   /locus_tag="Tb10.70.3720"
FT   mRNA            complement(<945455..>949153)
FT                   /db_xref="GI:71747117"
FT                   /db_xref="GeneID:3661724"
FT                   /locus_tag="Tb10.70.3720"
FT                   /transcript_id="XM_817521.1"
FT                   /product="NADH-dependent fumarate reductase"
FT   CDS_pept        complement(945455..949153)
FT                   /locus_tag="Tb10.70.3720"
FT                   /gene_family="HOG000260611" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADH-dependent fumarate reductase"
FT                   /db_xref="GI:71747118"
FT                   /db_xref="GeneID:3661724"
FT                   /translation="MLSTKQLLLRATSALVAGSSGVARDSPSLVGDPCDSVSPMRVVWG
FT                   RFFKSLAPPAPSVVSCQKRFTSHGADGISSASIVVTDPEAAAKKRDRMARELLSSNSGL
FT                   CQEDEPTIINLKGLEHTIPYRLAVVLCNSRSTGEFEAKAAEILRKAFHMVDYSLNCFNP
FT                   ESELSRVNSLPVGEKHQMSEDLRHVMECTISVHHSSGMGFDPAAGPIISRLRGAMRDHN
FT                   DMSDISVTEAEVELFSLAQSFDVDLEEGTIARKHSEARLDLGGVNKGYTVDYVVDHLRA
FT                   AGMPNVLFEWGGDIRASGRNIKGNLWAVAIKRPPSVEEVIRRAKGKMLKMGEEEQEEKD
FT                   DDSPSLLHVVELDDEALCTSGDYENVLYHPKHGVAGSIFDWQRRGLLSPEEGALAQVSV
FT                   KCYSAMYADALATVCLVKRDAVRIRYLLEGWRYVRSRVTNYFAYTRQGERLAHMHEIAQ
FT                   ETRELREIRIAGSLPSRIVIVGGGLAGLSAAIEAASCGAQVILMEKEGRIGGNSAKATS
FT                   GINGWGTRTQAKSDILDGGKYFERDTFLSGVGGTTDPALVKVLSVKSGDAIGWLTSLGV
FT                   PLSVLSQLGGHSFKRTHRAPDKTDGTPLPIGHTIMRTLEDHIRNNLSERVTIMTHVSVT
FT                   ELLHETDTTPDGASEVRVTGVRYRDLSDVDGQPSKLLADAVVLATGGFSNDREENSLLC
FT                   KYAPHLASFPTTNGPWATGDGVKLATSVGAKLVDMDKVQLHPTGLIDPKDPANTTKILG
FT                   PEALRGSGGILLNKQGKRFVNELDLRSVVSKAINTQGNEYPGSGGCYFAYCVLNEDATN
FT                   LFGGGALGFYGKKLGLFQRAETVEELAKLIGCDEGELRDTLEKYETCSKAKVACPVTGK
FT                   VVFPCVVGTRGPYNVAFVTPSIHYTMGGCLISPAAEVLQEYKGLNILENHRPIRCLFGA
FT                   GEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKREIALSKTSWTSVVVRESRSG
FT                   EQFGTGSRVLRFNLPGALQRTGLNLGEFVAIRGEWDGQQLVGYFSPITLPEDLGTISLL
FT                   VRADKGTLKEWICALRPGDSVEIKACGGLRIDQDPVKKCLLFRNRPITRFALVAAGTGV
FT                   APMLQVIRAALKKPYVDTLESIRLIYAAEEYDTLTYRSILQRFAEEFPDKFVCNFVLNN
FT                   PPEGWTGGVGFVNKKSLQKVLQPPSSEPLIVVCGPPVMQRDVKNELLSMGYDKELVHTV
FT                   DGESGTL"
FT                   /protein_id="XP_822614.1"
FT   repeat_region   950962..950984
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    951396..951430
FT                   /note="AT_rich"
FT   gene            complement(951952..953163)
FT                   /db_xref="GeneID:3661725"
FT                   /locus_tag="Tb10.70.3710"
FT   mRNA            complement(<951952..>953163)
FT                   /db_xref="GI:71747119"
FT                   /db_xref="GeneID:3661725"
FT                   /locus_tag="Tb10.70.3710"
FT                   /transcript_id="XM_817522.1"
FT                   /product="aspartate aminotransferase"
FT   CDS_pept        complement(951952..953163)
FT                   /locus_tag="Tb10.70.3710"
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="identical to GB:AAK73815.1: aspartate
FT                   aminotransferase {Trypanosoma brucei;} PMID:11443076;
FT                   go_component: cytoplasm [goid 0005737]; go_function:
FT                   aspartate transaminase activity [goid 0004069]; go_process:
FT                   biosynthesis [goid 0009058]; go_process: methionine salvage
FT                   [goid 0019509]"
FT                   /db_xref="GI:71747120"
FT                   /db_xref="GeneID:3661725"
FT                   /translation="MSRPFKDLAPVPLDPVFGLARAAKAAPEPKADLVIGAYRDQNGLP
FT                   YPLKVVRKAERRIVDMGLDKEYPPMTGLLNFVEEAVKLAYGNTVPLERIAASQGLSGTG
FT                   SLSLGATLLRQVVPEDTPVYVSNPTWSNHVSIFGIVGHKNIREYRYYSPSTHELDFVGL
FT                   IEDLNVAPQGSIIVLHACAHNPTGVDPSKDQWATIADVFVERKLIPFFDSAYQGFASGS
FT                   LDEDAYAIRHFAKRGMEMLLAQSFSKNMGLYAERVGVISAVVSDASRKEAVRSRLEVIA
FT                   RSYYSTPPVHGARIAHLVMSDKELRAEWEQELKEMVNRVRSMRQGVYEGLMKLGTPGTW
FT                   EHIINQKGMFSYMGLSRPQCERLCEKRVFVLPVGRANLAALTPSTMDFLVKSIDDVVRH
FT                   VRNK"
FT                   /protein_id="XP_822615.1"
FT   misc_feature    953686..953708
FT                   /note="AT_rich"
FT   repeat_region   953925..953958
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tg"
FT                   /rpt_type="tandem"
FT   gene            complement(954058..955524)
FT                   /db_xref="GeneID:3661726"
FT                   /locus_tag="Tb10.70.3700"
FT   mRNA            complement(<954058..>955524)
FT                   /db_xref="GI:71747121"
FT                   /db_xref="GeneID:3661726"
FT                   /locus_tag="Tb10.70.3700"
FT                   /transcript_id="XM_817523.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(954058..955524)
FT                   /locus_tag="Tb10.70.3700"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747122"
FT                   /db_xref="GeneID:3661726"
FT                   /translation="MNEDDILFAQPQVSSSRSGEGYLMDVTTTAITSEPSKSEASKWQG
FT                   SPLDSVSAESKAADVKGETSDPVQLWGDTQQSKNENGDWDDGDDFGDFVESAPCVSEAS
FT                   ARPSAAVGAHSEKVDEWGEAVEAATASNVAVQGIEKEEPKNEATSKNVGITGSAVAWGR
FT                   CDTTSGGISHKDPLSITFNGTSSGNTFGAQTFTSNNTYGSANNNSPGVDDDEWMDFQEN
FT                   GPTTVQPSKPLSATSTSASFPMDCGLAGSLSLLSGGGNFEFEQDFDTALLAKQLFSFTG
FT                   CTVDTSAGANRKMDYHTNTWALEGTSNQRESYSAGDIVTAMMEAFFFRRRKIDKNVAGT
FT                   FQGVGTLFVSHISEMAARKLRNSTQSLQNMNLGATMGGKMEERWDVIGDVDPVTAVRIA
FT                   ELHTIRFFSNTDSFLLQPMEAQTWQVAKGPIPICDVIAKVKALNAERQKQQQYQSVTDV
FT                   TADLWTVHPLLPTPHIGGSVSPAPSLQLPF"
FT                   /protein_id="XP_822616.1"
FT   misc_feature    955523..955562
FT                   /note="AT_rich"
FT   repeat_region   956601..956657
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="taa"
FT                   /rpt_type="tandem"
FT   repeat_region   956731..956783
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(957604..958470)
FT                   /db_xref="GeneID:3662473"
FT                   /locus_tag="Tb10.70.3690"
FT   mRNA            complement(<957604..>958470)
FT                   /db_xref="GI:71747123"
FT                   /db_xref="GeneID:3662473"
FT                   /locus_tag="Tb10.70.3690"
FT                   /transcript_id="XM_817524.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(957604..958470)
FT                   /locus_tag="Tb10.70.3690"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747124"
FT                   /db_xref="GeneID:3662473"
FT                   /translation="MGGNKVSVGPRVSEALRMMEKQVKADRELVLDSWWKERKRRLRDA
FT                   VAHLAEHAAQGRQSYQAAASRAGSQLNSPQPASNLHGNVQFPRGSDAPTSGDDGAEAVS
FT                   GRRSSFPTVATGTTVTTSSSSLTSPSLRSCGKRRLSGVETTSCRCNWVPPRLVYSCVNT
FT                   TSQLGGSFVDVETMKMNLAEEIRRLYEDFPQKHNSQPELVEKQQRKWRTLKTPTFHAAI
FT                   QPQTKAVGEQKTTPTKAAVAVAKFVPTSRSCAPNVDQRFEDHMTTEQVIRELRRLYGVS
FT                   DDESSFM"
FT                   /protein_id="XP_822617.1"
FT   repeat_region   958700..958767
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(959111..960514)
FT                   /db_xref="GeneID:3662474"
FT                   /locus_tag="Tb10.70.3680"
FT   mRNA            complement(<959111..>960514)
FT                   /db_xref="GI:71747125"
FT                   /db_xref="GeneID:3662474"
FT                   /locus_tag="Tb10.70.3680"
FT                   /transcript_id="XM_817525.1"
FT                   /product="rRNA dimethyltransferase"
FT   CDS_pept        complement(959111..960514)
FT                   /locus_tag="Tb10.70.3680"
FT                   /gene_family="HOG000260607" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rRNA dimethyltransferase"
FT                   /note="go_component: mitochondrion [goid 0005739];
FT                   go_function: rRNA methyltransferase activity [goid
FT                   0008649]; go_process: rRNA modification [goid 0000154]"
FT                   /db_xref="GI:71747126"
FT                   /db_xref="GeneID:3662474"
FT                   /translation="MSRRFLNRSQVTSASAALLYSRRGVSKPSTDAAASPLPPLRCPGG
FT                   PRVKAEGLKQLFKVPHAGYLAKYGQRFILNLKLTHQVAALLSRTTLRTPDKLLLELGPG
FT                   AGALTRSLLTRPCVGVLGIEQDERFNGHLEQIRQYTNGKFQWTNGDVLRINELEIVESL
FT                   YAGFAQQHRRKPAADARERASSDGNKSDGGEACSSGTKDSGCCTGDFYCEDAPLRNVQR
FT                   EKILRKRFGKYAAFNHDTASGQNSGSAAPSSDVSGCAFSSESVAFEVSDRWWSDGDAKL
FT                   EVIANLPFNIITELLMRYAVDCSRKQNLFVFGRVPLHVFTQQEVAECIIAPAGSIHFSR
FT                   LSVLCQCFFHTQLLRTFREMTYYPKTAVLGALITLQPRAVPLLPGLDAATLIHFTDLLM
FT                   RPGQRGMTVYKALQQHVPPEVAQYMLQELRTDGALTVLDLTTEEVCKLATLWHRFLEAS
FT                   SQQAHGSGT"
FT                   /protein_id="XP_822618.1"
FT   misc_feature    961995..962040
FT                   /note="A-rich"
FT   gene            complement(962440..963948)
FT                   /db_xref="GeneID:3662475"
FT                   /locus_tag="Tb10.70.3670"
FT   mRNA            complement(<962440..>963948)
FT                   /db_xref="GI:71747127"
FT                   /db_xref="GeneID:3662475"
FT                   /locus_tag="Tb10.70.3670"
FT                   /transcript_id="XM_817526.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(962440..963948)
FT                   /locus_tag="Tb10.70.3670"
FT                   /gene_family="HOG000260605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747128"
FT                   /db_xref="GeneID:3662475"
FT                   /translation="MSQYDHLFDTPAAYIAASSESRRNSVAVAASSITSNNFGPESHGH
FT                   RTSQQVGYFPTDDECKQLANPVRELLSRCRCYEVLGTSTQVVLLDVDVELTTAFIAAQE
FT                   RGLAACVLWDREECAVCGVLSSTDYIEILLYCSDHPDEAERVPQYTIRYWREKVRNYKP
FT                   SGTVNAGATEAETLANSFDRLCSLSPVPPLITCTSETSVSECLAQIMNNKAKRIVVLVE
FT                   KESEDFNVKALLDLQQILSYLGALFLSVESQGSGPRGVSADTAMSSSITSREASDYAEG
FT                   TGGPSALEAVSGYRPFIDSVVASNSEFSRGGVTLPLHVRNLHDLVLNEGRENPVDFGSY
FT                   ASVGPYKAITDVPFRFVPQLGQHRKTPISVTLETPFLDALRLLLLHNIDCIAVVSENDV
FT                   VVDAIGRSDIVRIEDNGVYNTQLTVRGALGDRPPKKIRVFYENDTLREIFIFFVRQRVR
FT                   ELFLVDPNTKKLRGQLNISEVVFFLVFGTTNTNNPSKSQCGCGT"
FT                   /protein_id="XP_822619.1"
FT   gene            complement(965185..965880)
FT                   /db_xref="GeneID:3662476"
FT                   /locus_tag="Tb10.70.3660"
FT   mRNA            complement(<965185..>965880)
FT                   /db_xref="GI:71747129"
FT                   /db_xref="GeneID:3662476"
FT                   /locus_tag="Tb10.70.3660"
FT                   /transcript_id="XM_817527.1"
FT                   /product="proteasome activator protein PA26"
FT   CDS_pept        complement(965185..965880)
FT                   /locus_tag="Tb10.70.3660"
FT                   /gene_family="HOG000260604" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="proteasome activator protein PA26"
FT                   /note="go_component: proteasome activator complex [goid
FT                   0008537]; go_function: proteasome activator activity [goid
FT                   0008538]; go_process: proteolysis and peptidolysis [goid
FT                   0006508]"
FT                   /db_xref="GI:71747130"
FT                   /db_xref="GeneID:3662476"
FT                   /translation="MPPKRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAVE
FT                   AHATIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEEDN
FT                   LGVAVQHAVLKVIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGSV
FT                   DAESGKTKGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQP
FT                   RTGSDHMVS"
FT                   /protein_id="XP_822620.1"
FT   repeat_region   966347..966390
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(966489..968015)
FT                   /db_xref="GeneID:3662477"
FT                   /locus_tag="Tb10.70.3650"
FT   mRNA            complement(<966489..>968015)
FT                   /db_xref="GI:71747131"
FT                   /db_xref="GeneID:3662477"
FT                   /locus_tag="Tb10.70.3650"
FT                   /transcript_id="XM_817528.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(966489..968015)
FT                   /locus_tag="Tb10.70.3650"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747132"
FT                   /db_xref="GeneID:3662477"
FT                   /translation="MRGDVPLPVWQLKVINGCICNNDLILPTSPQPLLLEHFYNSWSED
FT                   SGSARVKKNRIPRRVGRGSVCNTKASSGLAGVQTDEWMKTIPHVVLGRHTLLPSDYRLK
FT                   HGSISRLQCRVVHVENTVFHRKVLSKFPPMTWGVPSGTNSGRSTTGYKCGDNGTTKFEG
FT                   PYFCLLNSGSNPLYVNDRQLPQGRSHCLCENDIISFLENPFDEEGGILQPLRPEDNVNS
FT                   GATGQSGLTYGVHVANGDESKYLSYNHTAPQRSNGSPGCSTASFPECGTTIPSFVEVGG
FT                   KRIARYRESVAPRRLPQPLDSVSAGVCQNVDGGLSGLSPPKTNNALSSLEEGKDCKLEQ
FT                   DEPKYLSEVYTKTPTKGIDVRETPVVVCHDYDEDITPPKVFNCDGRFPYEMTGHSASAI
FT                   VDDTISPVRPRVITRGNRNDNIPTEVEEPCVVLPPQLPVYVFSRRSPSPVGLTCRTQFV
FT                   EPIKVSNGLQREGRRSVQSSVKLDAGAKKGKAISGKSSLTVPRPRKRNRW"
FT                   /protein_id="XP_822621.1"
FT   gene            complement(968518..970536)
FT                   /db_xref="GeneID:3662478"
FT                   /locus_tag="Tb10.70.3640"
FT   mRNA            complement(<968518..>970536)
FT                   /db_xref="GI:71747133"
FT                   /db_xref="GeneID:3662478"
FT                   /locus_tag="Tb10.70.3640"
FT                   /transcript_id="XM_817529.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(968518..970536)
FT                   /locus_tag="Tb10.70.3640"
FT                   /gene_family="HOG000260603" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747134"
FT                   /db_xref="GeneID:3662478"
FT                   /translation="MRPYFPGANGVLRSHCISCFVSRRQQSAKKNGTSADEGKQTPPYC
FT                   HTGENYCGSASVPRTEAVNARMMQTSAAYPRVHVTLHDPQKSKSEEADELSRCGGGEGV
FT                   NGINDKAETVFGGNRVGDLSENEVRAFLFRKEREIAHHHQQRNSTIPYPPHPDDVVPQF
FT                   RRIKRHQQMLVVALDPDYPVYDRRDNVPELPPAQSHPWVKKTPTGPFIVHGDGQLGVVG
FT                   TGEVGFEDAFTSDNTTEVAAATMGEVMLPLPRDFRGLQHRSTLHQSLPSCNGKVLQETV
FT                   IKNSFALTGRGVFTTRDVSAGETIMIVRNTARNLGVKSEIERLVEMCTDVLSDTYNNFC
FT                   NGNPQKLDFLHDWVLTGQPSSLLLHWPRSATKQVLECIGGAEVLRALELHEIHIARLAA
FT                   IMDMNSFLVESSYAVRKGMAYFPEAGFFNHSCSPNATYDVIPAHTFCETDYYVDELGDS
FT                   ANAAFCATNYGEYTKSSNNDIVDATSGRNTTSDTKSDRDASEDECMEDVHNADGNQIIP
FT                   SGTVEYLFCCRATADIPAGSEILISYVPPEWSFDNRQYVLHDRYRFWCKCPKCAPTLDS
FT                   KYARTPRLLVAMLIFSIFLQLLVMRQRDMEHATMRERETGEEEEMRHGESGREKLKRRA
FT                   RGLFELLEESRQEEMYTPDRGPIPERVAQDPWARPAR"
FT                   /protein_id="XP_822622.1"
FT   repeat_region   970568..970591
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(970824..972266)
FT                   /db_xref="GeneID:3662479"
FT                   /locus_tag="Tb10.70.3630"
FT   mRNA            complement(<970824..>972266)
FT                   /db_xref="GI:71747135"
FT                   /db_xref="GeneID:3662479"
FT                   /locus_tag="Tb10.70.3630"
FT                   /transcript_id="XM_817530.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(970824..972266)
FT                   /locus_tag="Tb10.70.3630"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747136"
FT                   /db_xref="GeneID:3662479"
FT                   /translation="MPRLHIWMLGATLAGCGQYVFCKHFYGDRYTEREEMESSIQAEKS
FT                   YLLQLMQQYALLNRSIQDLPGSLCTTNRERLSVYCKIQQLREVIHNLPLKSMSAVDRKA
FT                   MLLQLDGLEAAQCTPLNFRDEALTISEIVMCQFCYGFYMLCFCVIDPLLRRVAAERVRR
FT                   QFLHRTSKMILHCLRIPVTMAFEPQAEYINDEKEGKLCCLVFSPQHWVEVVGFWACPLN
FT                   PLLLSTHLQLWQLSLREAVPFSEYWHEQWCRMQRELVDAAVVSDPVVEYSGGRILQPTD
FT                   SINTVKGSDSPVTSTYGYPRALRRGYEGSPVLDPEMKNLTGVHPSSAASAAGPRFVPVA
FT                   SCGLPRLLYINEAVARPDVRPRPTQKEIYTQLQHLQYPESLGCSSGVRKINASGGNAKD
FT                   CNLKAEKEGELLLQLRSWYSCGGIPWWHRATWGAAYGGVGRRGNCDWRGLSFRLGRPCS
FT                   ADQLLKEQMGLCLCLHTPTNVL"
FT                   /protein_id="XP_822623.1"
FT   repeat_region   972486..972509
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   973476..973554
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(973993..975549)
FT                   /db_xref="GeneID:3662434"
FT                   /locus_tag="Tb10.70.3610"
FT   mRNA            complement(<973993..>975549)
FT                   /db_xref="GI:71747137"
FT                   /db_xref="GeneID:3662434"
FT                   /locus_tag="Tb10.70.3610"
FT                   /transcript_id="XM_817531.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(973993..975549)
FT                   /locus_tag="Tb10.70.3610"
FT                   /gene_family="HOG000260601" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747138"
FT                   /db_xref="GeneID:3662434"
FT                   /translation="MSSTGKFVDANHASMRIDRECLHDATFNESAEEQLEKLTPGGFLH
FT                   YDYRTPMAKEKRLPDQFHVVQWNIERGIQWDRVKDTFRALKADILILQELDINCRRSGY
FT                   RNVAKELAKALEMEVYFLCEFEELDSTLRSPKNAVGPLSQPTLHLDSRSGNSGAGGISG
FT                   QRRGQRHFHGNAILSSVATLSNVTAIPHYVGLDWEKHGVKLREPRCGFRYFMRCCIKSC
FT                   ERENVSMPDLYLYSCHFEIFCGVLGRARQLVDVLRDANALLKESEGMDQQPAFVLGGDL
FT                   NTVVYGVVRLSKTVANDRMRFLSIGEKESCWLQRKILSRGMQWVDSAEPASQLSNIVST
FT                   LRRLYNRVINSDTMYRLLYGFSPEELEAMDNKSLCFYDPSDKVRSVTLDNPDFYGFVKG
FT                   KLDWTLLSNVRVLPPELPEDIVHRLQESGSITSSSAESLRSGQPVPDGYVLFNEDFSAS
FT                   DHKGLLIHLMQNPGKSTETYPGDTTFRITPVSNVMFLSFLWITLWLVVAVFARSIINRN
FT                   L"
FT                   /protein_id="XP_822624.1"
FT   gene            complement(976037..976888)
FT                   /db_xref="GeneID:3662435"
FT                   /locus_tag="Tb10.70.3600"
FT   mRNA            complement(<976037..>976888)
FT                   /db_xref="GI:71747139"
FT                   /db_xref="GeneID:3662435"
FT                   /locus_tag="Tb10.70.3600"
FT                   /transcript_id="XM_817532.1"
FT                   /product="vacuolar ATP synthase subunit D"
FT   CDS_pept        complement(976037..976888)
FT                   /locus_tag="Tb10.70.3600"
FT                   /gene_family="HOG000230791" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar ATP synthase subunit D"
FT                   /note="go_component: hydrogen-translocating V-type ATPase
FT                   complex [goid 0016471]; go_function: hydrogen-exporting
FT                   ATPase activity, phosphorylative mechanism [goid 0008553];
FT                   go_process: ATP hydrolysis coupled proton transport [goid
FT                   0015991]"
FT                   /db_xref="GI:71747140"
FT                   /db_xref="GeneID:3662435"
FT                   /translation="MSSNRYTALPSRMSLIAFKTRLKGAQKGHSLLKKKADALAFRYRT
FT                   VMDELRRAKLEVADQIKGSYFTITQAQFIAGDISLAVQESLKLPTYTLTLRVDNVAGVR
FT                   VPAFTERNSRDESTAAGGNQQNNKSRSGVNSYGNYGSGGGPSKQQATSAAGIGRGGEQL
FT                   REARDAFRETLKLFVKIASLQVSWMTLDVAQKVTSRRVNALEKVVIPRMENTLNYISSE
FT                   LDEQEREEFFRLKMIQKKKKILQQNKDRKEAADNAAAAASNLLSMSPGKDDNDVTEADL
FT                   VV"
FT                   /protein_id="XP_822625.1"
FT   gene            complement(977527..979629)
FT                   /db_xref="GeneID:3662436"
FT                   /locus_tag="Tb10.70.3590"
FT   mRNA            complement(<977527..>979629)
FT                   /db_xref="GI:71747141"
FT                   /db_xref="GeneID:3662436"
FT                   /locus_tag="Tb10.70.3590"
FT                   /transcript_id="XM_817533.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(977527..979629)
FT                   /locus_tag="Tb10.70.3590"
FT                   /gene_family="HOG000260600" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747142"
FT                   /db_xref="GeneID:3662436"
FT                   /translation="MMNTATFSRFGSQHSAVARNSGIFLLRSRTPLPTNIRLNALFFQQ
FT                   RFIGPRQYAPKGFREAAGRAPMTFEFGEECNGLAKVAHQTKNYGDAISLYDRALTMRRE
FT                   KYGPIHSKCAATLHNIGRVFLDMREPAAAENALTEAAAIYEEVEGAKSLKYAESLSLLA
FT                   LAYTHLNFIPEAEKAFRESIKIFRDVCYNHAAGSWLPDNAEAEAAALTEPQNHPLASAA
FT                   HALADCAQLFLLQNQEHRAIVFLEEALEIRRFLYTRHNKFRPIIAQTLNKLCELKKTIN
FT                   DSTGAEMCITECLDICIASLGRDSPATAQATSSKASLLAARRQFREAKRFYEESCRAYA
FT                   ASLGEDSALYGQELVKLGRIEELCDDYSTSQKAYEKGIDIIKKALGPSALQLAEAYTFL
FT                   GSLLVKRRDLDRAIDLFRNAVELRKANKSPSGLSSNGKDPQLAYLYQKIGDVYAMRRES
FT                   HAEAYFLLSIEQFRENAKVEPLQRTFLTDVLDDLGLLYLDFHHYEKAEACLKEALDIRI
FT                   EMLGETHATVAYSYSNFALLYLHREDTENCEKMCKCALDMYAKTARSNVLAQADVYTTY
FT                   GHCCHLQKRYADALTWHEKALNVRRTRGESSEMATAESLNHIARVYVSLKKYAAATRHV
FT                   AEAKKIAFKYDADLTQYLRQEVAKTEQQIPPMESWNAEEGTFSNTEAISTSGLVIEVGD
FT                   NKGDGR"
FT                   /protein_id="XP_822626.1"
FT   misc_feature    979889..979911
FT                   /note="AT_rich"
FT   misc_feature    980006..980038
FT                   /note="AT_rich"
FT   gene            complement(981133..984201)
FT                   /db_xref="GeneID:3662437"
FT                   /locus_tag="Tb10.70.3580"
FT   mRNA            complement(<981133..>984201)
FT                   /db_xref="GI:71747143"
FT                   /db_xref="GeneID:3662437"
FT                   /locus_tag="Tb10.70.3580"
FT                   /transcript_id="XM_817534.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(981133..984201)
FT                   /locus_tag="Tb10.70.3580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747144"
FT                   /db_xref="GeneID:3662437"
FT                   /translation="MISRKDTGNSNCPRSGRTIIRSAVMSLPATPAPLLDGNGHTSTVG
FT                   PTSIKTIATRRRVMYNSPSYAAGDNSGRVKTLYSAHELSAVSLSNGNWKVASGEPPSGW
FT                   PPLQPDWSIATHSIPSQRTARNKNVERTVSLDPQGQLLKEGGSGTCTDGDVCPPSARLV
FT                   RQRHAETREKMPAGSTCSIIAQLPLREQNPRSGEERQPQKLVGDGAVGVDGVVQQSTTS
FT                   EKRKRKKVKCGRKRKSDSEPLATDRSYVTVLEGSQASLFKNSMCACTPSISNGSARNSN
FT                   FNDEGCAMNSFSSSVQRSASGPVVTEKWARSIIQPQDEYLLYDRRTPGAIKQEDLVRRG
FT                   QVILLRERIRCGWPNCCSAHRNQLSREKLADVRTQRHSCESTNAVPSDCSTLDVGDRDD
FT                   TASSRIVQMNERRIIERGTPLLFRRPYRRLFSDDEKVSKRSDICIPANSSSAPSLGIGS
FT                   DIPKGHGRSDTSIMVSSIYNLNFSNVSRPFGSTSSTVVTDIAASSNDKNKDCNMPSASS
FT                   GAGSPGKEKIIFSGSCASQPNAQNLSKAKCQGTTSTHSIAQLLDDAVTQNLDNLVGDPF
FT                   FLFCGDENHERLLLMQEEHEARVSLKRRCSKPPGCSSSSSSTGEKGIEGSAFQSSPRKE
FT                   STFVGLFPKQLDMGSRSATENEIRAEGAVAAVGNQNGVSSLSNASSGSLTQSWLIGDDE
FT                   DEKKQGNLSPRSVSISTGNVDERTSEKLQVKGSTIRSTGTADRARGSEKSVHLTSALAR
FT                   RLNNNADDAACFAEKTRLVVRQKSDSGREGKKREEQTNLVTPLDFSVLHDSCRRSPSQA
FT                   PETNVYAAPQRREKRPPPPAKGHSKSDFTKIQSVPLSSQHAMALSRASSTSPPQVAGEP
FT                   LRESLNLSDTEIKNGSVYLNNEIEEFLHFVHRQEQEKKRQKETRSANGKRSPLKAINSV
FT                   VGTRQSDAKRNGSNGKGKLPLPRSDSSEVGEEQVEADDNSPMEEEAHYAQSVVSVLSSF
FT                   GQMWNTSFHDVREHRKLPLHVRAQLLLFDVVAS"
FT                   /protein_id="XP_822627.1"
FT   gene            complement(985225..996930)
FT                   /db_xref="GeneID:3662438"
FT                   /locus_tag="Tb10.70.3570"
FT   mRNA            complement(<985225..>996930)
FT                   /db_xref="GI:71747145"
FT                   /db_xref="GeneID:3662438"
FT                   /locus_tag="Tb10.70.3570"
FT                   /transcript_id="XM_817535.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(985225..996930)
FT                   /locus_tag="Tb10.70.3570"
FT                   /gene_family="HOG000260598" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747146"
FT                   /db_xref="GeneID:3662438"
FT                   /translation="MPPKKRGHNARGREKIFRNAVQHVHVGIGYNVLGAINMQPAGGFT
FT                   DDWAPHPESEDCAFLTELNEQMLSHSTTDFKSFRWEVLDLCSSRALFQLNHRKIAQKLL
FT                   LAMMNRDKFAEGFEAFARLTVAFARDMREKFFLYFECFHQAINGGIYDANGQLLAETRR
FT                   LQLIFSAQAAWCREMRPFWLLQEQRKLVELVIKLYVRQMHDSKEYIRRLAAEVLASTCR
FT                   MTRELLPLVLEVMCVDVVHDFKDYCGDDARKVRGADDDVDGMDNEEEYEESHGTIGTHH
FT                   EEGNRVREVMGSKTNALTLDRLLRYQKERLSFLPVVDSLCFFAADVLRGIRGSLNTNFE
FT                   NFYVVLIYVFGLSKRTNFSSAYDSGYGVNEQEFFGFTVEEAEGFAHYTHWKELFLESRE
FT                   EYEKEGVEFVQQHGDTQTGVLGELVQMIGATSIGSALRTLIEETANSSATAASMGDVDD
FT                   DFEEDRDDSGSVHSPPLQMLTTVVATLDFTAPFLHLLQQLLHAKDCLLLWKGASLPAIR
FT                   QMAKQLQFFLANRRETLAHNDVAICGHPTAGWCHLVRSCGAALELFTPLCVDTGMVPRS
FT                   HMAKLHDLCLPLCRDIISTCVSVSSFKGDGSIGPQGVTLDLELQTSTRLLLFAFVQDVL
FT                   QKNYAYSLRQERIIHERDDEESANQMGTVGRSRSGSDRVKSRLTSFAYALLAPVLHASC
FT                   KMANASLSKLNSGDTLEDRDEASHSSGPDEESIAFRDTTHAVMMIGMMCDRTRNTSVSP
FT                   LHLLTTTTLTTAFGEGSKKRNNNNNNNNLSLEERVTLMKDIQTLLLGTAALFTSLQSAA
FT                   EAFTARTKAAKWADVLIAVLPPALVVAEAERTTLRQTRGNEPAEANALFAWQFRDALLQ
FT                   VISAVKLAVHGAPSATSARVTASSFALFAQASALLMQLAPLCGAPESDKDSMEFIRDAV
FT                   VILATSFEEHRVVILGDSEVGRLLHGMECLLHAMFRLFGVEESLVADGEGSEATVAVHK
FT                   KEKAKGHVVSQQISQQRQTFLRATARLHETLDDKSQRALVHTLLFEALVSPIQSLRVVA
FT                   LRLLRLFCHPEVEDTKRVSGCSSVDPTFFDSLLRAELFNPLSSAGNLDGIQQALAKLSF
FT                   DAASGALREPLRRVILARAMMGLLHTKYSVAWPIALKILSDLVKSEDTVARRHGTGLHQ
FT                   LRDDGSPFGDNEEVEDCKSLLDPLVWETVISRYARSIVLGDIVRVASSASNECDTDDCY
FT                   NNNSTSNYKGTESSIHSSSSPLFYRIQLTDMQRHEKGELVSKDFSTAQYKSSTVTWLLL
FT                   VNNDGEILMWERHYLPAVSPTYTHGRAAARHATDRAVLAKTFLSGLSDMARTGGGSAAD
FT                   TKDSLVAELAVELSAIRCGEHPSGIRHLKMLDERLTLALNAYTAAATVAYTEEESPLQP
FT                   SGQSREDATLLTKRLHRICASLVSDSNTKLQRAAIDLLRRLKVAPFSRYYRQLVPFCDT
FT                   QQNLFNFLSSFHVETDVPQEHRADYIATALTVALPKLTSSVSRDKVKDQAVLQRRLLAF
FT                   VTHLTDRGEFTAVLNGLVQRLIVEHVTPTKAAGSGVFCFGSWWEKWVREQTHCTRRLER
FT                   LLRQLLNTTKLLSALLQAVGKGFSSFAGTCLLLGINAYLISCKQTLLAPLSATTFPGIN
FT                   GGACDDGATQEEIGWRVKSALSSSALKSLMSRMRRGAATMVASLFEQFPAEVMETLRAD
FT                   LGVGSGDTGAASVEHSLISRYVAALHMNGGGAVAELIGDSQRAAATPFMRLVRAWIASP
FT                   HTLPLVGTFAGAVTEMIKQLFAANSTVTGTTNTSGSGLSVLSRNNQQQTAVLALHEGLR
FT                   CVAELLNASDEQINVFGATEQSTLRVMFVEPHVSEIFTSLYTLIRRGASCGVREKNTRF
FT                   PASRDKGGRPATTVMSFSVSMWKELIATVSMLTEYVVVIEKQNAEEKESAGGKHANSED
FT                   TNTMLSRLLEMCIAFVAHPACMKDRETCVAAVGVLEYLLPHVHRINVLLHYEPLVHLFN
FT                   AVTNPEARLLLCRTLNVMLTQMGAVSSSSDPVSCFCNEENTDFLLDGVQRGSRGYAAQL
FT                   AAVGRAVSCLNSFDDNNSSLDRYDFDLRFHTLRTLQQFFHNGGESAPVSIGKRKRAQQS
FT                   QVREERDYSGDFDSTIPLDDLEAPVLCVEGFLVLASNAVFFLRDPEGTISALAVQVVEA
FT                   MIRYASRQNTRVAEYDTLILNQVIRRIILPSLRRGVVARDVHIRNSHMQVFGALAQHYK
FT                   DSFRSFAALYDRNVELNFFVNIGHLQHRCRLNALALLRKKVDQLHPRDALRVFVPFLLA
FT                   TVKDFAQGKRDLQNLTEGRAKGYCDALLNTVATVAGMLPWEGYYRLLSLLLINAQENAS
FT                   LRLPMLQGVVLVLDHFHFLEEGVDDKIGTCSNNNNDIPEDGRQRKGAEESPQTAQGDDY
FT                   DEDEDGENDDDAVAAALEVTLRAKRIKYRNARIMHVMEDDILPQLYGFLSSGTRRSGIH
FT                   ASGSEVLVSAHTATSVRDEMRKTDGAQQNTTILQLPVAIAITKIVKRFPLDRFSSHAEQ
FT                   LLDEVVLKLRTKNDKHRERARRVLSAMMCEVGPGKLGFIITKLRDHLVHGYQLHVLGYT
FT                   VVTLLYNLYEPRHSLSYGRKKTPGKKLHKEAGAKARHSVVGGGEAIRPNGSQQHDKQGG
FT                   GALGQTSNSKEKSGDDVTTGNHEDDEEEELLRMIIPAAVQFDYEYGVSCLTACLDDIMT
FT                   ILLDDYLGEVSEQKRQVELMSTMLEVKSSRALHGFTLIASHCQATRVIEVFLQKITWLL
FT                   TPPSEAANVETNTRGGGARAGALLLLQELKTKYSTIGKSAAADFAFVQKVRLLAVRVAR
FT                   ALLKNATMEVESSFRVVRDLLHRHNETREEKIKKFEAKEGTRRIRGSAQLIAQRPSVIA
FT                   TTRREQLDANFLVAPRPERVDVDFSAHTVLATQQKQKLRTYRGRYGKDVKQAAKHFYRE
FT                   DPTAAVVLDTLDEFLLKYLLSVLKQVLGMGKERKSSKIAVRLDLLRSKNKQKEEQTDGD
FT                   NYITHTNASDEEGEQDASSVSSADVLLDPENLDDREGDALDRFAAEAEERDDEQRQKET
FT                   GEPSKKLCVRTEKRKRRGSADLTASFTRHYQQLLEELVPVVLSTLHGEGSDAVIGYALD
FT                   CMLALLSLRPPLKIVGMYHTNLYDTVTAFFERGGSVKQRAMRVAASVISHQRFTLTEAQ
FT                   ASQITGLCHAELVERNRFAPMALTLFYAVLGRHVHVVEVYELMGVVTELLLHVSAKRLM
FT                   RQRCISVITRFLTEYRMTPEKFRSHMDLLYRNMDYPEVTGRIALLELFIALINRLPTVV
FT                   LRQEAPLLLLPLAVTLSGSEFLEARRKAGTALQDLVRNAGVDTVVPTLSKWLEKDQTRK
FT                   RKTIALQTWALMLSAIASALGLSGKDNDSSSDNTKGITAEAEEFATYYTWSLPSIMDAA
FT                   TYDQISASRIRRRSEELSGTLRRKIEMKGWMYVFFGLRCVEAIASAAPSLVWHDVTFAK
FT                   PLVLYLSGRLILHTHPWVRGVALRLLGMYCTNGVETRCSYLVDDGWVGAHLVTSAVEVL
FT                   GSKRRRSEKDTSQKPTRRSRNSAVAIQPSSTASGDTLPYMVVFRGTGPIDNTDRAEEVL
FT                   NEISASLRLLLLNFAQSDVSNEKYAAHRAIARSSRTDAVRLALYLIRSLAAVSMALLVN
FT                   ATANESEEGLLHVREVVTRHFVALRRQFNSIAAPAISNGSVTNVMVRTASLVQCFGGLV
FT                   AAMPCVNGNGRKTSRGDNKSASETLGDVNEGERVDVGSVARWLLCNAINLEFIQQTVAP
FT                   TVAVAMRCGRRSEKLSTLATQVAYVLREQLEARRHDYDTARAHADDENAAVNVSPLEGR
FT                   KKLRKISRDKSNNGNCDRCTGSFVTVDDALFALTTVAEEIKNARKDELARRDTTNTLRK
FT                   RARSADESYPKGNKRARTSRR"
FT                   /protein_id="XP_822628.1"
FT   repeat_region   994588..994611
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   gene            complement(997494..1000520)
FT                   /db_xref="GeneID:3662439"
FT                   /locus_tag="Tb10.70.3560"
FT   mRNA            complement(<997494..>1000520)
FT                   /db_xref="GI:71747147"
FT                   /db_xref="GeneID:3662439"
FT                   /locus_tag="Tb10.70.3560"
FT                   /transcript_id="XM_817536.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(997494..1000520)
FT                   /locus_tag="Tb10.70.3560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="TcBr homologs are much shorter at C terminus;
FT                   go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:71747148"
FT                   /db_xref="GeneID:3662439"
FT                   /translation="MTTELNSFRVRKSEGVEGEEEDPALTELVFKKLRQTFLCPICHRP
FT                   LQENPTALDVCGHVFCHSCIVNAIEKSCPSVKDPWEEDERQLTENSHGDQWSSPQKRNS
FT                   RGRGNINDVRTSPVAKSGRGRSTKRLRLGQSCPICSVPAQISDLISVSLVSNLVSDIMK
FT                   HPLLSAALVSPKSNDDNDLVKAGHIEEEEALAPSAEVSQVLSTLSGVSLTGNAGVQTVT
FT                   LQSNNAPPVAEEATGEPEKKSEHGTHRQAIGSLPYSPSATPMGTSPLSVTSHVSVNTTN
FT                   PHSTVTLSDHNFPVSVRSRSGSPEVVGGVHQTMPEPHGRSKTRGVGCSSPSEVCRPLTS
FT                   NGDAENSDVLRNFEELSSSCSESGSSQDLQRHSEPCHRTNAVGSGTAGGDALTAVATAV
FT                   PTSVQSSASTRHFSQKPQEDVGVIDNVGGDALTPVATAVSTSVQSNTLPKDAPTVREVG
FT                   EGDGKDSSSDSSLSSSDSSSFFGESFNFRVHAQRSEIPTESALIFETKGRANTHENQVH
FT                   NGGVAVTQNLSSCDPDICSGRELLNHGKNIAGGSGARERSTSTISTSQLSEHKDDVFRL
FT                   PHTFSVDASVENSTKTGEVLVSAAQMFGARVLDERMGSVDSRLRIYDPKPQKVIRHVFR
FT                   LPSCQGSGTPAESQLYWKERHYAAASITCSYCLIMPTEGRLASISDDGSCISDCGGVPS
FT                   ARDSNLTSMTPTTACALVSGALVTDFRWIVESVAARCLLPALQYSKRPSWSRHESVSTC
FT                   GGSGASVDNQTPGRWAAEGHAFMLLPDSVLQLLLQQQTSGSISMRGSSRELSATVTGGY
FT                   DFCSWRRLILLSGGVLLRFPEECVRQLLLDAMSMSYNDVMIGRNGCDHDERVTAVQNAM
FT                   HMANGAGRSVFNVECCPERCTASTFLIRNVIILRDSVSTGKDAPCSGSQLLFKRRLERI
FT                   LQSFSVLLSLVQSREVTPVRDVSPSQVFVGSKPFVTFGDVTERYSAPHVMLRSTKWLLR
FT                   TFSGRLQDSSCESCVGSDQ"
FT                   /protein_id="XP_822629.1"
FT   repeat_region   999088..999129
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ctg"
FT                   /rpt_type="tandem"
FT   misc_feature    1000683..1000731
FT                   /note="AT_rich"
FT   gene            complement(1000999..1002786)
FT                   /db_xref="GeneID:3662332"
FT                   /locus_tag="Tb10.70.3550"
FT   mRNA            complement(<1000999..>1002786)
FT                   /db_xref="GI:71747149"
FT                   /db_xref="GeneID:3662332"
FT                   /locus_tag="Tb10.70.3550"
FT                   /transcript_id="XM_817537.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1000999..1002786)
FT                   /locus_tag="Tb10.70.3550"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747150"
FT                   /db_xref="GeneID:3662332"
FT                   /translation="MWKQDIGQWVERKGRKGWTKQPQVSPPQPCTYTSGPQRLPVRVGF
FT                   VPEGFEEKGEHPAVFSTASAASHADQAAATPSYAGQQWVTVYGVLPTSILDVRESLDVM
FT                   FGRTLMHKLPTRAAVPSGGLTSTSVVGHSSQQNWFYVKFEDPVAAARAVYQSPLIVSAP
FT                   STNNLYSSAVCGTESKVQDGRVNGASREEAVGIAWCTDELFLQEQLKQERLIKSLEGRR
FT                   EGSENNYCGETLLEEGGEGVLNTVGATPCGADRLQKASLTPFVEEGRPGLRSAASSRGL
FT                   GSLIREALCSPWSARWTASPAHTHDRSDADTSGCGNTNTRGSSSPSSTTSTANTQVFHE
FT                   NGSDGLGGTVCKGASSESNRNGGVSPLTEATIPSCLLARGRRYHHDAEHQIRNAQPTLP
FT                   LPGNYSVLCAFKADVTERGLFKRVIRGILYIPCRVKQLLVKGDERTINNNANFTESGEA
FT                   RFLLDVVSQGRKRRAMIRNRHYGAASRLHSVDDHSSGQVSTPVLAEWAPTRWHESSSLY
FT                   SLFVILLLIIISRNVNYADMRHTFTRGRGEDVLQSSKKIVDRRDNPTGSSQQPFNEVVP
FT                   NVLLIDRVHGSDKYRAKTL"
FT                   /protein_id="XP_822630.1"
FT   gene            complement(1003393..1009836)
FT                   /db_xref="GeneID:3662333"
FT                   /locus_tag="Tb10.70.3540"
FT   mRNA            complement(<1003393..>1009836)
FT                   /db_xref="GI:71747151"
FT                   /db_xref="GeneID:3662333"
FT                   /locus_tag="Tb10.70.3540"
FT                   /transcript_id="XM_817538.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1003393..1009836)
FT                   /locus_tag="Tb10.70.3540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747152"
FT                   /db_xref="GeneID:3662333"
FT                   /translation="MSSQAEAQKQRRCRLILVCSDGDAADIRYIGFILSKAACHFTPPR
FT                   DSSDADSVATRSSRVVLDEQETDDFDQNGVVAEVQAAFMKYMSAKRGTNVPATAIGAAP
FT                   AKGGKPKGGKAAGASGAKGATALSSPTEGSQKTQAGDGNSWYSVVHNRRCTRPLVIVHH
FT                   IPSFDRPEEDAVLAAALPRNPNPADAVATIQKALCTIVDEMEGRTAPVSRRVSRARSVS
FT                   LRGDASEGLKEAPRVATPVPLTRMEAHAKEMSILPVVVPIRDPRVLAFLLGHGCDAPPK
FT                   RLDIRLVVNFVDAPTSPGGTAQVAGVSCTPSSQRQRTTPSSKRQPGRDAAAGQTASGSK
FT                   EGDVNTVAPSGSSFAGVIEQCARLGLATTITDTDAALHAYTALCMREIVENRGDDKSSV
FT                   IRRCLDSVLPTVFNVVSNMTYYTRCMSTKATYQCPNLPLPLPQEEAATFPPPSGGSVER
FT                   GRPHFCEDAPRSVCPGCEPSFPFRDWSHYLQGRKVCDQWTCVSALHALAAQVTVSLARR
FT                   QTPKYVRPVPREELTPVHEVHSTPHSETVSTGKELSGTHSLLPQSIYCYAEKEPILSAA
FT                   FPRHEGIDDEPLNEQIEAAVDAATKRHASESKLKDRKSPGRLRKQTQSPSPIPHSPSEL
FT                   ASTQHEGNDPAVMLPLDHTMDRPFPQPTQNDVRCLTREFVQKGLGVFKQDNPITMTLSL
FT                   PNGGRSYSSMRAQELLEEPMNGLVLNMAEEGVDLRLLERVEKLFSCTDRTSGVTFDKIR
FT                   EAAEAAALRAPFVDEKLQRSVERSLTPRERTHVLQCFFLEMIAAAIGVSDKVVNADFPE
FT                   GRQSNSVSITALTPSLHEGFYPNARPLEENISKRAAIRCLNDFSSRFGEHLCRLVRCVV
FT                   PDPLESIYGNLAMFRSVGAENTRVRDKVVAVMAGGVVTPIQRQSIRVWCHYISGVPSLD
FT                   QFNELLSSESVCLGTTLTLPTLSSAPTDIAKTFGATQCFGGDLGDAIRVQLLRDLRNSP
FT                   QFIIPQLEEVVRGRGVWRSEGDIQTALEGRHTLYPHDNSIIEVITTDRSRICRYVRASE
FT                   IICTLHYYIAPPPRAAPSSSPAVTNATSTSAQTAGEAVDGGFSACSSAPPSSRRKEEEL
FT                   MYFTAAFDDGVVLTCSARPRYRLQYANSTINSDKDGAYGSGFTPRDALNGRGRLQSRKS
FT                   IGPFSGRVRGGLPGSAQGPTQALKRRLSRRPRSRSRGEDDGSNSGKNAQEGMTRTFPVD
FT                   DSGSILLWPAVKDPKHPHETAVQLPVQHGVPAVAITVSAGGVSVHNEEHEGILWLSRHD
FT                   SMRHPVPELVRCAHCVGEEVVLQRSMEVEVRRALIEDSGIVCRYFHSGTTQMLYPDGMI
FT                   VTGYPVAPVGGVSSTQEDGAQPVVETVLTPEGLCYVREVGLEETGSLHPVPSGNVESCM
FT                   TYDRCNHCHTMSRADGLIVVTYNKYFPHKTKKEGNAASLGAGKTDQKHGCGGGFDEMVL
FT                   ARVALHVDGTCITSLLGGLLHEADEHLPVPLAPLLEDAAAVQSSCDADVQYCVEGPFFP
FT                   RVFLCAPLYKPVDNQASRASRAEVSFGVGDNPKVSSQLNDKDVSHDGNNNRGLLSPLSQ
FT                   GAEENANSSYVASFARDPAPTNDPKPYDRFYVLFGDGTVLRRRVIYRGMRGTVTPFLET
FT                   LFTRRSETSVRILHESGVVIVEPAEAGLRNRSSVMSMAVGEGFPVFDVALGGLRLVDGR
FT                   QHLTEVKHLYSSGPVQSSIRGYTLEHLLRQLVLPMYTPHKVTKARWQAMRREEIEAEEE
FT                   DRRNRISGKCPPLTNRLREIAEEFVIANNLLSMSLLKSAAQESKRCSEPPSASDAKLPG
FT                   SATPIWGQRTQYDNLLKNAANVQPREHPQLVDVFDAQSYFPQDSSPPTVIAPLFFSEMQ
FT                   DGRVVQYLQLRDVNDFIRERASGVTPVFLSLSTCTGEPGVQQMTFLRLAENKEMIDADE
FT                   PSVNKMSLHRSPYNWGTSHAVTASSLAAECGLTDARTGAAGNVMMLGSKLGEAVNQQRN
FT                   LALFSGGTSLFPTSRWLPVVLQPPRRFLKHCRHSMKDTGKVNFKADSAFSGDRIGGGAN
FT                   VIDAPAGSHNLTVGDSPIEQLRMFFKFSDVAGVVQQLLLLEVSRRQRQLASLVQYSKAA
FT                   GTTCGFGGTPVDDPLCEGSERPTADETASFNGTAPVE"
FT                   /protein_id="XP_822631.1"
FT   misc_feature    1010161..1010216
FT                   /note="A-rich"
FT   misc_feature    1010289..1010324
FT                   /note="AT_rich"
FT   gene            complement(1010779..1011318)
FT                   /db_xref="GeneID:3662334"
FT                   /locus_tag="Tb10.70.3510"
FT   mRNA            complement(<1010779..>1011318)
FT                   /db_xref="GI:71747153"
FT                   /db_xref="GeneID:3662334"
FT                   /locus_tag="Tb10.70.3510"
FT                   /transcript_id="XM_817539.1"
FT                   /product="60S ribosomal protein L18a"
FT   CDS_pept        complement(1010779..1011318)
FT                   /locus_tag="Tb10.70.3510"
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L18a"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71747154"
FT                   /db_xref="GeneID:3662334"
FT                   /translation="MVRPHLRHYCVVGRETPSEKNPQPTVYKFEVFAPNFVVAKSRFWR
FT                   MMREKNKVKSTHGDVLSCKVVKDRKLAARNYSVDIAYYSQRCGYTHMVKEFRDVCKAGA
FT                   VSQAYNDLASRHRARYHNIEVLGVKSIPNHEVRRLNVAQFHPHNLSFPLLQRRVKAPRK
FT                   DRVIFVKKNSKRAVVA"
FT                   /protein_id="XP_822632.1"
FT   misc_feature    1011699..1011736
FT                   /note="AT_rich"
FT   gene            complement(1011893..1013803)
FT                   /db_xref="GeneID:3662335"
FT                   /locus_tag="Tb10.70.3500"
FT   mRNA            complement(<1011893..>1013803)
FT                   /db_xref="GI:71747155"
FT                   /db_xref="GeneID:3662335"
FT                   /locus_tag="Tb10.70.3500"
FT                   /transcript_id="XM_817540.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1011893..1013803)
FT                   /locus_tag="Tb10.70.3500"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747156"
FT                   /db_xref="GeneID:3662335"
FT                   /translation="MTEVKGHHLSEEVASSTRQVAELACAGGAERADSVKVALNKMACV
FT                   ISCTKTTKRRRRVHVGNKCERTVKSKVCGKRNKNTDGAKGSTSVSSVVKSTHVGGRDTS
FT                   RGSKNVGDSKKKTVAMNRKTEQQRKSKARKFGDYFVSFLRKMSLARETAAAGVRASGPT
FT                   AEEASLPFQKTSFPPTRQVRGRESSKEPKLSSSFLPDCVQNQRFHVALPLLPPRVHDIF
FT                   GRHTLNLGPPSVGSTQSHQSTMDSNCATSTCSFAVASLSSLFPTSAIKCGDEEALSCFF
FT                   PAIHNGGWFGTASDFIEHCASVSHKIFCEGAPLFPLVTVKEQQGAVDEFKESTPPIEAV
FT                   EIKGTSVEKNGGTQPLYSEVVCTGATMKFGLLQHNQGQYAYYWWFMRVHMATVQLGRKE
FT                   WDFSIAVPQTTPRYAHTAAELRRVGELWCSYRFFSASVATGVAKRIVLSPDLQWHVLRV
FT                   ATIHVTHVVRDAYLSLSHSLDVVDTFYNSDERVMSSLTAHVTDSGSADVKVYDAAMNAS
FT                   LAVLLSATSVMRDPLSKSEAKSLATFSTHVATSIVEVIEQKSGVRFPFRATYNTPGSHV
FT                   KNTTITEKGEKSASMLHVPSYNVTDSVGSVFDVEEEEHIMSLALWMYLRDAACAQFPMS
FT                   D"
FT                   /protein_id="XP_822633.1"
FT   gene            complement(<1014849..>1015511)
FT                   /db_xref="GeneID:3662336"
FT                   /locus_tag="Tb10.70.3480"
FT   mRNA            complement(<1014849..>1015511)
FT                   /db_xref="GI:71747157"
FT                   /db_xref="GeneID:3662336"
FT                   /locus_tag="Tb10.70.3480"
FT                   /transcript_id="XM_817541.1"
FT                   /product="vacuolar sorting SNF-7-like protein"
FT   CDS_pept        complement(1014849..1015511)
FT                   /locus_tag="Tb10.70.3480"
FT                   /gene_family="HOG000191086" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="vacuolar sorting SNF-7-like protein"
FT                   /note="go_process: vesicle-mediated transport [goid
FT                   0016192]"
FT                   /db_xref="GI:71747158"
FT                   /db_xref="GeneID:3662336"
FT                   /translation="MNRLFGRKKDTQKPTLEDASVKIGARCDAVDARVSKIDAELAKLK
FT                   ECIQRTTGATQQRHKQRAIQLLQQKRLYQNQQDVLMQQQFNIDQLQFTTESVKDAKLQV
FT                   DAMKDATKTLKREFKKMSVADVEKLQDELLNLYEDAQYVQEAMGRSYDVPDSIDEDEML
FT                   GELEALAMQSGNEADSSYLSDALAMPSGRLPDLMSNTQQQQETETPDPYKLETQLGL"
FT                   /protein_id="XP_822634.1"
FT   repeat_region   1015519..1015551
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="caa"
FT                   /rpt_type="tandem"
FT   gene            complement(1017025..1023480)
FT                   /db_xref="GeneID:3662337"
FT                   /locus_tag="Tb10.70.3460"
FT   mRNA            complement(<1017025..>1023480)
FT                   /db_xref="GI:71747159"
FT                   /db_xref="GeneID:3662337"
FT                   /locus_tag="Tb10.70.3460"
FT                   /transcript_id="XM_817542.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1017025..1023480)
FT                   /locus_tag="Tb10.70.3460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747160"
FT                   /db_xref="GeneID:3662337"
FT                   /translation="MDITNSISFEEATSVAYAQRTAGNLPEVGKEDGKVVSAYVRLLER
FT                   ERKKREEANTKIVSQRGSCTFEFSGSVAREDDICNTRKLSEPLAPLPVLARMRLAFDLH
FT                   EWRHQMKRNPVLDFAGSYSYERNSKEEVAAMFRYKQQCAELQKNLSEARADDLSPDVGI
FT                   RNKCTLTSLLSTSPPGMALGDFERDIVEPFFDALFPPIVSQKQPQVEGFDALTWHGMGS
FT                   DHMQFLSGNRNLSRLTYQRLNQSHVEAAENLFRTIDADGDGLVTWDELSTYILECGERS
FT                   LVKGDASARRKRGKSGRTSPDEEKEKSVDYVGRILDLTTVPANTTLWQKRYPLVRFLYH
FT                   TEAISHIVFIDHGRRYVTAAWDGLVKLWRTDPRLANAQGKPAIVHERNLLAAGVPILDM
FT                   SCSPQSLGNVEMLVVLTIDCSVTLVRAGTAEVVKTFLGRHSVPTLPVELQNGLPKTPSC
FT                   LRGGTPEESLDLLCTVDVTQLQDEDPSRVMRPEYKVRAYRRDALDILFTDVSRYFTGLG
FT                   IIAPTYEHLERPQPVKTDFLSRFGVCGASSLGYRSRPATRCERPRCGTREEVVTPETTQ
FT                   DTGNSLESTRWVHCGSRGDGHVFEGVGSERSNRKPTPGHCASDYTDEGVAWFSRCVALA
FT                   NYVKFSSTSLLPTGPLMLIGFSSGVLQFYPLRAHWFDVFGQTETRLEPPESHEPLLTLK
FT                   LHRAAIVKIVVSVESDIVMTVSDDCTVGVRHLSRVEVPFMTLGETVAPTGAVKLGSTGS
FT                   TSLWLSQNHGHRKRITCATFHAGRAILVTGSLDRTVIFWVPSSPRPLHRLELSEFRKSA
FT                   TSGYPVDVAFMQPPLRPLMLMAADSKRVLYFFDVDTYQCVCVVSDDSAASLRFGEMLCA
FT                   RYDAVQDRLILGGYYPRVWNPKQTDDYPAGYLGHRKPVVNLVHQRKWDIWFSADEEVII
FT                   VWRPAVTEVRLGVRKAAVMFPPDTEQSQQPDESDPQLEESSASDANAHWKITTVVERSW
FT                   VVDGGICCISVEQTESAHVFVALEHCRCIKEYNGLNGTLVRTFTFPSGVNELSSMACGV
FT                   MEGKGTLRQSVSLLSATFEKERSLDGTTALYLLPGKSSESLSALGDNTIEAHRQIITDR
FT                   VGVAAAIIYETLGIVIVGHRGGISTTPVDEVTKCPIPCTRLTDTSQHKSEGKRSIRASV
FT                   SESFKRRFVGDKQQIHVSQRSSTTNALHSDSDSSDLDASARTSTRASSQKSSKFPATTD
FT                   ARDCQSVQTSCENTVVPAPLDLVALLPGPLVQDPVNYTREFMQKRERYLNCNEPTRVTA
FT                   PSNPSNTHAENKYDVLLDDGSESVQRKSEELPPLLLFSRDFDEFLPASKRDCGFLLSEQ
FT                   FANLGFVSHIVPVGTTGYIVTGSDDGVIQIWNGRRRAESFRFRVTYELDAITAMEVSRD
FT                   GVYIAVSDHRGHMALLDVSNINWTISSPWETEGSMHEGVILLRRWRAHKNNLTAVRFIR
FT                   KTSFLASTTSEAELSPFPAESLTEASKGEGQSVRVNTFNATAPFVDRHTAVFLCASCDD
FT                   GYVYVWSVLVPSVSFGNPSECTVSCIGYFGGNSEVPPKMPSLKHNPCSFEVLDVVRKEY
FT                   VQKRLFPCVRELFDNRQVEAAITRAAEIVKEDMLGVRFRGGLPSAPHGALLFGTRTMSR
FT                   IGLKRSGDISPRASIFWSDQSTKTDMQQGSGSGYPPSYALAFRDEFHGEHDLPALLKRL
FT                   FDEVVGREFKTHVPSPISRKDSALISPHRGVFARRRTRTDTICETPREAYGVTVLHSTP
FT                   QAPALREESAALSDTFSAAHRIAEAAFSCNPAFGPAGIAPVVPSMLATPLVLPNRGSSI
FT                   FASEEKEKQSPVVCVPQVSRKAMSSSTERSGRDTGTTVVNMPPNCNLPPSSVYLGLLAG
FT                   TVDAWVLQPEIVVRGATCAPLPRRRCSPAAGTHKSQAKKGSSPRGGSPVKNEFSFNAVP
FT                   SSKAIRDHVEREKWRGVMTLLGPGSDDGSSSGRKGLQPIRGQMPSPFPVASSDHPRTRT
FT                   YSSCFTVGGASTSSSKKPKRKSEQEERLRVMKTLMSWNTCPVPKVTGGKGIVSTVRPPN
FT                   CKPVYEGSLLSYSDSSVASMTLPALIPPFMNVTRNVRTPSIDTSPQVKSLMTVLEEEKD
FT                   VMTAVLTAALQEKEQLLLRSNTNPSKLPAIQRAQSIMGGHM"
FT                   /protein_id="XP_822635.1"
FT   gene            complement(1023986..1026271)
FT                   /db_xref="GeneID:3661764"
FT                   /locus_tag="Tb10.70.3450"
FT   mRNA            complement(<1023986..>1026271)
FT                   /db_xref="GI:71747161"
FT                   /db_xref="GeneID:3661764"
FT                   /locus_tag="Tb10.70.3450"
FT                   /transcript_id="XM_817543.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1023986..1026271)
FT                   /locus_tag="Tb10.70.3450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747162"
FT                   /db_xref="GeneID:3661764"
FT                   /translation="MFWAITGSNVATALEATTRFGEEPAAEAQSSATDRRRTQYATGAP
FT                   TLEPTFRKPRPALPREADNPFYYSEAASNEPLQRLRKITYTTILVPLRVLYITLLIVLY
FT                   WLLEMIIQKRGCHTAAKEVDNLSKVSCLFRYIAGTLPRWSILGLGYLRVNRRNKCNYGR
FT                   RADGSRVVGPVIVANHVTIQDGLLLLFECDASLVTGNLAEANFTSMLLRGRTYNGEDRR
FT                   IVKSLELKHRQKTQEEIDGTEASTNNNPQTEMSADMSDCNETEVREGGEGVVAHVVFPE
FT                   PCCTNGRVMMRFSTDAFATGLPVQPVVLRHSHKYFNTSWCGAASPTSILLGTAAQLFNQ
FT                   VEVIYLPVCEPSKEEKLNPSLYAERVRRAMASTLNVPATWHSEADVHLALVAARLSLPV
FT                   DAVNVETAHPHFAGMPYDRVVRMLYRFSALLQRSDGGPQPQMNITPKGYMSPTALGRFL
FT                   SPIGLYPTLNERLLLHLSRRASVRGCYISFRDFLSALYTEPIIVGSSDSHGASDKTGES
FT                   SVPSNAHMVFIDELRKGEADDEVALDFILRRTFAMMLLAGEDLLRQQEKYRSHIKDTFV
FT                   TVGEVQGAGRENVEAGDANVISCAESPLPTGTCPSSYTTVYGCKVRFLFRPCQNINRCA
FT                   PVAASLAATALSVEERRLGRAEFDALLDMLFVPHHSTLWRGPATKSQVQLAEEDSLFSY
FT                   IRSGATEEWEATVGKKTVQIEEVGRGTNRSGEYITFDAFLRFCFRHRAMAEYFHACCEH
FT                   FLLCDDLA"
FT                   /protein_id="XP_822636.1"
FT   gene            complement(1027135..1029810)
FT                   /db_xref="GeneID:3661765"
FT                   /locus_tag="Tb10.70.3440"
FT   mRNA            complement(<1027135..>1029810)
FT                   /db_xref="GI:71747163"
FT                   /db_xref="GeneID:3661765"
FT                   /locus_tag="Tb10.70.3440"
FT                   /transcript_id="XM_817544.1"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase"
FT   CDS_pept        complement(1027135..1029810)
FT                   /locus_tag="Tb10.70.3440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphatidylinositol-4-phosphate 5-kinase"
FT                   /note="similar to Probable phosphatidylinositol-4-
FT                   phosphate 5-kinase MSS4 (EC 2.7.1.68)(1-
FT                   phosphatidylinositol-4-phosphate kinase) (PIP5K)
FT                   (PtdIns(4)P-5-kinase) (Diphosphoinositide kinase). (Swiss-
FT                   Prot:P38994) (Saccharomyces cerevisiae;)"
FT                   /db_xref="GI:71747164"
FT                   /db_xref="GeneID:3661765"
FT                   /translation="MCPFPPQYPHLTVVKVCYTKALNDISVISPATHPSCSFLPALLRL
FT                   NLGIEIRMLQSDVSGRAPPEEDVQWHVGEVRQPPPFYKLPGSSVTAREIGGQHSSCCCR
FT                   YGGGTHSGNRMWTHSRSVSLPDSCSKMCCSSFTCCGVGATVSRHVSVHTTNANTAPHHE
FT                   NEEALKLRIRVLEGQLRREYQRRRSQEENFQVRLELLKSCLGTAEGAVRHKNDLFGCHR
FT                   CGNNDICNTSEDCHSRDEVLEAEELDGSAPGPIRYGGLAQDTIELLDFCENIETSTAPP
FT                   KIVKGHSVQRDVASPSTSEREGQTPDILFCEEGGVPQGVHMFPSLPSVTCSSADEHEVG
FT                   GSANPIVEDHQLEELREVSVSCYGGEAALNNPENSRVHPYCTSLSFSTPAFGINGVGET
FT                   ENVSDDQKSTSCEAVNPCGSGMLALTTQLLSAGEDVSSSAYSGCSASCSETLCNPNQFG
FT                   NAVDPRGSRNRAWYVHTILRDVFEKLICDHPSLKPVWEKVHKSEATLTDAFLSNPSVLK
FT                   LALSEAMYLNFRCHHNKPLLETFDAPFPRQLPPFSSENTDPGLLEAFSGNSFTWSGQRQ
FT                   MHRTDMARVTVHAPQFFNRMRGILNLNMAELRGALTDRCVWREVPSCGESGKSLIFLGN
FT                   FVLKSLKESEFYLLKESFLLKYIHYCERNCMTTLPHFYALVTFAWVSSESCEHYILTQN
FT                   VFRTPHFIQRIHVAKGARVGLLSKAKSLSASWRTRFGEDVFRDDDPPPRLLTCGKLKRA
FT                   QLLAQFISDTSFLASMNIVGYSCLIGMRMHNSAFTDCGYAEATSCNGEGHATGGGGGSI
FT                   FDFDGGFLSEPLTAPGAEATTPWRYVCYIGLIDVLREYTSGMGLGRLTRGLFGDVQEGN
FT                   EMQPSAYAEWLQGVLCNATM"
FT                   /protein_id="XP_822637.1"
FT   repeat_region   1031410..1031470
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(1031998..1034220)
FT                   /db_xref="GeneID:3661766"
FT                   /locus_tag="Tb10.70.3410"
FT   mRNA            complement(<1031998..>1034220)
FT                   /db_xref="GI:71747165"
FT                   /db_xref="GeneID:3661766"
FT                   /locus_tag="Tb10.70.3410"
FT                   /transcript_id="XM_817545.1"
FT                   /product="protein kinase"
FT   CDS_pept        complement(1031998..1034220)
FT                   /locus_tag="Tb10.70.3410"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein kinase"
FT                   /note="go_function: protein kinase activity [goid 0004672];
FT                   go_function: ATP binding [goid 0005524]; go_process:
FT                   protein amino acid phosphorylation [goid 0006468]"
FT                   /db_xref="GI:71747166"
FT                   /db_xref="GeneID:3661766"
FT                   /translation="MTSTTEFTGSSLLQDEKVVLKDYVASQRLGEGGYASVFLVKYVPS
FT                   GECFAMKIIPNNYLMGSESLIIQEATVMQSLEHPHVVKLYKFLQSTSAFYLIMELAECG
FT                   ELFDLVIAEKYFREATARLYFQQLMSAIDYCHSNGVAHRDLKAENLLLGKDNRLLVCDF
FT                   GFCSKYRTEGEDGDDGSPNETLQPIGTLHYTSPEMVTRTTGSLAVDVFQQDLWCAGIIL
FT                   FFMLTGRLPFSGRDDEETLHLIQMGSFSFTEEEEARLTPGARSLVRGMLALEPTERPSI
FT                   SQILESEWFVVDIKADLFPHRPELKRGAAFLDFSTQHRATEQEEAAIRKAFKKINIDGY
FT                   GDITRDQLRDMLTTLHGKKVSAEGVSELVHLFTGKKDSMFVTFKQFHDAWVIRDLAHSS
FT                   FKHSDDFQLPKIIDTEMDGVERKVVRQVRTAFDCVDELHTGVIDMNQLKRLFERCQTDV
FT                   NDEEIRSLIRFFDEHEVGNRGEITFRMFLKGVVSRDMLVRHPMGRKLAAATNLAALYRY
FT                   CELRESVRRGVFVSGVWDNIVKKLMKHADRLVLIRDVVNMSDVERVYSFCYVGKSAAQT
FT                   TPLTMSATPPAIESEGCFLTPKDLSHNALLGSSFCTSSIPMLPHSTGHAGQYSNVNDAH
FT                   HGNLASSYEESSRWAESLKAGSVSPPQRTIAYGSGPTPKNQVTGTCTIDVLLSSGAFEY
FT                   TLVRFCRISGRTHDFHEAVAYVAKLLEPERLRAMEDTLPRGESVLI"
FT                   /protein_id="XP_822638.1"
FT   repeat_region   1034684..1034707
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1035068..1035126
FT                   /note="A-rich"
FT   repeat_region   1036009..1036048
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(1036198..1037637)
FT                   /db_xref="GeneID:3661767"
FT                   /locus_tag="Tb10.70.3390"
FT   mRNA            complement(<1036198..>1037637)
FT                   /db_xref="GI:71747167"
FT                   /db_xref="GeneID:3661767"
FT                   /locus_tag="Tb10.70.3390"
FT                   /transcript_id="XM_817546.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1036198..1037637)
FT                   /locus_tag="Tb10.70.3390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747168"
FT                   /db_xref="GeneID:3661767"
FT                   /translation="MKRSDDVSGFTSFLMYSPTYALTLDVSIVLSCLLAIACRIKLFAN
FT                   KSACPCTVPSLKKTGNCGTSFVGNYVGHSTVAKDTVSDGRHNSMPEVLQSNDVTMNRSA
FT                   SPSAAKGGCSETHVSESLTDSKPCGHCSDDALGQLFGIPVNAFAATALINYLSLVSNCL
FT                   TQYFRPSQVLYATLMSFCDVLLFAMSDYYGEGTSHCRHDKCVSHSDLCDGWRGLKLRIP
FT                   SVPHELHDLKGIADHKSQRRGGSDPVYPFGVEASSLHLETRGNRWRLMILGFMRSNVDD
FT                   ASKPKHADGGVLSKLRVRWYILPILHTISVAALVILRKYQLLFFLGTAAGYVASCVTLH
FT                   MVGYGLSALLSVLLFPFIGGGYYGTVRLSTNDERVEMLMGFFSLSGAVHVGGVGVYYVL
FT                   QQTFSGVCVVLYVLMLLEEDDALYSTHVSLMRWYVNPCGQGLLDAQKLFTFLLLLGSMN
FT                   RHKQRERLLARYRKNFSSHLL"
FT                   /protein_id="XP_822639.1"
FT   misc_feature    1039108..1039157
FT                   /note="A-rich"
FT   misc_feature    1039162..1039240
FT                   /note="CT-rich"
FT   repeat_region   1040076..1040104
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(1040463..1041929)
FT                   /db_xref="GeneID:3661768"
FT                   /locus_tag="Tb10.70.3380"
FT   mRNA            complement(<1040463..>1041929)
FT                   /db_xref="GI:71747169"
FT                   /db_xref="GeneID:3661768"
FT                   /locus_tag="Tb10.70.3380"
FT                   /transcript_id="XM_817547.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1040463..1041929)
FT                   /locus_tag="Tb10.70.3380"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747170"
FT                   /db_xref="GeneID:3661768"
FT                   /translation="MVGGFTEWAHLRLRDHRPGPMNYDLTVSDAPKRSILGKYPIRQSG
FT                   SGVGPGQYCIPSTIGDCRSTILRPPVAAVPGNADRVSPKRPSRSASKGRAAIRSVSETK
FT                   KYLADAPAFSIYGKLKDITPVNLAGPGDYDFPSTFGAPGKGPTFGKRTKLLTTRDIVPG
FT                   PATYDVPRFGDEKPKGREIITAIERKHKTDTGPGPGSYDDPTTIAARIARTKRFIVDVP
FT                   TFGVRPPTPSVAIHRGPGPAQYGDVSRIMTKTVTRTPIFREPTVRTPKSEAEVVKEEPV
FT                   SDGNLPSDFDYTYSKGVSFGPRSFVLLVPSTSDVVGPGSYDLSKVPHRVRGGRFAQHPY
FT                   DLHAAAKALMKSREVAVTGGGPMYNPNIDAVKPVKSFCIPGFGAAKRFCDQTSTGSNFY
FT                   NIRPLSPGRSTVFYRGDYNKSAYLKGQESSKLMYNVKNGTIAEGVEQGKGVTFGIRYPA
FT                   RATHQVCKPYDETTNINCVYADEMTWLVGR"
FT                   /protein_id="XP_822640.1"
FT   gene            complement(1042187..1042957)
FT                   /db_xref="GeneID:3661769"
FT                   /locus_tag="Tb10.70.3370"
FT   mRNA            complement(<1042187..>1042957)
FT                   /db_xref="GI:71747171"
FT                   /db_xref="GeneID:3661769"
FT                   /locus_tag="Tb10.70.3370"
FT                   /transcript_id="XM_817548.1"
FT                   /product="40S ribosomal protein S3a"
FT   CDS_pept        complement(1042187..1042957)
FT                   /locus_tag="Tb10.70.3370"
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S3a"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71747172"
FT                   /db_xref="GeneID:3661769"
FT                   /translation="MTLGKNKRISKGGKRGKKKAQEAMSRKEWYDVVAPKNFEVRQFAK
FT                   TICNKTQGTKVAADFLRGRVYEGNLADLNKTQNEDDAYRKVKFTVQEVQGRNLLTQFHG
FT                   MDMTSDRVYYLLRKWCTTIEATVEAKTADGYGLRLFLIAFTKKQENQLSKNCYAKTRLV
FT                   KWVRMRATNIIRRRLAKLDINDAVSLLTRNILRDRLAKRCNPIIPLRDLRIRKVKVIRT
FT                   PKFDAQALIAAHGEVPTSAEGEARVVEEAQEETA"
FT                   /protein_id="XP_822641.1"
FT   gene            complement(1043268..1044038)
FT                   /db_xref="GeneID:3662991"
FT                   /locus_tag="Tb10.70.3360"
FT   mRNA            complement(<1043268..>1044038)
FT                   /db_xref="GI:71747173"
FT                   /db_xref="GeneID:3662991"
FT                   /locus_tag="Tb10.70.3360"
FT                   /transcript_id="XM_817549.1"
FT                   /product="40S ribosomal protein S3a"
FT   CDS_pept        complement(1043268..1044038)
FT                   /locus_tag="Tb10.70.3360"
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="40S ribosomal protein S3a"
FT                   /note="go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71747174"
FT                   /db_xref="GeneID:3662991"
FT                   /translation="MTLGKNKRISKGGKRGKKKAQEAMSRKEWYDVVAPKNFEVRQFAK
FT                   TICNKTQGTKIAADFLRGRVYEGNLADLNKTQNEDDAYRKVKFTVQEVQGRNLLTQFHG
FT                   MDMTSDRVYYLLRKWCTTIEATVEAKTADGYGLRLFLIAFTKKQENQLSKNCYAKTRLV
FT                   KWVRMRATNIIRRRLAKLDINDAVSLLTRNILRDRLAKRCNPIIPLRDLRIRKVKVIRT
FT                   PKFDAQALIAAHGEVPTSAEGEARVVEEAQEETA"
FT                   /protein_id="XP_822642.1"
FT   gene            complement(1044413..1045456)
FT                   /db_xref="GeneID:3662992"
FT                   /locus_tag="Tb10.70.3350"
FT   mRNA            complement(<1044413..>1045456)
FT                   /db_xref="GI:71747175"
FT                   /db_xref="GeneID:3662992"
FT                   /locus_tag="Tb10.70.3350"
FT                   /transcript_id="XM_817550.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1044413..1045456)
FT                   /locus_tag="Tb10.70.3350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747176"
FT                   /db_xref="GeneID:3662992"
FT                   /translation="MVQQGNHVALFPTPRLYTADVVGNVYVTTFPASSVGETNKAEPPA
FT                   KRRRVDNQSSGGVDEHPFWEPVVAASTSGAEAYGARGWCGLTPLADDQVVCCREFFFDL
FT                   RLLDARNCGAVIRQYGTLHAPTGMATCGGIFPHGVVVAEGPVASVYDTRCSGAVMTKQT
FT                   EAMSGGQRSVPLVSSRFTDATTRVADVCATCNEFEVAIAVGRAVCVHDIRKWTRVSITT
FT                   SVLKYDIGSIAPFACGKGVVAAGIDAEVRLVLLTEKLNGASSTTGTVVHGEGNCCGGNG
FT                   SKKEVDVDVNGGAAVKSDELTSVTSFRNRIDSVVSCRSTWQGGWVPSVDASCATGISAD
FT                   HEFFMAF"
FT                   /protein_id="XP_822643.1"
FT   repeat_region   1046423..1046444
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   repeat_region   1046510..1046531
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   1047012..1047045
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="t"
FT                   /rpt_type="tandem"
FT   misc_feature    1047405..1047432
FT                   /note="AT_rich"
FT   gene            complement(1047609..1048076)
FT                   /db_xref="GeneID:3662993"
FT                   /locus_tag="Tb10.70.3330"
FT   mRNA            complement(<1047609..>1048076)
FT                   /db_xref="GI:71747177"
FT                   /db_xref="GeneID:3662993"
FT                   /locus_tag="Tb10.70.3330"
FT                   /transcript_id="XM_817551.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1047609..1048076)
FT                   /locus_tag="Tb10.70.3330"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747178"
FT                   /db_xref="GeneID:3662993"
FT                   /translation="MLPLSRGTALKSGKRIVLEEQQQKSNPHESLQDDTSLNAISCDVD
FT                   VIKENEEEEEKKKDEKAKSFRKEPSNESLKFSDYLELNEIPLLFDKLTATLLQERPDAP
FT                   LDFIISWMRLERARVLNGSDGNKNIITATTTYNNNNNNNVDNSNGDPKKCT"
FT                   /protein_id="XP_822644.1"
FT   repeat_region   1047648..1047670
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tta"
FT                   /rpt_type="tandem"
FT   misc_feature    1047901..1047935
FT                   /note="CT-rich"
FT   repeat_region   1048104..1048141
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1048435..1048454
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttg"
FT                   /rpt_type="tandem"
FT   misc_feature    1048557..1048592
FT                   /note="AT_rich"
FT   misc_feature    1049239..1049262
FT                   /note="AT_rich"
FT   misc_feature    1049434..1049473
FT                   /note="CT-rich"
FT   repeat_region   1049506..1049530
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="cca"
FT                   /rpt_type="tandem"
FT   gene            complement(1049836..1051386)
FT                   /db_xref="GeneID:3662456"
FT                   /locus_tag="Tb10.70.3320"
FT   mRNA            complement(<1049836..>1051386)
FT                   /db_xref="GI:71747179"
FT                   /db_xref="GeneID:3662456"
FT                   /locus_tag="Tb10.70.3320"
FT                   /transcript_id="XM_817552.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1049836..1051386)
FT                   /locus_tag="Tb10.70.3320"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747180"
FT                   /db_xref="GeneID:3662456"
FT                   /translation="MVGASSKRPREHETAVEPILAGSFSGGNVSKKSFNGTVVAETDNK
FT                   SLGVTATLLRDVDFNSQSSMKRSVSNNSNMVGSQNDDSNDECEGEVCELFKSPAQLGGK
FT                   LQVGVDSRPDVPVSNGQKTLLHAECTNSTASVDGAITTLHTLQQLKELFHTPPVQLEAQ
FT                   AKAPLLQLCAGETVFVVLHSNKEEIEGMLGNVTKKLSACRIFCLDLSALPLAERSGAGA
FT                   QITPNSASVDRVGDVILQRVTKILDLNSLLNGTPSAEGPSQSLSIKHSSAGAQVEFENV
FT                   ASSAQSSAKDEICHHELTLPSMVMWRVAGGPVDEYGDITAMGSYEAIQSEVGSVPPYGK
FT                   PLVVKELQTVDQLHSLSLLAPVYTVEHLLRKIGETVLFPPGNDTPSGTHTFIYMGASWC
FT                   PPCMRVVASLPTMMKEGFPHSFACVVKADMDFAEPLYKFFGVEIIPTFILLNNDVLKGA
FT                   GDWSAFLKGSGKCMGTCLEQLREGLRRSKMGQIQNSKVPLIQSFIDNHTKGLSFDEEF"
FT                   /protein_id="XP_822645.1"
FT   repeat_region   1051563..1051648
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1051829..1051850
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   repeat_region   1052041..1052077
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1052179..1052220
FT                   /note="AT_rich"
FT   repeat_region   1052372..1052419
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1052814..1052862
FT                   /note="A-rich"
FT   misc_feature    1053027..1053206
FT                   /note="T-rich"
FT   gene            complement(1053247..1053810)
FT                   /db_xref="GeneID:3662457"
FT                   /locus_tag="Tb10.70.3310"
FT   mRNA            complement(<1053247..>1053810)
FT                   /db_xref="GI:71747181"
FT                   /db_xref="GeneID:3662457"
FT                   /locus_tag="Tb10.70.3310"
FT                   /transcript_id="XM_817553.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1053247..1053810)
FT                   /locus_tag="Tb10.70.3310"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747182"
FT                   /db_xref="GeneID:3662457"
FT                   /translation="MKRWRRRRKKKGKKKLFFFFFLFVCVYVSVYMCVCVFFFLKRGKK
FT                   KKRKKKTYKKEENNNKRRRNIRERERERKEKKEGNNEARKKKEGKKKKKEKGTRNHTNM
FT                   QRKKKETVTEMKYDNKNKNKNKKSKEKKRIRKYTGPPVLPLCFFMCLFLFSFLFFSFFL
FT                   FFLVCVCFLFFFFFAFYFYEGRRE"
FT                   /protein_id="XP_822646.1"
FT   misc_feature    1053267..1053361
FT                   /note="A-rich"
FT   misc_feature    1053404..1053497
FT                   /note="T-rich"
FT   misc_feature    1053525..1053690
FT                   /note="CT-rich"
FT   repeat_region   1053704..1053742
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   repeat_region   1053861..1053918
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   misc_feature    1053987..1054043
FT                   /note="T-rich"
FT   misc_feature    1054282..1054376
FT                   /note="T-rich"
FT   misc_feature    1054458..1054601
FT                   /note="T-rich"
FT   misc_feature    1054726..1054763
FT                   /note="AT_rich"
FT   repeat_region   1054771..1054795
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tccc"
FT                   /rpt_type="tandem"
FT   repeat_region   1055201..1055253
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ta"
FT                   /rpt_type="tandem"
FT   gene            complement(1055378..1056598)
FT                   /db_xref="GeneID:3663052"
FT                   /locus_tag="Tb10.70.3290"
FT   mRNA            complement(<1055378..>1056598)
FT                   /db_xref="GI:71747183"
FT                   /db_xref="GeneID:3663052"
FT                   /locus_tag="Tb10.70.3290"
FT                   /transcript_id="XM_817554.1"
FT                   /product="ATP-dependent DEAD-box RNA helicase"
FT   CDS_pept        complement(1055378..1056598)
FT                   /locus_tag="Tb10.70.3290"
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DEAD-box RNA helicase"
FT                   /note="go_function: ATP binding [goid 0005524];
FT                   go_function: ATP-dependent helicase activity [goid
FT                   0008026]; go_process: nucleobase, nucleoside, nucleotide
FT                   and nucleic acid metabolism [goid 0006139]"
FT                   /db_xref="GI:71747184"
FT                   /db_xref="GeneID:3663052"
FT                   /translation="MVTDDDWREGLKAPTKDVRKKTEDVESRRNVTFEEYGLRRELQMG
FT                   IFEKGFERPSPVQEEAIPVALQGKDVLARAKNGTGKTASFVIPVLEKVDTQLPHIQALL
FT                   MVPTRELALQTAQVTKELGKHITGLEVMVTTGGTTLRDDILRLQSVVHVLVATPGRAVD
FT                   LASKGTAKLDHCRIIVLDEADKLLSQEFTSLMRDLYGFLPKGRQSLLFSATFPVTVKDF
FT                   ADKYLRNPYEINLMEELTLRGVTQYYAFVEERQKIHCLNTLFNRLQINQSIIFCNSVNR
FT                   VELLAKKITQLGYSCYYIHARMQQQHRNRVFHDFREGHCRNLVCSDLITRGIDIQAVNV
FT                   VINFDFPKYAETYLHRIGRSGRFGHLGLAINFVTYEDRHNVYRIEQELDTEIKPIPAEV
FT                   DPELYTA"
FT                   /protein_id="XP_822647.1"
FT   gene            complement(1057208..1058041)
FT                   /db_xref="GeneID:3663053"
FT                   /locus_tag="Tb10.70.3280"
FT   mRNA            complement(<1057208..>1058041)
FT                   /db_xref="GI:71747185"
FT                   /db_xref="GeneID:3663053"
FT                   /locus_tag="Tb10.70.3280"
FT                   /transcript_id="XM_817555.1"
FT                   /product="methylglutaconyl-CoA hydratase mitochondrial
FT                   precursor"
FT   CDS_pept        complement(1057208..1058041)
FT                   /locus_tag="Tb10.70.3280"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylglutaconyl-CoA hydratase mitochondrial
FT                   precursor"
FT                   /note="similar to Methylglutaconyl-CoA hydratase,
FT                   mitochondrial precursor (EC 4.1.2.18)(AU-specific RNA-
FT                   binding enoyl-CoA hydratase) (AU-binding enoyl-
FT                   CoAhydratase) (muAUH). (Swiss-Prot:Q9JLZ3) (Mus musculus);
FT                   go_component: mitochondrion [goid 0005739]; go_function:
FT                   catalytic activity [goid 0003824]; go_process: metabolism
FT                   [goid 0008152]"
FT                   /db_xref="GI:71747186"
FT                   /db_xref="GeneID:3663053"
FT                   /translation="MRRCPVLLAGAVAQVVRDGECSLTRVGEHIGLIGLNRPARKNAIG
FT                   RQLLSELKECICYCRNPENLIRCVIVESRVDGVFCAGADLKERRGMTLVESRAYVEEQR
FT                   DTLTALEDLSQPTISAIEGAALGGGCELALCTDIRIAGAGARFGLPETGLAIIPGAGGT
FT                   YRAPLVMGLSNALQLILTADVVPAERAQRLGLVTELVPAGGASEAALAVAGRIARNGPV
FT                   AVAAAKAAVRGGFGRPRDEALDGELRLSQSLMETQDRMEGLQAFAEKRPPRYVGK"
FT                   /protein_id="XP_822648.1"
FT   gene            complement(1058549..1060597)
FT                   /db_xref="GeneID:3663054"
FT                   /locus_tag="Tb10.70.3270"
FT   mRNA            complement(<1058549..>1060597)
FT                   /db_xref="GI:71747187"
FT                   /db_xref="GeneID:3663054"
FT                   /locus_tag="Tb10.70.3270"
FT                   /transcript_id="XM_817556.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1058549..1060597)
FT                   /locus_tag="Tb10.70.3270"
FT                   /gene_family="HOG000260578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.3270 by DGPI
FT                   v2.04 with cleavage site probability 0.702 near 653"
FT                   /db_xref="GI:71747188"
FT                   /db_xref="GeneID:3663054"
FT                   /translation="MSSALQAARSCANTILWQSLRIDAFQGATPHVLLVVDHTPCTLQK
FT                   VLLEGYIQELNRFNGEAPEAPNVVGPLRVGLHSSAKTPCFSKGFKSNWRVTYGVLPFKA
FT                   DRFLDDVRTLQAFLRLCGHPSDKASSESVTGDADGSVKAREKMRQMFDSLSWLLTPEER
FT                   GEMEWEDPLFERLCNGSDRELLGCILIQRNAFQNELDKYRLRLDLFNMGLRVAEHNHLE
FT                   IMSASADDVLASKCDGDSISDDTNCCLDNDELVHYMRSCSFKPDVAEAIGRAIADSIDV
FT                   WSWSRKISRKEENGEGNDCRPLQVVPPASFQSALSNEGLWSLYSSGVLTWKGRALDGEG
FT                   DGGTDGSVVPETSFITGPGAPLRIICCTGQVLTYDGGMEDCLLNTGYYAAAHASERNMV
FT                   QNHRLRFAVHHAEPSNQGENAATAGAEEAAAATLLPMDGVGDTGRHGRLKKKEYLAMLK
FT                   LKGAKDSTKCGLSHSCEEDVVRASGTDGSNVAGACVGSSIGGTFPVGEVISESFDLSKL
FT                   NGTCDVFAYPSLSKAVTMAQPKPATLTIVKGVVTDISPDAPDELVELIELVRQTEGSCY
FT                   VRELGIGLSPYLGRDRVVSDVTAFERQFGVHLSLGQRHPLFVKQSSKRNADGSVAVSVD
FT                   GPVLKRRAGKYHIDVFLDAARLEMGDFTVDFTKGLVSSSAAPAAFAG"
FT                   /protein_id="XP_822649.1"
FT   gene            complement(1060914..1061543)
FT                   /db_xref="GeneID:3663055"
FT                   /locus_tag="Tb10.70.3260"
FT   mRNA            complement(<1060914..>1061543)
FT                   /db_xref="GI:71747189"
FT                   /db_xref="GeneID:3663055"
FT                   /locus_tag="Tb10.70.3260"
FT                   /transcript_id="XM_817557.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1060914..1061543)
FT                   /locus_tag="Tb10.70.3260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747190"
FT                   /db_xref="GeneID:3663055"
FT                   /translation="MGWGRKMQGGSVTCHVQDGAAFLQDVVGSSTGTGESNSTFDELVS
FT                   SRTHSGTSVSFKGGDYPTNGNQHKPLSRYQVQPATCYDVLFVDLFVGSDPPAFMSSLIF
FT                   LQLCREALSSIGVAAFNLPKSDPDFVQMCQRVFGSQNVYQVPVPASANIVVLARCAAGA
FT                   GVGHTIYEERSHVAHRHFYRRAQQLQKSHGLPYDLSSHYPIWWRLW"
FT                   /protein_id="XP_822650.1"
FT   gene            complement(1061600..1062463)
FT                   /db_xref="GeneID:3663056"
FT                   /locus_tag="Tb10.70.3250"
FT   mRNA            complement(<1061600..>1062463)
FT                   /db_xref="GI:71747191"
FT                   /db_xref="GeneID:3663056"
FT                   /locus_tag="Tb10.70.3250"
FT                   /transcript_id="XM_817558.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1061600..1062463)
FT                   /locus_tag="Tb10.70.3250"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747192"
FT                   /db_xref="GeneID:3663056"
FT                   /translation="MPYFFKPLGARAWGFIAASVGGTFAIGIFREIALLRQREIPLFNE
FT                   ADVVHSEEHARYPCKTFLGYDVVVTNHYVREKGRGEQSLLPRGSDAENGNCGRSDRGGV
FT                   MKKLFACFSNETYTTAGHSDSVSEVNELYLVREVVGDAHAPRGDVSTRSVKGFNGDDDD
FT                   AVEDTVGNRVGSSMFIASSSWPPGTVKYTSMTIETSHNEVRNDSDALLRRWSNRVTQQS
FT                   LVRCDPLAPASMNCLADASYLGAPYLRIMLSALLLLPSPLPRLRVAVLGVGGGFSPSFI
FT                   AAAFLT"
FT                   /protein_id="XP_822651.1"
FT   gene            complement(1062896..1063942)
FT                   /db_xref="GeneID:3663057"
FT                   /locus_tag="Tb10.70.3240"
FT   mRNA            complement(<1062896..>1063942)
FT                   /db_xref="GI:71747193"
FT                   /db_xref="GeneID:3663057"
FT                   /locus_tag="Tb10.70.3240"
FT                   /transcript_id="XM_817559.1"
FT                   /product="short-chain dehydrogenase"
FT   CDS_pept        complement(1062896..1063942)
FT                   /locus_tag="Tb10.70.3240"
FT                   /gene_family="HOG000260576" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase"
FT                   /note="go_function: oxidoreductase activity [goid 0016491];
FT                   go_process: metabolism [goid 0008152]"
FT                   /db_xref="GI:71747194"
FT                   /db_xref="GeneID:3663057"
FT                   /translation="MGVIFLVCALLIALVFAAAWWSVHRVPFFHIKGCCALVTGGSLGI
FT                   GLETAKQLVKLGARVVIIAARNEQSLRAGVEALRVEAKVTGTKVEYVVMDVADEVSVEQ
FT                   AMDKVSKDVTAAGGKCLDLLVCNAGFSIPARFVDITPAEARRMMDVNFFGCVNVLRMVL
FT                   PSMLEQRAGRVVFVSSLAARCPLAGYSVYAASKAAIRAFAHSMDMENSCRGVRFQVISP
FT                   PDVYTPGFEQENIRKSPECTALSSFGGDEPVTALDMAKQIVDSIKHYRFDVSLGVDKQL
FT                   LCWMVAGVEPATDVLELLLQVLLNGWLRLAMAVLSKLHYNIVWRVRKDDEKPNETSTKE
FT                   SERGKKVM"
FT                   /protein_id="XP_822652.1"
FT   repeat_region   1064446..1064495
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="tttcg"
FT                   /rpt_type="tandem"
FT   repeat_region   1064496..1064528
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttttc"
FT                   /rpt_type="tandem"
FT   misc_feature    1064677..1064719
FT                   /note="GA-rich"
FT   misc_feature    1064957..1065021
FT                   /note="T-rich"
FT   misc_feature    1065436..1065457
FT                   /note="AT_rich"
FT   misc_feature    1065683..1065709
FT                   /note="AT_rich"
FT   misc_feature    1066128..1066198
FT                   /note="T-rich"
FT   misc_feature    1066448..1066468
FT                   /note="AT_rich"
FT   misc_feature    1067041..1067091
FT                   /note="A-rich"
FT   misc_feature    1067495..1067518
FT                   /note="AT_rich"
FT   misc_feature    1068124..1068147
FT                   /note="AT_rich"
FT   gene            complement(1068220..1069893)
FT                   /db_xref="GeneID:3662699"
FT                   /locus_tag="Tb10.70.3220"
FT   mRNA            complement(<1068220..>1069893)
FT                   /db_xref="GI:71747195"
FT                   /db_xref="GeneID:3662699"
FT                   /locus_tag="Tb10.70.3220"
FT                   /transcript_id="XM_817560.1"
FT                   /product="serine palmitoyltransferase"
FT   CDS_pept        complement(1068220..1069893)
FT                   /locus_tag="Tb10.70.3220"
FT                   /gene_family="HOG000206826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine palmitoyltransferase"
FT                   /EC_number="2.3.1.50"
FT                   /note="similar to Serine palmitoyltransferase 2 (EC
FT                   2.3.1.50) (Long chain basebiosynthesis protein 2) (LCB 2)
FT                   (Serine-palmitoyl-CoA transferase 2)(SPT 2). (Swiss-
FT                   Prot:O15270) (Homo sapiens); go_function: serine
FT                   C-palmitoyltransferase activity [goid 0004758]; go_process:
FT                   biosynthesis [goid 0009058]"
FT                   /db_xref="GI:71747196"
FT                   /db_xref="GeneID:3662699"
FT                   /translation="MPTYVEAENFLDAPRGAVVANKAVTEAESCDEAYNKQGSVRASFA
FT                   ANGATDTICQKESVGTHTQPKRVTHQEEEHKSIPFISVVMTYFTFLLLFTFGCIAELRR
FT                   KLFGAKRKQREGYASLLTFLEYFWQNHFYRRARDCFNHAIDSRPSRVIGVMERVSTDSN
FT                   RTFSFTGNIKPCVNLSSYNYLGFADDIPHITREVLNSLDRYGLASCSAAQHAGQHGPVS
FT                   KLERAIADFLKKEDAVVCGMGFGTNFRGLPALFGEDTLVVSDSLNHSSLVNGIRLSGAR
FT                   AKVFKNADMNSLEKVLREAVVLGQNPKGAYVPWTRIVIVVEGVYSMEGEFVNLPRVVEL
FT                   KKKYGALLFVDEAHSIGATGRTGRGVTEHFGVDPRDVDILMGTFTKSFGAIGGYLAGDQ
FT                   SVIDHIRTHSSLALHCDTLSPPCAQQALSVLDVLNGNDGTDIGPKHIQQLMENSRFFRQ
FT                   GLIDRGFSVLGNDASPVVPVMLYHLGRAIAVWRKCMRRGLAIVIVGYPATPLLGCRIRF
FT                   CVSAAHTRADLQFALDVMDQIKKETNIQFLPSTVPPQGEE"
FT                   /protein_id="XP_822653.1"
FT   gene            complement(1070512..1071618)
FT                   /db_xref="GeneID:3662700"
FT                   /locus_tag="Tb10.70.3210"
FT   mRNA            complement(<1070512..>1071618)
FT                   /db_xref="GI:71747197"
FT                   /db_xref="GeneID:3662700"
FT                   /locus_tag="Tb10.70.3210"
FT                   /transcript_id="XM_817561.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1070512..1071618)
FT                   /locus_tag="Tb10.70.3210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747198"
FT                   /db_xref="GeneID:3662700"
FT                   /translation="MQQVGEPFPSEELRGSNDYQGCKWYRTEGVHSSMDSNIVSTGAAC
FT                   EYSGPCVLRSFRTAPAISWESFQVIRKGKVVLGGAHEGAIAEDLAKLSNIYNKTDGPTS
FT                   TNTNSNNPSGARGNDINLPVKSIGKFLEDQLPGLCDKRGDSLYRGATFLLLGVLTGNIA
FT                   LAERCLEWGANPNEMSFLSEPFATLDQMRHGYSPMFVAIITGNIAMMNLLHSAGGSLIV
FT                   YDRWGRTPLHAALALADREVIQWLVEKGAPRCLGNTAPVLQGVTMCPDLSPVNLALNPR
FT                   PKLSIGHQVGLPGNDEAKIVDMKEGDTEKAALCHCWSGLPKGYCGCIDDMFLRWSYDRL
FT                   HSRWQPGITFTETSAAHPSKASKRPKAA"
FT                   /protein_id="XP_822654.1"
FT   gene            complement(1072101..1073093)
FT                   /db_xref="GeneID:3662701"
FT                   /locus_tag="Tb10.70.3200"
FT   mRNA            complement(<1072101..>1073093)
FT                   /db_xref="GI:71747199"
FT                   /db_xref="GeneID:3662701"
FT                   /locus_tag="Tb10.70.3200"
FT                   /transcript_id="XM_817562.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1072101..1073093)
FT                   /locus_tag="Tb10.70.3200"
FT                   /gene_family="HOG000260574" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747200"
FT                   /db_xref="GeneID:3662701"
FT                   /translation="MDVRDQLMQAAAQTVDALSFTQTHVIDEDFRAHNRATIESVRSLQ
FT                   REQRSRIEQTYGPQSPSADVLALQLLSSYRGEITFLDHSRGRDGRTSPSAAAGVVTSLT
FT                   HGQCLSFKKEMKQRIHEWERVFCEERGVAVTTRDKAMLRQVYELYKLAKNRLRGEESPT
FT                   NGGGEDNNNLTNSQSQTQQPQGARSSSERANSAGTVTSGVRVRTPSPSGSQVDNPARRV
FT                   VGSTTQPSGLQRQVVRSSTSSGLSANEGPGSTQPTIGSGIRVSQMSNEELAAEKRYLKR
FT                   ILHRFESDFEQRNGFAPTRNDRQAHSYEYIRYGELKNEIIRRMPSVAGG"
FT                   /protein_id="XP_822655.1"
FT   gene            complement(1073686..1077237)
FT                   /db_xref="GeneID:3662702"
FT                   /locus_tag="Tb10.70.3190"
FT   mRNA            complement(<1073686..>1077237)
FT                   /db_xref="GI:71747201"
FT                   /db_xref="GeneID:3662702"
FT                   /locus_tag="Tb10.70.3190"
FT                   /transcript_id="XM_817563.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1073686..1077237)
FT                   /locus_tag="Tb10.70.3190"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747202"
FT                   /db_xref="GeneID:3662702"
FT                   /translation="MRRFAPTVASALSGPPTGCLFAVTGNAVRRYQTEPLKKAAPAAPE
FT                   LQKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAPAAP
FT                   ELQKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAPAA
FT                   PELQKAAPVNFMTSTRRSRGRFTGDDRASGLDEERGRLQRSGGAKEGRNSRREVGYSKK
FT                   EKIRSRGDTYKGNRDMSLSNVVEDIQDIKIVFASHNPSPSKRQVPFAPKAAPRAPDPPK
FT                   APLAPPAAPSMPSDFVASSKPVSGSRNGTRTTIAPPTASGDPQDTVWAKSSALSLDEEI
FT                   ERARATRPLVRSPVIVGREIEGLSLNFEHCEKSEPIVELADKGGLKELSEKEATLIDNH
FT                   MVPDDFSGGAFMQKHTGVTHDVVGEKELSELSINNTVTAASLETSLYGMEEQQPKESDG
FT                   RSNLSSTVSSCITEHPPLAPWTCGAFTAQSGSALLKLSFDESSQHIVTITLWEPLVSTI
FT                   SAVGALNEAITAIENHSVTMSGPVTHVVLTSLPGIAFFQPKHSPLELSCSERIELIREK
FT                   ERLFLRMAKTPPLNFVAIVNGGSLDDFAAELFLACHYRVFLDATHTTFGFPSCMLGDFP
FT                   TSHAVRQLCRYFGAQRTLAASQQQYRFTAATLLDAGVARHARDTREGLTALRLSYVDHS
FT                   KASPPTSLLLRLENALLALLNRPALRDFVLRRFFLTRSTGGSSVEVYSNPITQAWRRYC
FT                   LAAMASGGCTHNVGESGNASAAVETGTLRSEGIYSEFLFSPSALNAARIYGHGCEIQRR
FT                   VLSSPPDGGYLRFKADEAELWPRKVRALSAESCNQVTVLLDCGKSNIEAIKSLVKDQSG
FT                   VLTKANVVLIGDEYVARPLIPEFNCVATISPVSAYAVSPLRDLQEVRLFGREGCPEHLR
FT                   ASTLSAALAYLQQEYRPYVVCRHSCSGRLIAAFVTEACRIAMHCDIEKVERVSTGVLRL
FT                   LGGPFRLADHLGTSTVSRLIEETSHMNDHRNPLIHDWLPSIGYQVLRSMSNDGFGGIRT
FT                   RRGGFYTYGADGSSVALNTVVQKQYLRRHLTDTELSDRLLSVVVNECCELLLSGHLLTA
FT                   ADANALTIATLGFSETTGGALTLADAMGAGLMLQKMEELAVWHGAHLQPSPLLKCMAHS
FT                   RVSFANLSEAVIQSARM"
FT                   /protein_id="XP_822656.1"
FT   gene            complement(1077869..1078108)
FT                   /db_xref="GeneID:3662703"
FT                   /locus_tag="Tb10.70.3185"
FT   mRNA            complement(<1077869..>1078108)
FT                   /db_xref="GI:71747203"
FT                   /db_xref="GeneID:3662703"
FT                   /locus_tag="Tb10.70.3185"
FT                   /transcript_id="XM_817564.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1077869..1078108)
FT                   /locus_tag="Tb10.70.3185"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747204"
FT                   /db_xref="GeneID:3662703"
FT                   /translation="MFLRPIALPLWVLFVTVATFFVLRALDPVDVGAHREKVYGLPPQV
FT                   VWLFPLVPVCVWLCYEAIMLMAPAGSKVALKVYD"
FT                   /protein_id="XP_822657.1"
FT   gene            complement(1078770..1080845)
FT                   /db_xref="GeneID:3662704"
FT                   /locus_tag="Tb10.70.3180"
FT   mRNA            complement(<1078770..>1080845)
FT                   /db_xref="GI:71747205"
FT                   /db_xref="GeneID:3662704"
FT                   /locus_tag="Tb10.70.3180"
FT                   /transcript_id="XM_817565.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1078770..1080845)
FT                   /locus_tag="Tb10.70.3180"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747206"
FT                   /db_xref="GeneID:3662704"
FT                   /translation="MQTPVSITRRVRVAGIDAEDVAVHGELFNTFSKYGVIEEVLFEED
FT                   RDFHSGSVTIQFQRLSSAERLQNDLSSSGRRWIVSYLPPIVHVGEKLLATSLSSLDISL
FT                   LRSLISQDVEDVAIEEKVLQVPHTLSSEAAEIAATSATPAVIGGHVGNRGAAKVKPPSS
FT                   RNEGVVRMFLQALSRVKARTIGKYAAVMSFKDVHSANAYLTNNQATLATNNAVYVTHIG
FT                   PNDELIHALKDILLTRWALKEVKVGSVLRGVVLPQSSEGGVGNTVTSCDVDVGLARKGR
FT                   TIVVRAKTNFTKVFPWDFVEVKLTSLETAREGNFVEADLCATLNAVNCGLSGTGNNSDL
FT                   LHCLARRGGPSSLVSSSSCDVLTKSDAPSSSKKELAGRLFKALQERKAAAEGGSDSSRR
FT                   QRHWSSTAERVHAFPTGIHTLSTISVCILRVDDDGLHARIAAPPHVTTSTIPAASSVEW
FT                   PVFIPSMFVPSEGGSHWREFAVPGERMSVAVLYATSIGGSEAALRLVASKRDAEMRRAS
FT                   FTLSHGAFPDEEEQRRRSGQHTNESLLLPGTSFSGTRVVWLPSTPSTDDPVYIVLPAST
FT                   SPPQLFTLSIFMHETCPTSGSTHASAVDAVMSTLVVSEVVHEPCRGYYAVAVEEPTYRQ
FT                   QQEERRTVQSQVESEQEKRVQRILAEALAGCKSGQSNAKAEVLDEVGQKRQRSPGV"
FT                   /protein_id="XP_822658.1"
FT   gene            complement(1081276..1081593)
FT                   /db_xref="GeneID:3662903"
FT                   /locus_tag="Tb10.70.3170"
FT   mRNA            complement(<1081276..>1081593)
FT                   /db_xref="GI:71747207"
FT                   /db_xref="GeneID:3662903"
FT                   /locus_tag="Tb10.70.3170"
FT                   /transcript_id="XM_817566.1"
FT                   /product="60S ribosomal protein L30"
FT   CDS_pept        complement(1081276..1081593)
FT                   /locus_tag="Tb10.70.3170"
FT                   /gene_family="HOG000055224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L30"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71747208"
FT                   /db_xref="GeneID:3662903"
FT                   /translation="MAKKVKSKVDTINTKIQLVMKSGKYVLGTQQSLKTLRQGRSKLVV
FT                   ISANCPPIRKAEIEYYCTLSKTPIHHYSGNNLDLGTACGRHFRACVLSITDVGDSDITS
FT                   A"
FT                   /protein_id="XP_822659.1"
FT   misc_feature    1081796..1081818
FT                   /note="AT_rich"
FT   gene            complement(1081904..1082248)
FT                   /db_xref="GeneID:3662904"
FT                   /locus_tag="Tb10.70.3160"
FT   mRNA            complement(<1081904..>1082248)
FT                   /db_xref="GI:71747209"
FT                   /db_xref="GeneID:3662904"
FT                   /locus_tag="Tb10.70.3160"
FT                   /transcript_id="XM_817567.1"
FT                   /product="60S ribosomal protein L30"
FT   CDS_pept        complement(1081904..1082248)
FT                   /locus_tag="Tb10.70.3160"
FT                   /gene_family="HOG000055224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="60S ribosomal protein L30"
FT                   /note="go_component: intracellular [goid 0005622];
FT                   go_component: ribosome [goid 0005840]; go_function:
FT                   structural constituent of ribosome [goid 0003735];
FT                   go_process: protein biosynthesis [goid 0006412]"
FT                   /db_xref="GI:71747210"
FT                   /db_xref="GeneID:3662904"
FT                   /translation="MAASLSSSTMAKKVKSKVDTINTKIQLVMKSGKYVLGTQQSLKTL
FT                   RQGRSKLVVISANCPPIRKAEIEYYCTLSKTPIHHYSGNNLDLGTACGRHFRACVLSIT
FT                   DVGDSDITSA"
FT                   /protein_id="XP_822660.1"
FT   repeat_region   1082701..1082729
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ttta"
FT                   /rpt_type="tandem"
FT   repeat_region   1083836..1083859
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(1084405..1085202)
FT                   /db_xref="GeneID:3662905"
FT                   /locus_tag="Tb10.70.3150"
FT   mRNA            complement(<1084405..>1085202)
FT                   /db_xref="GI:71747211"
FT                   /db_xref="GeneID:3662905"
FT                   /locus_tag="Tb10.70.3150"
FT                   /transcript_id="XM_817568.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1084405..1085202)
FT                   /locus_tag="Tb10.70.3150"
FT                   /gene_family="HOG000260568" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747212"
FT                   /db_xref="GeneID:3662905"
FT                   /translation="MRSSQFLLSGLRRTAILMTISDEYIPRAFPVKSTTGLAGIAVEPL
FT                   WKPKLLAAASELQAFLTSSDIPPESTYYNIAMTLVKRVNHGIKECQDDWCTLEKRYFWG
FT                   WPVEYILQVTWRELETAQKWNEWRFWELDPEQVKKVAREDQNIGREGLGYNSPWEQVVR
FT                   EDFDKRKKALTQEEMAELKRMDTERMARETAAYKERKDRIRDDLEKARGDMLKKFLNKR
FT                   FAVDKDLQRMQPGKRYSGKTADDLIAELKSSVENNPQKSDLGK"
FT                   /protein_id="XP_822661.1"
FT   gene            complement(1085850..1086071)
FT                   /db_xref="GeneID:3662906"
FT                   /locus_tag="Tb10.70.3125"
FT   mRNA            complement(<1085850..>1086071)
FT                   /db_xref="GI:71747213"
FT                   /db_xref="GeneID:3662906"
FT                   /locus_tag="Tb10.70.3125"
FT                   /transcript_id="XM_817569.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1085850..1086071)
FT                   /locus_tag="Tb10.70.3125"
FT                   /gene_family="HOG000231410" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="GPI-Anchor Signal predicted for Tb10.70.3125 by DGPI
FT                   v2.04, no cleavage site predicted"
FT                   /db_xref="GI:71747214"
FT                   /db_xref="GeneID:3662906"
FT                   /translation="MSVFFDIEAAAYVLLLIICTATYLRQYSPTLFHRDHTELHRKFLY
FT                   KCSVVGDRLSLWVATGCIVVAVRMLFVY"
FT                   /protein_id="XP_822662.1"
FT   repeat_region   1086167..1086187
FT                   /note="microsatellite"
FT                   /rpt_unit_seq="ca"
FT                   /rpt_type="tandem"
FT   gene            complement(1086417..1086815)
FT                   /db_xref="GeneID:3662907"
FT                   /locus_tag="Tb10.70.3120"
FT   mRNA            complement(<1086417..>1086815)
FT                   /db_xref="GI:71747215"
FT                   /db_xref="GeneID:3662907"
FT                   /locus_tag="Tb10.70.3120"
FT                   /transcript_id="XM_817570.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1086417..1086815)
FT                   /locus_tag="Tb10.70.3120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747216"
FT                   /db_xref="GeneID:3662907"
FT                   /translation="MPRCYNAGFSSPPFFSEQTVLVLSDLKPSTNQPAPADSHSTKIMI
FT                   FSSVSVSNLRCVHGVRCPCGKLVWRLSPSCRSNVIAYLRWGTLVRLCVVCLEPYFFPPF
FT                   DLPVAVFSLSFHLFPGIGFCVMAALLIL"
FT                   /protein_id="XP_822663.1"
FT   gene            complement(1087889..1089052)
FT                   /db_xref="GeneID:3662908"
FT                   /locus_tag="Tb10.70.3100"
FT   mRNA            complement(<1087889..>1089052)
FT                   /db_xref="GI:71747217"
FT                   /db_xref="GeneID:3662908"
FT                   /locus_tag="Tb10.70.3100"
FT                   /transcript_id="XM_817571.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1087889..1089052)
FT                   /locus_tag="Tb10.70.3100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /note="go_function: zinc ion binding [goid 0008270]"
FT                   /db_xref="GI:71747218"
FT                   /db_xref="GeneID:3662908"
FT                   /translation="MSFFRGLNFSNMNDGVDWENAVPPHITAQRNIERAALRNAAPRRA
FT                   MLMDWPLPEDMGAPTVAERRLVQSTASPGSGAPDVRRATRVPELREVRQESERRSLNRS
FT                   HPNSHHTQLRPQTSQQLVRADGNIFSALSGIANEMLQAQLSMVSAFNDFFSEGRSDAMN
FT                   AMGGTASARVLHGNEVTSVTQQRSVQRGPNSGVQVRRVMVAAQSVNGQRPQVAVQVDEW
FT                   SGPPATRTRNNNRSGSDFDIITGVPRRILYISSSDEGTGRGDPRGGNGNGSRGAGGGWE
FT                   IDDFSYENLLRLDDNAEKTGLPEAQLRGLKRTTYNAAKRSGATRRGNANPDNAEKCPVC
FT                   LEQLVDGAEVHEIACGHVSHHSCIIPWLRRSNCCPTCRYEIPRLKKR"
FT                   /protein_id="XP_822664.1"
FT   gene            complement(1089536..1097155)
FT                   /db_xref="GeneID:3662909"
FT                   /locus_tag="Tb10.70.3090"
FT   mRNA            complement(<1089536..>1097155)
FT                   /db_xref="GI:71747219"
FT                   /db_xref="GeneID:3662909"
FT                   /locus_tag="Tb10.70.3090"
FT                   /transcript_id="XM_817572.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1089536..1097155)
FT                   /locus_tag="Tb10.70.3090"
FT                   /gene_family="HOG000260567" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747220"
FT                   /db_xref="GeneID:3662909"
FT                   /translation="MNSSSALTAESPYASYPEVDWSFILSLPIDEWEKVVNPRDLRQFA
FT                   EGVSKVYWNKDDKHFADRQCAVAIMRLLRIMAKVYLDNEDRFQQENGFLQHVVQTVCDT
FT                   DEACRNRVTQLFKENEYFKVAFRHEENQAGVCGMRSPRGVELSGGHGVRHITEKYDKHA
FT                   RELDRLKHENEQLRRTAQFCEGEKASVVQENAKLQLEYKHLVAKHKRVIEKHNSVKEML
FT                   RETRRSEVDRLQDDESELKRLRQKVRELQLENHNLIQLRNRAEELCEQREMEALKDMTE
FT                   LQKLHHEVVDEERNRVQILTDELSRKQRDIDRRATQVVVERQRCPSHLREDDDKRHDMG
FT                   KNLPMSNSSLGFGAMQSGGTAKRSSPSARNSSNLAETGPFRLKANIEERDTQILVADIQ
FT                   RLQQENDRLSVELQQMELRAEAREEEIVRINRLIKNYERGDEGLRRLRCELETSTRTLE
FT                   LLREENSQLRERLNAMTDSLTFSSALQELCIRVGVTQEEIERLRPRSTLYCSEVEMLKA
FT                   EVITLKEEVDWLERERRHWMDRVRLQPLLDTKLRLELGLNPEQLKQLDKIVGQMKVGRV
FT                   IVEEAGEENYKEKYFQELRLRRKEMEHFNDFVKQRMEEVLRELSGKTDFSSSVEAASAL
FT                   QRLRDRVDIIAASRVADENGEGAADTLRLREQLQSALQLLEQSELTIKDNAATQTTLRE
FT                   QLAATTAERDMLLDERDKYRSAFFEGLVFDDTVEDSPQILETKEGAVDNLGPSRIPSSA
FT                   EGAFSPPSFPEGCNCGTPVRSSSLNYLKRTFENQLRKKDELITSLKSTVDVMKDQLSQQ
FT                   HAVHEEMKRKCTEASSQQEDVRNQVAALQEMNRELTEKLNERTNILKDVEGTIQRMESV
FT                   NTRELLQKIVLLRQRETKLLQRLRRVMEMHGEASKSERSMREYVNTVFKSLKEALENTS
FT                   TGFVLPRSSSSVCIENDVIDEMQQRLGGILRGRLFREDSTYLLHLQRVYRNMEHIEELK
FT                   VLRLEVQNQRAHRIVIEEKLEEQRVELECLRRLRDTVSEANEVKDGPVVGGGVISSVTR
FT                   WESEVTTWQQKCNLYMKRCEDKEREVSTIEAQLGDARRELALLHEHIDNSIGSGTGTSG
FT                   SGVPAVCSTPQDQQNGVAKEQRQQQEGAAIGHNRELGGIMSEGSKIYQLEREVARLKSI
FT                   NLGVLHYSLDLQGECKRLEIELEATKQELSLVRDAGNSQRLSDFVSAAIRQHSALRCQS
FT                   ELAVLQLKQARMQLHAMEANLRVAVNEATTYKLNAFRLYRKYVEQTVAVVDYVRSEQRC
FT                   FAGALSPHRTEILHKRLMDAITDNERSQAIRSELAAQLAEARGNAALLQQQLELLKVKD
FT                   GEGRVDALHAKLLASLSAVRDKDVKIVELREDCSFLQQKLKRAETHVQQLTEEISRLEL
FT                   NGTTLTAADGEAFRNLLQLKESVFSKSESPAVVIQQGDFGQRHQHEAVDMAAREYNQVM
FT                   EKQGVLVHECDLLKKQLKEEGIAARKVTAENDALKGEVGRLRERLQNVQQQLHDERQRA
FT                   EERERRVIRSHEAQAEVSHRAAEHHSRCLQDMLKSKDMCIEQLQGQLQAERRKYLECQV
FT                   EESTRMERLHERLFKENSAMVERFREAINGAAEQYEYGAQLPDAGEPASGVSEHVAVLT
FT                   KEVLRLRAELRNARTANIMLESRLSDQVADARRQQQHFPSVSGCPTEVERQHSHRTPQV
FT                   PPSGATPAVDIIDDQSVVIANLRQRELALTDELQRAHTERDLLAQQLYEARNLTVEQGG
FT                   VLKSVVAAKAAKPGVVETELRAQLSFLETQLAEAREKLDEERREARRLQTDTDKWREQL
FT                   DSLREEIIKQQNDVERARRLVAMNERLNADIHHMEEQNEKLIIATNLLKQRLVDEAQER
FT                   DSISRKHQHEMALAQRMGNIQQESSEHLKSVNLRLQSIQKELEEKVRREEETLRKHEEV
FT                   QQLAYELHLQLQEKEHEILRLKRELAAQPSKVSLQGRRSPKRMQASHERGTQVLQTVQE
FT                   NGEGEVLAEVPWKVQQQRREGQELCQRGYLEGRPLEVMKSPREPLLHPALADCTNCSAT
FT                   PVVGSHVIDQSQVAAVARSEVEGAQRDNLNEISSLRALVSRQARDLKDVSEQLRGERDI
FT                   NNTLRSQLLSTRKELETRELGAVRETAILHQSLDERGKRHHRPSGVEKGHFSNPSALVS
FT                   PLLQAAAGSNTQLIQQMEAKIKENEELQRQVEMLKSRLDSLDDAAQQIDFYKKELEELR
FT                   RRQVNTPDCIQPTSPAGVRASKRAVLKLEAVIESLQRELRVENEVRFRSLEQRVAELIA
FT                   ENQRLTVELNRYQVIPTTAVTAPALNVLTSMKPSDQNSLERELLEKNGIILDLRFEREA
FT                   LQLKVSRLERHLDDVLKADSINMRVGGAHKERGRVEALETLVENMKVVVERLQQENSVL
FT                   KSKTVSVAKHMDLVRELRELRSREKQLLEQSEKLSRRLLDSSMGGSAMSEQQARLQKRL
FT                   QAAELTAERYRTEVQELRQRFKDVSSVQEGDTWPYSESQQKDSGDVHGTEDRRCVQPLP
FT                   SLDSDLPPPLPRAPSF"
FT                   /protein_id="XP_822665.1"
FT   misc_feature    1098351..1098404
FT                   /note="GA-rich"
FT   gene            complement(1099257..1100000)
FT                   /db_xref="GeneID:3662881"
FT                   /locus_tag="Tb10.70.3070"
FT   mRNA            complement(<1099257..>1100000)
FT                   /db_xref="GI:71747221"
FT                   /db_xref="GeneID:3662881"
FT                   /locus_tag="Tb10.70.3070"
FT                   /transcript_id="XM_817573.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1099257..1100000)
FT                   /locus_tag="Tb10.70.3070"
FT                   /gene_family="HOG000260566" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747222"
FT                   /db_xref="GeneID:3662881"
FT                   /translation="MSTVPRQRIRGASFKQEYQCAALRRTRQRAPSMNQEMNSRWVLPD
FT                   QDPRYNGKLTLALDLDETLVYAREGPLYARPGLDEFFQLCKEKCVEVVVWTAGLRAYAQ
FT                   AIIRNIDKDRVVSHCIYRHSKWFTGCAGYQKDLAVLGRPLEMVLIIENTPDCIRGHQQN
FT                   GILVEDYEGGESADNTIHALQELVRRLCDSGMTVPQFISSCDMLKHGPIQTDVGDFIDV
FT                   YRLDTSVWKPGEHVRVNRDLASLQC"
FT                   /protein_id="XP_822666.1"
FT   misc_feature    1100181..1100214
FT                   /note="AT_rich"
FT   gene            1103461..1103763
FT                   /db_xref="GeneID:3662882"
FT                   /locus_tag="Tb10.70.3060"
FT   mRNA            <1103461..>1103763
FT                   /db_xref="GI:71747223"
FT                   /db_xref="GeneID:3662882"
FT                   /locus_tag="Tb10.70.3060"
FT                   /transcript_id="XM_817574.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        1103461..1103763
FT                   /locus_tag="Tb10.70.3060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747224"
FT                   /db_xref="GeneID:3662882"
FT                   /translation="MRENGGVLHRCVGTKGHGACSVTEATETTPERYGVLPRFPPLFFH
FT                   IKTPVAETPAGPRSQKSLPFLLGTKHKETVSGVKFRSTESEMSGKKRTHRSPTVV"
FT                   /protein_id="XP_822667.1"
FT   gene            1104475..1107069
FT                   /db_xref="GeneID:3662883"
FT                   /locus_tag="Tb10.70.3050"
FT   mRNA            <1104475..>1107069
FT                   /db_xref="GI:71747225"
FT                   /db_xref="GeneID:3662883"
FT                   /locus_tag="Tb10.70.3050"
FT                   /transcript_id="XM_817575.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        1104475..1107069
FT                   /locus_tag="Tb10.70.3050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747226"
FT                   /db_xref="GeneID:3662883"
FT                   /translation="MSSKQERIADAMKERVTQLERELRECQQQLQEALQRGDDIQCAKE
FT                   ALQCEAHDIVDQWSRKTAELQTKLNECLCELSEARRLIALSEDRNTGLQNQLQQLEAHH
FT                   LSQFQELEKYETQNKELSEKLAATERSLCFASQQVGAMEGRVNEMVAEIEQKSEQITSL
FT                   SRKEDMLAEALLELQKSRKQAETIYNEGRERVSLLDDELSRAKRLLARTRDALLLTEQE
FT                   VFCRCKIIADEANTMVGALFNQLLSAIHSNESYGEALKEAQHNSASLAEENGLLLLKLQ
FT                   EAEQDLSKLRVEQGQETATCREQIRLLELDVRELQDARINWSRELEAVQNELGRSETNR
FT                   HTLEESKMSLNAELKIVKDCYSTLLVEHDELKISVQIMRRESEAEISRLVTEKASAMNS
FT                   YEMKLQEVCMRNTTLNQILKFKEHEMLCHRESNGRQSILVENYHELVGLTQLYISKCEF
FT                   IHSRMYNQVLDSREKIASLTQTISEKQLENSKLVSIARDLEEKVTSAQNDAKMFRSKVV
FT                   ELSTALNSNREEADNLVSENKWLSDQVFGMREELRDIDVLFNCTLNDMREQGENQQRER
FT                   EMLSEEVNRYEKLLQKSQQKISRCEERCSVFAAEKAAMLKTLTLAEEELLTAKSECSRA
FT                   REREQFSLKEKGILEKELSQMRRDYVSSTNQVKALMEELRTHDVKQQLMNSSSRTEVEA
FT                   TKTKLNTYIELYENANVQVAQLTKSLQESRDAYDNLHESHQKAKVALEDAKQRCCHDAQ
FT                   EIQKALEERQRIASERDTLVEKYNKVHDVLKLIKKENSGTMAEEVRKLSDLCSQQEAEL
FT                   QELRHQNVILKRGIVKVADETHNPVERGKFVERLNLAEGPLRRPKKRPATDS"
FT                   /protein_id="XP_822668.1"
FT   gene            1107428..1108411
FT                   /db_xref="GeneID:3662884"
FT                   /locus_tag="Tb10.70.3040"
FT   mRNA            <1107428..>1108411
FT                   /db_xref="GI:71747227"
FT                   /db_xref="GeneID:3662884"
FT                   /locus_tag="Tb10.70.3040"
FT                   /transcript_id="XM_817576.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        1107428..1108411
FT                   /locus_tag="Tb10.70.3040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747228"
FT                   /db_xref="GeneID:3662884"
FT                   /translation="MESRCLSSATYTQKCVELDRLIRNHLIQCHIVIKALKTRLHDAEE
FT                   DVKRLKHDRCLLMTKLTEEKSKCETLKSVHADLEKVSANEFHRQQKAIQERERELQVRT
FT                   KHLDVRAKECERWAHHLKGMEDKLFAQQIRLESIKASLEGDMELVHRWVEGGYGRTENL
FT                   GRESRHFLERSNSQALCTRHCRCDAEAAFCNERECFYLEKEETLQRLSIMQQELFFVNK
FT                   IISSRVSHVLLVEENLMGVQTWINRKDFRDSVPIRTKGEGPVYSKLTEGQLTNSKGWMT
FT                   GGQYVEYPNASESVNSLEVGLSLKAEESHLDRLKQFEKLLTMSLEE"
FT                   /protein_id="XP_822669.1"
FT   gene            1108864..1109793
FT                   /db_xref="GeneID:3662885"
FT                   /locus_tag="Tb10.70.3030"
FT   mRNA            <1108864..>1109793
FT                   /db_xref="GI:71747229"
FT                   /db_xref="GeneID:3662885"
FT                   /locus_tag="Tb10.70.3030"
FT                   /transcript_id="XM_817577.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        1108864..1109793
FT                   /locus_tag="Tb10.70.3030"
FT                   /gene_family="HOG000260563" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747230"
FT                   /db_xref="GeneID:3662885"
FT                   /translation="MSYRRKVSSIIQLSTLRQLQLMCNAEAMSLPFQVHNAQALLEQLK
FT                   VYHPAKYEQFSKNPTTQEFVPSRVISNADGGSVTKGAPIFTLPLPKHFINPTDSAEDII
FT                   PRTFYHSSVARVVADPDAECYLPRCGLTGLFFSREEVVDNLQAAAAELHFRSPFWIRTD
FT                   HPALGDFLTLKDDSEAICISLTAAVISIEDVEPFPVDLLHPKLKQALALGKHAFSEQIP
FT                   PGMNALSGFVTKNPFVQSLPNGGVWLSHKQVLQQSFQIKKKSSAGESPFVLAEIEQWEL
FT                   HNADQLSVPGRLALNHNANNSKRTSVFT"
FT                   /protein_id="XP_822670.1"
FT   gene            1110070..1110933
FT                   /db_xref="GeneID:3662886"
FT                   /locus_tag="Tb10.70.3020"
FT   mRNA            <1110070..>1110933
FT                   /db_xref="GI:71747231"
FT                   /db_xref="GeneID:3662886"
FT                   /locus_tag="Tb10.70.3020"
FT                   /transcript_id="XM_817578.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        1110070..1110933
FT                   /locus_tag="Tb10.70.3020"
FT                   /gene_family="HOG000260562" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747232"
FT                   /db_xref="GeneID:3662886"
FT                   /translation="MDSCIVDGALGYMASVTTTIILFPYRDYVKAFDARAVRRVDPGSF
FT                   CAARYRGMLFQPSQPLLIALPSGLLYTGFLLGNGSVSGAFCGGALHGLGKVGVRTLAYR
FT                   WNLSHRPKEVSYKSVLKCLQQSVKHYGVLSFFSGASATIVISTAWHSTTLVALQRCGER
FT                   GFFESWWDAFRTHSFLTFVTSPLRNTFRSALFSRERSSGIHNASTFLAGEAAILKEAKG
FT                   VFSNMLRTEGVRFFVGGVLRSTFKTSLPFGLTFATFSLIGGSLPRGGEGRGNDHRRHHV
FT                   PHRRFI"
FT                   /protein_id="XP_822671.1"
FT   gene            1111159..1111521
FT                   /db_xref="GeneID:3662887"
FT                   /locus_tag="Tb10.70.3010"
FT   mRNA            <1111159..>1111521
FT                   /db_xref="GI:71747233"
FT                   /db_xref="GeneID:3662887"
FT                   /locus_tag="Tb10.70.3010"
FT                   /transcript_id="XM_817579.1"
FT                   /product="hypothetical protein"
FT   CDS_pept        1111159..1111521
FT                   /locus_tag="Tb10.70.3010"
FT                   /gene_family="HOG000260561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /db_xref="GI:71747234"
FT                   /db_xref="GeneID:3662887"
FT                   /translation="MMRNSRFLLVVCNKAPARPGPMLYGWGRTEQKRRLEYESVESKYH
FT                   KREFNKNWDLAGVEQRYTDFMVVRTYFSIGSRWGTWVYNMLQFYVLAFLPIFAFMHTLH
FT                   KNVEWYDERIRHAAWW"
FT                   /protein_id="XP_822672.1"
FT   gene            1111788..1112348
FT                   /db_xref="GeneID:3662797"
FT                   /locus_tag="Tb10.70.3000"
FT   mRNA            <1111788..>1112348
FT                   /db_xref="GI:71747235"
FT                   /db_xref="GeneID:3662797"
FT                   /locus_tag="Tb10.70.3000"
FT                   /transcript_id="XM_817580.1"
FT