(data stored in ACNUC15465 zone)

EMBL: U19146.PE1

U19146.PE1           Location/Qualifiers
FT   CDS_pept        75..428
FT                   /codon_start=1
FT                   /product="GAGE-5 protein"
FT                   /db_xref="GOA:Q13069"
FT                   /db_xref="H-InvDB:HIT000218497_06.4"
FT                   /db_xref="HGNC:HGNC:4102"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13069"
FT                   /protein_id="AAA82748.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
     atgagttggc gaggaagatc gacctattat tggcctagac caaggcgcta tgtacagcct        60
     cctgaagtga ttgggcctat gcggcccgag cagttcagtg atgaagtgga accagcaaca       120
     cctgaagaag gggaaccagc aactcaacgt caggatcctg cagctgctca ggagggagag       180
     gatgagggag catctgcagg tcaagggccg aagcctgaag ctgatagcca ggaacagggt       240
     cacccacaga ctgggtgtga gtgtgaagat ggtcctgatg ggcaggagat ggacccgcca       300
     aatccagagg aggtgaaaac gcctgaagaa ggtgaaaagc aatcacagtg ttaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page