(data stored in ACNUC15465 zone)

EMBL: U19144.PE1

U19144.PE1           Location/Qualifiers
FT   CDS_pept        100..456
FT                   /codon_start=1
FT                   /product="GAGE-3 protein"
FT                   /protein_id="AAA82746.1"
FT                   /translation="MNLSRGKSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEG
FT                   EPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPE
FT                   EVKTPEEGEKQSQC"
     atgaatctca gtagaggaaa atcgacctat tattggccta gaccaaggcg ctatgtacag        60
     cctcctgaag tgattgggcc tatgcggccc gagcagttca gtgatgaagt ggaaccagca       120
     acacctgaag aaggggaacc agcaactcaa cgtcaggatc ctgcagctgc tcaggaggga       180
     gaggatgagg gagcatctgc aggtcaaggg ccgaagcctg aagctgatag ccaggaacag       240
     ggtcacccac agactgggtg tgagtgtgaa gatggtcctg atgggcagga gatggacccg       300
     ccaaatccag aggaggtgaa aacgcctgaa gaaggtgaaa agcaatcaca gtgttaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page