(data stored in ACNUC27125 zone)

EMBL: U75348.PE1

U75348.PE1           Location/Qualifiers
FT   CDS_pept        join(213..375,770..837)
FT                   /codon_start=1
FT                   /transl_table=3
FT                   /product="Fo ATP synthase subunit 9"
FT                   /db_xref="GOA:P92811"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:P92811"
FT                   /protein_id="AAB48406.1"
FT                   /translation="MQLVLAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLKD
FT                   TLFPFAILGFALSEATGLFCLMISFLLLYAV"
     atgcaattag tattagcagc taaatatatt ggagcaggta tctcaacaat tggattatta        60
     ggagcaggta ttggtattgc tatcgtattc tcagccttaa ttcaaggagt atcaagaaac       120
     ccatcattaa aagatacatt attcccattc gcaattttag gattcgcttt atcagaagct       180
     acaggattat tctgtttaat gatttcattc ttattattat acgctgtata a                231
//

If you have problems or comments...

PBIL Back to PBIL home page