(data stored in ACNUC7421 zone)

EMBL: U74758.THIL

U74758.THIL          Location/Qualifiers
FT   CDS_pept        169..1146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /product="thiamine monphosphate kinase"
FT                   /function="converts thiamine monophosphate + ATP to
FT                   thiamnie pyrophophate + ADP"
FT                   /db_xref="GOA:P55881"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55881"
FT                   /protein_id="AAB37319.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEPWLEAFS
FT                   DSLFALLNYYDMQLIGGDTTRGPLSMTLGIHGYIPAGRALKRSGAKPGDWIYVTGTPGD
FT                   SAAGLAVLQNRLQVSEETDAHYLIQRHLRPTPRILHGQALRDIASAAIDLSDGLISDLG
FT                   HIVKASGCGARVDVDALPKSDAMMRHVDDGQALRWALSGGEDYELCFTVPELNRGALDV
FT                   AIGQLGVPFTCIGQMSADIEGLNFVRDGMPVTFDWKGYDHFATP"
     atggcatgtg gcgagttttc cctgattgcc cgttattttg accgtgtaag aagctctcgt        60
     cttgatgttg aaaccggtat tggcgacgat tgcgcgctcc tgaatattcc tgaaaagcag       120
     accctggcga tcagtaccga tacgctggtg gcgggcaacc acttcctccc tgatatcgat       180
     cctgccgatc tggcttataa agcgttggcg gtgaatttaa gcgatctggc cgcgatgggg       240
     gccgacccgg cctggttaac gctggcgtta acgctaccgg aagtggatga gccgtggctg       300
     gaggctttta gcgacagcct gtttgcgcta ttgaattact acgatatgca gctcattggc       360
     ggcgacacca cgcgtggacc gctgtcgatg acgctgggta tccacggtta tatcccggca       420
     gggcgcgcgc tcaagcgatc tggcgcgaag ccgggcgact ggatttatgt caccggtacg       480
     ccgggcgaca gcgctgccgg gctggcggtt ttgcaaaacc ggctacaggt gtcggaggag       540
     accgatgctc actatttaat tcaacggcat ttacgtccga cgccgcgtat tttacacggc       600
     caggcgctgc gtgacatcgc cagcgcggct atcgatcttt ccgatggtct gatttccgat       660
     ctggggcata tcgtcaaggc cagcggctgt ggggctagag tggatgttga tgcgttgcca       720
     aaatccgatg cgatgatgcg ccatgttgat gacgggcagg cgctgcgttg ggcgctttcc       780
     ggcggcgaag actatgagct gtgctttacg gtgccggaac tgaaccgtgg cgcgctggat       840
     gtcgccattg gtcaactggg tgttcccttt acctgcatag gccaaatgag cgcagatatt       900
     gaagggctga attttgtacg tgacggaatg cctgtcacct tcgactggaa aggatatgac       960
     cattttgcca cgccataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page