(data stored in ACNUC8465 zone)

HOGENOMDNA: USMAY1_5

ID   USMAY1_5; SV 1; linear; genomic DNA; GRV; FUN; 957186 BP.
XX
AC   TPX000007_GR;
XX
DT   23-OCT-2007 (Rel. 80, Created)
DT   30-NOV-2010 (Rel. 127, Last updated, Version 45)
XX
DE   Ustilago maydis (strain 521) chromosome 7, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ustilago maydis (strain 521)
OC   Eukaryota; Fungi; Dikarya; Basidiomycota; Ustilaginomycotina;
OC   Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
XX
RN   [1]
RX   PUBMED; 17080091.
RA   Kaemper J., Kahmann R., Boelker M., Ma L.-J., Brefort T., Saville B.J.,
RA   Banuett F., Kronstad J.W., Gold S.E., Mueller O., Perlin M.H., Woesten H.
RA   A.B., de Vries R., Ruiz-Herrera J., Reynaga-Pena C.G., Snetselaar K.,
RA   McCann M., Perez-Martin J., Feldbruegge M., Basse C.W., Steinberg G.,
RA   Ibeas J.I., Holloman W., Guzman P., Farman M.L., Stajich J.E., Sentandreu
RA   R., Gonzalez-Prieto J.M., Kennell J.C., Molina L., Schirawski J., Mendoza-
RA   Mendoza A., Greilinger D., Muench K., Roessel N., Scherer M., Vranes M.,
RA   Ladendorf O., Vincon V., Fuchs U., Sandrock B., Meng S., Ho E.C.H.,
RA   Cahill M.J., Boyce K.J., Klose J., Klosterman S.J., Deelstra H.J., Ortiz-
RA   Castellanos L., Li W., Sanchez-Alonso P., Schreier P.H., Haeuser-Hahn I.,
RA   Vaupel M., Koopmann E., Friedrich G., Voss H., Schlueter T., Margolis J.,
RA   Platt D., Swimmer C., Gnirke A., Chen F., Vysotskaia V., Mannhaupt G.,
RA   Gueldener U., Muensterkoetter M., Haase D., Oesterheld M., Mewes H.-W.,
RA   Mauceli E.W., DeCaprio D., Wade C.M., Butler J., Young S.K., Jaffe D.B.,
RA   Calvo S.E., Nusbaum C., Galagan J.E., Birren B.W.
RT   "Insights from the genome of the biotrophic fungal plant pathogen
RT   Ustilago maydis.";
RL   Nature 444:97-101(2006).
XX
CC   This Genome Reviews entry was created from data provided by The Munich
CC   Information Center for Protein Sequences.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..957186
FT                   /organism="Ustilago maydis"
FT                   /strain="521"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 7"
FT                   /db_xref="taxon:237631"
FT   CDS_pept        <24..497
FT                   /codon_start=1
FT                   /gene_family="HOG000213081" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12058"
FT                   /product="conserved hypothetical Ustilago-specific protein
FT                   (C-terminal fragment)"
FT                   /db_xref="UniParc:UPI00015952F8"
FT                   /transl_table=1
FT                   /translation="ITLEPREGERHAARYMTYIAWEAKNRRDPQSTTVPASSAPVVAGP
FT                   VIKSASMAPPNEKPLTEQALLIVLFDLGTSTGFKKAQDGSRPQVTPITGQQCPRLCIRG
FT                   LLGPHAYPCLDLFEARSTLVDILSSSSDPAPNPLNIIEKPMWNERIQPESDSI"
FT   CDS_pept        complement(3852..4514)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02816"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP7"
FT                   /transl_table=1
FT                   /translation="MVHDVRSQKQLRLRATGANFDEDEAYRLLYNLVDSYNTSSLKLAF
FT                   LKPHEKDDHRPASSPIGRHQTTLKRKQSVSLAREAGLTGQPLALQRHRDRQHASTSQDS
FT                   QDDEDQDGTGETDDGSSTHTSPAQKRRRMLQMQISDTLVKGVNRLIDLHAATFVHGSQQ
FT                   NHGTSQSSDQEVAAIRSQVSQLRTELTGIKQGLSGLSSKIDMVLRMLMQSEIREPFR"
FT   CDS_pept        complement(5249..5980)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02817"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI00003C1AA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP6"
FT                   /transl_table=1
FT                   /translation="MPLHSGFRFTPLGVVTAYVDIMFIASLSHEEVRRTKAEVAGKWKI
FT                   EDKGPVQEFLEIKSHRDRSQRTFFLNVIGNIRDTARKWLNDPTTKSHIPMPYLIHATDD
FT                   DECSPEHAKMYQQFVGQLLWISNTARPDISFAFGALARHMSRQVNTARTASLYLLKYLN
FT                   QTDDDRHTLRGPDRLHADLPISSSFLLRACMHIGENKCLFFSSHFCNKKINSRLPLITR
FT                   LYPPQQSSRGMCGKTTREKAQ"
FT   CDS_pept        join(complement(8050..8065),complement(7488..7876),
FT                   complement(7344..7453),complement(6232..7315))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02818"
FT                   /product="related to Multidrug resistance-associated
FT                   protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /function="ATPase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003C1AA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP5"
FT                   /transl_table=1
FT                   /translation="MTAIERQIYYLFVRVAQSCAHRVHSLLLASTLAVPLSYFLNTSAE
FT                   SIVNGFSQDLFVSDNDMTKAIFNVSSNLGVVLGSVMLLSLASPWFLLILPILLLALWLI
FT                   KSFYPQTSGQVRKLDLECKSPLYTLFGETLMGLYQAERGAGVTQSKGILLKFVVDALVD
FT                   LGIWLDRSGVGLAQRSAREGGSSQSTVGWVAVGLTQLMILTAAITMLTKAWTQPELCLV
FT                   AIERLQQVAALEAEADPHKTQSTTSATSCLVGANVVARCISVNHINPDTGIPTKVLRNL
FT                   SFHLAPSEKVAVVGRTGSGKLSLISALLRFTPLSAGNIWLDGDDASWIGLAGLRKRVLV
FT                   LPQQAAVVPSCTLRQNLCVLVDEDRMQLADSDLWQALKRVSLDDLALKLGGLDIPLDQV
FT                   QSGEIQLSNGQKQLLALAKLILACQAIRTNHDGKKGTLLILDEPKASLDEAGDALLGQL
FT                   LHDATAFGGFTTLIVSHRFGPVLYCDNVLLVRKHDHADDENNESFGFGPPSQLFEDNDP
FT                   AFGVLAHDAGIVAWK"
FT   gap             8956..9055
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.95-um_contig_1.96"
FT   CDS_pept        complement(9064..10062)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02819"
FT                   /product="conserved hypothetical protein (N-terminal
FT                   fragment)"
FT                   /db_xref="InterPro:IPR021047"
FT                   /db_xref="UniParc:UPI00003C1AA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP4"
FT                   /transl_table=1
FT                   /translation="MIKLKAFSSFLGSLQLTREQQRYRHTDYILLRSRADHHEAESTLT
FT                   KRAVGILPIVSILTVLLALPLCIFFHTFSTIFFYLSLFLFALPLTFVWLAPWTRTKLVF
FT                   VCSYLLFLVFTLCQVQSALDPSAVAVSRAAGRANTDKKVFIASNLHNNQDVLPYYSAAL
FT                   QQLVQLIGVNNTYVSIYESHSSDKTKPMLSVIDHDLQQLGVPRRILMDDKRTKVGLGQH
FT                   RNGRIDFLAYVRNVALEPLKELFDKGQPFTHVLWINDVYFQPNAILQLLDTDAGRYDQA
FT                   CALDFIGNGFYDIWVMRDVQGETAKRTWPYFANKREIQALRDERPFLVNAC"
FT   CDS_pept        complement(11016..12629)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP3"
FT                   /transl_table=1
FT                   /translation="MATHKQHFVPLDRIDPVSGFNRGHNPKRRLSFIYGFTTAALVWSV
FT                   TPICYAILAYRFYSTGHPIDIPHGYGFWARFCYIYALIEMPFSIYLWFLTKKAAARPPP
FT                   LNVDMDTLQILLTKSLTAGLGPAPESKLTKRINGVGNDKPKQQQPMGLCAFKDKHVDPD
FT                   DASARRERLRSWFFFAPIEDIYEDNMREWLAWAFSARSLKDALADPQYAHLINDGLEMV
FT                   KLRLGWTDMKKGLNPKVKAIRLTLDPVRTMHRPFGYYVVTNGVSFGTIAWLMLTKGFRL
FT                   ENSGKCSFLVKPAQPNKPSKIKGEKESLPIVFLHGLGIGLGQYIAMLRKLAKHQDGVVI
FT                   LLQPHISTNIFSRYFLEPPSKDEQASSLISISKRHNFSRCATLSHSNGTMVLGWLLRTA
FT                   PELFVRNILVDPVSFCLWEGSVCYSFIHRRWATGIEVLLGYFVSRELGVAHTIARRFLW
FT                   FDMILWADELPSHRPEDLLFVFGERDVLVDVPASVAYLRDAGVGDDCIRVMKGYNHGQA
FT                   LIVDNAGMKLALERVVLRTT"
FT   CDS_pept        join(14579..15066,15091..15877)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02821"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP2"
FT                   /transl_table=1
FT                   /translation="MLTIPLACVLIFNQSSLRPTILGNITSLFEILSTNSTMQNATLHF
FT                   CESSLFNSTNCPGAFEQGPPGGRSRCYTTSQVDVPQIALNYSQTNNGGQGMSCTDPVNK
FT                   SAGSKVQLIHGLVLITLITCLMSAASALSAVGSCKSSQDELMAPAAPCDGQDSNLEPAP
FT                   HKSCTNKINSNELNINPNLPYGCGACLNEALTCFPQGTVYVKTNDHFYASDKLIVIGSG
FT                   ECVDWGPNDVPAEITQTANCIQLQALTEGAQYQCFLNSCTCKGANARLALSGRTLKKKR
FT                   NATCKSFRPEGYGRSTYSRFTKVSDEVSCRQSASPCTISIAEGKPATFSSEFSLTGGGT
FT                   VKGIDVFGATFGGTFGGGHTESYSSTISYSTSVPVRQCGYLQSHSGATKFDGTYTECDD
FT                   GVDKAGTTLVVRENDLQYGLTLVSC"
FT   CDS_pept        join(17027..18768,18880..18886)
FT                   /codon_start=1
FT                   /gene_family="HOG000218692" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11932"
FT                   /product="probable methylcrotonyl-CoA carboxylase beta
FT                   chain,mitochondrial precursor"
FT                   /EC_number="6.4.1.3"
FT                   /function="ligase activity"
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="degradation of leucine"
FT                   /note="fatty acid metabolism"
FT                   /note="metabolism of propionic acid derivatives
FT                   FunCat:01.20.07)"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="UniParc:UPI00015952B9"
FT                   /transl_table=1
FT                   /translation="MLAKHTFRQIASSALGRAGRNGVATARSYRAASHSFFQEQQSVLP
FT                   NNLDPSSDEFLANKAYMDGLVETLDAAHARLALGGSEKARARHVARGKMLPRERVAALL
FT                   DHGSPFVELSRMAAYEMYGDDEIPGAGVISGIGRVSGTECMIVANDPTVKGGSYYPISV
FT                   KKHLRAQTIARENRLPCVYLNESGGAALPHQADVFPDENHFGRIFYNMAQMSALGIPQI
FT                   SVVHGISVAGGAYVPAMADETIIVRNQGTIFLAGPPLVKAALGEVVDDETLGGGEMHCS
FT                   ESGVTDHLAVNDAHAITLAREAVAHLGLCGRSNDALGDASFDQPLYNASELHGIIPENA
FT                   RKPFDIRDIISRLVDGSRFHEFKKLYGNTIVTGFAKIAGQDVGIIGNNGVLFGESAKKA
FT                   TSFIHLCNQRQTPLVFLVNVTGYMVGTKAERSGIAKDGAKMVRAVACANVPKFTVIVGG
FT                   SFGAGNYGMCGRAYSPRFLWMWPNARVGVMGGEQLSQVMGTVSSDKSKQQGLRDRIEKQ
FT                   TLPEYASARLWDDGIIRPQDTRSVLALGLSVANTGRWRSAQRGDAGGSRHPAWDGNNYG
FT                   DGVYRM"
FT   CDS_pept        19492..22806
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02823"
FT                   /product="related to CTF18-Chromosome Transmission Fidelity
FT                   factor"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /note="G2/M transition of mitotic cell cycle
FT                   FunCat:10.03.01.01.09)"
FT                   /note="chromosome condensation"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00003C1AA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAP0"
FT                   /transl_table=1
FT                   /translation="MNEPGLLNTTGLLELDRPANGSNLSQAKADELFASPVDPFRERDL
FT                   NLFSPSGSQSEAQKALNAWCSHGSTKLDNQTDTRNLERGESMDFDAEIDLDQLLDQEMA
FT                   LKQEIHKHTSHSGTGCAEGSQMDVDYDELEAFLLAEEEHASSRPTARDQVHGLQHPPSP
FT                   PPDIVSSRASSPMTDLLESNGLLGGSSLPPLQQTVTPSPKSTGLTLETFPTSAQPSSRA
FT                   IEALSSLSTEDEEPSSVLAARDVQVGPSRLGARLQPQGIPKYIPAGFMNAATMDGTLVR
FT                   FERRKRMKGWKPPAIMSDVDASQLLDRPIHQLLDAVEALKALEVVERDEAHAQQARESA
FT                   NHTAMHNSKAALQMWVDKHRPAKFTELLGDERVHREVLGWLKEWDECVFKRKNHRKERH
FT                   RQYIQSKYGFSDNGFGDKGSEHSWKDPYGRPKERIMMISGPPGLGKTTLAHVIGAHAGY
FT                   NVYELNASDARSAGAVEDVIKMALESGSLKDPRPTLVVIDEIDGATGGGGGASGESHGF
FT                   IRALVRLVEMGKGAGPKVAGLGARGKKQQRKGFKPLLRPIICICNDLYAPSLRPLRPIS
FT                   KLIRFHKPPTNLVVKRLREVCEAEALSVEARGLSLLAELTNGDIRSCLNALEFAKTKNI
FT                   ALTEAAVKSASVGIKDTGGHVHKAWEVLFRRQNRKQAAASSMKRANAKAADADASPWNS
FT                   SRKASASELTGDGKAPKDFNLIDTPQENVKRIVHEVTSCNEYEKLAQGCFEHYPTLRAA
FT                   DGGWKRYRQVHDWLHFGQSITSRAWSQGNFELLGFMPWSFVCWHLLFAHVGNALPEYPK
FT                   ADYENHLKTSAFNEIASQIVSVLPANVRSQFNRQSVVTELGPSLMRILTPDLRPINNQL
FT                   SRTEDKQSFASLVSIMTWLNVRFVQDKISEDEASVTGQTAGQLVYKLDPPLDVFTQFEG
FT                   KRSKEIGPSRFAVRQLVAREMERQMLRRNAGVEARNDDAGSTSKSATAIYRCKGDKVDA
FT                   ARDALETKKEKSAVDFFGRPIVPKSASLRVGMSTEPIVQCMGGQKRKVSDDISCGASEL
FT                   TPTTTLAAGDVNAANHDATAPAAVDLVRDDKIKVFYRYHEGFSNAVRRPVKISSLL"
FT   CDS_pept        complement(23116..24222)
FT                   /codon_start=1
FT                   /gene_family="HOG000207093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02824"
FT                   /product="related to diploid state maintenance protein chpA"
FT                   /note="cellular signalling"
FT                   /db_xref="InterPro:IPR007051"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI00003C1AA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN9"
FT                   /transl_table=1
FT                   /translation="MVLCTRRGCGIEFDPATTSSAAASCSYHPGAPVFHEGLKSWSCCK
FT                   DTNKPVMEFDQFLAIPGCSTTNAHSTEKQALPTIKNGAVVDDADPLPAAADVQAESKRA
FT                   NAKEMSAKADNTADILQPLSGMSLLAAQNATAAQSTSSPTNQPHAQDQAVEEQDPADAD
FT                   ATLSPGVVCKRAGCGYKHDGGVRDRSSESCKHHKGSPIFHEGSKGWSCCKRRVLDFNDF
FT                   LQIQPCTTSKFGHLFVGAAKPAALDATDDEERVDCRMDHYETPNDIRLSVYAKAVDAAN
FT                   SSIEFKQDAVVFSLSMPPTNASSRPRRFRKLLKPFAPIVPADSSFNITKFKVDLVLTKQ
FT                   QKGHSWPCLESGDRVIGYGLTFGRDKDK"
FT   CDS_pept        27093..31055
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02825"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1AAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN8"
FT                   /transl_table=1
FT                   /translation="MISATGRPGFRPRPPCQSRSSHPSPNTTTNVSTKHDTVPPSPRSP
FT                   LSDLSNHSCTNATHATTSRDMHESASDFAHATTTSQREPNLLYDAQTLTPSSSVEDLDH
FT                   ARLGRLERHELEQLLIEASRKMREREAKLVVAANIGKALLEKNLSLRSGIETSIASSSS
FT                   LFGLSDIEAMISDLADPTLPDPMLAFHGPTNDTPSPPLRPIYSPPTTDVDVHSQAHRSP
FT                   SRAASDTTPTAHPVSLPDFQPDYFSRPANDTTSPPAASTFSIQSSIVFGDRAMWVPSDA
FT                   GLIASQPCSPSASISSFASHALLSSQASASRNTSNRGSATSRHRSRPSLLQLQALEAQK
FT                   QLASLGEQNDVLHQQISDLQREAECARFEGSKKLSRLNKELRGLKAELEAATQRNLELE
FT                   TNHSASRSSPGARSAMRRLVLHDRQVAPPPQTFPTPAHHQSSLLPLAPPSTSTSTSPEQ
FT                   PDPKPDRSGLIPSTSNLEDMVRCANTTAGESALLAQLLAKVKELEETNTAMARAEEEFG
FT                   SRMGRAMQEDERLRDAFNTVGQDLAVESAALESWSSPDKVQKDSNVSLLTPAHSVRSLT
FT                   SLASAHTSSPLSSLSPSQKRRAPGNRHVIEHRKTVRMALRRAKKELAANIWGLDTDPAP
FT                   VSSDMSRSSTEKSLGTYSIDLSANSSVSSSPRTRGLNRKFSSTSMALGLSARPRIRITP
FT                   SIEDLGQRRKMHQEVIAGPEEASTSQPGDWQDLTTPTLANFPQFASLSPTDAMKASPAH
FT                   LQVGIRPGRTSQNSPRREFDRSAEEPLSEAEPRSSLSPSSQTSFNPTARVRRSRTRSSS
FT                   FSSNFYFPRASSSVEQSPDPFMSPAAALNRPGLHRNPSSGSSHRGRTLGSELGSIFGGD
FT                   DRKHDFDDDLPQRRRLATTMLADAANSSKVQSLVLHRTESTTALELRSKLGDVVESDRP
FT                   TANVGRLVPQSDDEQQDDLEYVLTQSVCDQVEDVFLEDSPLRPRDAALLARVEAEESGM
FT                   WLADQPIIETGGLQDQDEPRSAQFDLINAVIRHQAVAWADDDDYGRTISQREAVKLGLL
FT                   APNPSSRENRNIRLLKGKSKHAASDPGIMQAQQATGARKASFRLEIESCEQLERRLRIE
FT                   SLLRRRRQELLRERGFLNEWETEADVHKQEAEFVATYAPSPQRLQERRLKALSPGKSDM
FT                   WSTSPQRASLSNRDSRLSTQEWVRDLASVSPSRQTADGDRDDHHDDEENSMSLDCVRPE
FT                   DTEFEMLDCPSWKKQGGRGTDYFPTSFRARYRPAMVKQRVAHVSQVTYGWVEEWVQFAF
FT                   VVFLAFMVMVEQGPNRNNRREMQASKAQQYLLKKAE"
FT   gap             31515..31614
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.96-um_contig_1.97"
FT   CDS_pept        31997..33196
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02826"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN7"
FT                   /transl_table=1
FT                   /translation="MWLRPISTILIGFAILVTLVSADPPKAAVAFVDVKFDDKAAVWSL
FT                   LLDHRYSKVIAVTTGVNDHGRAAFELDGYLNRQNAMANIQFDKNKLQILQGSNPLGKAA
FT                   PHEAWWDGLARLRIAAADRSSLRRSLHGYHVSVFQIAPTAPEQVEAVLRAADPGSIDSY
FT                   MLLHGYNSRQASMEAQTSFLRRLRTWVQANNPEAEVFFTSSMDTYAEKNGGKQPYSAIQ
FT                   HMFPRHDLDQAMQDPFWSSQLLRAHKQRDLNIAPFPVQDKEQLDSIIYYARTNPEHPNS
FT                   QLWRAAIRDYIWTALANNPGKEKDNLVLTRLLHTHLPEFTGDATLELADAAHIAAFHRY
FT                   QAGGSGMQAEPIEFSAHAPAEGEKVRFFPATSELHGYLLRGANRDQDLAYIKYLAGVHF
FT                   "
FT   CDS_pept        34527..37868
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02827"
FT                   /product="conserved hypothetical protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003C1AAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN6"
FT                   /transl_table=1
FT                   /translation="MQPKPSAPQPGPSTQYGPSETASTTSSVSPRARSPFRTDTPDRGF
FT                   GNDNGSVPLSVSKAAAAGANSGPSRPATAALAAKIAASRPHGTVADAVAASLGSKRERR
FT                   RKRIHYSCAECHRRKHKCDRQTPCQPCIDRGLGDSCRPFEDGDQFGDMRDRVQRLEDIV
FT                   EGLAIAHAELAKELKDSRGQMAAFVEMVSSDEEQDADTNDPAATSRPKPKKRRRIIRPS
FT                   TARGIEREELFNSEAQAIAASKGEVVDSTISKANVPRYDLGGNPLEGGLARDGDSWFGA
FT                   LALPSVSRGVIETEINGERLELGANFPRFPASVKLHRLIHEGGAPENILSDLMNSLPSR
FT                   ADTDRLLDIYFRDINHTRLPIHEGTFRQSYDELMEFRWGNAKEERGDDGARHVPFLAFL
FT                   FAILATAMRSLPEAFGSDSEAKKGAVRLYHACRRTINIASTIRVDHIDLVLAHLFAARF
FT                   LICQRQSAESWSLLGNAIRAAQAIGLHRDGSKLGLDAITTERRRRLWAIIFYMDKTTSI
FT                   LLGRPQAIQDIHCDTLPPSDIDIDTMPRSARPYVPRTRPRPNTPPGVFLFVAIRHELTR
FT                   LTGKIVEHFQNLASPRRYADVVALDEELEKFRKDIPDIYRVDKATNGTGPDTNKEFDTV
FT                   CPWLPLHRYLLNIEYHYVRIALHRPYVLRNSEKYSHSRTAAFESAKADRRVRQEYRKDV
FT                   KWEPERARKVHMGGLYRLFNATMMIGIALLLDPNGPEAPDFLSYLDEFIELHKHREGDA
FT                   DQCSKREVKIIELFRAKARDPTWCATSATGASKKVPGVEASSKGKGGKPNGGASKRSKD
FT                   AAGKRESSNEGTAGVGTAAFSSAMLLGGSKPSGSQLARANSVNTTESITPPPFAGLFGA
FT                   NPGAPTPGLALGAVSTGTTSDATTDLAQSIFDQLGGYEPSFGMLNPTPNDALNFNSGSG
FT                   LGFGPSHTSNSMGFDSAAGFDITSYFNTPPAGSSDPSPNVTTNAATSSAPASSGLARST
FT                   TNSVHTAGTSSSEPSGLASYQPSAHPHLRALNTPGGFNSFAGASDGSVRRTADALGING
FT                   IAPMGGGTASGDWGLLPWGGLIEAIAQSSHGIDHQQQQQQQNGSNGTPGSHAEMKTETP
FT                   EEPEKI"
FT   CDS_pept        complement(38003..39955)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02828"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN5"
FT                   /transl_table=1
FT                   /translation="MDAPKSSQPLTAQVKLNVTSDGLPPSHHVLAPTPGTTLSSYIPHW
FT                   NPQPATWREEQRPDSTQSTQALDDDYSSNAACLPNSIALVDSSKVVRTGFRNPWPSWHK
FT                   PSVTEVWQGLEWGEDRDPAIEYAMQDADLGTSANAGTNGDASVLSDPYTDSRPGTPDLE
FT                   DASLSREGAHADRGTTPQSISSAAPYTRQQKIKMASKQLLTVESPSFDFDSDAKLKATW
FT                   LGHAGVLVQLPPLSSQGQPVRVLFDPIFSQRCSPTQVAGPIRSYAAPCAISSLPPVDLV
FT                   VISHNHYDHLDYETIRQLWAANQDRIRFVVPLGNKEWFIGANASSSEADLERTATSSTS
FT                   WSWTSAGSGVMNATTTSNLAIPPERVTELDWWDEVLLRQRGDEDRVLRVVCTPAQHGSG
FT                   RYGVDTNCALWSSWFLEHPGRSDAGAPTKIYFGGDTGCQFHGPSFPPAPPQSCEPDVAT
FT                   DTTHTGEVSSISDDATLPGSACRPTRTRTYQGGMRLQVNDERNEPNAYPGCPAFEEIVA
FT                   RLGRPDFVMLPISVGATISFVRSYMRLPDSISPIPRISCGLTAANHMPPWDAVSVFDKM
FT                   SDASQNPVALAIHWGTFICGPDEVLKTLGQLKWACHQHAIHFARSQHTIPRTPHSLNQP
FT                   SKSFVALNHGASISL"
FT   CDS_pept        join(40413..41663,41886..42218)
FT                   /codon_start=1
FT                   /gene_family="HOG000168004" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11473"
FT                   /product="probable UDP-xylose synthase"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /biological_process="metabolic process"
FT                   /note="cell wall"
FT                   /note="glycolysis and gluconeogenesis"
FT                   /note="organization of chromosome structure
FT                   FunCat:42.10.03)"
FT                   /note="polysaccharide metabolism"
FT                   /note="prokaryotic cell envelope structures FunCat:42.34)"
FT                   /note="sugar, glucoside, polyol and carboxylate catabolism "
FT                   /note="transcriptional control"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001595404"
FT                   /transl_table=1
FT                   /translation="MDEAQFDSIHGGITANSNEQSADHHVPLDHLRSLYYRPALGSGML
FT                   VPSSDVPLACSSRPATGQASNTPSLAISANWKQHTRADSDPTRVARSAASTFWSHNVPH
FT                   AHPESHVSILSQAQDEGASASRASTPQLQQRQRQLSYIHAAPGSSMSTFQPGMRRIEAS
FT                   GVLHSPNPLASLSSHGYLPTRVLPVEEKKRILITGGAGFVGSHLVDRLMLQGHEVLVCD
FT                   NFYTGQKSNVSHWVGHPNFELIRHDVVEPLVIEVDQIYHLACPASPISYQANQIKTIKT
FT                   NFLGTLNSLGLAKRTKARFLLASTSEVYGDPDVHPQPETYNGNVNPVGPRACYDEGKRV
FT                   AETLTYGYYYQDGVDVRVARIFNTYGPRMHPHDGRVVSNLIQQALRGEPLTVFGDGSQT
FT                   RSFMFIHDLIDGLISLMNAHRLDVHSPVNLGNPAEFTIMQLVRLVQKSVAKVKAQDVEA
FT                   CASADGGTLLYQPPSEIRFFAMPKDDPKQRRPDITRATSLLDWTPRWKLHDGLDEMTRW
FT                   YWERIKEGSL"
FT   CDS_pept        complement(42326..44152)
FT                   /codon_start=1
FT                   /gene_family="HOG000209142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02830"
FT                   /product="related to MSS51-mRNA processing protein "
FT                   /note="mRNA processing (splicing, 5'-, 3'-end processing) "
FT                   /note="translational control"
FT                   /db_xref="UniParc:UPI00003C1AAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN3"
FT                   /transl_table=1
FT                   /translation="MRAASRSLSHVSGMSRSAAPARRISAQLLSSSHTLACTPASQLGQ
FT                   HRTLFGFSLFGGGKKDKKKDAFALPPRTAKKPVLAQDNLFHPFSKSPIASIRARGERIR
FT                   SLAPCPVSMSKYKVRRLVNFECPDCGWPTHYSEKEWAQDTEHGKYVARLREANEDEHDL
FT                   RSGREMSEFKLPGPQGFEETINMSNWDVFFYTRNFNSIESDRSRRHVSKLLTFPTTMAA
FT                   VIHENSPYTKKSRRLTHEGLRSMIALRQTLHPKQGDKPMLDKMRIFVVGARAESTLPPA
FT                   VWDQLTYMFPNVPLHLFLIGPEAHIPTDKQLSLQQHRAGPGSGAISMHKGRIRKSNYGV
FT                   PSRTVVVSEGLTITTIQSNYQDVHTQLEPFDAYTDVFFAFSPGFGFPSQLAVDEADKAR
FT                   QEDRDHEAHFARAKSTYHAVGAEAAESTEASAQKAADDAVELAKAQIAEQQIRLDGDST
FT                   ASSAASVKPVAAAAYTIDATSSPQGGDIPSEEPAPVLTSPDGHTFTALTTAPVVQAQRE
FT                   WARAIGQILSTRCALIATGFSPADVERDVLAFESVDGVRGEFDWLITPGENVFASQQWA
FT                   VADFDPRVAVKANWGLWAVRGKRYDIQGPTGY"
FT   CDS_pept        44825..46867
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11474"
FT                   /product="related to Tumor susceptibility gene 101 protein "
FT                   /biological_process="protein modification process "
FT                   /biological_process="protein transport"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI0001595405"
FT                   /transl_table=1
FT                   /translation="MDHGVVQKWLRSVLGAYTDPDRVFADVDRALIAVSSLSPKTEVFT
FT                   FNDGRTQLLISLDGTIPVEFRNTTYNIPVAYWIPRDYPREPPMAFVAPTPDMAIRKGPN
FT                   VDPSGEIGGDYLSRWRSKPEACNLLDLIHDCQHMFGREPPVYAKPKPTPVYATTASSSR
FT                   FSANQQLRSHPPTPQRQASTSSNFAAQRPGPHPPQSASPKSPHLAAAPSFHSAAMHDPH
FT                   QKPPPPAPGTPASSQDAFAPHRPPKPSCSLGAEAVYAPRSRPHSFAASADQHGWSQPAA
FT                   ELHSPHHSGTARFAADQTYRRSSGVGLAPTGLDDPSHHGAPSPAEHAPQSPQSLSQRAP
FT                   WQYSSADRLQGVQLAHHGSQPYLPHHPQETQQRQQHQQHQQRSHTYPHTSLESHPGPQS
FT                   LYNDSKAPAPQHMQPNGTVIQPAYVSGTPQSQSQSQSQPPPLPGAHPYQPRPSPAAGSV
FT                   CDSANGYHGSAQVAVAPKSKGVNLLDDEEDAAGADAGTTGAERLMSNTSGVAPPPRPIN
FT                   PELLALHDRVFSKIDSRLNALASTLGASNARLEVLSSDLDRGLPAIQDEMSRLKAVRDV
FT                   CKTTGDRLDASVAEITESLRTLNAREEPDADSMVLATSIVGNQLVDLVAEDNAIEDTLY
FT                   HLGRALNAERLDLERFLKQTRLLAREQFMKRALAMKISEAMGWAY"
FT   CDS_pept        47421..48602
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11475"
FT                   /product="putative protein"
FT                   /db_xref="InterPro:IPR013882"
FT                   /db_xref="UniParc:UPI0001595406"
FT                   /transl_table=1
FT                   /translation="MSGLKRKRGDAIRGCRDGGNADSDRGITDTDAGALLERTLAELRS
FT                   STKRIETLVHTVRTTTPRSPLMALRAPVQPTHASGAPPRLLAQCSCSCSCSELQAQLAA
FT                   LREQVAQHTRDRQAWKAFKAWWLDSLAKRQRRASRAKMSKRTPTEHANMRQSALHSMVA
FT                   KLDEQTKRIWLDAGIVSREQVGEVDQDSSVNEAGQDDRQVQASNVQRATNEVISAHVSH
FT                   QQSDCNANGTNHQQRNHQQRPCHPETPNSASDTACQPTGAVHRQHPRHLAQAGATSRTC
FT                   LDHHRTAGAHIDSTPIRNRVARPTLIASSCPDCSLFYTHLNQLNPPTTQPQRQGDTSCI
FT                   ASSRHRSTLPRATTPDGYWNIAFPDTQQVQHINALAQTRRPPPRRSSPHHLHS"
FT   CDS_pept        complement(48711..53669)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11476"
FT                   /product="related to Guanyl nucleotide exchange factor Sql2"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /function="protein binding"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR015759"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniParc:UPI0001595407"
FT                   /transl_table=1
FT                   /translation="MTSTSAAALGNSLPYTRTSQPRLAYVPASFDDPTPSTGDDSDEPS
FT                   SFFVRALYDFESNDASSLSFSKGALIEVLTQLESGWWDGLLDNHVRGWFPSNYVEPISD
FT                   HEAELELISRAQMHAQYSLGLSPHLSADSDSFSRLGLGAGFDGLQALIKGDGIGNSDAF
FT                   SQLAEAAMLDPKRRIFDPASPQLAHTPVLQLPDASPYRRDTSSLASTSSRSAIPEYPRA
FT                   SSSSASDQMLALERERSRAASVSNPLQPDSAASTSLAAAAAAAAARPRAATGSQADTSP
FT                   SGDVWVLKTSQRGHTVFYNTRTGATSAQVPPDTRSTHNDTAVFSSPTSRLQPQPMIRTT
FT                   SSDQNSSADSRKDLYDSSHLGPERSRPTSRNASAESRPSSANSSNTAIFHNGTAPVRAP
FT                   SSNTADRMPDLTAVPKPWRVRLTDDEKYFFYVHRSTHEIRWNHADAKTKLTILSNVTPR
FT                   SRSPRHSTIPAIAPIEHSRGAPNLGAGLNITQGVSELQLGSDESDIDGDMNPHLPGKPP
FT                   KPSSSRHGRHRVGSIASTLAALANHAVLSSPKILPFSLLHEETSAYEMQKALQPPPVPP
FT                   VSSLVRRANELIRNLAAIATEQIGTNGLAQADVSVCSADGIYLPRLAYATADVVAAIRE
FT                   VLYATGSLSLSSSDVASVSKLVAVPMASSDIPKSLSDTAHVTKDVDLNLYSKVLDTLCT
FT                   LTNGSDPSDLHVIGVSQKDSLAPTPGSLHLVARKLNAVVSKLVLSSRQVIDHTVTLASS
FT                   PTSGMESTMTDLDADVFSKLYQCRQRLREDALELARTLQSLGTEAERSRSTALGAPYSR
FT                   GWLRRVEGSLESDLGLNGVGSTSYGSGMAAGWLGNGFVLPSKCETALMKAEGKGARSNP
FT                   FDQRRDVESAVVRGLLTLRRIPEKRLDQQMIQQLQQALIRLEAQPGSSVATSALSVLSQ
FT                   YGALEAMIESIDLASGLDVDGPHAKEAKSSSINERNAANAVKARDLMRRFVVLKQIAYD
FT                   ASGSLFLAVQEYGSSAPVVQKQTVKLAKLSAAVVKTLQEIAKVGEEQLRDASPFLGVRA
FT                   SPNGSEDGIILPSTGVFSRRVNTTSNGLHEELDEMARYHKANDDEPEEEAEFMYLGPGI
FT                   AVPNGPRARSGSRATSVSTSNSPVPSLAAGRLGPMQASNNHRQRSTSVTTGGSVRSLQS
FT                   FTDTSGRIVSRRGTLGDDAPLTQTTTHDSEHSAGTGITAPSSMSRRKEDEVPWFLEPDY
FT                   MGDDIVIAQDGSVKGATLEALLARLTMHNSFDASFNNTFLMTYRSFTTTQTLLDLLAQR
FT                   FRILPPEGLSEDELALWTEKKQIPIRLRVFNVLKSWLEMHFYEGEDEPYLDQVRRFAVE
FT                   EMGEAPAMKAPSQHLQRLVERRQGEGEQMIRKMVLPNSAPAPILPKNLKKLKFLEIDAL
FT                   EMARQLTLLESRLYNKVKPAECLGLKWTKPGNDVHAKGIMDSITTHNRISAWVAETILQ
FT                   QEDLKKRAALIKHFISIADRCRALNNFSGMWAIVSALSTAPIHRLRRTWDAVSQKYVLV
FT                   FESLEQLMSASRNWANYREMIHKLKPPCVPFLGRYLGDLTFIEDGNRDRLKENDQLINF
FT                   GKRQKTAEVIREITIHQSTPYNLAVVPALEKYIEANLVDARSADDLYEQSLLLEPRERE
FT                   DEKIARLLQESGFL"
FT   CDS_pept        complement(55892..56902)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02833"
FT                   /product="related to SEC66-ER protein-translocation complex
FT                   chain"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="transport facilities"
FT                   /note="transport routes"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI00003C1AB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAN0"
FT                   /transl_table=1
FT                   /translation="MALSIFVPIGYVATLVVSMLVFSRIYRRRSALKLAKSYQPWFGEG
FT                   HEARDIYQTLVAADPPAPEEVLKAALLNRAMTDVRRIMRMRDDKQALATLLQKGSIGDE
FT                   TMARFTLAEKELEAEILDVVSEANTFREGWGQLIFPTASEMVAHLKHKEIYYDIQRQRA
FT                   AEVKTLQDQGLPVPKPTVELPPLVTPPGTKIEIQRGSQGGPDAPGAPGAPDGPGISLPM
FT                   TGSGADARVTLPNGQQIHPAQLAALMQGPLPPNLPPQQVAMLMQARAQLQALQDQAQAQ
FT                   AQAQSQQQQQQQQPSKGTTEATQAAVAVPASARDGADSAPAAVSKTATVEDDDEA"
FT   CDS_pept        complement(57706..61506)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11477"
FT                   /product="conserved hypothetical protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001595410"
FT                   /transl_table=1
FT                   /translation="MVCTNRTCTALSPISQNQSVDVITKRFTPKIDALPASRSSAANTT
FT                   RSALRAKLAHASSTLLRSPSLSTRKSCPTELPLVNAMPFASREIAQVRAGLKRKKGARE
FT                   QLGGVAHEPTQINRSFEKLEVEASTADGSRRIAPRTPRRRSGKQIHIVTSPHLPRDKPS
FT                   SSASELSDWSSVVSTSPTASRVPTSRAEESAAVQLSRPGIQTRRSSRNSLYKTLDGMTL
FT                   EDSLASVRSLARSSRSQSRSVSRKNSNLNAGNDNETGFPSAASHRIVSAHKVPDSELSS
FT                   EASIDMDDKEAEQARLVSSAPTWQLHRLRKDELVQLCLSARAWDASPTDAELELVTKQD
FT                   LVNQIITCRSRLDHSRSDELHASTTVQRQSRSVRSSYHTYKQRSNDLPDEHADESDALW
FT                   MALPARESLHRSARSSLCASPTGSADDDEADLTDASNEAGGEETEAEPHGSPSSRRHMG
FT                   RPSQARLKAYEGGALRRMDSSTFDEFEPSKANQAPRRQLRDKTTLRNGVARRQLIGNAS
FT                   EAMSASTSSSIFGGRSSRASNTSHSAFVQRRQLGVFVASSPIRTRSRTARLTAGLPSRR
FT                   KVGTRVVSASIDGASTGPDPMATPKVGHRLPQRTKKSVKFCAASPGQHGEYDRDEWMED
FT                   LSSGSDDVAVGLQTRSISLLQDEHEHTAVRNAPTRCSTRRTLRTRRSTAESEASFTFHP
FT                   PRSRSASSEAASSATQEDDLVAERDGDVDMANSDHGDDDVAATPTKFRKLRNGKLRLVV
FT                   GASNGDSDVRTSGNEQLGDVDMESAAEHADRSREQRTESPDSDTAPSEGLDSVMAQPTF
FT                   ATLTRLRKSELGQLCLDRAIDMDGDDKKANLIKKLLDWFQLSELDAAKNADSDADDGDE
FT                   TQSDISNATAVAQDDQAQAGQRTPTRRRNTRATSNAHASATDSDQPLLLRARSTMVSSE
FT                   KLLTPPLTSNNEEAAAPQVGDGVDELNGLDLESLNLTDKEIAPSKLEKLEKIGSGGFKD
FT                   VYVGKYRISKTRVNKVAIADIRDQLTEMDIKELSLLRDLRHENIVRFIGVSIPEDPRHV
FT                   PCMIVSELCSNGDLFDYIRNTAAPSDAEVFRILLETARGLEYLHTRTPAIIHRDCKSTN
FT                   VLITRRKTAKINDFGLARVKNTSRSMMRSLVGTVNWQAVELWVPKPQYNEKVDVWSAAM
FT                   TFWEALQWHQPEKKYPFQGMNEHQIYQDVGQKRQRPYTGFIRRQFGDEIVDLLDRMWDQ
FT                   TPKNRPSMTEVCNELESLIQMKKDAAAATAATAGSSIRFRA"
FT   CDS_pept        join(complement(66082..67360),complement(62925..65449))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02835"
FT                   /product="conserved hypothetical protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI00003C1AB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAM8"
FT                   /transl_table=1
FT                   /translation="MSTAQTSSPKGDLQHLFPSPTYSDSTLSSSSLLYTPDNNMVNVKQ
FT                   ESSDRLHHDHTSISAANAAFASAAKRSDANTTGDATDDHSLLFAHDASGIMDADMSGDA
FT                   QSLSAALNFDRINADMQVAFGNGNDSLAVSSKRPTTSQPKGAFGSMLHIRADSNSGRRH
FT                   SIQTLMPSADSSSSLADYASLVGPNAGARSMSISVDAFGSFAYSQNMPTDTSANMQNAS
FT                   GNGFLMSPPRLTVSMSSSNSPTPTPVQGFAEDAKRRRTSQVDATPERAVDHLTHQQRYL
FT                   PQQTPPNMYPYQQHAHFSVGSSVDGGLETPASAQSTASPCRVRRLSLTAMDRANHIANL
FT                   TANLALPGFSGEHPPRSAPPRAPADAMQRAQSQSSLIRKAADDKSTPAKTSVSGNNTTG
FT                   GNATPSGNSNGKNQDVWPDDVEVAFWEALRLIPKLGRRKVLVHGKPCGRNELIADYIER
FT                   KTNKVRTRKQVSSHIQVLKNIRKGDPEFQQLIAEPTTEEDFYIPAGGMMYAQTLAGYGY
FT                   GGLGGTYSLLPMDNASSGLLSPYTPGLTGGQGLASPLSPGAPPLSATHAITSGLNDLHL
FT                   PQQTGVKDTSGNTPCPILPASFSMWVHCSSGDEKHVYTNLNRNSMTTYANNQTCLPPMT
FT                   LDSVRVGHFRFPRLAEMYHHMPCQFLHVHVPLSIPRHDVMMPRYDHFSTQLSLTSAQDL
FT                   RLTSVTTVYSHGKRVLSLVEPLEAPRRISGRNGGETSSTSTVAGAEGSDSNANAQSADQ
FT                   KVRAQEDATTSTPIKNNSIQRRESDGSVASLSPVSGTSSGPVSPCTPLDANNESNSSFR
FT                   HRWCHQAPFATDFWADFLSRNHPVNAYGGRDGLQSFGKEPSERAALGMAVSGVTIIQEL
FT                   VVAGEGAAGALAATTGREGAPALLNDAGSSLSPGSKVGDVVLVIAWDLECVEALGTNPG
FT                   TPTVSLLTAGPSASPMGRAAPLMSPLLPAGAGLQIGAHGLTSMPPNVGGAAQQYHAAMV
FT                   HQPQAQLNTLNGGAGARGFAHAHPPPSVIHTQASPQPGFGFRASPHVEGSNANLQAPTL
FT                   LRKRGLSMTKPNLMVSIPTAQSYLNAQRISNDAMLSPHPQLSPAVSPTPAAWGAIQQRA
FT                   VHTPITPFPQMGAGLCEPPPLNTGDDARMQKERLERHWASQSNPLASALPSPLDMGFNQ
FT                   ADASGSSMSSASMAAAVDGQSDSALGLMVPGGNMNHGMSLLSPGGFDMCGKMGVHSGLD
FT                   SGNNSFEHLLNEGSDLSNDASTQEYLNGLLASIGVEGQPFHS"
FT   CDS_pept        join(67780..68111,68312..68392,68665..69031,69052..69129)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02836"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAM7"
FT                   /transl_table=1
FT                   /translation="MYPFKVEWSVPQKCLKQQSGLEQMLILPLTKQSDNKGGKFGPSDC
FT                   VETSLFDELQTCKEGAALGRPSLDGTEALAAMSSSVRARGLSHQAQRDGIADRGIEQIA
FT                   KRQAKRCLPGGTIRDRQVKQSDGANLNRPANYQNMPSCIEGREGYGLDIAASPGCQRRN
FT                   APRKKNWFQEMGLQTKIKNRGRFVNRSARLSDRGGEKLSSSRCWQFNTILRATVNHARR
FT                   TITIVSLRQSHNHNAPLDADRLEGAAKGSNLLSPPTETASVQFLDVAKQGDKKIDRIVN
FT                   RVQF"
FT   CDS_pept        73207..74001
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11478"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595411"
FT                   /transl_table=1
FT                   /translation="MSYLPPINTLWDHASHPSKRAWSRSPSPEPAHHDTVHTQAGPSTQ
FT                   LTPLRQAAIQRRLVRQSTRGDHLPMRTRSAEQARLLRALKGYPPIGSSADADQLSDLEE
FT                   SIEVGRFQMVRFGERYIVQIGRRRTMREEELSNEEDDGRRAGFSAVDAGLSFAPEGGVL
FT                   PAMQDASLQTNGGDNEGITGPGLFVGGHTGHAQAEFNQRRIAEAERRARDAEAGANRAA
FT                   AAAEAARSQAERQAAFQEEQDAVDLDADVEDLDEGDDEVDFD"
FT   CDS_pept        join(74749..74810,74928..75798)
FT                   /codon_start=1
FT                   /gene_family="HOG000212535" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="arc35"
FT                   /locus_tag="um11479"
FT                   /product="probable ARC35-subunit of the Arp2/3 complex "
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /note="actin cytoskeleton"
FT                   /note="assembly of protein complexes"
FT                   /note="cell growth , morphogenesis"
FT                   /note="cytoskeleton-dependent transport FunCat:20.09.14)"
FT                   /note="structural protein binding"
FT                   /db_xref="InterPro:IPR007188"
FT                   /db_xref="UniParc:UPI0001595412"
FT                   /transl_table=1
FT                   /translation="MILLGTENIIIRDVLTEKFDKPASVDQTFTDFDGVAYHLESTSKA
FT                   GPLTLSMDIRCWSELVQAGAMEVLKREYNSWIRDAVEPEYSVTLEFDYAKVPAAGPERD
FT                   ALIASVSLLKRNAMAAPFERAFAMQKQLEQEAESNVPSTGTEIMPINYRDDEAIYVIPS
FT                   ADRVTVVFTTTFKEETDKVLGKVFLQEFVDARRQPSIQNAPQVLYSNREPPLEVRNVAG
FT                   LNKGDDVGYVTFVLFPRHFSNAEVMASTISRIQLFRDYLHYHIKCSKAYMHSRMRHRVA
FT                   EFLKVLNRAKPELAEKERKTASGRTFRRA"
FT   CDS_pept        complement(75953..76930)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02838"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAM5"
FT                   /transl_table=1
FT                   /translation="MTYRMAQLFEMAAVELHKLNGDTSWLFRLPCLSSVDATATFYNVI
FT                   LDPWLHPTPQTDGSPLFSRQTRTEPAAFASIGALDEWLRDRSQGEERVDAILFSHSFTD
FT                   HIHPQTLADHASLAVLRRVTVFTTTDSSAALRWLKVAVDHEKVVNLCSVDFGHDTDQNR
FT                   VLPQGISVQHLPAKDWALSPAWSKLHGAILIRCQNTARPVQIVYSPHGITPTSLTASVR
FT                   QNDEDAKRILIHSFDRQTLPLIGVVSCGLPNILQLIPAFKPHLILATHDEHKQAEGLVG
FT                   HLLRREHFSLDQATQLVSRLRAPTVKRLHCVLKQLAPGESICIV"
FT   CDS_pept        77572..78495
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12196"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0001595413"
FT                   /transl_table=1
FT                   /translation="MSNLLQSVLSSRLANATLGGGSNDSSADSPPQSKEGLNDWEQVDT
FT                   DDELVNVGSAPATAAGTPLERSRPASPTRAHSSSRLGVETDTTDFESDVDSNTGSSSKQ
FT                   LSASKLRTTTSHTKKRCSKASKTDPLRAFTSEIAQHIFLQLPVESLLACSGVCKRWRRS
FT                   ATLNYSWYRHYQHSFAASSLDSALPALPAWGSGGAKWTRRESKTDWKTQYGRQKRMEAK
FT                   DAARAESLPGSGTATPSRTQRMQDAGIQTTHEARMQQWKEESDAQWTKQEMRDYYKSGA
FT                   KGGKFKGKREKGGVKTGAAGDGGLWE"
FT   CDS_pept        complement(78702..80225)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02840"
FT                   /product="related to CHS5-chitin biosynthesis protein "
FT                   /function="protein binding"
FT                   /cellular_component="intracellular"
FT                   /note="pheromone response, mating-type determination, sex-
FT                   specific proteins"
FT                   /note="regulation of C-compound and carbohydrate metabolism"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniParc:UPI00003C1AB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAM3"
FT                   /transl_table=1
FT                   /translation="MSAHYVGQIAPNYIHSTMQSNSSDDSFTFTVGKLDAGMAILIGDK
FT                   ASLIEFPSLLLPPGVSSGSVVNIRVLRNDQQERRQKDEFDQLQEDILHTFGQQSPKPPA
FT                   LRLRNVTQTSVTLEWDRLTLATATLLSLDIYRNGQRLAPIPNPLHNTSTKLSGLDVNAE
FT                   YTFHLVLKTTAGTFSSPVIKTRTHTINDTSGISVCFGHVHDAEMLQAAKKALTSMKAKW
FT                   HDRIQIETTHYVCTDPRSPGDVNAPQGSQGQGYSKAMQLSIPAVLPHWIFACHDQKKMV
FT                   GISAFYLDQDPPNASTIRQSIDQVLGKQVTSTSASTSASTTAPTQNAAESAANTTANVS
FT                   PPPPPLEKDAATPKVVDDRVATQPAPPAAEDVSPPTEQAADSAAAAPEVSGSALGLSLT
FT                   DSQPSSSTPIITTSAPSEDADVQLPSSATTVPPPPQVIITSSESQEQLTSDEPAASATS
FT                   PEGAHTHIQTLGETDEDGDADADADGEMDDVSLGGPNADDEMDQDKRVY"
FT   CDS_pept        80662..83760
FT                   /codon_start=1
FT                   /gene_family="HOG000138296" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniParc:UPI0001595414"
FT                   /transl_table=1
FT                   /translation="MITFIPLSVPYATAASAAAEVEGSEKSVRTKLASDSASSEEQEHP
FT                   RALAYLLQMDDVRVLIDCGSTEDFLFHGTSSQSDDSADAEAESQPQPESSSMAQQRQAS
FT                   DLDINHLKAAPLDTLLRQLASTIDLVLLSHSSLDHLGLYAYAHANLGLRCQVYATMPVQ
FT                   SMGKLTVLEAIQTWRSEVDIEKECTSASTRRCLATPDQVEDAFEEIKTVRYMQPTHLEG
FT                   KCASLTLTAYNAGHSLGGAVWKIRSPTSGTVVIALDWNHNRERHLDGTILLSSSAAAPG
FT                   APGSGASASDAVRRPDLLITEIERGLVVNTRRKDRDAALIDLVHTTIQAGNSLLFPVDA
FT                   SARLLELMVLLDQHWAYAYPHARFPLCLISRTGKEVIERSRTYMEWMTREWATKANETI
FT                   EADKDTLPAKMQQRNARGGGLRPAAASSPLDFKYVKVFPTLQAMDEAIPQDQAKVVLAV
FT                   PPSMTHGPSRKLLARFAQNPNDVVVLISRGEPGSLCRELWDAWNTNQSKGFSWSQGKLG
FT                   QAVVASNTSLRFELKSKVPLEGDELRAHREAEQAERERLAQQRALLARSRRRLEADEDD
FT                   SSDSDSEGGEEGENETVYDVAGGADEPGGAMIRKRPYGVAFDEATNPGGALSGGAGASG
FT                   DTNQLSFDIYLKGNASRATSFFGSKAGQEGPFGLGVRYRLFPAIERKRRVDGFGEVIDV
FT                   TRWLSRRRALEAAESAAADPLSESATLTAEAKRKQLAAQEEARAAAVPCKFITQLVSVQ
FT                   LNCKVAFIEMCGLNDGRALKTLIPQLHPRRLIMVNGDRETNADMLDVLDAIKSLTRDIS
FT                   APRWLESVQIGQVTNSYTVQLGEGLLSRLELSRFEEFEVAHVRALVRRGMGDAEMGGVA
FT                   MLETEEDVAAATAAAAEQAEREDTAKQNVLDELALSGIMRSVASQTIRASRFGASSSVD
FT                   CAHSPVQGTLFIGDLKLSTLKALLSSSPYRLPADFAGEGMLVCAPATMTAPDAVSVSKR
FT                   GKGRIVIEGNVTRNFTSVRNAVYGLHARVAGGVSLAHQTHEQH"
FT   CDS_pept        join(complement(85604..85652),complement(84116..85482))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11481"
FT                   /product="related to aquaporin"
FT                   /function="transporter activity"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /note="ion channels"
FT                   /note="non-vesicular cellular import FunCat:20.09.18.07)"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniParc:UPI0001595415"
FT                   /transl_table=1
FT                   /translation="MTTIQKPQQLSRTTNMTNPKPPAAGSGVYNVGGKQPTHMCQADRG
FT                   CTDTTLVHGARKREEHQSGLALARTGAPVPSGDSNVREMVAQPSMFSLGDRTQEQPTML
FT                   ERRESSMIEEQLPSFMQVDQTEHKHRHHYRAALRRRLVLKNNVIAFVSEFIGTVLFLLF
FT                   SFIIASQASNAQAATQRDSEATSLAQNAPVDTSALLFSSLGFGFSLAVNAWTFYRVSGG
FT                   LFNPAVTLALFLTGTLGKLQLVHLTIAQFAGGIAAAALADGLLPGRLNARTTLANGTSV
FT                   VQGFLFEFFLTSQLILAIFLLAAEKHRGTFLAPVGIGLALFLAELAGTNYTGGSLNPAR
FT                   TLGPNTVLATFQQYDWIYWIAPYSAAIVTSGFYMLLKYLQYESANIGQDSDDTKQVFKD
FT                   TYGNVVGVLETMAASEFSFVSQVAPPAEAEIQALVNIDPSKPALTAARTKMPTQNQKAA
FT                   ANLGPATVHNNLA"
FT   CDS_pept        complement(87010..90075)
FT                   /codon_start=1
FT                   /gene_family="HOG000192536" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /gene_name="kex2"
FT                   /locus_tag="um02843"
FT                   /product="probable KEX2-endoproteinase of late golgi
FT                   compartment"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /note="cytoplasmic and nuclear protein degradation
FT                   FunCat:14.13.01)"
FT                   /note="pheromone response, mating-type determination, sex-
FT                   specific proteins"
FT                   /note="protein processing (proteolytic) FunCat:14.07.11)"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00003C1ABC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAM0"
FT                   /transl_table=1
FT                   /translation="MKAIKLSSSLLLLLGTFLTVSAAQPNAYANSSLAATTCSDEGAPQ
FT                   RVTQQHKRSTLHPWSHQKRSVPLPAKRSYDTHHYYVIEVHARSGEQPDPRAIAEALGAE
FT                   FVERAGELQNHWLVRSEKPFPELSDTRAKRGGAGTSSSASASASLARPDVPESQDPVLQ
FT                   RWSRIRRSAREPGFITTYNLSKRQHTAALSIKAVERQEVRRRHKRNVIYDPSEMPHLYP
FT                   ELRDPLPAVDGWPFRLRSADPSPRPPMIPTAKTADLMSKFDIKDPIFTDQWHLANDRKT
FT                   GNDLNVTAIWEQGILGKGIKVCLIDDGLDMHSPDLRDNFYAPGSYDFNSHTELPEPRES
FT                   DDQHGTRCAGEIAAVKNDVCGVGVAYEAKVSGVRILSGPISDVDEAASLNYAYQENDIY
FT                   SCSWGPPDDGRSMDAPKGLIAKAMLNGVQNGRDGKGSVFVFAGGNGGASDDQCNFDGYT
FT                   NSIYSMTIAAVDREGQHPWYSEMCSAIIATSWSSGSGDHIHTTDVAWNGVNRCTGSHGG
FT                   TSAAAPLAAGVIALGLSVRPELTWRDVQHIAVRSAVKFNPEDPDWQQTQAGHHFNHKYG
FT                   YGLLDAYQFVQEAKRHKLVNPQAWYESPNITLPATETLITQSGTESTYTVTEDHLKGAN
FT                   LASVEHVTVRVWITHQRRGDVNVELISPHGTKSALARSRRYDDATTGFPGWSFMTLKHW
FT                   GESPTGEWKLRVFDPAHPNRVGNIYAWSMSLWGESIDPSKAVPWNFPEDSIEYHEKLPA
FT                   APETTIIKLPPSYTSSAKLKKPTDHLPSNHGIAEGESHVDFTNHNGSVPIAVQPEADTG
FT                   YISGLKKNSSWVIVAGGLVIIFAGSLAAFFVMRKRKMRRGGSGGGGRGGSGDGGYESLA
FT                   NDEEVAMGDLDDDGRGSRRGEKSRRTKELYDAFAEGSDDDEDQAAEASAGRGLLGRGRT
FT                   DEPYRDDLDDDDDGDRRFALHDDDAEEDDDVDAARTGPDTQQNSGAATAAIVDIEDEDE
FT                   SPSGGSGAGSAGEGSWQDAAEGRDLLAGAGQK"
FT   CDS_pept        complement(91375..92598)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02844"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1ABD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL9"
FT                   /transl_table=1
FT                   /translation="MSYAFQSPRAQVSSTLPHINDNYPHDPYSADSLQPYDPPSSRPDH
FT                   DEYRDEVGESHDSNPSRTLHRDYEQDYGNHYNHLRAGAGEMDNYNMGAEKANSGSPYAA
FT                   KRASGNSIWTKDDKRAFQSRSCPAKLCRILIGNLILAIILVVSIICLLALFVRPPNIAI
FT                   SGIGVPSQNGVNYQNGAFSFNVSIDISVSNPNSISANIKKLQATAYDSEDQSTALGHGL
FT                   VTDQAIRANANTTVEFPFQIKYNQSEDPNGSLIRNIASDCRLDLTGGSSIGSGDLSFLF
FT                   KIEVDVEVLSITVPVNFNRNVSFPCPLSGVNLQNILSGLGSVLGNALGVGGSRRAISDG
FT                   AEADQSVAAGLARRQLAKRDVIDMATWQREVNAIDLVAAAADGLIRRYAPLSNDEDKRS
FT                   LASEHDAL"
FT   CDS_pept        join(complement(99166..99275),complement(93955..99019))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02845"
FT                   /product="conserved hypothetical protein"
FT                   /biological_process="retrograde transport, endosome to
FT                   Golgi"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="InterPro:IPR019515"
FT                   /db_xref="UniParc:UPI00003C1ABE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL8"
FT                   /transl_table=1
FT                   /translation="MSTGAQEASASSTHSIGPSLAYTAAQNAVPTTAAEQTLINSEHLR
FT                   LGFNSPTLALTGFNAISTVLNNPSKRQHPIDPKSSRFPPVTPNHVPAEIPKVKKAELDP
FT                   YLSSVRPEWDRFMRNQSMGRQGKATIEQQQLQQQQQQQQQQSLSSTQDSSYDSDLLENP
FT                   NLRHRTTSSIASLSSDLQALPPPQPRKRLPNLSAVPQFFFSEDFDLGNPYTFDQVTERY
FT                   KTAVPSPGDQNGAKAPTYDVALNQMLQEKLSYYSDVIEQHLIIEIGQQSSSFFAALENL
FT                   NDLNAEAESCLAKIHHLKSELESIDKNQAKKGLRIIQQQQHRQDLERKQTVIQSVRQLV
FT                   ERRDLIRLLLQQGETEEALDLLNKLRATFGRPAADHALANTEHNGTRTADDEPLLSDLQ
FT                   SLASIPAQLDEMEQTLSGMLEQDLVAILKQDLDARLATYTKERVCSMAKPDSTGSSPTP
FT                   NTVQHSQSSLNSDATITEPSLTPSKTTPSSFTHDSRMLSSADAELASRIAPIVVGLART
FT                   GGIEATVSAYREVAIQAVQETWKATLSQSSAEMAETVKWLLAEELSKFDDREDLPAPAA
FT                   RIRDLKHASFLNIGQKLFEILMECLKAIDAQCKLVLRILDDLASGTSSVQSPPLESESV
FT                   VNLVSPGTVPASDIASPPTMPSGVPTTLPARLSEVVVASAEQAHTLCARLLSLRAKTHA
FT                   ALELPPFLVVFQLCWSFVLSSEQLCRKMIVGLRATVLGQAKGFLANFHRRRIERAAKAV
FT                   EEETWAQADVDINIQAQIRLIVSSAVQDPSEFVVTGGESRLDAPAKAAGDHVADQETAT
FT                   ISAKTLDIENRQYFVVDASLDVLALLVDYLKVIINLPLLTTEAMARVVEFLKQFNSRTC
FT                   QVVLGAGAMRSAGLKNITAKHLALASQSLSIMISLIPYIRETVRRHLSPKQAVMLTEFD
FT                   KLRRDFQEHQYEIHAKLVAIMSDRLTVHCRTLSALDWNADNSAADQEQQGGISKDPEPN
FT                   KYAADLVKETATLHKVLSKYLQAVVVEHVIGQVLCAIDTRIAQELDKIPIQNQQALDRM
FT                   QTDVRYLGTKLSVLKHVEWKDEALQQVLAAKHVPNTPAVTVTASTGSSTPNGETVPGSP
FT                   ARDKPVASPFGPVTYKPRIPNIFSRRQQQQLSQAASPRGSTDAPGSTTPAETQRSVEST
FT                   PRTSLQLQQQQSQSATTAQAAGVVQEAIDEAAREVATPATEPSIRPSTSAAQSVEEEVN
FT                   NVPPTPPSKNVAMQSTAVVKTEDKDAAESEDSVVSVVPAPDAAAKVLSESDRVSSELTA
FT                   TAPTLASMAAAESVQQEDANGGQDTKAVSGDQQDQATESADVPATSQSATGKQADHKVS
FT                   MEAPQHDDTARRVTNTSSVGTFAASEPIESQRPSTPKKDRHVASAYNGQGGIANSTEAS
FT                   PVRSGASTPAATPTSTPAKPARMSLKERLAEAARKRAQQSSSSAAQPPNPPGAPTTPTA
FT                   PAQPSETAPVEPALAPADKVDKPVSEQKVEDKNVGANQIAEPVESSAETNTLAAPRDAS
FT                   FAKREEVTAKTELAPSPQVEENALMAGGSEPVAASKQEPKEEGARIASSVVSEQDASGT
FT                   RTDAPATEAAEAIVPVGSTETSGGISEQTEVIVQSSSGADAAAEVVGEADGLSHTGGDD
FT                   QQIDAKLAEIQDAPSATSDSVAAVTASKDSAMTTEEAADDRDGDDIGDDADGDGDTNET
FT                   TNDSAVGSGPSTGSKKNKKKKKKAKKK"
FT   CDS_pept        join(101128..103492,103591..103604)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02846"
FT                   /product="related to WD40 repeat protein CreC "
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003C1ABF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL7"
FT                   /transl_table=1
FT                   /translation="MAYSMAFPPTSMRPLPGGTTLVSAQQPVPAAAAVMTTESFDAPEG
FT                   MYVCTSRFTPPPQPMIHLNPVPTTQLGLSAIYPTPRVSSVSLRYPASSKKASDSITAEL
FT                   AAAPSHNVLLEAPLASQGIDAPSSSLTGGYPPGTAGSSAGIAGIGGAGMGFSGLGETMG
FT                   KLSAKPTRPKNSLKSTSSNFVNRMMTHPDLAKILAARTDSEHFTFLTNARSFFWLADTT
FT                   GRTKESLARITFSASPSAHDVNQFTRAHDRLDIVIGFVTGDLIWLDPIASKYTRINKSG
FT                   CITNSAVTQLRWLPGSENLIMAAHADGSVLIYDREREDSSDFAPATWEALAASTPSSSS
FT                   VALQSAIAVPGTPSSAAMSASQTSASNDSSSSNPAASALGSAMSDSRPMLGARTVTSST
FT                   ATTTTQTDIADTNLSIGSSSAANLVKPRTGLAPATLSQRRQAADPTSEGQPLLVVTKPG
FT                   AVPITSGLPSGAALPSPEYQQAAAAAAVAAANSNSYGNGLSGKGKETSWSRLNPVSHWA
FT                   VSKTRITDFAFSPDYSHVALVAEDGILRIADVNSERLLDTFESYFGGFNCVVWSPDGKF
FT                   VLTGGEDDLVTVWAPREGRIVARCQGHTSFVTGLAWDPWRWSSDDRTYRFASVGEDCKM
FT                   ILWDFSSAALNRPKTYAPHHAGHRRSSVGLGSTYSLADKHVCSSIMRSPASVHTGRRMS
FT                   ANNGSASLTPATVTDDTIRHAALPRSEVAILQPVVTVNIDGEIPAGVRFAPDKVSIIRK
FT                   NAAIDTFTRPLPERPASVVASASAGTHRASLPAGALFGS"
FT   CDS_pept        complement(103724..105301)
FT                   /codon_start=1
FT                   /gene_family="HOG000135973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02847"
FT                   /product="related to ISC1-Inositol phosphoSphingolipid
FT                   phospholipase"
FT                   /note="fatty acid derivatives mediated signal transduction "
FT                   /note="osmosensing and response"
FT                   /note="osmotic and salt stress response FunCat:32.01.03)"
FT                   /note="phospholipid metabolism"
FT                   /note="polyphosphoinositol mediated signal transduction
FT                   FunCat:30.01.09.11)"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003C1AC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL6"
FT                   /transl_table=1
FT                   /translation="MPRLPLSPHSTSEVQALPPIFPPASEPVGSDPPSDDHQLSILTLN
FT                   VWGLKYISKLRIARIKAIASRLASSDMPLYDFVCLQEIWYESRDWRFLKHALSSRYPHS
FT                   KFFYSGAFGSGLAILSRWNILETRTHPYSLNGQPIHVHHGDWFVGKACGSVTINHPRLG
FT                   LVDVWNTHFVAAGGEDGPEYKRSHRITQAYELAANCRNSASKGRHVVCVGDLNSTPPSL
FT                   AIGLLRHIGGLYDSFLDTRPQLPEHAVSLDPEETSTQVGDRATAAPDPQRAIEELGVTC
FT                   DSPLNTWTAGKPLDERASRGAGKRLDYIFYRGPVDQQHSSESNASTVSSALAYSASHST
FT                   RGRLTCKSSSVVITDTIPEHLCSYSDHFGVASTFDILPPSSGAPSPTASDSDARKTAQR
FT                   RVLTCSLHALAGGFAASRSNQSSHLYVFGTALLVALGLIVASIFQPLGAVNPVFVLLAV
FT                   VAAWAGTTMLYSAVVWGEWEQRTLRTLMEMLELELNYLQPAQNGVTNTNNIVRAQSAND
FT                   AVREGTLF"
FT   CDS_pept        join(106138..106146,106225..106306,106406..106501,
FT                   106588..106676,106763..106910,107009..107086,1
FT                   07177..107211)
FT                   /codon_start=1
FT                   /gene_family="HOG000233456" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11482"
FT                   /product="probable Ubiquitin-conjugating enzyme E2 "
FT                   /function="ATP binding"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="protein modification process "
FT                   /note="DNA repair"
FT                   /note="assembly of protein complexes"
FT                   /note="development of asco- basidio- or zygospore
FT                   FunCat:43.01.03.09)"
FT                   /note="endocytosis"
FT                   /note="mitotic cell cycle"
FT                   /note="modification by ubiquitin-related proteins
FT                   FunCat:14.07.07)"
FT                   /note="modification by ubiquitination, deubiquitination
FT                   FunCat:14.07.05)"
FT                   /note="pheromone response, mating-type determination, sex-
FT                   specific proteins"
FT                   /note="proteasomal degradation (ubiquitin/proteasomal
FT                   pathway)"
FT                   /note="protein binding"
FT                   /note="unfolded protein response (e.g. ER quality control) "
FT                   /note="vacuolar/lysosomal transport"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015580"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniParc:UPI0001595425"
FT                   /transl_table=1
FT                   /translation="MIKIWSMKKEEESAKKKKPKTSPAQLRVQKDLTELELPKTMKTDF
FT                   PDPADVLNFSLTIEPDEGMYKSGSFKFTFAINSNYPHDPPKVKCTQKIYHPNVDLDGNV
FT                   CLNILREDWKPVLNLNSVMVGLQYLFLEPNADDPLNKEAAEDLRKDRSVFASNVRRSLA
FT                   GGAIKGTTYDKATVK"
FT   CDS_pept        107832..108521
FT                   /codon_start=1
FT                   /gene_family="HOG000257189" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11483"
FT                   /product="probable l-isoaspartyl protein carboxyl
FT                   methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /function="protein-L-isoaspartate (D-aspartate) O-
FT                   methyltransferase activity"
FT                   /biological_process="protein modification process "
FT                   /note="cytoplasmic and nuclear protein degradation
FT                   FunCat:14.13.01)"
FT                   /note="protein modification"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="UniParc:UPI0001595426"
FT                   /transl_table=1
FT                   /translation="MAWRCSGGTNAELIANMRNASLITSSRVYEAMLKVNRANYVPSQL
FT                   SAYQDSPQTIGFGATISAPHMHAHAAEALLPFLHSQANVLDVGSGSGYMLAIFHHLVDN
FT                   GKVIGIDHIPGLVDQANANLEHDGLGAELKNGKIVNVCADGRNGVEAQAPFDAIHVGAA
FT                   APGIPQSLLHQLKAPGRMFIPVAEQDGSGEQNIYQVDKSETGEITKTKICGVLYVPLTD
FT                   AAKQWRA"
FT   CDS_pept        join(complement(109414..109561),complement(108762..109333))
FT                   /codon_start=1
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="guk1"
FT                   /locus_tag="um02849"
FT                   /product="probable GUK1-guanylate kinase"
FT                   /function="guanylate kinase activity"
FT                   /function="protein binding"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /note="phosphate metabolism"
FT                   /note="purin nucleotide/nucleoside/nucleobase metabolism "
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI00003C1AC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL4"
FT                   /transl_table=1
FT                   /translation="MPSSNWASTPPIPSDKRPIVLSGPSGVGKSTLLKKLFQEFPNDFG
FT                   FSVSHTTRDPRPGEVRGQSYHYVSQQEFQDLVQQGAFLEHAKFGGNRYGTTAKAVADVS
FT                   TEGVKGADGSTAARRAILDIDAQGVKLIKANHASLNPIYIFISPPSFSTLKQRLIGRGT
FT                   ETPESVNKRLSMAATEMAYAREKGAHDWVIVNDDLEKAYGLLKKAINETLKKGEDDSMP
FT                   AKDQDEEDWEKQQQQQQ"
FT   CDS_pept        join(110058..110193,110240..112119)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL3"
FT                   /transl_table=1
FT                   /translation="MDSCLDPELREKLFVHSTQKRLATLHALDVIHKLGEGSASVDVQR
FT                   ATPGVDSAFKHGSSQHNHHHCDILFIHTAMIVPDSQSADVAGPSRQSAGSHDRWNRHLN
FT                   PKVKPEPACENSNNVIDLCDSGDELARSVKPVPSKPILRSKTPAAKGGRVKDQVDDDDN
FT                   GYDGLLKSDHDDEFGSTFVKHKSKKRGLSESPSISKLYAIARIATLATDGVASVSECEA
FT                   KLAGVSAGILSRIQKSLALAKHPGTGEAEAQQALRLATRLMSSQNLTQADLLASSDAET
FT                   NQSRAGMSIVEIVSQTNASPRNESWVNQVAIAVNLFFDVKAYSTSYANRTKLSWTFYGL
FT                   AVNTVAAAHAFEMVHNQVLTWAYDKAAAKLVSGKTGKNSYCQGVAAGLIALAKKEKKEE
FT                   MRLAIESEQKRLKLAEEQEQAQIKKERQRLNQSAIKCESDVPTWSRVKPEAHEQSMHTG
FT                   SARGSRTVKLEDVVDEQDTKPFRYGIKRSDSEDADAGFGRWTENRSNRGISVGGIKREN
FT                   GVEYDDSDNEDTNEQFYDFNNHIPPGHGFGDDVDDDIKPHFDEALERDIIDLTDDLEED
FT                   VKPKLETDFTDVKPKPERDSEDVKPDFGAGWQSGNQLIRFRQDAEKVADDYLASQHSGL
FT                   KLKKRAKSSFKKDSHAFQQGKEDAKKIDVKRKRIQN"
FT   CDS_pept        complement(112555..113160)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02851"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL2"
FT                   /transl_table=1
FT                   /translation="MNLNLLLFFFTLLSLAGLVESAPTTAFYSAKNVLQRFAKDMYPNE
FT                   PAQQAKAVVTLRYLFRNDAWNEVAHWPYMDDYLRTGGFQQGYSSVDQVLVQSALSHLQG
FT                   GTVYTPLGAMRPSLDALIAKNFSKAKNVYGFDQHELLRETNLGRKPPTSGAGLFAGVPR
FT                   ALSLEDAESLVGNAWRRGGSGGVDEQRRIRGNQPSPWG"
FT   CDS_pept        join(complement(115083..115257),complement(114916..114984),
FT                   complement(114640..114833))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02852"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="UniParc:UPI00003C1AC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL1"
FT                   /transl_table=1
FT                   /translation="MTPSNICTAILLIAITCTGHVKAYLLPKEEIVWRQGMPIERAIQQ
FT                   LKERVSEALQQNTALQNPPVDVFPQFFRDMALIGRTTGRSAAYPLTGLEWNAWYAGEIA
FT                   RMRAHRQAYYRTVDEIHNEAAAMNPDRRQGRSSAISSLVAG"
FT   CDS_pept        join(complement(116853..117030),complement(116703..116771),
FT                   complement(116500..116612))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02853"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="UniParc:UPI00003C1AC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAL0"
FT                   /transl_table=1
FT                   /translation="MYSPKLTLLLPMLLLTFLASVWSYQIEAGEQLWQYGQPIEEGIRN
FT                   LHLNIFSALRRNGENAINPDAMAAHRFFRSLQQDGRLESTARPVTGAEWNRWYAAEIER
FT                   IQTPEARAARAGSRS"
FT   CDS_pept        complement(118684..119046)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02854"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK9"
FT                   /transl_table=1
FT                   /translation="MSRVIGQLGALTLLAQLVLLLQLSWTSTAVPIVPVKRGMPAEIVD
FT                   KLMSKDIDQVRQAFNLAYTASDQIEQQLRVQENSLFHRLSQNVEQDLRQVKADQVQVPP
FT                   KNHKRVRSPAGKSYSA"
FT   CDS_pept        join(120547..120826,120927..121042)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11484"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595427"
FT                   /transl_table=1
FT                   /translation="MRLFRSPIILPLLVLVVFTATCVLAVPAGDNGSSSSSSSSTKGRL
FT                   AKLLGRFKKNKPPSLLDHLNAYMPAHEYAELKPTWDRAVEQGWIRPDTGEAIRYDGIRS
FT                   RQENETINLILHKIDPYIEELARNLPH"
FT   CDS_pept        complement(121514..125746)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02855"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003C1AC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK8"
FT                   /transl_table=1
FT                   /translation="MFTTPSRVRDARSSTPLVGAGVGASHSANHPSRAGTPVFGGQDPL
FT                   SPPSFLSPSTFRRGDVNNINESGDVSSGSLFLSTNARPRTTRARPRPSSMLAISGPNVS
FT                   LLSPSSAFDREGSLINDDADMRSVAESAYSASMAGFGRRPPLLSKDAKAQLEEGTVLLG
FT                   DRWVHVSAYSRLPNEVLEVLNDADLYIDAFQGHLDVQTGYACLVSRTQCFVWNYSSRGI
FT                   GTGSPTCFVFPVPQYSSSSMTAINDLAHCCFIPRGANREPALLLVAPDGQTCLWEGISS
FT                   SLTRQDRAQRISVPLSSTSETIVQLQRVDESTLVLATSQSRMLRVSVGSRAGMLQAEIR
FT                   PFSQQRGLLSRLFGSTSAMGSSNDQVVSIAVAPIQAGKQGREVYAIGRKTLQRWQVLDQ
FT                   GGERLLAEQDVQQVIASNVLQLSDERYSAAQSLSFDVLDGAVQSDGQLVLLYSQAKAEH
FT                   EPLGYGLAIVDAVKDAGSFVVASILALNYSNFADPRPYAMPTLSLPNGGPAAFICFADT
FT                   VVAKQLESGCETFEEVIKLKDDVKNRFIGTGCDSIDFGNHAIAALSLISATSGSLLVET
FT                   SVNEIRNRCTAYTSAADRQRADTERLKSKLEQALYYSESPLNPLTFQLASHLQGTLMTA
FT                   CEDLSRELLTFSNPISQSVAPSVDLRAALKDRLGKLRFLVQFVAACGHLEKLPQTTKRQ
FT                   LRADAELAAALSELWVYQNEFYTSTHSHASAAQSPLARSIETVMAEQGLGTSADDLVRK
FT                   FFRHHADLTTEVLERLLKQTKSISAQPLRTRSTDVLEFNRVVMSALRAALRYRKESGAL
FT                   YGILEPDSGVSTSAVTATAATAATPAATAATAATPAAPAAQAAATIAFEAWTAQSATVQ
FT                   LLESLFALTVNLIPDRTRELGSSIDAASTEFSGAVSEELKREHRVQAELKTQLCSLAEI
FT                   ALACYLERLQYLQAAAASATDSGAFEREFAVFATTYRTARPLFIRPLVTIGRSDRAFTL
FT                   AEQYMDFRTLVELCNDPALKSDARTETYLERYQESFAYELYTWYVEHDQQRTLLTQKSE
FT                   YHALVLSFLSQPGKERLAWLHDLALQRFAAASTKLEQLGLVESNVSQRKLMLSLAKLGY
FT                   LSTLKVQDLRTVGVQKQIEFFDDYLDLIAVQDSLVALWENSVAGGFPVDLPTAGTPAAD
FT                   KLANEIVDTVASRLAEYAAYRQHYMQLIQQLVLSNTYLGAEDLIDLLTLKDTPESQLED
FT                   FSTAIKVLIRASSNMPESRRHACLKAIWRRSVIRDDWVSLSETNNVSDQTLLEDLKCTG
FT                   LYAVLREVLGDQDGSGRHAWIDIGDLAKLDDAVSDDTDPHPVERQEQGKRLRSLLEARF
FT                   HDAPDHFITLLLQDYQKEAATVLGFFEDSDLPRLANELAGLAANQAGVRSDATLHPLVD
FT                   QDDSMIES"
FT   CDS_pept        complement(126345..128600)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02856"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003C1AC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK7"
FT                   /transl_table=1
FT                   /translation="MAKNTSSAHSNGDSSNRKPSDHSLKFDTINGSSNGHRNGKPAVSA
FT                   LEDYSDAPAFSPLFPGSSIDRRELVKLTLQSLREMGFDSAAKTLEAESGITLEHPSITA
FT                   FRTAVLSGDWRNAERLLIDGLTYAARRIQASRNPLGSSAGSSLLDAPASSSTASSSVSL
FT                   PAVLDSSNQDLIDSVLRRPDLVSLRSIRFMLQKQRYLELLEARQTKKALNVLREKLTPL
FT                   SHDTSQLHLLSSLVISASPEQLHARAGWDGADGDSRRLLMVEIESAVSPLVMIPSRRLP
FT                   QLLEQAQSFQKQQDPFFNSPHGSHFSLLTDHRSDRSVFPSHNSIIIMDHRDEVWCLQFS
FT                   HDGTKLATAGADKTILIWSVQDDYKLLQKFVPLSDNISSVSWSPDDEQLLVTSDVDVTL
FT                   CRLATGSMLTLREHSYTVATATWLADGSGFVTGGMDGKIVWWDTQGYVLHKKTTSPFRV
FT                   LSVAASPDGAHLVALSARQVAQTGLSSSTTRGHTSSSTALSISTASDQLSDTSSQSTAS
FT                   TGIIHDRADLDLAADLGGGSRTMGTERYRIHFINLRTREELGSIYLREEVVSLAVSGDS
FT                   QYALINVRPSELQMWDINRQCLVRRFNGHKIHQHVIGCGFGGIDENFVVSGSEDAKIYI
FT                   WHRASGRLIETLEGHNGGTVNDVAWHPKDSLTLASCGDDHSLRIWRPGGRPLASPAHPT
FT                   EVAPKSDDSEMSGAANPFPWSFSDPSSAVEVDMMRSIHEAMDEEEEDSGVNSPSPTF"
FT   gap             129209..129308
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.97-um_contig_1.98"
FT   CDS_pept        complement(130070..134359)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02857"
FT                   /product="conserved hypothetical protein"
FT                   /function="DNA binding"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003C1ACA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK6"
FT                   /transl_table=1
FT                   /translation="MQSDYFGAAAEPENGRVRSRPHSPIPSGPARKIQKRNSTASNASN
FT                   EDRKHDNDDDAAAAAADVSTDVAGGPVPSGPPFICPTCSTSYSRLEYLRRHERRHADIR
FT                   PFVCDCGKGFSRSDVLSRHKRQCRVVLHLDGSVETEKPAEGEAPPKVSKPRRSSTAAKP
FT                   GRPKGSTKAAKAAAAAATNGANGNPDTAAADGAPNLSVFCSESINGPTPPPPAPQSDQL
FT                   THDAIAVAAAAAAAAAAAAGHHHATAQEQPEDASAMIDPAIAADSQAQAAAAATTVAAI
FT                   SSVAAYQYANSMDPPDFHMGRGAVNPYASTPFPLPVHSAVAALHPQLHQPSSPESSQSR
FT                   SEHGSPRYGGQSLTRHSSNSGSRFSLSRQAAGYDPYTARQASAFANPTDAAIWEGLDTA
FT                   KLPSPGHAAATTPGSVARATASMLASLGFSVTSPMGHLGDRSRTGSHLGSDASYFRSVA
FT                   PGISGGAGAVYGSNSSNSPAFSFGTSTSSADTGTSSSSHSTSHATAATSMSQGQEASGP
FT                   TTPKEPVRFSVSTLGPLSPFSNTALNSSMSPYLSAFSNARDTPLVSSPRSQLPTTPGGG
FT                   LASLDLGGQWTGMRPPSRSVSRHNSLQGINISGHSQSTSPQSDGIAASSKLAKSSSHER
FT                   FSLSDRTAAADDNDAKSATTSTATTSAATVAEQQATSSMSVSSVAAVPSTSAAASGGRG
FT                   AITTSAPIQISNSGIDTPSRFVKNESQQYFDGGALSPGPEAFLLRLQGGVQELRAGIHG
FT                   NEISFLNSHGLPLSSAPLGASQFSTPNWDHSMFSNPSAGSFAAAAAAAAAAASNSMPSA
FT                   QLSALGWLMSPSIQQLLSVFSTTAGSGKVDTTNASDYFNSKNVTAPETAGLDLTSLEVL
FT                   PTPLEKALTDVKNPFFIPPDMFRPCYSVQHWSLPPIARLSVLALHAQQNLLKHFPVIHE
FT                   PTFRIDTTPGCIAFAMCMLGGHEAGRKWWAGEEVIPKSAINIINSHGASESANGLQRLI
FT                   DNTGPSRLIDEEDGQELVKPIVMGEKSEMLMRAFASRCKSVKDKCSVVQALMLFQSNNF
FT                   LSSDATTRMVAGVSHGAVVNMARQAGFFDRDAEHAERGMSLTAEDVMQQVLFESVEMCF
FT                   SYPFFPSYGAEKDDSEKIWRRWAELEGRRRSAFVIYMVDTVAHLDAAVPTLLSTKELAH
FT                   LPLPMPDHVWRAPTASSWSTALKTHKCLTLDEALQELLSSEANASPLQELLDSPSLYGS
FT                   HGPFARLAMVLALLRGIIEMLEGRAMRVAKPSSLSQWMRLGDLQSDGNSVPANEAQVTL
FT                   FKKALSRWRKAWDQDPTCRFASAKKSTSGNGMDSIDDGNVHWANVATATEGKHEWPKEL
FT                   QQTLFTPLTASGATPLSNDALPLYWLAHVLVTHAASNQRLPLRSVEGRMGAPSRNGGYT
FT                   AVGGGPEMPDFRAMLRFAKNFVTRGEK"
FT   CDS_pept        join(136243..136775,136855..137062)
FT                   /codon_start=1
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11485"
FT                   /product="related to SNARE protein of Golgi compartment "
FT                   /note="intra Golgi transport"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="vesicle fusion"
FT                   /db_xref="UniParc:UPI0001595436"
FT                   /transl_table=1
FT                   /translation="MASTSTASQPWDVLRRNTRNLESAIDARLTTYSQLASKIARAADH
FT                   TTLDMTGAGSSSASETREHSEHVELETELESLINELSNSVDALTAKLDDPAIPPTTPQL
FT                   HAVQRHRELLFDFTRDFRRSQTNVRHAIDRRDLLGNVQGDIDAYKAAHASDADALLAER
FT                   ARIDNSHGMIDRTLEQAYATRADFADQRSTLQAISTRMSSSAAQVPGLNSIITLIGRRK
FT                   TRDSVIMGCLIGTLTVLLLKFALG"
FT   CDS_pept        complement(137330..140569)
FT                   /codon_start=1
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="crm1"
FT                   /locus_tag="um02859"
FT                   /product="probable CRM1-nuclear export factor, exportin "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /note="RNA transport"
FT                   /note="nuclear transport"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="protein transport"
FT                   /note="ribosome biogenesis"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR014877"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003C1ACC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK4"
FT                   /transl_table=1
FT                   /translation="MEGILDFDKDLDIGLLDNVVAAMYTGAGQQQRMAQQTLAQFQEHP
FT                   DAWQRVPVILQQSSSPQTKYISLQILDKLISTRWKVLPEDQQQGIRNFIVEMIIQHSSD
FT                   EANLKRERTYLGKLNTTLIQILKQEWPHNWPSFIPEIVSSSKGSLSICENNMAILRLLS
FT                   EEIFDYSAEQMTISKTKSLKNQMCGEFGEVFQLCSEVLEKAQKPSLIKATLETMLRFLN
FT                   WIPLGYIFETNVIDNLIGRFLEVAEFRNVTLKCLSEIANLNVGAEYDPKFVVLFNMVMT
FT                   SVNRMIPPATNIAAAYETSADSEQELVLNLALFLCNFLTAHLRLVENPENKDVLLNAHM
FT                   YLIKVSQVPEREVFKICLEYWSKLVSELYEEQQSQPIAEMNPLLGLNLGNGVSNASSAN
FT                   LRKNIYADILSNLRLVMIERMVKPEEVLIVENDEGEIVREFMKESDTIVLYKSMREVLV
FT                   YLTHLDVLDTENIMTEKLAKQVDGSEWSWANLNTLCWAIGSISGAMNEETEKRFLVTVI
FT                   KDLLGLCEMKRGKDNKAVVASNIMYIVGQYPRFLKAHWKFLKTVVNKNFEFMHESHEGV
FT                   QDMACDTYIKIAQKCRRHFVIQQAGEQEPFIDEILRNLHRITLDLSPLQVHTFYEAVGY
FT                   MIAAQPNRPTQERLIAKLMELPNSAWDNLMQQAHNNVDVLSSPENIKILSNVLKTNVSA
FT                   CVSIGTFFLPQIGRIYLDMLALYRSVSGIISAKVEAEGLIATKTPMVRGLRTIKKEILR
FT                   LVETYVKRAEDLESVNTNLIPSLLDAILGDYNHNVPAARDAEVLNVMATITSRLQGLLT
FT                   DKIAPILDAVFEPTLNMINQDFAEFPEHRVGFFKLLRAINLYCFPALLELPPPKFKLTM
FT                   DSIIWAIKHTMRDIADTGLNICLELLTNISGSPLEVANGFYQQYLLNIIQDIFFVLTDS
FT                   DHKSGFKTQCILLARIFELIETDRVTAPLWDPSTQPDPNMNNRLFIRQYTTNLLRTAFP
FT                   HMQAEYVESFVNGLCMHSSDLIAYKLHLRDFLITSREMFGGNTGASDNADLFAEDREAE
FT                   AQRKAAAEREKAATVPGMLKPSQIKEEDEEL"
FT   CDS_pept        142969..146286
FT                   /codon_start=1
FT                   /gene_family="HOG000187674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="pho81"
FT                   /locus_tag="um02860"
FT                   /product="probable PHO81-cyclin-dependent kinase inhibitor "
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /function="protein binding"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /note="regulation of phosphate metabolism FunCat:01.04.04)"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR022351"
FT                   /db_xref="UniParc:UPI00003C1ACD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK3"
FT                   /transl_table=1
FT                   /translation="MKFGKYILGQQISGWGAYYLDYKFLKKIINSLEKGRLGDAALFAT
FT                   GVRPEESVNSQSTVSPQPQILPRVEGSDELQIHKAAFFFKLERELEKINNFYLQKEAEL
FT                   KSRLQTLIDKKRILFESRNSSKLSKDSPSYVALYEGFRYYEKDLSKLQQFIEINATGFR
FT                   KILKKWDKRSKSQTKELYLARQVEVQPCFNLKFIAELSDIAAANLLELENLSHGRSLSD
FT                   TLGTNGASLSADNRLDFAAAQSQDFDALADLEANLAEAIKVGRVAPATEMIRIAAQNED
FT                   LTSVSRIVWRALLEAPHDAMRAALAHHLADYKFVDDISLRTCLHESAMAGKLFLVQSCI
FT                   ENGVDVAQQDIYGRTALSYAAMAGHTDVCQYLLSLPSISAATYDLDGFSPLILAVMNGR
FT                   TDAVRILLEHGASVEPRDTIDLIPLCLASSGGHADIVHLLLQKGAKIVANAEGLYPQAL
FT                   AARAGHAQCVRLLVASGGNPDAPEKGTQWTPTFFAAENGHVDCLQVLLEAGCNVNIVDE
FT                   KDRTAAFYAAWNGKIACLLLLLQAAQQSQAPPRERRLSRTSVAKTSSSADAAHDLDLEI
FT                   DGIPDLSLPPPIIPFRTYGHNYLDKRALVSVSLTNNSVKLYKHQDPNRPEQFSTSSLKL
FT                   VMTSRPDASTTAIPHNVVLPLADEREVFSFQVDRLESFSIEWELMPTFGSKVIGKAVAL
FT                   PSSFEGMTDRKRFVLPLQDVYLKVVGEVSFELDFVKPFDSVQLEIGGRVETYWKSMLPG
FT                   VAAASTVGPTRMTPNSGVSGIGGSLSSKSAAAGPTQAVADKSATASSNGAVGTPSVGSS
FT                   GAASATAAAAQPTLVTGSSLAGEYLRVVVQVTKDAKAVVWPAQFIPLPGLQVYVGSVTS
FT                   EEFLSVATQTGRSLDWTPAQAAQASWVDWQRALERSVVTLETLLSLLPVSVGIDIDVMY
FT                   PSTAEVRSNPGMPKMEVNQFVDTILHTVYAAGTSNREQSRKILFSSRSPTVCTALNWKQ
FT                   PNYAVFFASFCGIDGMASLERGQLLPSTRHETDPRRESISEAVRFAKSNNLLGIMVDVA
FT                   LLNHVPHLVESVKASGLLLITIGKFKRQQSLPQLEEVAELVDDVDGEVDQGIVVCKS"
FT   CDS_pept        complement(146635..147018)
FT                   /codon_start=1
FT                   /gene_family="HOG000000714" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02861"
FT                   /product="conserved hypothetical protein"
FT                   /note="pheromone response, mating-type determination, sex-
FT                   specific proteins"
FT                   /db_xref="InterPro:IPR019434"
FT                   /db_xref="UniParc:UPI00003C1ACE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK2"
FT                   /transl_table=1
FT                   /translation="MAKSLRSSSKLKARNQKRSNPKSDYAVAEAARVNALSARLAAGLN
FT                   KDKLPVQGDSKHAEEEMIDIGSVEKQEDGATQQNKISTSGHRDSRRETYRKSRGLKPFK
FT                   NSGGNSLFDAHKSKNNGKAKRRR"
FT   CDS_pept        149037..150725
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02862"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1ACF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK1"
FT                   /transl_table=1
FT                   /translation="MRETKLHIPMTTATGETIGIVGILAQIALPPHNPQEHEPHPVYTS
FT                   RSTTAPIEPFSRHIQQGNLNRPDISNDPSASAHLVHRSSHFVEDDHATMQRLRHKDQTF
FT                   KRRGYPIYPIDKRDTRGLKIALILHGVLAHKDQIYHKQLARALPVDSFRFDFRANGETP
FT                   GTWSMGNLADDVEDLVAVVDYLRTKLEYTVEIIIGHSRGGLDGFAWFAKHCPDALPPSL
FT                   RVPFFVALSARFNMANIHERDPVYLSAFAKEGFFRWQARVAGQDKELHVYPEQVEQFAA
FT                   WPTREIALAFPYNTDVLLIHGTADKSVPASDVTSYGNILSGIHRRPGSCSVKLIDHADH
FT                   LFRGFYPQVVEAIVEWLAERSELTKMGLGAAAIRDKETLGLARFNPSHFGQGRAAGSQL
FT                   WDNNLAGTVGGAVRGGGLGAPLLDNTGISGAQRPALGASISPFQRYVAASVGGVPSQPK
FT                   QERMPQADDSRAAKEDMSDTANSILTADQRSPTPTTPVERPPAESPFQSQHAASIAPKM
FT                   SQDTLGTGHVATSSHAPASTTASTDEANPNHASIAVSSQRAKSRL"
FT   CDS_pept        complement(150986..153580)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02863"
FT                   /product="conserved hypothetical protein"
FT                   /function="DNA binding"
FT                   /function="catalytic activity"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI00003C1AD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAK0"
FT                   /transl_table=1
FT                   /translation="MGIPGLWAELAPAAETTTLHSYLLTSFVQNRNELRGLRLGIDASL
FT                   WLFHALQSSGGANPHLRLLFYRLAKLLSLPVLPVFVFDGPKRPTWKRGKLVSGRQQVIE
FT                   EPFSYLIEAFGYQWHRAPGEAEAELAYLNQVNLIDAVLTDDSDALLFGAHVVIRNWGKN
FT                   LSGTMAFSRTTSTSGDMFDQAAASTQDITTASAASRPQLSGQDGNHLITLYNTLELSNR
FT                   YYMGLDRDALILIGLMSGGDYDTTGLLQCGIKIAVALARSGFGYSLNRAFKASYTSQES
FT                   ASHTCPKFERFLKTWRENVREELRTNKIGFLPSKRPKLASTIPNNFLSTPESRKVLAYY
FT                   LYPLTSQSNKQFDPSFFYFKGGMAEPDLKRLARLTQIYFKWSKEAILSKFRTILGPGVV
FT                   VRRLRQESLEITAWTEEQVMSWRVRQQFIFIDVASVARRVSVSTTQQKSRALHDSPNAT
FT                   RITDFFAKAAIATRPCAGTAETVDHLETSLSSLPAFRSSVKILAIKMQRRHAALDPFRD
FT                   FRVLVPMEEFAELAQLGIDDALDTRLASERMQGNESDTDRLGDQQEDTRTRPKSGMAGK
FT                   RPDPGSPLLMWIAEPLLELSTSGAGPLHEFLDEVEKKAAAAQAKELRKKAATEARSKAN
FT                   QTTLSPFIESSVKPSLRNQVKATPKGPQSSDTSSKRSSLVQESTSGAVEAPHTPRQLRV
FT                   PSGMQRSLRRTESVPVPIATTDQTSAGFAAPAPCRGRGQSRHISLPDATSALMRSSDAD
FT                   GEEADSSIEFLGAVVSDRLASGGAGHSRAATPPRSTSNGSEEQRRPNKSPRKLLTPAPH
FT                   RTTTSRSTPSQRALAEPVIIDSEDSDCDDHDAELLNAAVKPFSTRLAESMAQ"
FT   CDS_pept        154068..156335
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02864"
FT                   /product="related to Acetylcholinesterase precursor "
FT                   /function="cholinesterase activity"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="UniParc:UPI00003C1AD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAJ9"
FT                   /transl_table=1
FT                   /translation="MSTINQSIDGLTSKHDLLLPLQGYIRPRRVHLASFTAETRKGSVL
FT                   AYLGIPFAQPPTGTRRWQVPQGPLPSWSKTRNSKWQSDPYQDFAAMEGMHRGRKNAKTA
FT                   IPRSEDCLYLNVWVPESKDNDHAKRPVLVWIYGGAFSVGNCSRPLHDGARLAHESGCIV
FT                   VSLTYRVGALGFLGSHSMTEEAAGEWPLVMLESLQNRPARGQGAHVGAGNWGLWDLVSG
FT                   LLWVQNSISVLGGDRNNVTVFGESAGSIAIHYLLLSPRTPEGLFHKAILQSGVVATLLP
FT                   RTTQAVQATFDSLVRSLCPYHLEGDDKAQLEYLRTRVSADDISACLRPLVGKRPRSEYT
FT                   PTLSDMKRLPRARENLNGGDAFSVTDQWGPVWDGAFVDPDFVERALGPLPPKSQMRNGR
FT                   SGVIVGMCADEGTMFNFLIATRQSLAAHQDLFHPQLSSDLGRLYGFDIRELVASKLSGR
FT                   EKVLRDQQAFYTCATYTGDAQFTAPILDYMAAQSGHAADRTAEEDCVDTYGFLLAYRPS
FT                   WGMLEALTVVPEMTEEWAAFHTLDVPFVFGLTGHPGLDGHVYVSDVSDYGVDPEQDNGK
FT                   DAAAMPLVHSRSTSRGMTEEEKQLSLYMMRTWTAVAKLIECDGGGELKLPDGSTWLGLG
FT                   SSTEEASKVGIDRIRLLAIGEAPQAPAKAATANVGGSIRIWQTQLSQHAFAQQHGIATL
FT                   PSLQDRVRFWMHEPITGTGSASQSHADAAQSDKLRLCRSMQNYYGFLSTPPVFLPWKPS
FT                   QS"
FT   CDS_pept        157109..158686
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02865"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI00003C1AD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAJ8"
FT                   /transl_table=1
FT                   /translation="MRIVSSQLLTALTALLGAASIQAAPALDNDQLVYQSATPSGLGAL
FT                   TLGFSSKLFSTFSSLITHISQPVAAFEDQGKTIWQVINDSEEFSQLAHILNYSSDATKD
FT                   ILKKKEDLTLFAPLDWHHDRERDDEDKEAFQDTSFGPASIHQWDAIQKQIADYERDYSI
FT                   DARRHDKGDNKDEEKKRRRECIRNLIDATALYHLVRSDTILDARTIGDNSSVATWLNSG
FT                   KAHANNDGTNWRVRTGKSLLPLPSIYLNFYSRVVKPNIRAKNGLIHGIKYPLVLPPDVL
FT                   QSLFYGQTTFSTTTSALQKAHIDKFFTYRPEHAHRHHADHDKAAGLIDTWYHERSASKH
FT                   FDGVPAETIFVPTNLAWSRLPFIFRAYLFSPWGTELLQKIFMLHSLPSDIVYADFVHHV
FT                   SHSGEPASDAVHSVVGHANKTSYTFDTVLPKINGTKGEHETVDVDVYRYYLLPGGRGPL
FT                   QTRMVAQNVSVILQDGPARNGVWHAIDRFLKPKGHPEQGVWAEVATAAEEAGFGSLDLL
FT                   SEAQANLW"
FT   CDS_pept        162643..163866
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11486"
FT                   /product="putative protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI000159533F"
FT                   /transl_table=1
FT                   /translation="MAQTQRLEQIQNYRQLIAQLNATMPASADSTVPMLPFGASFADSA
FT                   KTVGTGLNAASFGLNPMSADDPSWIGHGFQAQAAVDFLSSPEWTDPSPALTDSMSFEID
FT                   SCGPSPLLPLDGYEDDLGVPGIAGAPLFPPQDGYASSNVSPLEPAHNDFGSSTVGDFGA
FT                   PEMGSDFTLFPETRPAKLPIEMAFSKLNKPAAGSGTSNEDPAMTLLRALSSAALSASSS
FT                   TASVAVSNNSSTSVAASSTPVLTASPLAFTSMGAPQALAPSSTEATPPALQRTSLSLSS
FT                   SSAPVATSESRGTKRRMESTDLLPLDAPIQKRTYYTVSATSRRDTARAAEVDEFAEEEA
FT                   AIRREKDPRVAKRLSNTLAARRSRHRKAEELRLLNEKIEALTSEVESWKRRCEQAEKER
FT                   NDALALLS"
FT   CDS_pept        join(164553..164588,164681..165133)
FT                   /codon_start=1
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="grx5"
FT                   /locus_tag="um02867"
FT                   /product="probable GRX5-glutaredoxin"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /note="detoxification"
FT                   /note="electron transport and membrane-associated energy
FT                   conservation"
FT                   /note="electron transport"
FT                   /note="mitochondrion"
FT                   /note="osmotic and salt stress response FunCat:32.01.03)"
FT                   /note="oxidative stress response"
FT                   /note="protein modification"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003C1AD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAJ6"
FT                   /transl_table=1
FT                   /translation="MSAVFRQSLGLLRSAPARGSLLCNPTRACFTPTYTSLTRLLSTEA
FT                   RAKIDSAVKSNPLVIFMKGTPDMPMCGFSRAVIQVMQVQGVKPELLKTFNCLEDQELRE
FT                   GIKEYSDWPTIPQVYVDGEFVGGCDIVINMHQSGELEDLLEKNGLLLPLNEEAAKAQA"
FT   CDS_pept        complement(165497..168487)
FT                   /codon_start=1
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02868"
FT                   /product="probable ribosomal elongation factor EF-2 "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /note="ATP binding"
FT                   /note="GTP binding"
FT                   /note="RNA binding"
FT                   /note="directional cell growth (morphogenesis)
FT                   FunCat:40.01.03)"
FT                   /note="fungal and other eukaryotic cell type
FT                   differentiation"
FT                   /note="mRNA synthesis"
FT                   /note="protein binding"
FT                   /note="splicing"
FT                   /note="translation elongation"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003C1AD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAJ5"
FT                   /transl_table=1
FT                   /translation="MDDYDEFGNYIGPLSDSELGSDDDHSQGYGQDPPPSLEQPAPLEG
FT                   YDDGEDDDERLANMELDEDGNIVPQHALIRVDEAASNAVVLHEDKQYYPSASEVYGEDV
FT                   ETMVQEEDAQPLSVPIVEPIKVRRFAVQEQGLPETRFDRGFLSSLMGFPDMVRNVAVVG
FT                   HLHHGKTSLLDTLVYETHKIEVDMDTHLRYTDAHLLERDRGISIKSAPLSLVLEGTKRK
FT                   SYLLNLIDTPGHTNFQDEVAAACRLADGVVLVVDVIEGVMCNTVQIIRHCILQQLPIVL
FT                   VLNKLDRLVLELRLPPNEAYYKIRHAIQEVNNCIASFDANPALRLGPERGNVAFASTQM
FT                   GYCFTLRSFAKLYAETYGASIDVDAFAQRLWGNIYYNAESRNFSRKAPDAESKRSFVHF
FT                   ILEPLYKIYSAVLSSDTHTLKRTLAELRIRLKPAVFKVDVRPLLKIVLNQFFGPSQGLV
FT                   DLVVDNIPSPKDAAVKKLEKCYTGPRAGAIYEAMAACDADASLVIHVSKLYQTIDAQEF
FT                   RAFGRVMAGTARPGMRVKVLGEAFSQDDEEDMVLATIQTVGVYETRYVVPTDGVPAGNW
FT                   VLLSGIDASLSKTGTIVDASLATEDVSIFAPIEHMTQSVLKVSVEPLNPSELPKMLEGL
FT                   RRINKSYPLAVTKVEESGEHVIMGTGELYLDCVLHDLRVLFSEIEIRVSDPVARFCETV
FT                   VETSSVKCYASTPNKKNKLTIICEPLEKGVAEDIESGLLDIKMPPKQLGKVLQEKYGWD
FT                   LLASRSVWAFGPDERGANVLVDDTLPSEVDKKLLYAVKESITQGFQWGCREGPLADEPM
FT                   RNVKFRILDATLAHEPIHRGGGQIIPTARRACYAALLMATPRLMEPIYEVEVQTTATGV
FT                   AAVYTLLAKRRGHVVKDTPKPGSTLYTVQAYIPVIDANGFETDLRIATQGQAFAMMFFS
FT                   HWSIVPGNPIDSSVKLRPLEPAPMLGLAKDFVVKTRRRKGLPENVAVASYLDAEMTVAL
FT                   AQAGIEM"
FT   CDS_pept        169267..171954
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02869"
FT                   /product="related to General alpha-glucoside permease "
FT                   /biological_process="transmembrane transport"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003C1AD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAJ4"
FT                   /transl_table=1
FT                   /translation="MPSISPQHTAEPSSSTQSTLHSTPAVSQVRIQTPEAPASLDELLK
FT                   SPHNPALQIRQPSSTLRGATPDDQRRRNGFHLWRTESEDARNARLRQAIQAAEAQANAP
FT                   PSLKHRLGNALGKASDWIQSRGFLSLYRLNPIQLGDGTEAILSDAFAVRSPKLSRLGLI
FT                   VLTISLAGAQLAWTLELAYGTPYLLSLGLSQQSTSLVWLAGPLSGLIAQPVVGSLSDHS
FT                   TSSFRRRKYMIISALLLTVSTITLAYSVPISTSLVDLFGGGLADWDPRRHDLVHSTTQI
FT                   ISVMAFWILDFALNGLQAASRALILDTAPSEQQTIANAWQGRMTHAGNVVGYLCGWVDL
FT                   ASWKSLRWLGGGQFRRFAMISLLAMISCVSVTISCISESPTDDRFSQSTHQRQSMCTSA
FT                   WSTAQATLDDVWHAIRRLPRSVRRVCLVQLFAFMGWFPFLFYSTTYILQIAQYERNLEH
FT                   RRTHDDLILVQPFDAGQGGQAGRPSSDRDAERGSFAMLMFALISLVSAALLPYLALAGE
FT                   KRDQPCLKNADSNNGQETPTPPLQINIPADRASLWSEPRHTADREHSERISRVQRVTRG
FT                   LVQGLTLRTFWSVASIVFAALMLVGTAWASTVRQATVVIALVGVPWSVAAWAPFALVGE
FT                   FVREAEDGASPFEFEQDHWSPARMRARAAATEEGRPRKHSQPSAHESVSRVDQADVGAG
FT                   GGFKYIDQVSPTRMGRGGEQGARERIRASLVDCAPLPRTSTASSEDVESLHVAPHCGDG
FT                   GGWRSSSYSSHAPTPQNATGGAGTILGIHNLAIVAPQFVVAIIASLIFSAVHSSLSATH
FT                   LVLNSPALASLADRDHRVAQGGVVNPAKGTVWVLRFGGSMALIAAVVARFVPLTLSERQ
FT                   RRYPAQQPIQHHAAGQHDDYRDVL"
FT   CDS_pept        join(complement(173823..174145),complement(172290..173550))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11487"
FT                   /product="conserved hypothetical protein"
FT                   /cellular_component="cytoplasm"
FT                   /db_xref="InterPro:IPR007320"
FT                   /db_xref="UniParc:UPI0001595340"
FT                   /transl_table=1
FT                   /translation="MPQPASDDGYDSDSGSEFDASDVQLGLADGPLEGDDEANPLVSRI
FT                   GGRAAWLPMKACPSDKIAQCNSCEQQMQLLVQIFAPLVESPYDRCLLVWGCARPACQRN
FT                   DASSLRVIRTLKFNRRWAAKLEKQKAKRLAREQAKKEREAAAAKAKQEQEERAKINPFS
FT                   APAGGANAGLGGLLFGGSSDNPFATAAAAAPASATHVADEAQDSDDESGDESDEGDEES
FT                   ESERLAEELALKSDLAASAPTAESTWVESSTRYPPLYLNTVPEPCSSSLSKKLSKQEAA
FT                   MLKSASASGALTTTDSAADDADLKGFAKEGYEKMLLDGIDDTFERFLKRVSVEPRQAVR
FT                   YEFGGQPIAFHAKGKIYDLLWPKEYQPKAGQGVAVTKGQFTAGSAAPGERSFSARAVPP
FT                   CQQCGAERVFEAQLMPNLINLLRADQIQAADGSVAPDALEVSLSETQDEEAKRKAAIEQ
FT                   ALGRRLPGSAEGNGQKATTGDLTFDARTGLVWSTAFVFVCKNDCCNGELHGDDECWQEE
FT                   VVLAQFEDEQ"
FT   CDS_pept        join(175593..175605,175815..175876,176031..176099,
FT                   176199..176468)
FT                   /codon_start=1
FT                   /gene_family="HOG000214661" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="erv14"
FT                   /locus_tag="um11488"
FT                   /product="probable ERV14-ER-derived vesicles "
FT                   /biological_process="intracellular signaling pathway "
FT                   /cellular_component="membrane"
FT                   /note="ER to Golgi transport"
FT                   /note="Type II protein secretion system (general secretory
FT                   pathway, exocytosis)"
FT                   /note="budding, cell polarity and filament formation
FT                   FunCat:43.01.03.05)"
FT                   /note="development of asco- basidio- or zygospore
FT                   FunCat:43.01.03.09)"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniParc:UPI0001595341"
FT                   /transl_table=1
FT                   /translation="MSGEGWLFLLSVLLSAVLLFTMVFFIIMFSDLECDYINPIDLCNK
FT                   LNQFILPEMAAHAVLTLFFLLSGQWLAFLLNAPLVAFNVNKVMNKNHTLDATEIFRTLS
FT                   QHKKVCFIKLGFYLVSFFYYLYRMILALIADTE"
FT   CDS_pept        complement(177574..178041)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11489"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595342"
FT                   /transl_table=1
FT                   /translation="MNADRKPFALAIVVGVSKFTNLDVVTVLLKVASRLAFRAAFLAIL
FT                   VVDQQFRHEANPELSCVSQLGKSHHPDESFLDKRLVTIDRLEKQILSAEMVKIATRGFT
FT                   LPVTFGDPSVKVSLHKHMETVRSRALYLPDNNDSIPPLRTAIGRSKTLSSR"
FT   CDS_pept        join(179918..179941,180084..180756,180839..182340)
FT                   /codon_start=1
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11490"
FT                   /product="related to B56-delta regulatory subunit of
FT                   protein phosphatase 2A"
FT                   /function="binding"
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /note="cellular signalling"
FT                   /note="stress response"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001595343"
FT                   /transl_table=1
FT                   /translation="MKGLKKAMNLSRSKSNDSNGNRSGSAGGGTVPAPPPKGGSVPANP
FT                   AYQGSLKSTKNGPSSASSSFSSLSSSATSAAPSHAPYNVPVYPTGQGTPQTRLLPHGVN
FT                   NLADKTPPAPPVVVVDVSSEMPADPIPHSVATASQPSSSITPFHHTGSPGSPPPPGAAM
FT                   ASLSSTGIAASELATPPKAASLTRLRQSPSNSGPKDTIPITSKTPPRKQRSSRFHVTEK
FT                   VELEKLPHFNEVVPADRPELFVRKLRQCSLVFDFNDASQELEGKQIKAATLHEMLDYIT
FT                   TNRKVITDEIYPEVVAMFSANLFRSIPPQVNPVGDAFDPEEDEPVLELAWPHLQIVYEF
FT                   FLRFVESPDFNTNIAKKFIDHHFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLNLRAF
FT                   IRRSINNVFFQFIYETERHNGIAELLEILGSIINGFALPLKEEHKTFLTRVLIPLHKVK
FT                   SLALYHPQLAYCVVQFLEKDSSLTEEVLLGLLRYWPKVNSPKEVMFLNEVEEILDVIEP
FT                   SEFVKVEVPLFQQLQRCINSQHFQVAERALYFWNNEYIVNLIGDNVQVILPIVFSSLYQ
FT                   NSKAHWNRTIHGLVYNALKLFMEINPALFEMCTNEYKQQRQMEKQKLIDREEAWKRLRD
FT                   TAIKNSKAIGVEMPASLKEEQAAPAGSVNPYDLDAFDSAADLTAGADSLFEQMGQGING
FT                   EVSTTDFDDVEAHRVAQETSQAQQPDLTREDSVDDMVR"
FT   CDS_pept        join(183243..183481,183569..183719)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12197"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595344"
FT                   /transl_table=1
FT                   /translation="MHRPTSLYVTLICLLGTVMSVRAATQRVGDSCSYKQNCQDWAEGV
FT                   GPDWAKGAITCAVPQDGKPEKCGSGDKKGRDEFSGVCKAVGTLSATEYGCACGVHKADC
FT                   PETSPFSRIFWPQDWLETAWSQVHH"
FT   CDS_pept        complement(184048..187923)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02874"
FT                   /product="related to SGS1-DNA helicase"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent 3'-5' DNA helicase activity "
FT                   /function="ATP-dependent helicase activity"
FT                   /function="catalytic activity"
FT                   /function="helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /biological_process="cellular metabolic process "
FT                   /cellular_component="intracellular"
FT                   /note="ATP binding"
FT                   /note="DNA binding"
FT                   /note="DNA recombination"
FT                   /note="DNA repair"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="UniParc:UPI00003C1ADB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI9"
FT                   /transl_table=1
FT                   /translation="MPQSALTPNTPYRACKAEDRRSGIIYLDDDEHTHLDDVKHVGARD
FT                   RPSPKRSITDDQDASTAQKRSRSGPSAASISNVSGGLPSGSRLPQPTSSGSISQTPRKY
FT                   PPLGSSQTAPPQYDSQYDKYSEDELRIDFAAKEQILRGRLAQLQTLELGWHGPEAWYQK
FT                   HEAFERVHEMQKKLAHIAWALGAKEFGAVPAPSLTSATTPGHTAENTSRRSTPVRSLPA
FT                   NPYSDSAVRTTSSSFQILGDNMVSAARKPLASPVTTSREQTPSSTASKSNSTAPLRVLR
FT                   DPSHILHASDDIVSANENSTDLPEIVDNSIQHRTQADEAPSVATSAVNVDDQDGFLQGS
FT                   LSADRRDQPIVNAQIYELSDDDEDDVEAMPVEEKFKLCGPSMQEPMSKDQLRSMPHYPW
FT                   TTQVGYVLKKFFKLKRFRRNQLEAINGTLSGRDVFVLMPTGGGKSLCYQLPACIDTDKA
FT                   TGVSIVISPLLSLIEDQVLDLVRKDVPAVKLTGDMSANDRRDAFNTARDRVGSLRLLYV
FT                   TPEFIRQSNQAMELLDLLYSQKRLARIVVDEAHCVSQWGHDFRPHYTELGALRDKYPQV
FT                   PIMALTATANARVIKDVKSCLKMRNVLQLSSSFNRPNLEYQVRKKPKSKLIDEIASFIL
FT                   TSHKDECGIVYCFSRESCETVADDLKKHGITAHHYHAKLGKDDRSKVQQRWKNGEYKVI
FT                   VATIAFGMGIDKPDVRFVIHHSLPKSLEGYYQETGRAGRDGLDSVCILYYSWTDVRRME
FT                   NMMLSEEKSQEAIDRSIDSLREMQRFCENEIECRRVQVLRYFGESGFTSEQCRSTCDNC
FT                   CRQSGAIYIQDVTELAVKAIKLVKAIADKGGRWTLPHCAEVFYGHRTKKIREAGHDKLE
FT                   MHGAGSEIAKVEIHRLFEHLCSEGVFKLKDVMNRAGFNTSYLMVGSAADKVLNGQKAIK
FT                   MQVAAKVSAASSSLNNGRGQNTRKQQRQLRDEDFAEFDEDAHDISNVSLTPPSRVEPQA
FT                   GTTDGSLDDDNWIPEEMFTDNFDLDADTDDDAPLAADNQAANGSRRVVSNAAGSDDSAD
FT                   DFEIDPRSSDVNQGCYRELKKLDDRLARQEKQSRGWLIRDDKLQEISVLAACSIDALSS
FT                   CLRGTDGARWVQKYGSLYIEICQRFLQTERRAPDVGRTAATGGTGRRSTLARNAEAEPT
FT                   ANTPKSSATAGLRKERAAPRKSALAAAASLGQYTYQDPDTRATRSRGSGASARNASRAT
FT                   SGNGRAAHASSNSTADSRVSATAAQAPQPLKRITLHRGFLGGANATPAIRPMPLASSST
FT                   PNLPRSG"
FT   CDS_pept        189204..191285
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11491"
FT                   /product="putative protein"
FT                   /function="DNA binding"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0001595408"
FT                   /transl_table=1
FT                   /translation="MESPVAALIRSGNLGQRQEDSFTPDLQHSRYMSGESDNESAYPTP
FT                   SDPTTAAQPVPHETWPISSNSKMIDGIPVRADEEVRKIHYIDSSADHAFLTPATKLEAP
FT                   TAVATTTTMPSSSVGNVADVSHLQVAPTNQAASAAPTGASPISSATLPPCSSAAQNTGT
FT                   AQGLTGNAAAVSSMPATDAAVCAADALPLRPVNMATSSAASTPASTPGATPQTYARKRG
FT                   RPRKHPLPDPNAPPKSKRKLSPVRSAAAAAKKKATAAAAARSAASSAGSLLSVPDLGRL
FT                   IPQGSTSDNAQNFIQNNLRLFADLFVALQKQAATDSPARNESLVLLTGATQENMQHALD
FT                   AGQNEVSNSESTRTSVIDERPPEDMATSAREPTAAPSTLYADTGAGMANVGATSSTSAA
FT                   PSNPISGPSDAIRDEIKKKMADVTKGREAIQAEILQMRVDASFFENAQKTVDERIVVLR
FT                   DRIAKHTALLQREREATRQAREATRRAKKDRKAREKSLRDSEREERRLAQTFAQLEREI
FT                   AAEEEERRRLEEVDSSDEEEDERPEEQRASVSGSQLPATETASLSASPTEATTVSATGT
FT                   PSIGNEAAITPDRAIGFSDEELAKVLGISTSELAGFSQTLELTAGLPTSPTRTPLSSSA
FT                   AQPDATPSTFASMLPSVTEASDSNADSFDVAAFLEIAGSFGSASDAITSELSATQQQG"
FT   CDS_pept        join(complement(191980..192163),complement(191710..191897))
FT                   /codon_start=1
FT                   /gene_family="HOG000164754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02876"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniParc:UPI00003C1ADD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI7"
FT                   /transl_table=1
FT                   /translation="MILITRSAIKFSLSNSAAQSASRRALYTTPLVRSGGFNRPGPPPL
FT                   PPQEQKEFENLVKQKQNASPFLSSSDPEKGEMHPDARRKPKAEFEGETNPTTGEVGGPK
FT                   NDPLKYEKEWTYGGRATDF"
FT   CDS_pept        complement(192751..194364)
FT                   /codon_start=1
FT                   /gene_family="HOG000234572" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02877"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003C1ADE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI6"
FT                   /transl_table=1
FT                   /translation="MGLQLWGAFTPEQRRNIGIYTCGIMCYKVALELFAGSFITQANER
FT                   FGARRFEKIAILTGTNYAAQCIGSIIVAPLIKRFPTRTVLATAVLTFGIIATVPLIADA
FT                   ATGGVLKYKTANNKTKYGSWSPNGLFPIYVISGISYGTVELIRRVIPRDIVGGDVDRLR
FT                   KMDAFVHVMYEVAGTTGAFTSTSLIGKFGYNYSAFLSPVLFTLAAAVWIWISSLGESQR
FT                   NEEESRLARVEVETRGIVMSMVDGVRAFIKAFWYGGYLIFTDRRFIWLVPGYAFALYGH
FT                   RYLENGLAPIYARAIIGVSSYSQIIVGGSNFGELLGALSVMIFTQAIPTPMPWLRLDAL
FT                   LLNLVWVMPFFPYTRGNVGSAWKLAAVFIPVSYGWAAGDVSLAAYIQSTLARMEAKDKD
FT                   VSALGSVMAFLYVTYIVMYSLISTFLGRWIDRQLRGLSGVAAINRARDCLKYVGGVHFT
FT                   VLSIVIIAATFIPKGSFSFNPKAIDTSLLQSDEESDRCSQDDIKEAKYQERDSFAPQDI
FT                   QGDAVGALAQNPAARVPTRQ"
FT   CDS_pept        join(complement(198171..198335),complement(197679..198074),
FT                   complement(197128..197169))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02878"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniParc:UPI00003C1ADF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI5"
FT                   /transl_table=1
FT                   /translation="MSGHFPRLNLDRPADLDHVLRAIDQHAHKVAQMEFGSELERDKAL
FT                   RALVNKTFKRLTGAAKAKIERNLLYNGMSPSEFARHSKGVEPFDEDLSRRLQVLNDQAN
FT                   TLTTEVIGFRKALPARRAEAMEKRAAVIRALEAKKEEQRRNAEKEHAQQLREQSKPVNI
FT                   DLKRKAEVAGTLKQSVVDITGLQVNVESTASRPIYEV"
FT   CDS_pept        199046..201661
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02879"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1AE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI4"
FT                   /transl_table=1
FT                   /translation="MTDEKAVVPTQKHRPTFTQLPTILVRLVNDRFDEDQYDQAVELLE
FT                   QLRVEGVRPPKSLIQKLVGLSLCSLAPRQVASTSRWTLDHQLHNIAARLLTQHKGTKSD
FT                   RDAMKTTSSTPERPSGSAVLRASSLLIQYSRCNALISVDNTRPQSEAERNASLLALHVL
FT                   ESLPSQRRPLESRKSNRSASTQRARLDSERLDDSDHDGSFEVSSIEQWVYDHLQQAEDV
FT                   WDLLSGRRFSNDSESEEVSLGRVSEFWMNDSERKRYAKQLHAFATAHQRLEDRLRDHRW
FT                   KKLNGGTDSNSSDSDSDEVSDEDILGLKAKRSVQPNSKRKATCQQKKPDKRERTRKGAR
FT                   LPYNDTGTSHTNVKMTEGGWRTLSVLLELWHRASPQAVGASADSMSRPIDEPPLLWQFP
FT                   HSHVTSQDDRHPTSKIAAGKDTTDEIGRALDVAFSFPSVLPAYVSCSSGTEASVNLFDT
FT                   AKSVTACGDARLFSSVSAAELMHRHEVGNQKVERLMAVRAEAAAWLLSSMYELVKLNYI
FT                   SHVALLEGMSDRMEALQAQEIQFIMLPLLAKEAYLVAAVLIRNLTDTTRTRPDKIKALD
FT                   HSHFLFDGQGIITMDAALAYAIPRHESAITLLQACLMRYQDGNAKAVLQFLSLNRLELD
FT                   DAADSDLQLTLPNRAESGKQAVVRKQSRRHLKTKPSTRKTGKMMTEMQASEAASTELTE
FT                   DMMKNGMLAFAFVRTLQMGARNRINQIKFLIARAMSVLHAGNQTSQASPDAGASTNDRN
FT                   PRPAQDSESKTNKLGEVESASQQRNLEVFLTQLCKALEHDVGDFQSCVAAMKTHVNQDS
FT                   ADRRFKDLAGQLVSGTSDRDAPVSLPSLEALVDRCQKYYDDTQHLAHTTRMLLDSVKWS
FT                   "
FT   CDS_pept        complement(202072..202878)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018796"
FT                   /db_xref="UniParc:UPI00003C1AE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI3"
FT                   /transl_table=1
FT                   /translation="MANTPLLVRALPAIPALRTATLFATPSSSRSASTSLPSSSTTSTP
FT                   LRRSARFASRPGADMVGPPDPISNLRPIRYGSAFEQASSSSASTSTSAGQTLAISHPYS
FT                   LQEFTTSGESSWSSARSARSARSPSPYFERLLSKLEEAELAHKLRMARADNFNQRFWQD
FT                   NNARFIQALSEFRSRTGSSKAVATLPKSREHVKQAAQESELDLDSDSLATFYSAWLKAN
FT                   AARHRAYNRQLWRQTFGDLAPAARYQGLRAWAKLVGSVQRKLGRIN"
FT   CDS_pept        203948..205159
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02881"
FT                   /product="related to Cleavage stimulation factor "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /note="3'-end processing"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003C1AE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI2"
FT                   /transl_table=1
FT                   /translation="MAGAQRGSRVVFVGNIPYDMSEEQLTDVFREVGKVVGFRLVNDRE
FT                   TGKFKGYGFCEFEDPETAASAVRNLNEVEVGGRPLRISFADIDPLMEGRSTQHGQFDQD
FT                   DLRRRAAAAGRAGRPGTFGHGGTARGGGMAGGGGWQQRGPADSGFGQRQFGGPPGGQAY
FT                   GGPVGAQMGGGAPGGYAGAGAASMGVGGGPYTLPANLPAGVPLPAGVGSTDAITQTLAT
FT                   LPPNQLLDIMSQMKSLVATSPDQARALLTGHPQLAYALFQAMLMMNVVDPDILQRILAA
FT                   SGAVPGAVAAAAASVPPHMQTHSGASNGSATPPQRYGTAAAATRYAAPARPPPTSYAQP
FT                   GYGGAPSAPAANDAVAALAGQNLPEEQKALLMQVLQLTPDQINALPPDQKASILQLKAQ
FT                   FGQA"
FT   CDS_pept        join(207929..>209011,<209244..213581)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um15086"
FT                   /product="conserved hypothetical protein"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniParc:UPI0001595409"
FT                   /transl_table=1
FT                   /translation="MTPPNIQSSPPPLPYKPQIRRPSTAKSTRTLSNSSIPTLATARLA
FT                   TQPSPSSSSATLIQHSPLQPRRPPRSAICPSSSRPPLPHSALDPSQDHHRSDSGRSTGS
FT                   SRSTATTDSFFLPQHPHPFNRRLKDLPSLPPSSSFVDSPTPHRPHDAPASASASASALD
FT                   LNLTIASSVAPALVPPARLFRSQSSISTTPTSPEDGSGSPLGGSVTADHAPLDDANAKL
FT                   QAQHADSLDDFWQADYSYARPSTEMRKTTLPPLLRSNAPIPPSRSQSLDPLAEPLDANS
FT                   VDSPSQHNQSSPVGSAVPLLAANLQKLNSQNDLRRNSVSVTGKLASPNPSSLSGNSLPP
FT                   DAATTLASQRLAYLLTNSQQCMTLSRQAKTLRNSFMWTPPTTDNTIAAKKEPSITSSLF
FT                   LSPDSLSTPISQASSPTPAVRSPQLQSSVLTSTQLSSHNQGILAPQQHHCAFPPISSAK
FT                   TSVPTTVAASTPSSFSSTDVLPKRTASKNANTDASLTFSASANTDLPNPNPKPKKPATD
FT                   YGKTADRSRSRLSSRITLQNANWSMKISNMKTKKPTDASAFTSTTSHVGADASSRTTNR
FT                   RSKSQASLSSALTAASANTIHAEVRDTAERVPRLESSKAPASLLIDTTPVSTSESSGVD
FT                   PRLSPSFAATFAFLNSEIDSTDHSPLLVSTMLPSQENAQNAIRIADRASLPASVIPAIQ
FT                   SSPEHKVSQTSVTDLYDTTIATPSSQPEPSRPSDAEDARAQSALFDRLADSPEAVHKTL
FT                   VLPDPLHPPASTSFDRVSAASQSTFQRHSHKKHMSLGSTTLISKSARKAASDLDKRACV
FT                   ASSGLPLTNVNAASRWSFASALPLFTPMSEDGTFFDALTSPLDEQPSNVKASPSPPDNS
FT                   VLPSFATATEFFPLTKTEPVSPVHDQPFTPCTKTTVAAQMAATAQAMPPPNRSSLGRRL
FT                   SGVVEPSKVRSSDHCALASPSQSTHAETMRRDALPARPETSLGFYLRNPLRKERKASQK
FT                   AAQSLTPTVSRTETSSTASHKSPTSAIRRMSTGFRLDRSLPVKKELTRAETSLGMAASE
FT                   VKSARLFSSRVLAPTKSSLARSVQRSPPSTGSATAKSSPASSLATPITKALSRSPQRPT
FT                   NPPSSYRGSPAASSRPSVSAVGSAFKSTPSSKAPLSSTSRGRTSSSQDVATSMATGQDA
FT                   LPAAPSNPTNVRRRRTLSKPLLNPIRTSFSETRNYSRPSTAIGFRGGMTAADRKMSQPT
FT                   LDMVDDREFLEALEQVRAVQRERIQAEAQKVENKSRLARLGMASGNHLKTKNPESALDK
FT                   DNNDTSTSPNSLNRSVNEPVTAAAPTSIVPARPRLRHKRSASADAQLAHVQTTTSVAAE
FT                   ESDRDIDQRQKDIVKAYADKQPLVGPPTSGLEWGVGKASGKLHDGAFVNDDDWKKEVKA
FT                   LFLIRELVQTERSYSRHLSSLLGVIRKMPVAPGSNSPSCPSMKRKSTSNLFAAYSSAVA
FT                   SKTSPNASPPSHMALMRTYLPQLIALSNALVQRVEENPTSAGVGGAFDMLAAQLESTFV
FT                   GWSGVASQALAELRSTEMAKSKSPFKIGLVPLMPRESTEVGASTADAVSSASGSSTPGS
FT                   SFRNAALRMTSFTRPTSPVVSRRDSNAPADGNATVTTKRSTKRRSTITSTSFHPPPRVV
FT                   VAAATVLSSSPEQDKEGDSSAFATTTTAAQRFGHLRSQSTLVTPLPTPTSSTAPDPWSA
FT                   PPPSGGKSLTPMDIAIMPTQRLPRYGLMLRDLLRNTPPESLSHVRVQRAIGLIQKVAGL
FT                   CDAVAPVGVTGGRGTSGNSSGAVPSARARSVMGVASTDFAVNAGSSITDQ"
FT   gap             209012..209111
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.98-um_contig_1.99"
FT   CDS_pept        join(complement(214249..214451),complement(214061..214157),
FT                   complement(213878..213967))
FT                   /codon_start=1
FT                   /gene_family="HOG000135972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02883"
FT                   /product="related to Prefoldin subunit 1"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /note="protein folding and stabilization FunCat:14.01)"
FT                   /note="stress response"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI00003C1AE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAI0"
FT                   /transl_table=1
FT                   /translation="MSSIPDETLSKVLEKIQLQVYQTNQQLAALRAQISARERESKLLT
FT                   LTLTELQAIQDSNASFYSSVGKMFIQESRPVILADLTAKHQANSADLDAFKKKQQYLVK
FT                   QGQDAQAHLKDIFSSVNRHQQQQSA"
FT   CDS_pept        complement(214845..215918)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02884"
FT                   /product="conserved hypothetical protein"
FT                   /function="intramolecular lyase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniParc:UPI00003C1AE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH9"
FT                   /transl_table=1
FT                   /translation="MLTPTLITAAGARRSAASCTAAARGISTFTRSYPSFQVCSASSQP
FT                   RAAAAFFQQSYHPCVVALSTPESSHTAQRKWKSLSAAAALAGIISIYSVSSTDSIRLDA
FT                   VAASGTGSRLTSLSGDVSKQVVVDADTNLSFPLYMRTPASLASDEPQPRLRLVGLGVRT
FT                   VSFLRVRVYVAALYMDESALHFDSSAETIEQHMKHLLDQGTPAVIRIVPVRNTDFNHLR
FT                   DGFIRALQNRLKKAIRQSQIDASHETQFQQEIQHVKDAFPKGSVPKGSPLDCVIVPSGN
FT                   QKPARSGLVFEYGGEVFGQDTARDELKHEVKPVDASFTVARELVLAYFAEQGEISTPFK
FT                   KSVADALLVQKQLPTSQ"
FT   CDS_pept        216815..217354
FT                   /codon_start=1
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11638"
FT                   /product="related to glucosamine 6-phosphate n-
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.4"
FT                   /function="N-acetyltransferase activity"
FT                   /biological_process="metabolic process"
FT                   /note="aminosaccharide anabolism"
FT                   /note="aminosaccharide catabolism"
FT                   /note="cell wall"
FT                   /note="metabolism of primary metabolic sugar derivatives "
FT                   /note="mitotic cell cycle and cell cycle control
FT                   FunCat:10.03.01)"
FT                   /note="protein modification"
FT                   /note="pyrimidine nucleotide/nucleoside/nucleobase
FT                   metabolism"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0001595416"
FT                   /transl_table=1
FT                   /translation="MPATTSKLTPDSELQLAFDPSLIPQASKDLLPEDIIVRPLASDDY
FT                   NRGHLRVLADLTQAPDIGLTAWSKQFALQLASPNTYYPIVFVHTHTDQIVACGTMFVEF
FT                   KFLRGGGSCAHIEDIVVHKDGQAKGLGKRIIEILTHIAKQRACYKVILDCSEKNIAFYE
FT                   KCGYHKAGDQMAVYFV"
FT   CDS_pept        complement(218114..219244)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02886"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1AE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH7"
FT                   /transl_table=1
FT                   /translation="MPSPANNRASAAALSPFGRNSQNAALLAKANKASSTPPSSPSSSN
FT                   SNRQAPSTPKSSKASALGTGNTGGGSGGKRSISLSSRSSPLPSSRLTSPPTPGASAGGS
FT                   SSFSMYDSTGLLSRDFETTYHRQCRTLLVTFVAAARMWEEIATFDGLKWAKEAVDGWEE
FT                   VYAANRIGEPESGATRQAKGAAGAYNSSVQDKKRALALDAKQAWDPMVGPGGWRETRLA
FT                   DAVDRIESAHDGLTTVVDRLTKVLNKLTNACDSLRALLDEASQRNGLEFAFQEPMWATW
FT                   PLEPFVERTAELTRQYRISTHHLQVLVPTLIQSGEPPASAGTRKHGDQETVERRSKHRR
FT                   AAYEAWIALPYLDTRGSHSLVGFEAVCEVEVGRWKE"
FT   CDS_pept        219678..222554
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02887"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH6"
FT                   /transl_table=1
FT                   /translation="MASSHRSVPGRSRAAAAPSPSSSGKQADEPTFLDPTDDATFQSLK
FT                   KLLSAPASSTQHLSLLSESTLFGSITFYLSKLELDHVAEFAGVISSSGCLWTPPPPAAK
FT                   PPTATPRSASNQVTWTTEPGSSSSDSEKADIAKTTTTASSNSARSSASSSLSGFLISRS
FT                   TSVSQAVAAALTKRADLIVRSKKNSTGWASRSALSQYLGAVIQGIDDTERDATPESYRA
FT                   ARGLPIPRLAIIGGLLNALSILKDQRARTRNMSILDEMAALRANPVLGLSVRQQLSTIQ
FT                   DEWIVTLAEILDHLHGQPGSSASATAFQAGSGSSASREREDDVDEWEAEFRKRTASVSG
FT                   PASITLLASKQTLRAALSDVRDVPLYMAAQLAPLVPDRKIHALDPVQLTSVTSDAILSL
FT                   FEGPQGSCFLATLAQDVHTQKSCGEDGIKILVDANGATANALQGILDSTLFPLLGPLSK
FT                   LMSRALAKAVTSLTPEELSALLLGTADAALEPRFGETEFFPFLVRMSRLSSRLEASWLA
FT                   SALAGANEDDIVESSRQLTKQLWTTFKTLLFSYTMLFDSMMDALVDMCPSPTLTIPAAA
FT                   AVAETDALVDSSLTSRRWPYASTSNLPPPYLIIVQHVLAIYSHLYWITSTFGSDGFDIY
FT                   RKVFYSALDVIGRDGEACIQLLELIAPDQVDVVGELDGLETNSAKRSATTYFLNVAEQL
FT                   VGVLPDEVVEELILPICRPYLENTRFTDTFESAHSVVLALYSNHKRCILNLAPFYVELL
FT                   IASYPKRLTSMQFEYAMSTVVAAISDRSDSVAWWVITKLADEIDRERLAGSAAERTAED
FT                   TIRAGGYIESSQATRQDVEEATANSASEHPTVPTVASENVAAPTQQTNADTYDRLTHLQ
FT                   MCLIGCVPSVNLVLLRSALAKVEAYIMQCKQQERSLSQANATLDQNESTSSRLALCQKT
FT                   FDAIQALNAATREEGLRWWLDHRTKFGV"
FT   CDS_pept        223727..224824
FT                   /codon_start=1
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02888"
FT                   /product="related to ADH6-NADPH-dependent alcohol
FT                   dehydrogenase"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /note="C-2 compound and organic acid catabolism
FT                   FunCat:01.05.06.07)"
FT                   /note="alcohol fermentation"
FT                   /note="cell wall"
FT                   /note="detoxification"
FT                   /note="glycolysis and gluconeogenesis"
FT                   /note="metabolism of phenylpropanoids FunCat:01.20.35.01)"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003C1AE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH5"
FT                   /transl_table=1
FT                   /translation="MSSTDALFEGWVGHDKSCIGNMKWETYTPKQWRETDIEIKIECCG
FT                   VCASDLHTARSGWGPTRYPCVVGHEIVGTVARVGKQVSGFNIGDRVGVGAQSDSCKSCE
FT                   ACKNGDEPWCEKGIVGTYNGDYSSTDGSGFSMGGYAKYSRVPAHFAVHIPDSLPSTVAA
FT                   PLMCGGVTVYNPLKTNGCGNEGVKRVGVVGIGGLGHFALIFAKALGAEKIVAISHTHSK
FT                   EDLARKLGATNFIASGDEDPWSAHKRSLDLLILTNNNADMPITDYLTLVRPHGKVVAVG
FT                   VPEEPCMPTPLPALAFSGVFLGGSLIGGPAIIKEMLELAAKQNLKPMIEQRDMKDANQV
FT                   VKDMDAGKPRFRYVMVNKDYEPVKA"
FT   CDS_pept        complement(225047..226219)
FT                   /codon_start=1
FT                   /gene_family="HOG000208988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02889"
FT                   /product="related to SEC9-protein transport protein "
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI00003C1AEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH4"
FT                   /transl_table=1
FT                   /translation="MGLFGKKNSSKIPAVDSAPAPQSNVAGRHGAAGGGGGGGFDRGNA
FT                   GYGAGGYGQQHYGGTPGGTTGYQERFANARAPSAGFGSGYDQYAGGGGSKSGNLSRNVQ
FT                   NQRGGVGAEGDLEAEYGRGSGVGVGSTANTGYDGVEQREEQRDQEDDEVEAIKQQMRFT
FT                   KQESISSTRNALRIAREAEETATNTMFKLSDQSEKIGNTERSLDLAKAHASRAEDNAKE
FT                   IVALNRSIFRPNMQFNKKAKRDAEEARIIARHIDEREEREAVRRDVTDAQSRLDASMNG
FT                   PGTGKASFGRFGQDRFGSGKKAEEAAQRNKVAQRGRYQFEATESDDELEDELDQNLDEI
FT                   GMLSSRLNQLGKAMGQEVDSQNARLQRIGDKATTLDTKIFAGTQRLGNIK"
FT   CDS_pept        complement(226826..229651)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH3"
FT                   /transl_table=1
FT                   /translation="MSQVEDWSDSDFDLDNTELRTDHTSLQDVRDVSHTELYAEPNWDQ
FT                   DFPEDDLEDGSDEQADTIKLSTAASSALKLMLEAGKASASASSAHVFAAHDSLDEQLRP
FT                   PALDLERLSHFDDVFKAQGPPACSTASLSTSASTSSRSMMGLSTDLTDPDSPHSKSGSL
FT                   RRSTVSSQSSGRNRSDLELPLSETDANVKMDFDLEPDMNNLSLCSSLSRARSNTSLSQV
FT                   SRDTWDDESAFSAAPLTSTTHTSSSSLHPPSNPEHPPSAKSLSGESDADDEHEDMLDGL
FT                   DLEGSIFAKPSSASTLTPSDIQAEAEALLDLKRSGQHGNLEPDHSQTADSDAAIAAGLI
FT                   IDDDFDLSTSRIAARNVTSKLYKARSTSRLGVEILSIPCDDRRHPARTASQHEDILPVQ
FT                   PFTTSSDIRGASRDRLRFKRSASDLQAHMSGAAASNATPSSSNRLQNRGSQLTRKRSLP
FT                   SMRTSPPVNMPCSVDPPPATISAPAMRQRHNSGNSTASSASRLRRKGSSRLTDSTAASR
FT                   ARAAEAADQLARLQRDISAPARPSTPVSFGSRHIYQPVTRISVNTRSKARSNLERRSSS
FT                   GESQPVARLLKRSVTYGNGAELDGIDDLPNATVSIVQSFRPAASSDKLSKNRVAATPAS
FT                   APPVPPHGNQSKRGVQRGKRSKPALIRSLGAGTLPAPRLVKGMRWNAQALRWEGNEGVL
FT                   RDFDQVIQSSTRPALISQLTGSSTSSALTHAAGYSSPLSPESSTLLSKIASGARVVGDM
FT                   LFDPVQMRWVHKSGDEEEDVFAGFDEPFEDGDDSHDASWAMRSAVDGDNTVRARRTKST
FT                   EAFGRSSNPRSRLGERDRSSSPAPDRDANERSIDRKNIQAIRRALARGAFAPSSGIDRE
FT                   LWDACVQAEKRHAVEVDAFLIHNAGSRLRSRTRSHASDHAITMDEIDRPRPHLYYLEKI
FT                   AKSIVKPDGRS"
FT   CDS_pept        230519..232879
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02891"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013636"
FT                   /db_xref="UniParc:UPI00003C1AEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAH2"
FT                   /transl_table=1
FT                   /translation="MASIGSSRPQLKSKFSESYTALLQGKQPWLESNGFPVSASSSSFD
FT                   AQAAARPAASRSKSAGKSNSGPRTRYFADLLCLPVETRFVAQQLEAIPPETLLDDDPHA
FT                   RGAHIADNIGSLWREAIRVWRESEEDEVRRRNAVDTLVALSFPILNKRFANYSFDIITI
FT                   FAGGMDDADETFTLLVDSIDDTLRGGDLARVRIPSSARDEDDEREHDLARAKAREWIDS
FT                   EVQHRALQLGLLWLSCVAQTSLAAYFLRRDLFVTASTFISTPVGSRFAFEGAVFLGLLA
FT                   TIGQGAAGGVSPNVSTSNPYARRFRDWVDEDCMAKILVAASTAMDQNIELYRQVVDDSP
FT                   PTLTGSIAGLASLRWVSSLAELVSSPTSPTFAAAPGRRPSTASTMIGDFTHLPSPSCVI
FT                   LLPLFLLSRSNQAFTSLILDVADSQPVQNETQARARGESFCHLASLSSYLATHASVSSR
FT                   SASYSRIALLSLLVFLYDPRGSRNMLAESEHLTDTLRRIRLCRQREPALALPRTKRTRL
FT                   VTAVLDTATCSLRYNLSKRIDVASYLISLKLVQRVVILCSDERIQLEYDWQDCWSAMLA
FT                   LATFLASRYSEIRSSKDLSELIKALITSLSTILLRSDHFLASTNEIHQFIYEIVRCSMS
FT                   LRKNVLLLDPSLKGTSSASSSDSNLNGSASIPISPKLHSQVPAWKNLERVIQAVESKIA
FT                   EWVEQKPSSRKNKTPDINTIIKLIASIDREHLLAGATTEDTHPNSSSNGRAAVALGGAA
FT                   HHELEWLDRIQDQCLPEFVRHVCSDILRILPIY"
FT   CDS_pept        join(complement(233230..234467),complement(233021..233153))
FT                   /codon_start=1
FT                   /gene_family="HOG000159961" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11494"
FT                   /product="related to SHP1-potential regulatory subunit for
FT                   Glc7p"
FT                   /function="protein binding"
FT                   /note="budding, cell polarity and filament formation
FT                   FunCat:43.01.03.05)"
FT                   /note="development of asco- basidio- or zygospore
FT                   FunCat:43.01.03.09)"
FT                   /note="meiosis"
FT                   /note="metabolism of energy reserves (e.g. glycogen,
FT                   trehalose)"
FT                   /note="mitotic cell cycle and cell cycle control
FT                   FunCat:10.03.01)"
FT                   /note="proteasomal degradation (ubiquitin/proteasomal
FT                   pathway)"
FT                   /note="translational control"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="UniParc:UPI0001595417"
FT                   /transl_table=1
FT                   /translation="MDESIQQFAAITGASADRARFFLEASGGDLQTAMSSFYESEPSQS
FT                   EAGAGVEDTAEASSSPSVEQNYTGPRTLSGQPVDPSSLSGFGSTSLASSQSSRSRASGG
FT                   IATFRDLQTLNSSPASGKRASSDDGDDDEGDDDEMNYYAGGERSALSVENPEARRRRNQ
FT                   PGGDLVQEILKRAAEEGKRHPEELAAGRAKASGSKPPSSASFAFTGRGRTINDAAEAES
FT                   SSLSTPSMPGGFGSRLGGAGANEANDEEEDGEVAIRNLTFWKDGFSVEDGELMRYDDPA
FT                   HAQTLAAINSGHAPLDLLNIRFGQQVHVHVHRRTDEEYKPPPMKPFAGSGNRLGSPAPA
FT                   SFASSSASSSRSQPTAAAASSSASAATASTGDFKVDTDKPTTQLQVRLGDGQRMTARFN
FT                   TQHTIADLRSYINAANPGMSTRSYVLNSSFPPKPLTDESQTLEQAGLLNAVVIQKFQ"
FT   CDS_pept        join(235077..235272,235459..235775,235871..235903)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11495"
FT                   /product="related to nadh-ubiquinone oxidoreductase 21.3
FT                   kDa subunit"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI0001595418"
FT                   /transl_table=1
FT                   /translation="MASKSNEQVVTETFSERSPFADGMTAAGASAGAGLFVSAIQNSVQ
FT                   SHNKGALGVFTRTGSTIALFTAMGGIFSYTDSTVANFRQKDDAVNGAIGGCAAGFVLGA
FT                   AARSVPMMFGGCASLAALIGTFDAAGKSLQGTYARASPYDFSHDHDAAPGAQGWREARD
FT                   ARRQNFFKQKKDDVESDA"
FT   CDS_pept        join(complement(237488..237550),complement(236072..237277))
FT                   /codon_start=1
FT                   /gene_family="HOG000209131" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11496"
FT                   /product="related to Tyrosyl-tRNA synthetase "
FT                   /function="tRNA binding"
FT                   /note="RNA binding"
FT                   /note="RNA transport"
FT                   /note="Type II protein secretion system (general secretory
FT                   pathway, exocytosis)"
FT                   /note="aminoacyl-tRNA-synthetases"
FT                   /note="protein folding and stabilization FunCat:14.01)"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="tRNA modification"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0001595419"
FT                   /transl_table=1
FT                   /translation="MSGQRARQLITATYAQYANNASAIQQLQGDAALPLTDLANKLADL
FT                   TGKSAQIFGADDKAKSATTEWLEKLDKSDEKQLVSAEGLKSLNEQLDSVTYVASNEPTV
FT                   ADLALFACIYPAVSKLEPAEQHKNPSVARYISHLSNLSSVAKAANAAQLGFASFEPTYE
FT                   GMPTIERAKPEDLKKAKKASKEAVAATAGFSKKEVSEQQPVKEKKEKKEKAPKEAKAGA
FT                   GGGGGKKGGAAAAAADTTGPLPSQVDLRVGKIVSIERHPDADALYLEKVDFGEADGPRT
FT                   ILSGLVNFVPIEKMQNRMVIGVCNLKPASMRGIKSYGMLLCATHKDGKDGGVEPVYPPE
FT                   GSQPGDKVWVEGFEGREPEAVLNPKKKIFETIQPGYTTTEDKQCAWVGALPDAVDPEAD
FT                   KKPRLLRTEKGVLTSDFVGASLS"
FT   CDS_pept        238250..240253
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02895"
FT                   /product="related to ERG27-3-keto sterol reductase "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="metabolic process"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003C1AF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG8"
FT                   /transl_table=1
FT                   /translation="MSTAASTSSQAKQLRPVILVTGANAGVGFGICQRLLVQLSSPTPS
FT                   DTLPNHPQLYSDPTIQPTPTPFSAADGCTIILACRNPIKAHKARQQLQQLLKWIENLPE
FT                   HEDTPTGPPESWAFAFDADSKDDKLTDPETEQDIRDTPHEDADPALVAHAQENNVRRRR
FT                   KQRKALANGDDTSQDPSAHLESEADKVDDGDSLGSPDLNASLEQRNKRANAWYRRRFCQ
FT                   GTRIEFVPLDLGSMGSALECARMVRERYSHVTHVVLNAGSSAWTGMNWFHAVWMIMTQF
FT                   RYAVTWPAYKMQRAGDKSDDDFGWVWQCNVGAHWILVRALLPSLRATPYSVPSRIIWTS
FT                   SVEAFSKYYEASDYQCLDVAKSPLPYESVKYQCELAAFGLDDALQTRRMRTQPGTPMEE
FT                   RSTMLGMSSTGSESMHRSASSASGTAPHGFLGLPPASRPVPGQPEPRSFLAHPGVVAST
FT                   MMSQFVASWVTIFVVASFYIARWVGSPHHPIDPFKGAISVSYACLAPDPDPKKRYGSRS
FT                   DFWGREYVGIEKIEYYRSQLGGAGPGVGARLALAGIDPDTVQGDVSDAGRVLAMAREYV
FT                   GLCERIARQVWRSARRGDLPPWSSLAGDEFVVQEHMHQLSIEDDHGQQNLDAEDARPPA
FT                   PSNDAGPAITLKTTTVPSSGPSTDDKEWEKVQ"
FT   CDS_pept        242253..244730
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02896"
FT                   /product="putative protein"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI00003C1AF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG7"
FT                   /transl_table=1
FT                   /translation="MQQTTAAVAVPQLIGRRQSGNLPPDMPLSADPRLGATHAYISLSN
FT                   DPFPSQTSDIAHNYHYTSSRASFDQQLPFDGASSSNVPSWFYTGSHAPAHPTAAENRLP
FT                   YHFDAYAPHASSAASSNMSAPSDAPLTTNTQHQASNSVLPTARFATKSAGLSSTNAAPF
FT                   GAELSVNAHSSSASGASHSVPSSLASRRISDESAHLAAAGTSMSEASSSLVNPPVRATT
FT                   HSASESTGFNGSISPSSSARMSGSPENMDVCRPYHVYASTSTVPPLSGMVMGAPVTASM
FT                   MESIDSWLAPGPPASLGAGPSSANVDSLATAMGSAKARVAVTPKFSSADASTADDAPSS
FT                   SHMLGGSVIHPSSFTSNSSSTSGAAPFKTSIERRERNKASQRESRKRKQDRLETLEGEN
FT                   AALRKALADMKRFSHALSNGAGIRGEDGGEVAPAQLAKFTGAFHLDLIESHLEDESTEA
FT                   EWKGLVGRRWPSGTAQTGDRQGDVSALATSTASSDEDNIRDESQDMANDAAQGSASMKG
FT                   ESDNAPQSASQQVKKAMWEISLNQKRQKAAQSFPSMVAVPELVLYKVCRLYFSTLLPFT
FT                   TKLKSGIVNLRAAREAPGFFGGLDDLPRFPGDPSFGVSELYLPKNLMPTEMQLRIGFHP
FT                   VEIAVMPYPKMRDRLLTVLSAFQAINELAQEEEAAAAAQISEDVSGSNSQTGNASIDQH
FT                   VKPSDASNVELTNEDIRQRTALVADMSAWKPRDGTGAVVVPDKSRVYSYGFLEKPRGSS
FT                   RLRKPAQRWLDEFFYEVVQTLRVWSPAGDVFDGECFEFKESFFRKYPYMVDSDILRATN
FT                   RWRRARGEDPIRL"
FT   CDS_pept        245975..247474
FT                   /codon_start=1
FT                   /gene_family="HOG000186273" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11497"
FT                   /product="probable UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="metabolic process"
FT                   /note="aminosaccharide anabolism"
FT                   /note="aminosaccharide catabolism"
FT                   /note="cell wall"
FT                   /note="phosphate metabolism"
FT                   /note="pyrimidine nucleotide/nucleoside/nucleobase
FT                   metabolism"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="UniParc:UPI0001595428"
FT                   /transl_table=1
FT                   /translation="MSISPVDITSLKQRYEKAGQSHLFAFWDTLAAEQQAELAQQLDEL
FT                   DVSRVNQVFHTAIKADEEARAGKSHQVQPPPPSSVENTIQGEADPAKVEQFRNVGLNAI
FT                   AQGQVGVLLMAGGQGTRLGSSAPKGCYDIGLPSHKSLFQIQAERILSLQKLAAKHANSS
FT                   SSSSSSSSSGVIIPWYIMTSGPTRKDTEAFFDQHKYFGLEKQNIIFFEQGTLPCLSLEG
FT                   KILLETPSKVATAPDGNGGLYRALRTPYNKGHPETVISDLEKRGIKYLHAYGVDNCLVK
FT                   VGDPVFLGVCLQQDVQVGVKVVKKENPKESVGVVALRDGKFGVVEYSEIPEALSEARDA
FT                   NGELSFRAANIVNHFYTTKFLADDVPAFEPEMAFHIARKKIPTIDLTTGQPVKPSTPNG
FT                   MKLELFVFDVFPFCGDKLAVHEVARQEEFSPLKNAKGTGVDDQDTSRRDLLAQQSRWLR
FT                   AAGAKIADDVEIELSPLLTYSGEGLDKFAGQTLSQSGNIEP"
FT   CDS_pept        join(complement(250148..250163),complement(249423..249524),
FT                   complement(248189..249159))
FT                   /codon_start=1
FT                   /gene_family="HOG000107331" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="rpl4a"
FT                   /locus_tag="um11498"
FT                   /product="probable RPL4A-ribosomal protein L4-A "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /note="ribosomal proteins"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="UniParc:UPI0001595429"
FT                   /transl_table=1
FT                   /translation="MAARPTVNVRGLDGAASGSLPLPAVFTAPIRPDVVQLVHTNVAKN
FT                   KRQPYAVSTKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMVRGGHMFAPTK
FT                   LWRRWFIKTNQNQKRYATASALAATAVPSLVLARGHRVEELEEIPLVVADAAESLTKTK
FT                   EAIALLKSVNAYNDVVKVSNSRKIRAGVGKLRNRRHTQRRGPLVIYNKDAGIVKAFRNV
FT                   PGVELCSVERLNLLQLAPGGHLGRFVIFTQSAFGRLDEVFAAKTGFTLPKAKIANTDVT
FT                   RIINSDEIQSVVRAKGPAKTTRPFTQRKNPLKNRAVLFRLNPYAQAAIRSEIRAQAAKK
FT                   SGFKKEAKQPVAKEFLQLLHAN"
FT   CDS_pept        join(250878..250939,251877..251985)
FT                   /codon_start=1
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="rps29b"
FT                   /locus_tag="um11499"
FT                   /product="probable RPS29B-ribosomal protein S29.e.B "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /note="ribosomal proteins"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI000159542A"
FT                   /transl_table=1
FT                   /translation="MTFQTLWYSHPRKFGKGSRQCRVCGNQGGIIRKYGLDICRQCFRE
FT                   RADQIGFHKYR"
FT   CDS_pept        join(254061..254275,254727..256902)
FT                   /codon_start=1
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02899"
FT                   /product="probable aconitase"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /function="protein binding"
FT                   /biological_process="metabolic process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /note="biosynthesis of glutamate FunCat:01.01.03.02.01)"
FT                   /note="propionate fermentation"
FT                   /note="sugar, glucoside, polyol and carboxylate catabolism "
FT                   /note="tricarboxylic-acid pathway (citrate cycle, Krebs
FT                   cycle,TCA cycle)"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI00003C1AF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG4"
FT                   /transl_table=1
FT                   /translation="MLPLRALRSSSLRAAAKAPLARGYATTVAEEAAEISPSLFDKKVE
FT                   MSVVEKGKGYYVNYKRIEDNLKVVRQRLNRPLSLAEKIVYGHLDNPHEQEISRGNSYLK
FT                   LRPDRVACQDATAQMALLQFMSAGLPTVAVPTTVHCDHLIEAQVGGAKDLARAIEINKE
FT                   VYDFLATATAKYGIGFWRPGSGIIHQIILENYAFPGGLMIGTDSHTPNAGGLGMIACGV
FT                   GGADAVDVMADIPWELKAPKVIGVELKGKMSGWTTPKDVILKVAGELTVKGGTGAIIEY
FT                   KGPGVESLSCTGMATICNMGAEIGATTSVFPYNERMGDYLRATNRSEIADLAKGFHRNL
FT                   LPDTGAEYDSHLEINLDTLEPHINGPFTPDLATPLSKFAEEVKKNDWPEELKVSLIGSC
FT                   TNSSYEDMSRSASIAEEAAAHGLKVKSKFTITPGSEQIRATIERDGQMEILEKAGGMVL
FT                   ANACGPCIGQWDRKDIKKGDKNSIITSYNRNFTGRNDANPATHAFVASPDLVTAMAFAG
FT                   RLTFNPMTDSLKGADGKEFKFSAPTGKELPPRGYDPGNNTYQDPPKDGSSVQVAIDPKS
FT                   DRLQRLEPFKPWNGKNPTDCPVLIKAQGKCTTDHISAGGPWLKYRGHLENISNNCLIGA
FT                   INAANGKANEIQNVFTGEWGPVPATAIQYREAGKPWVVIGDENYGEGSSREHAALEPRF
FT                   LGGCAVIARSFARIHQTNLRKQGMLAFEFADPADYDKVRPDDLVDILGVTELAPGSKVS
FT                   LVCKHKDGSKDELPLTHTMNDNQISWFKHGSALNKMASQAKSA"
FT   CDS_pept        join(260590..262065,262232..262453)
FT                   /codon_start=1
FT                   /gene_family="HOG000183590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02900"
FT                   /product="conserved hypothetical protein"
FT                   /biological_process="transmembrane transport"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003C1AF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG3"
FT                   /transl_table=1
FT                   /translation="MENTKTQEVDVGLQADIKREKTNEHVKAANPGQLEKQVSPNSDLA
FT                   VRPDSEAVDDMYERKVYILNKVLNEHIGMGKVQWQLFLLSGWGWMADNLWLQGVAIILP
FT                   QVSREFNIQSNIRWMTFALYCGLICGAAIWGVLADVIGRRPSFNITLCIAGIFGIAAGG
FT                   APNFVGLGGLLAALGFGLGGNLPVDGMMFLEFIPANRQYLLTLLSVFWALGQLLASLVA
FT                   WAFIANYSCDGYESNTPGTNTVPCDVSRNMGWRYTFYTLGALTFVMFIARFFVFRLPES
FT                   PKFYLSKGMDAEAVAVLKEIARRNGKPLGDDIISVEIFRSAAGQEADMDVRSVEDEPTG
FT                   FKAIISAPRRMLKSFEHVSFTPDLSHVRPLFYGWRMATTTTILWILWSLIGLAYPLYNA
FT                   FLPIYLSEAQGVEDTSSVDTTYRNYAIISICGIPGSIIAAWLVELPRSGRRGALGIGTI
FT                   LTGVFLFLFTTASNEGAVLGFNCAAAVVQNIMYGVLYCITPEVLPAPHRGTGDGIAAAL
FT                   NRIFGAMAPIIGIYAGGTAPLYVAASLFLFSGVLAFFIPLESRGKSAL"
FT   CDS_pept        complement(263225..263632)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02901"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG2"
FT                   /transl_table=1
FT                   /translation="MPSSKGKPTDPKKREEAKKEVLNMEKGGGKGQWSAWKAAEMSKRY
FT                   EAKGGTYQDTGDNPNQAKTGAPTPKKEAINKGERKDPSEAVGTPKKRKADAKDDGAKSE
FT                   SKEKSKKPRTKKEPKPATKGTREQPKRGAKK"
FT   CDS_pept        265862..267517
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02902"
FT                   /product="related to BAG7-Rho GTPase activating protein "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /note="GTPase activator (GAP)"
FT                   /note="assembly of protein complexes"
FT                   /note="small GTPase mediated signal transduction
FT                   FunCat:30.01.05.05.01)"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003C1AF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG1"
FT                   /transl_table=1
FT                   /translation="MPAPLAKSTSRGNASIQSYPAGNVQHISSPALASTSQLQSVPSWP
FT                   KMATASQDEHASTKAGLKAWWASFTKSRYSKDKKQIENRVFGVPLRQSLKYASVAISIA
FT                   GEDGQQYVWGYVPVVVAKVGLYLKENATEVEGVFRIAGSQKRMKELQETFDTPPRYGKS
FT                   VDWSKYSVHDAASVLRRYFNHMPEPVVPHDLYTEFRNIRAKEQFDQAGAIKTYRLLISS
FT                   MPSASQYLLLYVLDLLAVFARKSDKNLMPSSNLAVIFQPGMFSHPSHELSPGEHKLAVQ
FT                   VLEFLIDHQDHFVLGMSPQPASQLPQDELTAVSKPITDEDILVASESDEEQGELEVHQG
FT                   GGARLMRSKTTKPKTKRYGFGRSRRANEDDNGSEIDELSSQPLRASDKSPASEEMLTNL
FT                   KPATGLRRSRTTPSRKPAEGVSPARKGRRPRASAGDKRAAEEEHRRIVAALIPPPPEPK
FT                   SQTMQKASSSTNHVQSKTSRTSTDSGLAPPAAASMRKALSATEATTIPASATSVTPSAS
FT                   LDHDNTGLPTPPPSKILGAEASAPASVTTTAEAP"
FT   CDS_pept        complement(268233..268982)
FT                   /codon_start=1
FT                   /gene_family="HOG000157370" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02903"
FT                   /product="related to RPC25-DNA-direcred RNA polymerase
FT                   III,25 KD subunit"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /note="DNA binding"
FT                   /note="rRNA synthesis"
FT                   /note="tRNA synthesis"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003C1AF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAG0"
FT                   /transl_table=1
FT                   /translation="MFALAEIEDTISVHPSAFGQPSLTSISGQINTKYANKILVDVGLC
FT                   ISLFDILSCSEGKVRFGDGCLYHHVTFRLIVFRPFTQEVLTGKIKSSDEAGIRVSMGFF
FT                   DDIYIPYHLIPKPCAFDHQERAWFWLYEARTEQIAADPLLSQPEERMYLDTAEAVRFTV
FT                   ESDAFWDSEPGPGAATRSADSATQNALHQKEHTTKETKPHYSITASIAGSGLGLVSWWT
FT                   GAEAAADQADEYIEQIQLEHMTEPANP"
FT   CDS_pept        269659..271686
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02904"
FT                   /product="conserved hypothetical protein"
FT                   /cellular_component="outer membrane"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI00003C1AF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAF9"
FT                   /transl_table=1
FT                   /translation="MEFDSLKEQRTNVHDAAEARAAAAAASVEAESDSASSSSQPSWSR
FT                   RSKRPAQAKSAEASTTSAFDSPFGRAMAEPDLGNQDESHSEPLQDGSLPTTGLGSDQHA
FT                   APSTALSDDIDKAADTPVEEQEPIKPHNLLQATELLQAGANSPLPFAPAPILRLNAIRI
FT                   SGAGRALRPSYLASLCRPYMDPTLSDQNPNANIIHSLYYGSRISHVLPSQPTTLPSILA
FT                   LTSSLAGDLDKLDVFRNIEASLAPSMFPGASQEDVDVIIACGKPKGRVFLKSSTDVGNG
FT                   EGSASVQGRIRNVLGGAETLQGSATFGTRTKQAFNLEFGGPLAGNPDIEYKLAAFSHER
FT                   DYSAFASLSEAVKGVRASINSSLTDEPKGVVDACQDVMPAATTTQHEFAYEASLRELGR
FT                   VMGDASVAVRKMAVAPSVKSALSWTWVRESRDSAILPSSGSKLRTVLEYAGLGGDAQHV
FT                   KAELEASTGRHISPLRSLLSLASWTTTSASGLLGQETSSLHSTRPPTSLDADSIGSLSS
FT                   ILHPIYATLTLRSGLLHALSFSAPHFSDRFQLGGPTSLRMFRHSSLGPKCDTDSLGADA
FT                   FWSLGLSLLSPIPKLPHWPLMLHTFFNAGQMSQLPPPSHSSAWRTACQSLLQPSTSIGV
FT                   GLVYFQGPLRVELNAGVPLTARNGDATRTGLQLGIGIDFL"
FT   CDS_pept        complement(271802..274642)
FT                   /codon_start=1
FT                   /gene_family="HOG000176022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="rpn1"
FT                   /locus_tag="um02905"
FT                   /product="probable RPN1-26S proteasome regulatory subunit "
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /note="CELLULAR COMMUNICATION/SIGNAL TRANSDUCTION MECHANISM"
FT                   /note="proteasomal degradation (ubiquitin/proteasomal
FT                   pathway)"
FT                   /note="protein processing (proteolytic) FunCat:14.07.11)"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016643"
FT                   /db_xref="UniParc:UPI00003C1AFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAF8"
FT                   /transl_table=1
FT                   /translation="MARGDGQELGITVPVEDPKKTEQEKAKEKQREEAARKGLPPFSEK
FT                   KANGKEKPEDELSEDDLQLKNELEMLVERLKEDDSSLYRPALESLRTLIRTSTSSMTSV
FT                   PKPLKFLRPHYPELKTLYESWSQASADKSLFAEILSVLAMTYSDNGQRETLHFRLKANQ
FT                   VASDGKSEDPGLWGHEYMRHLAAELGEEYNARSQDEKNTDELLELALQVVPFSLTHNAE
FT                   ADAVDLLLELEAIDKLPQFVDKDTYARVCLYMVSCVNLLVPPDDAMFLRTAHEIYRKHD
FT                   RFAEAMTLALRLGDKHLVRSDFEAPKNPTMRKQLAFMLARQHIPIEWLQDEDSPITDNE
FT                   LLDILYNSHLSRHFVDFGKELNVFEPKSLEDIYKTHLENSRTGLGGTVDSARGNLASTF
FT                   VNAFVNAGFGNDKLMVDAPEGNSWIYKNKDSGMLSATASLGMSLLWNTETGLDQIDKYS
FT                   YSSEEAIKAGAFLAYGIVHSGLRSELDEAMALLSEHIESQSIPLKISAIVGLGLAYAGF
FT                   CREDIAALLLPNIQDETTPMEVAAMSALSLGFVFAGSCHGEITPTILQSMMERDPAQLD
FT                   DKWARFMILGLALLFLGKQDESDATIETLKAIEHPISKQAQVLVDMCSYAGTGNVLKVQ
FT                   NMLHYCTERSAPETSDETEGDNTNAETENAESSQDKDDQEDKETNDLFQAFAVIGIALV
FT                   TMGEEVGAEMATRHLSHLMHYGEATTRRAVPLALALLHPSNPSMPVLDTLSKYSHDSDL
FT                   DVAINAILAMGLVGAGSNNARLAQMLRQLAGYYYKEPDCLFMVRVSQGLVHMGKGTIGI
FT                   NPYHTDRQLMSRNAVAGILALLTSMTDARGFVLDQSHWMLYFLSSAMYPRFLITLDENL
FT                   EALPTSVRVGKAVDVVGQAGKPRTISGFQTHTTPVRVGTFERAELGTEEYLSYAHVLEG
FT                   FSILLKNPGYVKEEDL"
FT   CDS_pept        275702..277381
FT                   /codon_start=1
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11500"
FT                   /product="related to COT1-Vacuolar zinc (and possibly other
FT                   metals) transporter"
FT                   /function="cation transmembrane transporter activity "
FT                   /biological_process="cation transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /note="cellular import"
FT                   /note="detoxification"
FT                   /note="heavy metal ion transport (Cu+, Fe3+, etc.)
FT                   FunCat:20.01.01.01.01)"
FT                   /note="homeostasis of metal ions (Na, K, Ca etc.)
FT                   FunCat:34.01.01.01)"
FT                   /note="metabolism of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI000159542B"
FT                   /transl_table=1
FT                   /translation="MGLSKETRILTLLVIDVVFFFIEIITGYAVGSLALVADSFHMLND
FT                   VMSLIVALWAVKLSTKSSDHRFSYGWQRAEILGALVNGVFLLALCFSIFMEAIQRFVNI
FT                   TEVSNPKLVIIVGSLGLASNLVGLLLFHDHGHAHGGHSHAHGSHSHAPHDHVHSHAVTD
FT                   GSSNSNHAAHQDNTDAAASSKKTTMTNSASSDDITSGSPSAVRGRAREGSVGSILGHPA
FT                   QTRAFVVQTAHDLGYEASGSRHQHSNSVTSVNGSNERSRLLANGSQDYGATGANADLEA
FT                   AIGSSAARKNGHSHEHDSHADHDHDHDHADVADAHDAPGHAHAHGGGHSHGSMNMQGVF
FT                   LHVLGDALGNVGVIAAGLFILYSDAWWRFYSDPAISFLITIIIFHSALPLCKSASYILL
FT                   QGVPASVSLEAVRNSIMSVEGVLNLHELHVWQLSESKIVASVHVLVDCSSGQTEKYMNI
FT                   AAKIRANLHGWGIHSSTIQPEFVPGGLREAAILSGVQVAESDNEGRLRTVEGRLVESEV
FT                   QKVDTACLISCGKDNDCQTESCCPPSNTPSKLTSGSATPDHH"
FT   CDS_pept        complement(277781..280687)
FT                   /codon_start=1
FT                   /gene_family="HOG000206760" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="mgm1"
FT                   /locus_tag="um11501"
FT                   /product="probable MGM1-Mitochondrial GTPase related to
FT                   dynamin"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /note="mitochondrion"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000159542C"
FT                   /transl_table=1
FT                   /translation="MSSYQSINRIVQRTGRRSYIAGARSQHVLIRPPLSRFAGHRPSAV
FT                   DTTLATQLTASARGSRLMHIRAISFNSVPKAAFRAARLPAYGIAAGGGALAYANYKVDE
FT                   FKDLLGRSYGRLSDRAKEAYNGLSEIGAEALDSARDGWEALSEQMDGIELPKLQTPEFL
FT                   RNFFVSLNSSQTDADGHDQSKTSGGGGPDPNGAPQLAGAAAVAASSLFGDEDASINSTD
FT                   AIAQGSTEELMLLTRKLIEVRNILKEIDHESDQLTLPSIVVIGSQSSGKSSVLEAIVGH
FT                   EFLPKGNNMVTRRPIELTLIHTTTQPGRPTKDTVVEYAEFPGLGLGRITDFSHVQKTLY
FT                   DLNMAVPASECVSDEPIELRIHSPHVPDLTLIDLPGYVQIASMDQPDELREKIQKLCHK
FT                   YIQEPNIILAVCAADVDLANSPALRASRQVDPLGLRTIGVVTKMDLVPPEVGAGILSNN
FT                   KYPLALGYVGVVCKNNLGVFQSSKGHDRATGEGRMSSLVMKQESDYFSTNREHFCAPTR
FT                   GRNAGVQPMTGTDTLRRRLMSVLEESMGSSLHGIANAVQVELEEASYQFKVQYNDRSIT
FT                   AESYVAETMDALKLRFKEFASNFGKPEVRALLKQALDEKVMDILAQMYWSDARTPELSQ
FT                   LADARKVSPEDLDKYWKYKLDASSSALTKSGIGRLSTQLVVDSIRTQIEHLAQSEPFNH
FT                   HPDAAQRIVAFSSAILRDRFGLTADQVENCVKPFKYEVEVEPNEWEAGRQRSVQLVERE
FT                   IGMCDAAFNGIKKVLGGRRLQGAMEYVKHLEERERKRVQAKLRAREAAASTEEVDQEDD
FT                   SNDPTRPDYNSALLIKAREALFLTERSKMLRTRLSTLSSKRCRSGPGAKAFCPEALLNI
FT                   VADKLTYTAVMFINIELLSEFFYQFPREIDAKLVYDLDKAELAKFARENPGVKRHLDLQ
FT                   ERKEKLEMVMDKLADLVKIYNDKSGRDKLGASSRWSFF"
FT   CDS_pept        join(281545..281950,282026..282240)
FT                   /codon_start=1
FT                   /gene_family="HOG000028966" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11502"
FT                   /product="probable dUTP pyrophosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /function="dUTP diphosphatase activity"
FT                   /function="hydrolase activity"
FT                   /biological_process="dUTP metabolic process"
FT                   /note="deoxyribonucleotide metabolism FunCat:01.03.07)"
FT                   /note="phosphate metabolism"
FT                   /note="pyrimidine nucleotide/nucleoside/nucleobase
FT                   catabolism"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="UniParc:UPI000159542D"
FT                   /transl_table=1
FT                   /translation="MTSNICSDARTSDEARPTKLAKLEEAGTMSVNSTVRLLVQRHPSH
FT                   PLAKLPTRGSALAAGYDLYSAEKVVLPQGGRKVVQTGICVAIPDGHYGRVAPRSGLASK
FT                   HGIDTGAGVIDQDYRGLLGVLLFNLGEQDFIINQGDRIAQLILEKISTPDVQEVESLSE
FT                   TLRGAGGFGSTGGFGTQTTPSTADATAAAVAADLPAEVNAKSS"
FT   CDS_pept        join(complement(<287760..288917),
FT                   complement(282401..>287620))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um15064"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001595345"
FT                   /transl_table=1
FT                   /translation="MEHKDSADLNPWGAEPSYAQRLSSYQAEQDADYHQQLDDLLNSPK
FT                   ASRFSVPHDASTNNGTFLNGNHVHHQDDDNDNDDDFVYDGIDAAAAPSAWTPDDSTVSS
FT                   EMSSDTYSAKLKDILGSDDDDAGRDQHADLTIERPARSSITSPSSPTTQKAPVLQVDAD
FT                   TSSNTTPRHTDQAPSDDSFSFRYPHPLPNDVSFDTRSSTSSQRHRIPSQPSSLRILTPR
FT                   STSGIGFSLLRQSSTMASSSTPQRPMAYPSISRLRASMGRATGSSFALPKHLNDVSGAS
FT                   SAHLPGTPSVPSSPRKARSPLPFEFTANGLSAAAAAAHSSKDDDASRSAIAESSITQRS
FT                   RQSSYSTSVSGSIFGQNKPRRSRASFPYGGTSNGPLVPTAQSATSLHFRHQCKVESRRC
FT                   HPVPTVLAVAGGLIAVGTRGGRSMVCDFAQQPIASCGHDGGNHGDPVTALAFSSDHSFL
FT                   GVGHASGNIFLYDLSSPGRAARHVPPVPLSSVKAGKKEGHLSGSAIVHIGFIGLRHTAI
FT                   VTADIKGLAFYHALGKILGVSSNDTLRLLGKYPQYEHEDELGLGDTKKRNTIFQLSPLP
FT                   LGPRPHSADETSFIAMITPTKMVLVGLKPSPRTWYRKVNRAQPTEKQDIAAPVNEQPVQ
FT                   EPSCLAWYPASTETDGKRRRQTNPILAFSFGATLHLVRLKVKRVDQPPDPRNPRSTNGA
FT                   GAGSGSNVVGEEVDPVELTGENGIEEPDHIVALQWFSPDLLLLTTTSGLALFDCRAGKV
FT                   TERMRGGSASAILAKTVEQRYYDAVLLGKHYDPHTETQDNHTNSNGTNRVRSWALNHSV
FT                   RISKGRCFFLTESDLVVGTLLSWADRLLLYVVQGDFLSAIELATLFHQGKFLGSAVGLP
FT                   SDPNERTLIVADKLRELMSASAEYAFSPDRLTDATHVTPDNRGVDRTLLFEGLARVCAR
FT                   ACLSLGNLDFLFDTLYDKYEDYGIEAIFVGQMEDFIVSGELRSLPIPVVQRLVAFRRDR
FT                   QEYAQAERIIWHVDPKSLDLDQALSLCLDRRLYDALIYVFNAALEDYVSPIIELLHPLR
FT                   RAIGHRRRHQQSVTANSIQASDDPYALIRVTEAADLHQPDPTSDWELEEKDIEDAYRVF
FT                   SYLSVLLTGNRYPSQEPFQEDEQASKAKSSIYSFVFSGGCTLWPPGPGGKLVLYGLDDD
FT                   ANPSNLREDGKDQVAEHEPIYPYLRLLLEFDAEAFLDALDLAFEDGFLDDEDVVGKRVS
FT                   RQLIVDVLLELNNASLPERPDLAGNLVSRRSQDAKSPKMPLAARIFAHIFVARNAPKYP
FT                   QFIRLSQQNVDLLLRSLACPSPMSRDAKEDLEAIESTHEDRELAAECLLSHYKPRLDDD
FT                   WLDTFEKASFHRILRSVFRQEKKWDRLLGMYLRQHLQTGQSDPVDRNSGAEANAPGGDA
FT                   FSHFEEVLFNAARKNTPERDVLQTRLHEQLSDHIIDLLDLDPLKTTGLLDRFFPGKHES
FT                   VLRRLEQLDEKRLLLYLRCFFEPLHVSNDSALHVPFADRVDNEAGFNWTGIRAPGTATY
FT                   IVDAVRANPEHLPRKEQDAYLDLLCRYDPETVVRNLDAKGADYFDLEQLVQLCRSRKTA
FT                   IDGSRVAVNSDAVLWALDRLGQSNEAFEELDTACARTADSLVYVASADSFGTDAAETVA
FT                   DELLGDVRRCVNVAVRLCIERANAYGGDEETDEEDSGTRKRGKRAEKRLDTDEVWYRLL
FT                   RSLVRLVHDVAHLGVADNHQGERYNGSRPKKLLDGVRDIVQDTLSDLISSTAAEAVSFP
FT                   ALFRRLTGSDNGRTSAAGSKAIKAESQAGVAEYYAEIRSVLDGMLSAYHLRSEVLAITN
FT                   KLFDRDTFHQFRRLHMQRKHGWRPAGGTSTRCAGCDVLVIGPRRGVSTFYPVALYENGT
FT                   NILPGSPEAGKEAETEDVRRTAFQPSRSTSFTSVAETRRSSGGVQLGSMLSPPASLLQP
FT                   HRRRAKSPYDEKAAPLASPRIDKGKGVVRSASSEFSRINGDHAVLGKGKANRRHASEGG
FT                   EGELHEVDGYFASEFTDRPSWSTQRPTGQSSAVMTRSNSVASSAGVSLRINDALADAQQ
FT                   HLEATEEDADGTLTQEHFGQAASADSAHLNAATLSSDEMQRETDVVEGGIEAERIVVQK
FT                   SGRVYHQRCWQRLHA"
FT   gap             287657..287756
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.99-um_contig_1.100"
FT   CDS_pept        289711..291021
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1AFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAF3"
FT                   /transl_table=1
FT                   /translation="MTSATATTATTARTASACPLTDNKSGFRSLYIHTHDVSRSLKPSA
FT                   DGELAHAIHQTLHFALDGHPDDFTPCLPNSGIGMGCGSLATMPTSASSETASVSIANGH
FT                   SSSAAWAVKKGFFPTGDPERPYISYHWVPSTATLALPNPATITNPIADPCSPDHRSTYD
FT                   ITAKFFFLDPSDLSPSLLDDALTRLTSTTGIITVETLVLAFPSLDLDSRPHKHFESGLE
FT                   STASDQQNGVEAPVWLSSVRDVWSHASLNPQLLSLGVSDISCTNLELLLNSLSPPLEPP
FT                   TMPLFSPAIPLSTSSTEVSASTSEPQLAHSDVATCSTSQQNGIGSFCNMEYSLVSSARR
FT                   PRIVSINVKKDLGSFDRSFHQYCNKMGIQLVAHSDRKDVLPQRTLPALMDEFKHKLPIK
FT                   LDAGKQLRPKWALKYTTLIRDRGVLADKGYIVFVSSD"
FT   CDS_pept        complement(291144..295505)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02911"
FT                   /product="related to UBP2-ubiquitin-specific proteinase "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00003C1B00"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAF2"
FT                   /transl_table=1
FT                   /translation="MGAQRSESDLNSIVDNVTRPNDATNHIRNGVGVASPAADDGETID
FT                   ITIDEDDHKKVFGSQSSVCLELPPHPIVRPRTEYEPQTTPSISHNLPASPPPSYDDASM
FT                   PLTDAALPDASSVATPHIAHLLLPTALHDSGLLFNPQLSQSRVSLERDPIPEAPSATIS
FT                   KADSLVPASISPLTDCALIPTLAQCESCKPHPDALFVAETLEWRLILDRSCMYRLPPAP
FT                   SSQYDATDLYEACDLVPGSVPMYETQPTIIPAHDQCRAVQLLQHWDPATPDAPLPFLEE
FT                   FNTHFCPFTGKHIFSSPPDSIVTVVDRHLLIRFKESRENDPAVGLTGLESFLRALRILL
FT                   RVVGNYVHGERRGVPTTSASLTQKLGWDRHSRQFFLSLGWKESTMADGRNAIVPPSTST
FT                   DLFDANFHLQRNIRAWIELSIWHTFHVEQLRKTRPNSPVLTSPDKFAVATRVQIHPAAE
FT                   SLLDLIGSRQDHLDPTYKTTLSPATLEAFFTLGASSTARDQLVKFAYLVNMKAGHGHTA
FT                   LNLFAALNQVYTSQRRTSRVLEELIAYERSQGRYTPRDIDQAYERLHLSTAHLGPDVER
FT                   LSIPHSLIVDNYKARVREVLINSDASEHAALKDALRIIAVDLGKPERLIKALDEDIDMD
FT                   IDQACSMLDTNPDMDDSTVLAIFDLYVADAPARQDALRHALRAIAEHRNSDYLRHFLRT
FT                   GQKDASVAETWQQMPSNDLPAGIDNIGNTCYLNSVLQYFFSITEVRDRVLQAAASLAES
FT                   TATAQLSCDTERRVGGQRITARELQRSRRFVAQLGGLFHHLIHANALSVRPERDLAYLA
FT                   LVSSRAEDFEKELDPVPETGALLQHQGDVVAYSSDPSVLSSEPVTIGNASLDAGINTVS
FT                   AAVDGESMELTADELSARQMDPLQAHASNTSTSAPPLPPRPARQSTSADSTSAALPPPA
FT                   RRNSLMQLGAQQDVSECLDNCMFQLEVALAASEAAFAPRTSTEQTIVVDGSEESKAVSD
FT                   TVNGSDQEDLLTSLFLGKTCQRIEADTKPTIGNNADGSLSRPAQPQKQPSTHIKHEVFK
FT                   ILPIDVLEEGRDIYDGFDGFFDSDTFVSTSGAVQRRSVTLLSAPPLLQIQLQRVQYDRV
FT                   TMRTFKSQAHLDMPETLYVDRYMDVSADDPENAVRIAKRLDYQAKRKRIEELRAKLAAC
FT                   KDGSNVHLTQTLSQAANAVEELARLPPLADVAAQLDEIEKQSAQPEAIEQDSSSRRCLA
FT                   KQSAEDTSASTESNATHSATADSTAPGTVDSAYPQSLSSVIDAGLATLLRDESKLVREQ
FT                   VKQAQEEIDTLKSEMASIWADERRFAYRLVAAFMHRGEASHGHYFLNLRGGGENGKWFK
FT                   YNDSTVSETSLDQVLRDRSGATPYLVTYVREDYVHLIDPICRAIEHQNRAMDVDQEKHV
FT                   HEALNGVNHTKANVDEGCAVHNDEAARTVDVAEQAPSGPESPVKRARTDDL"
FT   CDS_pept        296586..303005
FT                   /codon_start=1
FT                   /gene_family="HOG000209133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02912"
FT                   /product="conserved hypothetical protein"
FT                   /function="binding"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003C1B01"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAF1"
FT                   /transl_table=1
FT                   /translation="MQSALRAGAEIESQAQYAEALELDESRLQSATTSDQGEIFVIEWL
FT                   SKAEQALTKADVDTIRSYQNSFESAILKLACPSVSFGKTDDMAIVITSNAAIPRPGRPT
FT                   RRLLARCILVLFRRIDSRSLFDILQNLIRVAAEDAKGKTPEREVRVAALYILGEVFGSL
FT                   GQQIMSLFNEIINLTQRVFKQTSHPVILRYHALITLQKTLNVAGKSLGDQVGKDLIKAL
FT                   RQGLSDRAGAVVRGSADCILAIVLHAQLITTRTEVETLVSPALKAIESADFVTKRALSR
FT                   MLAGLLASTQIEQAPPASVPAKKSSKKKKEGTADDDSDDEDPIPSAAAAAASAPRAMLT
FT                   PIGMLDQLSLPFLRGSTGSKGRSALLDVYATLFETLGSSWINANYAVILKHLIDDLPNH
FT                   YRGSSLTRADVLNVRTGVSLILRKLIGERMLGEQAQVLAIQEICRDYLRKWPALMPEQQ
FT                   PPSKTTLSLALAEISGLLVQLGSVPPQVLDAAYDPLIRCLAHPSHSVQVQAAWCLKTLC
FT                   QVSPVHLSPTLAAVLELLNRDLTTLANRGGSVGISQLSKRANGHAQGLAALISVIPQRP
FT                   LYTSFAISSKVLSLAIQLLKNSGNHDLNVSSIEISVAWTLVGSLMSLGPNFVRLHLPQL
FT                   LILWRNSLPKPTSKDTAPGPSSRSDAEWSFLLLVRERTLSSILAFMLHNGSSLITLDTA
FT                   RRLVALLSNTLAFADGFAAQNPHLLQEYTPAAESDTLSLLDREFLLRRRLFQCLTVLAH
FT                   NPAMEPMQAGLIKTTIQAFADPDRYIGSSAQAAIAASAGNFTSVWEMADGYAFGVTSLQ
FT                   RDAQTFVSDPVDALRACSLIAQPDLLNRDLVETQLDALQRRPVLGAAEHDPLFLYSTPR
FT                   SSTSQQPGVSSNPVEPRESAALSPPAPTGVVDAAIQLFTSLLPYQERDIQVAAIEAMLA
FT                   HTKSTKLDKNPGRKQAVQINVVVAILGALRVAVQGGTGANGKRPSGFSNDRLSSAIKDL
FT                   LQDALLQADPALRAAASEAYGKLAAVAGSQALSSQVQFLVDQIVGNRDPDARAGCALAF
FT                   GSVYKEVGGLAAGPLTKTIVNVLMSLSNDPHPTVHYNALEALHVVIDSASLSYSPYVAS
FT                   TLGMLVKLYMLDTHEPEGGSAGSVNLRADLPAHQAVCRVVNALIGVLGPDLQESTRVRS
FT                   LVHCLLSEFSRESDPGVVVESTRALQHFGLFAAQFVDVAAWIEQLRKQLTGKQRTLKLA
FT                   AINAFYQLVQREALAMSRIGGDQLVEEFFAQLDEDPQLDGAREVILSWLQKTADLAPSG
FT                   WIDLCQRIMSSVPSHSKGIDAADKGKDALPSLATMLQDEEAAAIDLGNESNAVKLNATG
FT                   GSRWRTQLFALRCLHQVFVTVRQAGKLEHFSTPPGAGEKGQALPQRRLLMSNRVVDLIR
FT                   MAFTASTSANVEIRLEGLVVLRDVIESFKLARDPDFEDALLLEQHQAPIAAALTPAFLA
FT                   DSTPEVLAAAVQVCAVFVSSGVIKEVSRMGRILKQLVSALESCMQPSMTQLGDVKDLSQ
FT                   NANAMLKIAVFTAWAELQTASATQSYLVDVVKPHVTRIVPYWIACLREYAKIRSDPEMD
FT                   AGGAPDGPGPSINPSLDSQYAGLAREVVLPYHERSWYTILQAVTGLLHDNDARAFAALD
FT                   GETTPATAGPNTTASNARSEPCLFFFVLYGLAFEALATRSSGSVESLQQGTVMRISLRA
FT                   MTSLSRPQVAGSALLQDTLFSELCNLWYRLVMTEPPAVQVSVLETIGGMAASYGRLLLS
FT                   ADDQAAAEAGKLPNEAKLSQCLRVVVCVLQNVRTTRGSVEEKTTLLRVAYSAYIGIVGL
FT                   YAKALQEDLFAVGFYTFAEMLKDETSEQDLVGPTLGSLKDLCERSAKSIRPDSDVLQRA
FT                   IHGFLSQALQHVDDLRTRAGRIALNKTINSLLATVVVLTSIPINIKVSQAVAEHACYLI
FT                   VQKVLQFEEEVEQSMQTSQQLAPGVQETGLTAVNCARTIVLACSRGNPALLYCVGQLLP
FT                   GLIEFVCRAGPVVAGSQAKSESGAMVAIRGAVEDAIKTFAGLISVLPSEGEFRAKALAI
FT                   VLPTLVVLLSPAAVTDLHMFTVRQLITLAGQHAAAFKEATASLDAERKALLENAIRAQL
FT                   EAGSRGGAIAVATNKQSTPSSIVLKSFGA"
FT   CDS_pept        complement(303200..304477)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02913"
FT                   /product="conserved hypothetical protein"
FT                   /note="RNA binding"
FT                   /note="tRNA modification"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniParc:UPI00003C1B02"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAF0"
FT                   /transl_table=1
FT                   /translation="MPWKRKRSGPGFNRDASSDSTSAFKRSKPGYNQVYRLASKNICGP
FT                   GIFVTCVQGKERKAALQFIDLLNETADRIYPGVATESLNDGADAREDDDDQDMDAMRNG
FT                   VASESSVLSSRTKEEAESPAQHPVQEKGGEPERVMKEDKAEDDIAAQIAAELKDIKATE
FT                   RPRRGGSSKVAAPRFKSVETDTECFLFISVSRPFDPYLLVYTILSEVQVSGEPRTRFVQ
FT                   RLTPVTTTCPANPSDLTSLARTILPTFFSSNPDQGKTFKIDPRIRSHSKLKRNDVIQIV
FT                   ASQIPTSEPAEDGQSKRIHNANLGNPDLWIVVEVVKNSAAISVLEDYERFKKMNLQSVA
FT                   LAANEKKAELHEADKDQGLREGRIAASLVAKSSAVDKNDVEVATPTEAGQGVGEIAAAV
FT                   TPQLEDGASQEPKQDNESQISNFRLF"
FT   CDS_pept        304769..305590
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11934"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595346"
FT                   /transl_table=1
FT                   /translation="MNLNHNKYDPHGVQRLLEILRRQQDTNSNAISTPVIAAPTSETRS
FT                   STLPHPYASNPFSLASSSSSPLGSRIHAIDVESEAAQRRRNYNAPSANYGVSALSDERF
FT                   DPYALNPFSASDAVISKRALAVASALPNAKPAVAASAEARDLASLSFAEALPILSTLST
FT                   DSSALTRIRTLRKQQHQLEHRLSKEYRQFSATADKQFPNAKARRAQDEKRRIAMLHQWD
FT                   ECVRKQQDELKKAGIPAVKVTTEKREMDKQRKVLNVLVEMLDDAETEDRNG"
FT   CDS_pept        complement(305727..308558)
FT                   /codon_start=1
FT                   /gene_family="HOG000201750" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02915"
FT                   /product="related to Adenosylmethionine-8-amino-7-
FT                   oxononanoate aminotransferase"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003C1B04"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE8"
FT                   /transl_table=1
FT                   /translation="MAHLYPHLRVHQVFGANTDVGKTIFTTALCLASSALPLCSSSSAP
FT                   KDVFSASAQGLGEHVHYLKPVSTGALDDADDAHVSRYASGVHYKTLYRFSEPVSPHLAV
FT                   ELERRAKLAERELEQAPSPPSDQVFVRDVGDWIHAAAEAVTPEETNKPAAVAYVETAGG
FT                   VHSPGPTGLSQSHLLRPLRLPTVLIGSAELGGISTTRSAFESLLVAGYDVEAVLLFPSP
FT                   RYGNVEYLRKLFAEEYNIPVFGLGGPREGGGYGPPPIKNADSAADKAAMMHFYQGLVNG
FT                   HPDPTSCTSAAEHTAGGVYGVVRYLRSRHAQRIADLSTMAQRTRDTCWWPFTQHQLTRT
FT                   NQEVNVIDSAYGDFFSMLDQRSPASSVVDVMKSNSLLQPVFDGSASWWTQCLGHAPHNL
FT                   VTAAAHAAGRYGHVMFPNGSHEPALLLAELLTGKYVSSTEEPSLLSNPGYGWADRVFFS
FT                   DDGSTGMEVALKMALQSCILRYSTQRSSSRKAAEKAAPGQQPGYRSGKPKQEWEVLGLK
FT                   GSYHGDTIGAMDACEPSDYSEAVHWYRGRGFWFDAPTVEMHAGGKVVVSLTVDDQDLAD
FT                   RMRDRHLPQTLAAGKSAQIFQYLYNSIQDVYDVEARLRSNDPLVEFYRRSIRDQLEQLT
FT                   VQQQRKFGALVLEPLVMGAGGMVFVDPLFQRILVDTCRESEHLFSLTDAPLTPPTTSCT
FT                   TNKNTTGGEWQGIPVIFDEVFTGLYRLGACTPASVLGVTPDVSVLAKILTGGMVPMSVT
FT                   LASRSIFQAFNQSDSKVDALLHGHSYTAHPIGCAVALETLKAIGILKKSTEWESCQSDW
FT                   QSQSQTGTEQGVWSFWSKAAVERLAELPNVEHAIAMGCVLKVALKDAAGSGGYTSTASV
FT                   ELVKKLRYGDNTTQGHPSVPLKQAEEHKLPYNIHARPLGNVIYLMSSLNTPDKVLRSSE
FT                   EVLFQAIKQEAGM"
FT   CDS_pept        complement(309501..311216)
FT                   /codon_start=1
FT                   /gene_family="HOG000135971" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11935"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="UniParc:UPI000159540A"
FT                   /transl_table=1
FT                   /translation="MPGYAEIYAELLYLGGEGYPLWYPSALRLGDVGYIRDGSFKQLYN
FT                   IVDGPGTQSDAASLLTAIHSDRSPSSEHGHGESSAKKARLNLHDPVGAPTDPVSPSPSS
FT                   SLAASPLISSVSVGMSRSHSSEPLLPHSAQKGSPTFLHRRFHSGTPPEPSQPPGRFEVR
FT                   ELATSPPFHMGPRMSSSFRCLGVNGDASVPSSPANVKIGFESSGGDGAILIPRDPTEIT
FT                   ELDDLGELKAYVKKHYEWMYQTYGEAKSIKTKDLTLIYKQYRTSDWAMAVICHGDKRVK
FT                   AEFEVFGSVSAGFWGNWSSGVTASQRGPHRPQRARDTHNYGQGKPPALLQRHGKGNSSL
FT                   GVSIDGGLNHQSFSYASSSSKESAYNGLGRRSRKENTADSSPKPMDQTILINRLTVSSV
FT                   LGFLPVRIKAAAEPRDPDMDRDQDHGSDAVSGQDGNQGGDDDPGKRNHWSDDPLEALHD
FT                   WIHKHGGAQIKVSIATDDDCLQLLRQLGQRYASKFGLRAAVRTAADRFARISVDEAGFA
FT                   TVSISRVPFKASKLVSTPSAALDPSPKTTAADHDTQFDLRQGEHGSKYDCRCET"
FT   CDS_pept        join(complement(313932..314883),complement(313013..313911))
FT                   /codon_start=1
FT                   /gene_family="HOG000135971" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02917"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="UniParc:UPI00003C1B06"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE6"
FT                   /transl_table=1
FT                   /translation="MPSFAEIYAACLYTGGEGYPLWNPSPLRLGDVGYVRDGSFIVLYN
FT                   AIDGPGRLSDAASIPLARRFDCSPAREHASVDTGTKPPRMDLDETIVVPTGSIDSSRRS
FT                   SLATPSVISSMPAGMSRSSDSDPLLPSSAKKGSPSLSHRRLRSGTPPEGLHPPMPLSVD
FT                   QEAPKLFDMGPRMSSSYRCLGVNGGASVPSSPVNVKISFESSGGDGAILIPRDPTERTR
FT                   LKYLGVLKAYIKAHHKWMYETYGRIESIGIDDLAFVYGQDRTSDWAVAVSRDAARGGRV
FT                   EFEIFGSASAGFWGNWSHTLSACQRGPHRPHGPRSSPSSRREPSNEGASSWGMNLEGGV
FT                   INPSFSFAFSSSKNPSDDDHARGRNRNSVSRAQSITWTPEVHAGPDQTISIRRVTACTT
FT                   PGLGFLPARPKAAAEPRDPDMDRGQDHGSDAVSGQDGNQGGDDDPGKSNHWSDDPLEAL
FT                   HDWIHKHGGAQIKVSIASDDDCLQLLSLLGEERVNMFGLRAAVHMAADRFARISLDEAG
FT                   FATVTMSHVLIAVPKLVSTSSTALIPSSRVRTIRADSTGNEENMDQSTAATARPGLGKA
FT                   RQVHGVLKPRPLLSSARFNTMHPCRSMQSVGSACASLIPS"
FT   CDS_pept        join(complement(<321295..321766),
FT                   complement(320808..>320982),complement(318596..320618),
FT                   complement(317658..318452))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um15000"
FT                   /product="related to Vam6/Vps39-like protein involved in
FT                   vacuolar morphogenesis"
FT                   /function="binding"
FT                   /function="small GTPase regulator activity"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI000159540B"
FT                   /transl_table=1
FT                   /translation="MHTAFDSAPLLTGIKGKPEAIVAHGGKLIVGSSTGTLHVYRTDTT
FT                   SASQQPETSPPVSSSRRPPSPHGSSAKPASILSHTSTREIKPSVSASAPIQTAPQFSKR
FT                   SIDQLGVIKEANLLISLSDGFVSLHDLATLELRSQLLQTKGATTFGVDTSIQKHADGQH
FT                   GIMTLVTVLAVGVKRKLLVFRWVDGEFWDTREVALLHTPRSLAFVTPTRLFMGLSSWHV
FT                   EDFDLSSNAAGGEGAHSSSGGAHPSTSISIAGGAGAGFSAALGGLGGLGGYMGLSSKGK
FT                   MSVLHVEGGEVLFVRDGTGIFLGADGRPTRREGVEWHASPLEVAFAKPYVFAVLPSGSI
FT                   PSLRNSSLPNANNPVLQIRSVGTLFAVQTLCFPPASPTTSSKPASSPPQVRLLTPSSGN
FT                   KPPIFVVVTPADRTTLEREGSTIWRLEMQSWGQQIDELVEKGEFEEALGLLDSVDNVIL
FT                   EDKDERRAHVQGLFALSLFADERFDEAIEMFMELDTNPAKVIALYPSNVAGELSRSKQE
FT                   WFPIFGGKTPAKLRASSLDAGDASPTPSHATLATSATNTARSRLGGLFPGRRPDSIIGE
FT                   PVVTSNLSSSPSHASSTKPKSSRIATSVASSMAQEADAQAETASIRSVRTTREAPEIKA
FT                   AGSGASRDSRTAAEPSSRKALDALGKFLADRRRIFKPILESSPQHESKDHMAMSQVKRD
FT                   THWLLSLANKPFGEMDKDELIAVAQTVDTALFKTFLLTKPALIGPLCRIENWCEVEQVE
FT                   ELLKERKKFSELIALYGGKEMHSKALGLLKQFADEEDDAEEKIRPTMQYLQNLGPEFIE
FT                   IILETSHWLLKVDSKLGMEVFTADTGKVGSWPRLEIVDDLNRFDKALCAVYLEFIIENG
FT                   GEADPELHDKLIRLYLRRAELNELMQKLLKFLRTSTQYRPEQILVRLPADDNDRDMLEA
FT                   RALLLGRMGQHEGALSIYVRKLQDLTRAEEYCRDVWRYRAASWGHITSGQVQPQQARLG
FT                   RSNHQQSLLVDQEEKQLADQEVFLTLLRIYLDTSSEKASVQLDAAVGLIERHAARIDLR
FT                   SALELLPSSVPLSQIAGFINVNLRDLTRKEHEANVIREMRRNRNWQVEETLCKLQSRRV
FT                   KVGESRTCPKCHKRLGNSVVAVNPVSGAVMHYFCSIHAEQKGQQRPS"
FT   gap             318494..318593
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.100-um_contig_1.101"
FT   CDS_pept        complement(322290..324590)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02919"
FT                   /product="related to tRNA dihydrouridine synthase "
FT                   /function="FAD or FADH2 binding"
FT                   /function="FMN binding"
FT                   /function="catalytic activity"
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /note="pyrimidine nucleotide/nucleoside/nucleobase
FT                   metabolism"
FT                   /note="tRNA modification"
FT                   /note="tRNA processing"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI00003C1B08"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE4"
FT                   /transl_table=1
FT                   /translation="MPSVAEIHQLSPNHSMDPPAKRLKMDSDAPRIDIEAVAADSTSYQ
FT                   DVGPLPTTSETERVDDLDPIPVCTSTLEYRNGIFLAPMVRIGTLPTRLLSLEYGADLVW
FT                   GPEIVDRAIIGCERKVNPHTGVVEYLKDHKQIFSCHPIERPYLVYQLGSADPHLAFQAI
FT                   KTITQADDVAAVDLNCGCPKPFSTHAGMGANMLSTPILLCNTLKAMRRAAPAHVAVTCK
FT                   IRLLPTQEKTLELVDKIVRTGAIECLTVHCRTKDMRPREPALLHRLREIVDHVNSVATE
FT                   MGRTIPVVCNGDVWDAATVPRIKELTGVTSTMIARGAEANPSCFRPQGNVSIPQVIAPK
FT                   WVKYSIALNNPVGNTKYCMAQLAFKPAEAGNAKGMSKKQLSALRMGISHAKTHEELAAV
FT                   FGIDAEQVKSQSVEKQILKDLREALEERVKRHATSHSGSGSDGQRLGAVVNNASNSLDQ
FT                   SSAGGQQNNDGHASGPDQNKATSNSPQPEWKQILADGIGDNIKNEKSILYYAFSTVEQP
FT                   SSVHDAAKPHVRYVVHRGFVNEKRDGDAEGGVASHNPAFGSSPCLMTTTDVRTPKVQQL
FT                   TSQSSLRAHGHDGSRCGECEISWWIESTQMQFRISGTVHVLPTPGHPLRSLFPFERLSP
FT                   PRAPDAMDSGEPFDWDAERTRIFNKLNAGLLASFCRPTPGSPHPNAHRLDAAKPKDDTS
FT                   SPWPLQLPQPGKEENEEQKEQLKQSEKNFALVVVEPYKVDLVNLADDTRTIYELVDGEC
FT                   AATGRWTSRRVVP"
FT   CDS_pept        325804..326610
FT                   /codon_start=1
FT                   /gene_family="HOG000204074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02920"
FT                   /product="related to TFIIIC subunit, 55 kDa (transcription
FT                   initiation factor)"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003C1B09"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE3"
FT                   /transl_table=1
FT                   /translation="MLDTIYICRHGFRMSWIGAENFPTTDRPRDPVLTAHGQSQARHLA
FT                   SYLSSLPASEQPQLIISSPYYRCLQTSLPTASALKLELVAEPGLAEWFPTAATKTGVHP
FT                   SPASAAYMKEFVTELSLSWKPMLYPSRDGETISELHARARRVLDLIQQRCGQLGLKRVL
FT                   ICSHAATIIAMGRVLLDDDADGKRTKFIGAGTATLSKYTRTREGGVWKQELNGDASFLP
FT                   GGVEREWHFGMVPDNVTEHGMGQGWVDPEAPTEKATGQGQALSTKL"
FT   CDS_pept        complement(326921..327778)
FT                   /codon_start=1
FT                   /gene_family="HOG000135970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02921"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE2"
FT                   /transl_table=1
FT                   /translation="MTRTLVYAILAAAAWLAPSASAQKKPTFNINSLPDKWETNQAGSN
FT                   QCSKWGASSRSSLCQNVFINNANDFCLWGPIKPNSQIGASEENVVAYCLKSGYGTRLIP
FT                   NGAIQGVQFLKTPNFLQVTGVGDFTGMNIQRGDAGGELDPHGADGTGNPKGGLVFSNNV
FT                   PGKEGKWTQIKEWNNFMSAYEFSFRAAYGPQAAQYAPHVYDVMGAYFNTNRGKFDKGVF
FT                   EDCQGDSGKFVGVYGSSTFRQGQAKTPAPHKPAASSNCKQYKTVSNGPAPQKAYRRSIA
FT                   KPLK"
FT   CDS_pept        330200..334699
FT                   /codon_start=1
FT                   /gene_family="HOG000167149" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02922"
FT                   /product="probable sulfite reductase cys-4"
FT                   /EC_number="1.8.1.2"
FT                   /function="FMN binding"
FT                   /function="catalytic activity"
FT                   /function="heme binding"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /note="amino acid metabolism"
FT                   /note="nitrogen, sulfur and selenium metabolism
FT                   FunCat:01.02)"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI00003C1B0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE1"
FT                   /transl_table=1
FT                   /translation="MGSISAVGAVARIAVLTSATLVNVAPSGKASTSSFSSVADKASEL
FT                   NAQLDVEHLNQHVELGSVLSQLKPAGNGLISVLSHAHQPTFTRLVPHLPKLVHTPLVFH
FT                   VASAGEHSDIMALRQSGLVLLHSSTAAQAHDHALLATKIATSAKRAVLHFFEDASGPVE
FT                   EVTNVDLASFIGSVAASTSTDAAAPKINGLNGHANGINGHVNGVNGANGNANGYASAVA
FT                   SEAGFDDLESAIDAAYEDVAELVGHAVEPFQLVGASDAQNLAVVLGAGSETLQDYTAPH
FT                   NDLAVLDIRLVRPSLPQRLLDTIPAGIKRIAVLEQSVRRTTKLGPLFVDVASAFQGSER
FT                   TLPSVFVSAILGHIDNGDNAAKELIKALQAPKPKHAFIVGDLKKLSARAQASPATAATT
FT                   APVQVPKHEEAYNLMLEQVFADRLALVNSANEESDDHPAARSPEYAFGQVLAQLEQRDE
FT                   LIRAVNDVLRDGGVSTELHEALSQWLVAKQDVKKNVASSNKVASLLQSSTSGAALQNIK
FT                   SLSEHLLLKSRWIVGSDAWAYDAGMGGVHHVIASGRNVNMLIFDSVPYTKRDAQAAHKR
FT                   KKDVALYAMNYGNVYVASTAIYADYTQVLHALMEADKFDGPSVVLAYVPYRTEDAPALD
FT                   VLRETKLAVDSGYWPLFRWDPSAEARGSDVFRLDGVRLREQLQQFLDRQNLFTTLINSR
FT                   PELSYDIAASQGNALRELQRRKAKEAYEKMLGSLDGPPLLILVASDGGNAEKVAKKLAV
FT                   RAKARGVAARLLTMDDFPVTEELKDEKNVVFLTSTAGQGEAPQNGRFTYKALHAMADAA
FT                   LPDTLNFTVFAMGDSHYWPRPEDAHYYNKPGKDIDVRLEQLGATRMTPIGLGDDQDADG
FT                   YQTGYKIWEPLLWKALGVDTVEVKEAEPEPITNEHMKIASNYLRGTIKEALVDTSTGAI
FT                   PETDGQLTKFHGTYMQYDRDTLEERKAAGLEPAYSFMIRARIPGGVVTPAQWVQLDDVA
FT                   EKYGNQTIKITTRQTIQYHCVIKSNLKAAMQGINKSMLDTIAACGDVNRNVMCSPNPNL
FT                   SELHEDVYEFSKSISEHLLPRMNAYHEIWLDKETDSSKQLLIGGVLQDYEPLYGPYYLP
FT                   RKFKIAIAVPPRNDTDCFAHDIGLIAIADPVTKRLAGFNLAVGGGMGVTHSMKATYPRL
FT                   GNVIGFVTPEQTLDACRIVMLIQRDTGNRANRKQARLKYTIDKHWGGADNFKAEVERRL
FT                   GYKLAEPKSYKFETNTDLYGWTQDYKGNYHCTLWLENGRVKDEPGAPFRTGLRELCKIH
FT                   KGAFRLTPNQHIIVSDIKPEDKDTIDAHLRKYKMNNWEHSGVKLSASACVAFPTCGLAM
FT                   AESERYLPLLMDKIESIFEANGLRSTDTVFRMSGCANGCSRPWMAEAGFVGKAPGQYVM
FT                   TLGGSHNGTRLSKIYRESVDEKEILEIMNKLVPLYAENRIEGESFGDYVIRAGIIKPTT
FT                   EGKAFYEDMCPSDVVPPSAAAKKGPAQATEHYDRASSA"
FT   CDS_pept        complement(335067..335915)
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02923"
FT                   /product="related to HOR2-DL-glycerol phosphatase "
FT                   /function="catalytic activity"
FT                   /function="hydrolase activity"
FT                   /biological_process="metabolic process"
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /note="osmotic and salt stress response FunCat:32.01.03)"
FT                   /note="oxidative stress response"
FT                   /note="phosphate metabolism"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003C1B0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAE0"
FT                   /transl_table=1
FT                   /translation="MVKTVSVEVDTILFDMDGTLIDSTPAVNATWASFAQQYNLDLSFV
FT                   MQTCHGYRTVENLRRFIPSISDAELPKEVERFESNILVVAKQNAAKGQGGSIVAMPGAK
FT                   ELLDQINSGRPDAAVEKGNYGWAIVTSATKAYAQQGFASAGVSSPPEVFITSDLCTKGK
FT                   PDPQPYLMGAEKTGQDISRCLVVEDAPPGVRAGKRAGAKTLALRTTHDGEKMQQEGADY
FT                   IVEDLRSVQAKWKHDGSGLVLTIQAEQPEKGEAKGISELAKQIQLQNDPTSNTHAVNGQ
FT                   P"
FT   CDS_pept        338460..339089
FT                   /codon_start=1
FT                   /gene_family="HOG000170452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02924"
FT                   /product="probable ribosomal protein L13B"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /note="nucleic acid binding"
FT                   /note="ribosomal proteins"
FT                   /note="translation"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniParc:UPI00003C1B0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAD9"
FT                   /transl_table=1
FT                   /translation="MAVKHNNILHNNHFRKDWQRRVKVWFDQPGAKKRRRTAREAKAAK
FT                   LGLRPVQLLRPAVRCPTLRYNTKIRSGRGFTIEEVKAAGLGKKYARSVGIPVDHRRRNK
FT                   SEESLKLNVERIKAYQARLVVIPKLTKKNKDKKVDLSNVEAVRQVQSVLPLPAGTEAEK
FT                   PRAITSEEKEFNAYETLRKARGTHRAAGKVKARIAKKEEEAANAKK"
FT   CDS_pept        join(340605..340684,340771..343000)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02925"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAD8"
FT                   /transl_table=1
FT                   /translation="MKGLLVPFVLVGLLGRFDHVAASPTVDVVHPPNHQGGTTALSDGI
FT                   IGSDSKTSPLLEARSSKDGMTKAASANGAPAEDCFLPLLGGGLPNMFQPAAPGMSSLTP
FT                   GMSSQSSPSSSPSPLSPLPVTDTSGSAGLGASAALSGSGAPGASSSAGLDAHGGLSGSV
FT                   GLGGPGKSGSSGGADSSGSSGSSGSPGSPGSSDSSGGAGGADSSGGADSSGSSSSPGSS
FT                   GSSGGAGNSGNSGNSGGSSTTDTTTGGASDKECDKHKKEQEGSNGSARSGAIFGDSDTA
FT                   SSLHSSGGDTDNGAASDCAACKGESSWQRDDDSSGSASASPSPTSSDSDDSDASSLAGS
FT                   GGSDADSGHSGASHSNTGGDSVLPASSASAGGTGTGKKQDCEKGKHTASSQTTGGTTSG
FT                   NTPSSPSSDEEDEEESSSGAPASSASTPASTTDGSEDQEDQADQRGAWPETSATSPHDS
FT                   PATSTGDSDSSTPLVGAATGTRDKGRHEQDKGGSSRNLAGGSSITSTSHWEHHTHSHHS
FT                   TYASSGSKSSGGDTGSCGRPATFKDILKVFMPPSSEAGAGGVSSGGSGVALVSSGGGGV
FT                   PSSGTWSAAISSGGGSVAQSDASSPGSGSSGGSAAADGKGSASSLNTDDDNHQSSQGDS
FT                   GKSRGADSNDVSSTRSDTSDASCPATSSKATFEIAPCDMAALFAHMQISAAQLATFEAG
FT                   LQALLSSQKATYTVDGKRVSADQLSTSVGAQIGRALDAHVGVRADGGRADASVHSRGLS
FT                   ASGPSRFLFKVRRRLF"
FT   CDS_pept        complement(343422..344183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02926"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009688"
FT                   /db_xref="UniParc:UPI00003C1B0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAD7"
FT                   /transl_table=1
FT                   /translation="MALRAATRVMLAAPRGGSSSLSTLRFSSSTRIAQQYQRSLVGSTA
FT                   WSTSTLGCSIAQSASPCARSRWMHTSTSNSSKSTDHTSQSSTQSESPDSDSPPPKASFR
FT                   ERLKFLTRRYGWWALAVYLAASTVDLSLIFLAIHLLGADHIQSLESSLRKSIGLEERTD
FT                   NANPPRGSSTIWTEAVLAYTIHKTLLLPVRVAFTAAVTPSFVKWLVKIGWAKANHHVKA
FT                   QVGRKAAEKAIQDVVKRNAAANKAQQISKHQ"
FT   CDS_pept        344550..344861
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02927"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B10"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAD6"
FT                   /transl_table=1
FT                   /translation="MKHENVPTTHDCGGSLHHADPAHLHAPFMSALTPTPEHICSLKCQ
FT                   HSSHSRLSFDTASSSRRPAHPTSRAPSFTLLPFVQDRLTNIWAHTLQTFVKQVFSIHR"
FT   CDS_pept        complement(345036..345803)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10317"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI000159541A"
FT                   /transl_table=1
FT                   /translation="MASSESAASASLASAASVSRASASSAALTTSTGLTTTLTATVIAT
FT                   PTLVPTSSASADSQSSSDTGSGGASKGLIIGVSVAGGVLVLAAFIFLYFKFGTRRFSNF
FT                   DDADADIKWPELKHDPDSNVMQPLPARRTGGAGFDMGDESDNEGGDHDANAGIGEKGRD
FT                   SFSGSTTALAAAPPAGYGVNDYASGMDHAYAVDPAAAYYQDHHMYDGHQYGIQTSPGAG
FT                   AAYSDNGTYGVDPYAHAGMTHPQSQQYPHGHYQ"
FT   CDS_pept        348565..349956
FT                   /codon_start=1
FT                   /gene_family="HOG000216359" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02929"
FT                   /product="related to longevity-assurance protein LAG1 "
FT                   /cellular_component="integral to membrane"
FT                   /note="ER to Golgi transport"
FT                   /note="cell aging"
FT                   /note="cell death"
FT                   /note="glycolipid metabolism"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="UniParc:UPI00003C1B12"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAD4"
FT                   /transl_table=1
FT                   /translation="MSSAPPPTRPATGRKRAPSFSEAIAQVPQNANAQDETADPVVADR
FT                   IAAADAAAAAAAIKDPVAASTSTATATATKKGKYSFQDDEIYRSQGLIKDLTTFRWMTA
FT                   PASSFQLAAIFVLAYFNWNFFIGTPDNNPIAPFLMLSHRVPQSQVVLDSLPPKDGVQRA
FT                   LQNLIPRSAESLEARYQKGYNDLFFLVFYVIVFSFVRQSTTLYIFKPFAKWWGIKSESK
FT                   QARFTEQGYAVLYWGSAAALGLYVMSFQDSWWYNLEHLWLKYPHWQMRSELKLYYLLQF
FT                   SFWLQQALVMLLRLEAPRKDYYELIAHHLVTLWLIGWSYLINLTMIGTTVFVCMDIPDT
FT                   WLGFSKALNYMGLDNITVVIFALFMVIWTYFRIYLSAATLHSVWYQFDLIPRYAREWEP
FT                   EKGWWLVWWMKYQIFAPLFLLLLLNLFWYVLMWRIMFRAIKGNVADEREDGEYDDDEDH
FT                   EKKTQ"
FT   CDS_pept        join(complement(350713..351449),complement(350453..350601),
FT                   complement(350306..350378),complement(350121..350217))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10318"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008591"
FT                   /db_xref="UniParc:UPI000159541B"
FT                   /transl_table=1
FT                   /translation="MPLPRYSLDDGGDAIDETLQESYSSVASASHTVPTWSAPPDAADA
FT                   GADAGAPMSFEETPSFRLGRSVSPSVAAYDAPSSLDIDALLESTGPHHTKDNRSSWLAS
FT                   ASEAVGWPYSRNSPIARLTPFEQLTLYMSTQKAAPELLPFPTHAFDSLIGQMEQQQSIL
FT                   DSLLHLPPSNAQDEEQDAPESGVDEDEFLRLNLVQVDLERCKWLLKHILRTRMDLLQKF
FT                   GAFIVARQNERRKLNDAEDRFVGEFWQLKKDHFHSAVLGYLPEQLHDLTTGQPADTDDL
FT                   SQQDTQQPNNSSNMVPGPDLDAPVFLRCLQDCGEITLPDNEKATLSNESMHLLRYRSIR
FT                   HLVYQGVAVLL"
FT   CDS_pept        complement(351941..355429)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10319"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI000159541C"
FT                   /transl_table=1
FT                   /translation="MLVYMSQYVDEHSAAPSAVSIKSPPKPASSKSRKDKINFVSKASL
FT                   AMFDPRLAMGIDAGSDWYEPDSHVSVSSSSLGHAAHDCIARHSEDNARAHHWNTSPTPE
FT                   LEAFAAASIDDYSYSSSSAHANVDMARQPSASSSVFEDDRDVPETSSRRRFLSRKSVAP
FT                   ASTAIPPNDMLFSPLETKSKSNRGATAASTSSASSFSRFFSRRKKDKAPHLAGLASRST
FT                   PDLFDGVPQSAPPTTMTFEQSGFTFSPPRNTSDSSSLDDSPSSLPTSPEHQPILLLKEF
FT                   NPVRTSPLNAKQSMPALRQIREAHNAAGACQPRSIAFASPETRLRSVAAAISDSFDTAP
FT                   ALPPLPSFDSCSPMIPPEFAWDSKRTMAHESRMTSTASNARPVSRVVSSTGRGVPSPSL
FT                   NPIRLNDSRKSVALPRSEAAVRFAGNVKPAPVKSTVTRPAAEPTRADKRLSMTQSVVDG
FT                   LLDQNHGREEPEMRTRRTDMEVRSARRRSRSVDSRTLPCLTQNHVVSPPSSKSHSDSVF
FT                   PAFVRHAPVSPGRANSPHSHLSAEAESANAVTPTPRQRSSFKTPTSASPSMPPAHSAVR
FT                   DQSPSSRSPQRQASGETHQARRVNFAGQRVKAVAVASPLLLSKSPRLGGRSGASLPVVN
FT                   IMPPTPDLTGTEQDQEHQQAVLQQQPRQNTVVQQTVAQASVVAAVPSSNFTKVVTSGSS
FT                   QNKAQTAPVERTLPSRQGATTPTPKHVAAAPVKPVQPAPVTVMSPKSVYSPVSVYSPET
FT                   GDRMMSFLHGVLTGDEDDMSKEEMQITADSVAAEMSYISITRNDSVTSELSEASSARSS
FT                   CSGAFAFSRSMSNASLVSGGTFSSASSNASESPERRMRSLFSKTSFDFSPTKMSSCASL
FT                   ASTAGSDVLEMVDKLQTSTTAKADPSEAWISDKLKMPFQLKRLSVDADSASPAAADSSD
FT                   CETPTLASCRQMDAASVQPRDKAQQDRIKANRQLGLSMDLNDLAQELGLGRLSQLGLSH
FT                   LKGVESLAQVPGGEPSIMPDVAKKMQPIKPPKSSARAAATAAVGGGAAAPHFGMGMKDI
FT                   ASSAAMSPLPVSIAGRSPQTPPRKQLPQVEPAAGCKVSASGVPKSDGGFGLGLKFFESP
FT                   SPQSEPSKAAIAPTRYGQHVLEQSHTVPTQLLEQQQALSYHYEQHDEVDWVGVAM"
FT   CDS_pept        join(358803..359495,359581..359807,360074..360123,
FT                   360360..362415,362502..362573,362656..362716)
FT                   /codon_start=1
FT                   /gene_family="HOG000196377" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10320"
FT                   /product="related to CWH43-putative sensor/transporter
FT                   protein"
FT                   /note="CELLULAR COMMUNICATION/SIGNAL TRANSDUCTION MECHANISM"
FT                   /note="cell wall"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI000159541D"
FT                   /transl_table=1
FT                   /translation="MPSDVHPSRARSAPLVVLSGGLISHIHTVMGFLAFFGALITALSL
FT                   HYPKVVKNHVAQYPDEWWPSVSATIGDWYPERNIFQVGIALMAGPRFALVLLSALLVSL
FT                   STPIPSPKASILLCVGVLRTLACGGWVYVTSTDDHLVHDIAMFVYLALTPPWMFITSGS
FT                   LAQPPSVKNAAKTDDQLASKARKMRRIACFSFFACTPFMGFFFYRHNALRIPGAYSYYA
FT                   YFEWGLIIFDLLFDAASVYDLSRFQIHIVEAPLPDAPSPPATNLSTTHGPEEKRLIDGA
FT                   WIRGGRSQAIASGAWSAAHSDSLSDGPTSLKAIVSLISDCYLVSVYNLAIGGHEALLIS
FT                   QVIGLGLTLAVPALRSCVRRQLADGASTVGPISSQAKALGWLLSLVGQASWFVADPLVR
FT                   LISVAFSNALLAVLLALEWGAAWESDQLSVKVGIWLIGLLASNLAKYANHSNNPAWPFM
FT                   DSTNGGHNVVFLALALLAVTETALRPKYSHLPVVRQRHGRQSVTPTQHNRVSVSSEQPG
FT                   SFYLAALGAGALLYAVHTFLTDTGTMIAWGWTGYPITGPMAIPHGCIILITMAFSSLAA
FT                   TRWSTFGYRLSLFLVQCGSAALLHLTDDWGSFAGAIGIALSLPALSFPLISAAMHHDPI
FT                   KVMLFAWLVANLLTFFGVLTVAYAFVPGGKIMRERTGLMLVVHLMLLGGGLINARSVDL
FT                   RRLSSQRDADGPSRHHAKPSNSKEAKTDSSRKAAQSGSSYYICLFMAFIGLVGNLVPLY
FT                   RIVPASSIVPHHPQERLVTAGMWTVHFALDQHMRDSSRRMASIMKTLDMDLFGLVESDL
FT                   HRPVFGNRDLSQYLAEELKMYADIGPAPSKNTWGAALFSKFPIINSTHHLLPSPGGELA
FT                   PAIHAVIDLYGTPTHVIVSHNGQEEDPLDRELQTTEIARILREAYPHPAIFLGYVVTKP
FT                   HAERPAPYKILFEDGKIQDVEPTDFGRWCEYLGLRGLERISYVRVSRYTVTDTELQTMK
FT                   LVVPKEPIDPDRNDLTNFVIAETYPESMRYPTSLIDPDAFVYDKHIYSPYPWPIYYGRP
FT                   TPDF"
FT   CDS_pept        363290..366055
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10321"
FT                   /product="conserved hypothetical protein"
FT                   /function="RNA binding"
FT                   /function="binding"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000159541E"
FT                   /transl_table=1
FT                   /translation="MPPKIRQRGKKPSKVRKLQQEQEQLQQHDAQPLASSASSSTNPIQ
FT                   SQADYIPVDVEDADTSTVPQNDAEEDQPNWIKLGDRPGKAEHEAPFGYVDAELKAYLRA
FT                   GWERVTELESQGYTSKSTLTAIVAASAPSGAHKNGLGADDDEADDDDELALLLQATLKE
FT                   MDGKELLLSTDPDTSLIVEAILHRLPAKPLRVFVDRLAGNFAVLAKHRFASHVIQACLT
FT                   TLQPAVTLEHASQQHFYQHQHRSSGLNGKATASSAYASDAATIVNEDGILRSATQLILD
FT                   LIDELSSDQDMLFSLVTDSFGSHVIRSLLCVLTGRNIQTDPSSTAHAAAASDLRSRRSA
FT                   KFRNRKAPTAPNSAAVAGAVSPEDLLVVVPDLLYNRAMLLRQEILKDASVETVRRWATD
FT                   AVASPLLQLLIEIEADSLDGEQGDKLWKGTLVDSLLNGFVSSPPETVEEGEVKKDVYLE
FT                   TSLRDNVASHALQLVLERAPASTASRFFHIYIRSRMAKLCIHPAANHIVATLIRRLSTA
FT                   DLEPVIAEMAKIASGMVKEQMVGCLQAAVDRVVQLTQEESDKEEVKELVKAVSEVVLAA
FT                   FRFKSQSSSEQSDEEGLKLLVPAVLALRTRKAYLHTYSAHLKKDNRDGEGENGARGSKR
FT                   GRDGKAKQSKTKYSKKKDAEVSNKEEEQEQSPWTMDASYELPAAESTTQGSLLLQSLLR
FT                   LPGPAAPARAPPKRTFGRAAPASASCTSAARAESWGSALVLDSLCSLPTLTPFARNPTA
FT                   VHTLISCLCPPPHPTSPHLDWNQSTRRRTLSSTLTTSLASFCGDKYGSRLADSLWFSVD
FT                   GYSKEKIVKYVIEHSTEIIKQPYASYFTNKLQLQLYRKGKVREWNQAIQAQAQLANKDK
FT                   EISVSTVQSGARKHSPIIVETKRVSEASAKSKRRKKSKLDGQLDSILDQI"
FT   CDS_pept        complement(366302..368995)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02933"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1B16"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAD0"
FT                   /transl_table=1
FT                   /translation="MAASTMHTATDGLGIGIGIGLGVPLLTSVDPDNAKPKLSNAVLGY
FT                   GHPHLNQQLRWPYSTRYRSSTHMRLGCAYDSSPTPSSSSSESDSSVDTHKTPASATHDV
FT                   LLSYFSPALSDASQPETLDKVYLLSSGLKNPQTRRSKSETFRFPLPPGKPGSIKAQPVL
FT                   LKSAMRSTSKDYTLAKPSRAVQSVEGHDRFGTHLSPALQETSQARQGWSPYSSVAPTPR
FT                   QVSASQRFGLDSSLDVTDSPNSQRMTYTQSLDRSDSAAYACDAWSGSCSSQTLVSDSET
FT                   DSGAETDPGFSSDAAKLARLHASLLLLDGAVTELPLSLGETGARMGSDERVQLAGSVEE
FT                   KMAYLCGLGYRYRSAKRDRHARNASGEFASAKVQHAEIGGWWSDDPDNPEHHGVVGVDE
FT                   REKMRQGNVQSHAPTVVGTHKAVRVVSACASAVTSGDSSPILGGTLAATVHIEQAVDDG
FT                   DVTMRANLLPEPAAFESLLDDDFSYLVDDRLIDSHDWHEHAAAKWVSAESALMTPPLTT
FT                   PELGLHGASPALLDAWPSPLCAIKTDATASAAWPRGALQAIDGCRPYSTSSSVDAFEFS
FT                   AALSRRGTQPTMLLTSSSSCPLSITTPTHSKSTHDSQRHQSDTEQALEIAQVGRTTTWP
FT                   CSVLTRPRPLACSHSSTSLFSSASSDRLQKPPGSESVLARPRPLALRSADHCSFGSKPD
FT                   LVAPRKAVVSKIEAAQAAQKLSMPRSASTSTVATQIKVPQRKSSLNMRAQAQLPRLGDQ
FT                   TEEHEPSHPPSRVRWHHDAQYHSSAESYVMSGPFSAPIAQHGYRAPISQAASQVCTSAA
FT                   NSARIRRRRLHESIPQSHSLPVLFTARTPAQRARAEPRLRTNPPTTTSVVSAPHPTENK
FT                   PSTYTVQPPNHGVLVVQEITTIGLAL"
FT   CDS_pept        join(369835..369879,369996..370118)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI000159541F"
FT                   /transl_table=1
FT                   /translation="MPPRIPLTPEQKRIRTIMISFPLLVATSVVLFKRLYLGEEQRKLP
FT                   THGKIAPAPA"
FT   CDS_pept        complement(370796..377209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI000159542E"
FT                   /transl_table=1
FT                   /translation="MTDSTFALKSPRFDIDEEPGDSHSSSGHRWVGAFERVLGDRESLA
FT                   SERTSRPSVKQVSSINPVVGTRDTRSFSSRAAAFDEPVSEPSRSTAVSRAGSSHSSGHG
FT                   SPSMRSIPPSDLASSQQASLTDTITSDHAQLLFGTETASHGATLTRFRTNSSSGSISLV
FT                   SLPPSSAASTHNASSNTSYGTCLQHRTKPTSTSLHIVPPQLHDTAELRVHSQGPAHVSI
FT                   NVHDCLRFEQSYINHAPCVHHVMVTNRSSQHSALVRLESDLRQGLTFMRRKRSSSLNQF
FT                   EPVAWPSNTFAWAQNGGFIPSNLRGWRHVLANLENADSFILDPQQSTKVYVVLRPVDFV
FT                   EEAEAERAHTGWPYKTPTSPSTQAAPSKHGELLASPAPPLAHSEHSTTTSPVSTPAALG
FT                   DQQGSFSATVSEHDNAASGTEELGLTSPRSAPEMRGPRHSSSSQPVRSLHPAFGLRGTI
FT                   TLSSWALPSTDNQDEASLDTTNPHASSRPVSIYGAGSQAASASASVVSSSLSALQSQAE
FT                   ERDVQKIRIPLAAQCCRPFIDAAIASAARIEPNSSTQTSHGSAIYLDFGDVIVGHSQSQ
FT                   TLTLRNLSEIDCFCQVKLEEADNMLQTPPISLTQADTDEIVPSVWAGDQESVSYDPLVL
FT                   ARLESKQIKVSLKPQEPCRDYEQVLTITSLHNTANSIRFVIRANMLGTAKDDALSVLSG
FT                   DYLDFGDCYGGHWTKQLLVLKNNADVLLDVSFGVQKGFQVMFQLAELAPQTDDEAFEQE
FT                   ELPPSAHISEISLSSASTDDRSLMSSLEDSGSGGFGADGASSAYEHSRLSDAQGEHGAT
FT                   NSELAKTPTHHAHVPKGSAALDPPALQLPAADAADACDLLRGRRASNQTDEDGVDASSV
FT                   ASQAGSRSTSPVRPATNLASQPTVGAPLASLAAESAQSSKADSPHLNLMDRVHSGRAQS
FT                   LSSAASDFDRASVSTNPHSQMSSAFMSRPASRGRLTESERHDDANSVRSVHTALSQDSR
FT                   PGPYPASSSHAGSSNVSGRNSHRTNTGAAISGLRNVEHAQTNQLEELMLRPGGEYRVFV
FT                   SYRPERAAWDADFTGGRLVEKTFRVSLDYSRARLANMRSRGGRERRTIVCHSRTCTSFI
FT                   SIAPKMIDLGEVQVGTRKSANISVTNRSELTARVDLRFVSKVLSMYRDEVAIPALQTVE
FT                   LKVESFPRRVNETYRKQITVANLLNRQGDQIFEVRSRNVDKQRISFHSLFYRILTPTGA
FT                   NYVDFGDVDINSMRMRTFTIENVSDKKLSLELSPAHPEDVTLYIKAPPADASHESSPKL
FT                   EAKAAVSKYSETQLNEPQASSAETAEGTNPGRVNGGLSMTKSSKPLIKGADLKERFLET
FT                   ISVDSPTSMRTENASWRLAQKHSHYRKKEDGSAVSTQRKTHASGKSKPNINLLSALKKG
FT                   GKGRITVGYGKTVTFKDRSLISEFEYLDLATGPPVDAKRIPAKSKKYALLENITTGGKA
FT                   KSLGQTTGAKHAADDDSSNGGSVKSKAGSKFKASQNAKDKATEVRPEPGSLSPNATASK
FT                   VASTVPRLPSPLANDIIAHSASQCRTVTKHTPHAGTGAASKSQPASAIRHHGKSSKEGK
FT                   TGDASARVHFSPALTGKRKAPPVLSNPVDVSRMSIEDLLAAVEAQTSMLSTFFLGSPDA
FT                   EEQFVRAEINLRRELQSSIDTGKLIPLEVLAVAPRSEGQVIAIYHPSGSTRPHIQGTAR
FT                   KQDSRIFMRLIDFDLGVVQRSEEFSGMAELEADELPVRDLMLRSNTCRSLLELGQPHIN
FT                   FGHMEKGDSKTRKILIQNRSEWALRYCIRKSGSIASGDIKLSSGRYGVVPGYGKREVEF
FT                   VFSPSMSGPFQEKLVVENVADRDNDQTVVLKANVRKTPNFAVDPGAINFGACTPGKLST
FT                   PESFVLTNTTAKSRSFVIAIDSHDLLHQRCLIDVGLSTASDDQVRGTLSKEEEEEIENL
FT                   SQKLKIANRKGNTDKVKKYEERLTALGVKVPSLSSSASASADDAPPVVSSSENAAANSV
FT                   QVDGETGKQEDSRRATEGEPAANAAATVSSAATAGIDRAKELKRISSTVTCSLSPNQSI
FT                   RLILRVRPSAVQSAIPSNTSDPADRRTQDKSGMEEVSVPVKVHEVKNQDETKTVVLMAT
FT                   VEFDLPKCGSDDQEVFPADAVIFSSSE"
FT   CDS_pept        379129..380205
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02935"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniParc:UPI00003C1B18"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAC8"
FT                   /transl_table=1
FT                   /translation="MIDRAAIVVPMRSQFTALTNCTVHETHLRDALNPKVTLCNPLHAS
FT                   TFVLACSCLTLLACAFGPRLDVVLTQPRRELSRTLSCSRYASLRAMRIHVNLPVALAAA
FT                   RSNVASTSIRSLAPPPLTALAPDGELLLIELQGSLEIENQSPTGGQVLGTISFEPTRPD
FT                   RPILMISHHRLEGKFVNLVKPLAVLEKKVRKDPAHAQHDVLVELANGKRSAQQASPITP
FT                   KRARCEQDNATPWSPPLAPPLSPRRGRDALDFSSSPPRHTPIRQKPVKQTFGLEHIVEN
FT                   TATLLDSSQEQHPKPSKVQDHDDDDGNKDNDDDDDEYDDDAEPQTAVYYDVVNVIKRKI
FT                   LFSKRPEPIVRLNPSFTT"
FT   CDS_pept        complement(380331..385151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02936"
FT                   /product="putative protein"
FT                   /db_xref="InterPro:IPR018849"
FT                   /db_xref="UniParc:UPI00003C1B19"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAC7"
FT                   /transl_table=1
FT                   /translation="MPINTDGKTATTAAESSALACASISTSEQLVKTLRIPQPPPNGVR
FT                   KIDIALEAWHSNELYVPQKAELLSQWALGYLCSSLKSSSSAAASGPSNKGKNKAKQQQQ
FT                   QHIPTSTVELDSKAWMLLSNIIATQIGTGSDLSEAAKRSWLSHLANTQPVLTLSGSFAR
FT                   HLSQDTSLSLEERQTLLSVASASLEKLLLPATSRTAATNIEAATDSIQAWLDFFARPCS
FT                   TLEQQKGFAILGAIVTTWTTTLQYGSNAKRNHQHFCSNVVPSLLRALHTLSFRGTHGKA
FT                   GSARHGALLDTVRQIAAESLFTEDVQRSLLQVARQAQGTNSPSCKHTQIAATGVVSQLC
FT                   SSLQDPQLSQAAYSSLSTIGDLLWTKLSRSEALHVIISSSNITSGTVREAQLALVRKTM
FT                   LSQWYFPLLPHLCTCASTQAPHVDRAAAIRGVLNGIERHSLYTLGCDEAEDWRLLFSAL
FT                   FESLRNELREIATDSSPTAQAEKADIFACLTSLWRLEKSVVEDNLTCIFALVGAQRVSK
FT                   PALWLAEQLSPATLAALDMFRAVAAINVRFRTIPSLVNTIIASLQLTADLVAKTDDASL
FT                   SSSLFMSQTFLTEFAKLCHDSITAMQVPELIQRLSSLAQRLNSISQSSATPKASKKQRT
FT                   SHGSPSKTDNVQTEGTNVWIAHLEIAAQVVQSVNLAPTLRARCSAAAEELHKALILPCI
FT                   DVCLSSHTVQQSASIYGVAAAALRVRQALLSEKWRYDPSEPVKLDGSLPTESLTSLEEA
FT                   FDERADTLLELLSHKHQDDPDLCQLQFQIVQGLLQRAERDLFLGLKESRYCRLLAEDKG
FT                   PLCGLIRELPLSGGSQVSAWTGCANQIRSRHELMQTLWMAIVTRWAPLFEAIAAREIFE
FT                   VLAHTLVATAQPSLQRDDVQSAMRYMTSTALRNASFLELANWRKHIIATIQKELASPTL
FT                   ERRLASTAVLCVTPSEWVTKTARGPMLKALLALDRDLVAAQHKRKAAEQVATVERIELR
FT                   RLLASVQEAYATEANVSDDELLASLEAFWSSQVSDANLQHAWERASLAAIRTALGVLFS
FT                   RGKANAATLERLFSLAKQVRHEATAEIKDDSTRITLKMRAAQEMFTILSAVGADHAELQ
FT                   TEAGAARTNLDAIMNVSSTRLETISDVEKTLDVLLYHLGEVRLLVRATGKDDNLQQETA
FT                   QTLSRAVMRSVCTVFGRVNVLTPENEATKLVRPAADVALELLRCMDMCGRAMSDSNIML
FT                   SACLAYSALIASLPGLKEQRRVGDGLQRIVSRLEAQQYDTVLSKLLNALGCTASANIAV
FT                   ATVSAKEAATMDGDEAALIGTIGLVLGSAPEATSKIARTHLSNWLAILSGSNATGGGGR
FT                   IKLRSMVACISALDLVCSHHAMLLRTQDLGAVLQLFSTVTGPSMCDEPLASVVETKREE
FT                   LDGMRSKLFGGIVSTLSSLMRLRQDLVVGFLPQVGLLLARLITLFRRLGRHASNGEIQA
FT                   SGSQRRSLRRDLPAWLDPVLVTPLRAHHEARALSRLVSNVMAKSVSLKHRSSDAPGTAV
FT                   KAESLARPLSKHATYMLVAYLKSLTAQGSVVPADVRAELEVGMMTICEIMGHHQRDAAM
FT                   SGLLDSAGKVLMKRIWSEFEKQRYKGQ"
FT   CDS_pept        join(385643..385975,386065..386076)
FT                   /codon_start=1
FT                   /gene_family="HOG000111586" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10323"
FT                   /product="conserved hypothetical protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /note="mitochondrion"
FT                   /note="ribosomal proteins"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="UniParc:UPI000159542F"
FT                   /transl_table=1
FT                   /translation="MMHIALSTLSRRTAAAATAQVRFCSSSSSSFSSALLKTTATSTSL
FT                   STPPSSSPRLPTTGYSKSSPVFKSMEQQQRGMKVRSSVKKFCDGCSVVRRKGRLYVICS
FT                   KDPKHKQRQG"
FT   CDS_pept        complement(386380..388293)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02937"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAC6"
FT                   /transl_table=1
FT                   /translation="MDARTSTSDSASFGLNPSSGDVNNSATRLPGLAGTQSEKQLTQRE
FT                   LAALRTIKRNVDTTKYAGWLLGASGTWILLSRRKPPPRMIPKLGWCVVGGLGGSFLTMP
FT                   AGILLSRNVLRDVEDPQHLRKVLAGAIEEQRQGRKPQVGVAPPKGLNGESDFEQAQQQA
FT                   EWGGEQSAQNYTAGFDNENVAANTVTAHSTAQGSTSIRSGGNTSDRSGTPRPPADAAPD
FT                   GTGPGTRWAQLRGERGVEPSKWERIRQDNARTAYSRSTAASSDAEQSNWQDLSSSYNNN
FT                   SQSSSEQQQTDKRFSSSRTPPRSTDEPVMTLSGAEDDPRWSSPATFSPRSSGWGNNELL
FT                   DDPAAQSQTRRGPGSTRSYGILSVLEETSSNTASEYQLESDAPIQVVKGSLLSALAGGT
FT                   CGSIYGVLKGRQGAGTVLGTRMAFSTFCFAFPFFAVREYILSPILKRTSSGPDPANRHM
FT                   RLSAVAKNRHTHNLIASGLAGAVVGAGAAGFTRGPAAIHKGALTFGLACTGLQLVGNQA
FT                   RIVRDTIIRRTPRPVPVPDSMSAHHVLSDPPAPAPPAPSASEDVQPEASTHDEAKQADQ
FT                   RDWLSKVKRAMPIRSVSDQDYEEKLKHRLANVNHRMADIEIEIREIEELLKQQQEKARK
FT                   QD"
FT   CDS_pept        join(389095..389217,389301..389459)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10324"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595430"
FT                   /transl_table=1
FT                   /translation="MTNKTTDQTFKKTRQVVGANGNQLIDNLNENIMNEAPGHDGNVAL
FT                   EQSGQQRSHNQQIERDLVNKGYSTRPTDEQVAIDADLKTKLDKRASRE"
FT   CDS_pept        complement(389564..392737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02938"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAC5"
FT                   /transl_table=1
FT                   /translation="MSEATHLRGAYADNKLIRAAIHQEQRRIGHICAILVRNLSLRPTR
FT                   DRALQTLTSQRPGRLDRYHTTSDDADLTHTIARSNSKGKEKTNQSSRRRRSASWSRLSN
FT                   HGSSDDDHREDADHLDTSSASTSTATKSQININHRNGRGRSALLINHRRTSDHELTSSS
FT                   SLASTSDGAHSIDASPRPILKRASSTRDGRDARIYGGSPASASNTSFLDELGANTTMLS
FT                   RSDSRSSSHSSHTIRRPSHRARTTSMTSSSSVRSVRFDESRFAGNNNARRTSRISGRLS
FT                   AAPRYPLFSQKSLAQIMKDRMLECHVELSIGSGKDDRLSATASAAMNYVTDQGSERGAD
FT                   SENLQVFYRTSNSKPGLHHSWGYQSGDPIIPERDFRVDSNGSSDVHPLEASTLSIKVYA
FT                   RTPPADTDNVGPQRGAQTAKADAPDWKLVCQTSADLRDLEPLPGNMQSVNLSLPPNSIL
FT                   LGLAPGANSLSGRANIASSDSYRNMDSEASEEAKSGPKLNRSTSEREAERTQHILESIV
FT                   YYVVPLHMSQKLDAAHAIGAVSTIDEAADASRGHRNKDGSSSHSPTLFRHTSLDHYASD
FT                   PESAPSRKAVSAPASEQVAATLDSLALPSVAIAATPDARRRERRKAFEDEQRRVLELSL
FT                   RETKMMPSYTLNDAKHVAKKQAELQHLSDQVQELRRVNGDLLSEVDGFVQLRLRYEQQK
FT                   ARYSAVRQMALDEADQLQRKRTELTERKAALEARRRAILASQSLFEAVETTSRQLKEDV
FT                   QTLNIEKAHVALQLHVQQASMLRDLEAIFPIELSDASSLLFSICGLPLPNAVPSIPASE
FT                   LANEERRWKDTIKRHVPASTRPVFHPFDDETISSALGLVAQLVMLLSTYLATPIHYPLA
FT                   TAGSRAVVQDGISLMSGPRAFPLYAKGMERYRYEYAAFLLNKDIEQLMNVHSVTVIDIR
FT                   HTLPNLKNLMVTVAAAPPTSQMTRKSHIGKSEIALRSTPPVQRNVDVTNGNVKKSGLEI
FT                   GLGLPSVNAGAKLASAGGVRNEVVHDMLVTTRVLGAPSTATTKPATANGAIASVSRALS
FT                   YISGGNARS"
FT   CDS_pept        complement(393184..393738)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10325"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595431"
FT                   /transl_table=1
FT                   /translation="MTTIITDHGSGRQTSEIRRLALVTHSAAAPHRSLAEHLENARLGS
FT                   ASLALATASMRNGSGTRRRLCLMAAILSMIDQPTNATSSVGPLSRGHSASARTVIGEFD
FT                   PRIVLRILSIPRIVVVRTYPRTTHPAAARFVDLERLFAVFQIADPSQECWRTRFLDDDL
FT                   SSPRTMPISKNREYDPHESRI"
FT   CDS_pept        join(397330..397695,397785..399143)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10326"
FT                   /product="probable Mannose-1-phosphate guanylyltransferase "
FT                   /function="nucleotidyltransferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="polysaccharide metabolic process "
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="UniParc:UPI0001595432"
FT                   /transl_table=1
FT                   /translation="MSSSRSHSPHLATPSNPSFLSILATSTTTTTTTSSSSTSDSNQSP
FT                   TTPTKASAAHASGDLDQYLIAPDQAGSVNSALHIQERALHNLTANDVHHSTSTTMGNVS
FT                   EQSAMDQVLSGVLAMQKELSRLHLRMDEMESKNDVNACRRNSFYNNFTPGQMSPALKSP
FT                   ALFPRLTRAPSSPPKNNGSSDLLHAPHLSMGASAHTQPAPLLAEEPKLGLWAVVPAGGA
FT                   GTRLWPLSRESYPKFLLDLTGSGRTLLQSTWDRLLPLAGQAQMMIVTGQAHVGGVSAQL
FT                   PDLEQANVLAEPSPKESMAAIGLAAAVLLQRDPEAVLGSFAADHIISGRDAFESAVTEA
FT                   VATAKAGYLVTIGIAPSHPSTGFGYIKLGEKLDVSEAPNARRVTEFKEKPDARTASAYL
FT                   STGDYRWNGGMFVVKAQVLLDLLKGTVPELHEGLTRIAASWDSDARDTVMSEVWPTLPK
FT                   IAIDHAVAEPASKVGKVAVVPATFGWDDVGDFASLADLIPAEEGEPRILGDSRLVVTES
FT                   QAGGLIIPAAGRPIACLGVDDVVVVDTPDALLITTRARSQDVKKIVGRTKKVYPELC"
FT   CDS_pept        complement(399707..402229)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10327"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595347"
FT                   /transl_table=1
FT                   /translation="MDPSFMPSCGFHYIQHTPCSASSPSATTSPDPTFSPRSVSCESND
FT                   TCPSSFTPFFASSTADKPLDSRHTPVQLPESSVSSLPASTISDAASSSFTLRRRPRPAH
FT                   CNNGTISTDAGIPDSRFSSLHELLEKAGYKETRVVTPDRQSLAGMFAQKLATPPRKPRL
FT                   VDDFSSDSPSLAACELRRAYERSTTSRSTPKATSTKSLPSRNYKPPTQNNAPPLPSAPA
FT                   SSSSWFPNIWFFGPGSFSNDASQVAVQGDEPVDIASQQEPLQANVGSSTLASTSASAST
FT                   SPSSAVTAAKAKRTATVNPVWTASVAYRSAKSHTAPVRKSAAISSQATHSQADAEQAWK
FT                   ELHNRGSNANTKRRPGLIDAFSSPTKQAPHANASQASPSRQRQWRQERAKWRESLGDLQ
FT                   AMMDQSRLRREIAAAAAAATTETETAKAIETDCTNGSGMDDDTSAEVAAGEAVFAARAA
FT                   QTHNDAMAKFVSGPALPFLSTDPAVAPRNASCTTPAHLSMRRIKSVEVLSKIMRERRTI
FT                   STASSSCNALDTTWHDTPSSIGIDVQDGRISPTIKKRCTPPRLTVSSPRGISSPKELEL
FT                   EGQEFEPMSWSPGKCGGAIIISNRRVQNKRRSKLRHVSSGADLVSTTTAKGDLKTPSRR
FT                   ARGRDKTLANTSPGESGGARVAVAALIRNSVGSLSRGSTARAFKDDFHVLDDAEREVAL
FT                   QAGGVLDSPTRQRCSNPEHSVLALSSIHNTRAASDRTDVFRSSTTLTLSKKDFSARITR
FT                   TSKIMRLIDEAENVPSIASMISQPVVASRSSSASRPAVAQPITSPKPSPANSRTHIAQG
FT                   LSSSLSKNSRDRMHTITRVLGQKQPLSS"
FT   CDS_pept        404750..405667
FT                   /codon_start=1
FT                   /gene_family="HOG000249397" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="met16"
FT                   /locus_tag="um02942"
FT                   /product="probable MET16-3`-phosphoadenylylsulfate
FT                   reductase"
FT                   /function="catalytic activity"
FT                   /function="phosphoadenylyl-sulfate reductase (thioredoxin)
FT                   activity"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sulfate assimilation, phosphoadenylyl
FT                   sulfate reduction by phosphoadenylyl-sulfate reductase
FT                   (thioredoxin)"
FT                   /note="assimilatory reduction of sulfur
FT                   FunCat:01.02.03.03)"
FT                   /note="metabolism of methionine"
FT                   /note="sulfate assimilation"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003C1B1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAC1"
FT                   /transl_table=1
FT                   /translation="MTAPNQIAQSSKQAEEEAQIRHVIRNLEAINRKLGEADPTEIIEW
FT                   AIDNLPSLYQTTAFGITGCITVDMISRISEQRAAKAGLPAKHLVPLIFVDTLYHFPQTL
FT                   DLAHKAAKHYNAPMHIYYPPGTNTVREFEEKWGPQLWEKDEDTYDYLVKVEPARRSYEE
FT                   LGVRAVFTGRRRSQGADRASLKAVEVDETGLVKVNALMNWSFGQVDAYAKANAVPYNEL
FT                   LDLGYKSIGDWHSTALPGTGDAGERAGRWKDKAGKTECGLHKDYFKMKNLAEKKLREAE
FT                   LARKDEAKDKDASQALSSPPAATA"
FT   CDS_pept        406351..406713
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10328"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595348"
FT                   /transl_table=1
FT                   /translation="MDNQWSAVQFAGSLLWTSWQTLIPKKPVSWQLESTQPLPLNYQVF
FT                   TTFQEAIAKRGDASAAARMEECQKLEEIAKATVEEMHGAWREESTRDCEIYAEPCQPSP
FT                   RSNREYSLSNGRYIVS"
FT   CDS_pept        408094..410337
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10329"
FT                   /product="related to guanine deaminase"
FT                   /function="guanine deaminase activity"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniParc:UPI0001595349"
FT                   /transl_table=1
FT                   /translation="MPAPHLLPKRIFVGAIISSRSATDLSIIERGILGVGSGGVIRFLE
FT                   DLDVLERQLPHAATLLNPSTRTSSTESSTSTSTATSHSTEDRSSTPVPIPGSSASSLPT
FT                   LQDAPELEMPPPVVPSRHPTTNAPSTVDEASQREQQLIKHVLDKHGWRKGQYKLTRLPP
FT                   GSFLCSGFIDTHTHACQVPNIGLGQQYELLDWLQHVTFPRERRFEDARYARKTYESVVQ
FT                   RLIDSGTTTACYYATLHLEASKILAEICNERGQRAFVGKCQMDRNSPIDYIEKNASQSI
FT                   EDTKEFVRFTRSLRPYGQPPDVSSPSMSPADLHNTSPEMDASIARLSATMDELMSPTGS
FT                   KPPSEAGGSPSSLKFNPAIKSLSSTSRTSVPVARQPSSSSIRSARESGTSTPSRQRERE
FT                   LNNALVQPILTPRFAISCTDAMLTGISALLSRDPTLRVQTHLSENEGEITFTKQLFPFA
FT                   KNYTSVYDHYSLLGPRTILAHAVHLDADELAIIKKRKCGVSHCPTSNLNLRSGASRVGE
FT                   MLNMGIKVGLGTDVSGGFGLGMLSAIREASVVAKVLAFQRAQAESKAKEEQDAFTATAP
FT                   PTSEQVARQAQQPLSGTAAIDGRYPGPPVAGQYQPRKPHSVTTSSLSPTEVSQSVQDPA
FT                   SSLTNKATVDFTKGPLSIATLFYLATLGGAEVCAMASRIGSLEVGKEFDALLVQTTSHW
FT                   GPSGYTGNPGCFVEEDDTLPDVFEKWMFTGDDRNIGTVFVRGRVVGGAKPLRD"
FT   CDS_pept        410861..413158
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02944"
FT                   /product="conserved hypothetical protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003C1B21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAB9"
FT                   /transl_table=1
FT                   /translation="MAPPARATVEEVEDVDDPYAPYRVGERGSHPSLATSSGSRSTGST
FT                   SSTDSTTSAASSSSTCTSNPSRQTSRNTPSSSFGQNSTAYDIYQQSPSAGTQGTFPREG
FT                   GDEEPLLGGRPFRDAHDPTESTSSDLTSRSTDKEYLYTILNVATDASADAIKDAYRSLA
FT                   VLLHPDKHKDASRKGAAESRFREVQRAYEILSDPERRTIYDYFGEEGLKSTWSVAVRGR
FT                   SPREMQEEFERERRRKQAADAEALVKSKGDFTAHIDASALFAPSSRLSRRPPQQQMPGQ
FT                   PRAATATNKQDLPVAPGGMVVPTAPFPRTVTFADRISRIGCTQLIGKHGFETQVTNQTC
FT                   ATFSGQMVSRNGLGGGNLVGTLKTHWSPRLFTEITLSFLRPQIITTKGQFTVDANSFFS
FT                   WQATMQTLMMPPTFNVTYGQRLSSKSTLTGFTSVRSGTYSLLGWGEDLQGAMVRSEPAA
FT                   VSVGLTKQIDEGKGWTVQTSISPVDQNISVDYALKVLGGVKLRTGFNLGTGSGMSAFSS
FT                   AERRLTENVRLSLGLNCSLPMGGVTLRVKVNRLGQKIMLPILLSPEFRSDLVVLFTVVP
FT                   AAAYTALHWRYLEPSKQRRLRNRLGELRSANREMILERRQAALEAVEVLRDQAVKRAHQ
FT                   ELDRSGLVILEAWYGQKDSFPRPSITTAQAERLWNDVKNQSALPSSGTGDVDLTTETYW
FT                   DVKIPLQALTTRSQLIVPGARSKANLLGFHDPVLGEKKHLLVRYSFRGALHQVIVEDFT
FT                   ELALPMRIHQLD"
FT   CDS_pept        complement(413541..417254)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02945"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 5"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /db_xref="InterPro:IPR014801"
FT                   /db_xref="UniParc:UPI00003C1B22"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PAB8 "
FT                   /transl_table=1
FT                   /translation="MSTGEAQQLIQKLLLEALARRLAQPKWLSLLHQLVRRIEAAQDDD
FT                   GTFDVIPSLEGSHAAECLVKYLLSQSFIDPLLIEYLQALIYGSANRSGVSPDQGPITDV
FT                   MTVTLHLLANVQAAASNVPAIEIISSVIGQGLLMTFQAPVPFRVSSPSFLALLQRLFAD
FT                   PTYEQDQTPSFPVDHVDTGASDIKVAPASLGFVVANLRLLALAADPAIASPQNLLAPRV
FT                   SITVLINVGQGLLAYVTQILSAAQTAKNDKLKPDGAILQQLRSMASTSLTEIEAVLRSM
FT                   NPAWKDEIALLRSLTSQIGVIDQISESFAEANTSKLSTRPTKRKLETLQDAQQRATWDH
FT                   FLDVSTIAASEKPAVEPETALLMHLLVDHHTSWDFKLDAIKTLFLARRSAAAPSLTLEK
FT                   SLTAFYFELLVAAIDACAAVVEMPPAFKGAEVYATIWRNALCGMIPELVLQLEQWLDGN
FT                   QELPLRGQRLEAPHVRLEAALRAALLVMSDRLNVCESATNQSHAHGNVAATNGEEAAGA
FT                   HANMMSDVLGLGTPPSQPIRAWLLRACIEHSLARPEAIADEFANGHKLASEVQSLTQSL
FT                   RMDAQLEGLALNTLFETRIPTDHPVELLQRVASDPGTHFIFARQLVLQVQGWLEQHDLE
FT                   SIARWCKALTENACEGGAMLDTIMIYIDPAQMLDPLASILDHQDLGQTSDEPSTLSDIL
FT                   LFVQLLCYRYSTPITRISRYTVSNHDMDTVDSSAPLHRSMPPFLATHLATSSVSYPLSV
FT                   LSEEDRGLVSRWIHALFGNEGISDDLISASPPTTLLRLSPLLFSQSISACQHGIIDLET
FT                   LRGGLSYFLQDLLSFALPGALVWLLSEISRTPLQPILDFLSESGLQASVVDVPSSDGTL
FT                   ANGLPRNATSKSVCLEVLALLVDTDACPSSVRQLIAKAFDAFVSTIEADVTAAPQLAVG
FT                   CETFNLASLKARMEGAGVTARLLSETGASWLQSVAAGHQDSRSKLFSMLTTLQPSVHAM
FT                   DRLIGALKSGQVGRNGRDQKGLAAWLCFIAPASEPTSALRFVQRLELGDIEESAIEGVV
FT                   RIVGLVVGLIMAAEAQRATTDAVADDLLALARAADTNARGTKATVADTTAAARPAEADL
FT                   FDDEPCSPQPPHAAANATSHTSNAAPTVTSAASLLASGELRTTSKQVLDMMALKLVRFR
FT                   SHMLGEKNAKSTTISAKWATLQSAIADHLAGGEAWHGAQQCRERTQNDAPVNGGKDADS
FT                   GSGLSAWLSAMS"
FT   CDS_pept        418446..420725
FT                   /codon_start=1
FT                   /gene_family="HOG000185918" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10330"
FT                   /product="related to AVT3-Vacuolar transporter, involved in
FT                   amino acid efflux from the vacuole"
FT                   /note="amino acid/amino acid derivatives transport
FT                   FunCat:20.01.07)"
FT                   /note="vacuolar/lysosomal transport"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000159534A"
FT                   /transl_table=1
FT                   /translation="MSTPNNPNPNPNGNGKARAIPSPSLASADTLASTPIRSPSRAFGE
FT                   GWGHASPSLPNIPPRVGSPSAEPLNLYSSSQQQRQDSSNFPRSFSIEPPSRDSPSLAPP
FT                   AVDSGLSTPSNLDNLDSLPFSDERKARIIERHLARPDGNRDSISATSIPSSEHTDDFDD
FT                   SQDAHGSSTPNPAASGDGANESPSEIAFEDVDESYIGPHQMQGGAITDDVYRWAHKNRR
FT                   VSARRTRSESLHMPRTATIDPELDVQGIKEPGGFRRFFVINQAQEQGRAPPRALRSFID
FT                   FLSLYGHFAGEFLEEEDDDDDDDEYEDDADERAIPGTSRGAGTGDMETSGLLRRRKGLQ
FT                   RSDTQARMRKANKERRRGEASVLDAVMMLLKSFVGTGVLFLGKAFHNGGLLFSTVTLCA
FT                   VAIISLVSFLLLVKTNLNCPGSFGDMGGILYGPRMRLAILASIVLSQLGFVAAYTVFVA
FT                   QNMQAFVLAVTHCKTLVPIWALILGQMAVFLPLSLIRRIAKLSTTALIADVFILFGIVY
FT                   LFWYEIGKVAKDGLADVVMFNSKEFPLFIGTAVFTFEGIGLVIPITESMKEPEKFPRAL
FT                   TGVMAGVMVLFASAGALSYMAFGSEIQTVVITNLPQTSRFVQAMQFLYSIAILLSTPLQ
FT                   LFPALAVLEKGIFTKSGKYNWKVKTEKNLFRFLVVVVCCLAAWAGANDLDKFVSLIGSV
FT                   ACVPLCFIYPPLLHLKANATRSATKVLNYAMLVFGVVCVAFAGSQTIKAMLESSQPARP
FT                   PRCSPR"
FT   CDS_pept        join(complement(421787..421789),complement(421375..421540),
FT                   complement(420933..421279))
FT                   /codon_start=1
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10331"
FT                   /product="related to peroxisomal membrane protein "
FT                   /EC_number="1.11.1.15"
FT                   /function="oxidoreductase activity"
FT                   /note="chemoperception and response"
FT                   /note="homeostasis of metal ions (Na, K, Ca etc.)
FT                   FunCat:34.01.01.01)"
FT                   /note="oxidative stress response"
FT                   /note="oxygen and radical detoxification FunCat:32.07.07)"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniParc:UPI000159534B"
FT                   /transl_table=1
FT                   /translation="MAISKGEQIPNTTFTYVPWAPELADGTACGAPTKIQTHEAFKGKK
FT                   VVIVAVPGAYTPTCHVNHIPPYIKQIDSFKSKGVDQVIVLAQNDPFVMSAWGVQNKAED
FT                   KVIFATDLNLEFSKAIGSIADLSAMGFGQRTGRYALIVDDLKVVDFSPEPNPGAVEVSG
FT                   ADHVLAKL"
FT   CDS_pept        422531..423919
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02948"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAB5"
FT                   /transl_table=1
FT                   /translation="MASLAKRPRRSDDYDPAPVAPTAVASGGYYDNVPGTSMTRSTLAP
FT                   QPSGSASAMLAPGTSYSSHLWAYPATSVAPNGINGTSAALAATSPHLSSSRSLSAAPAV
FT                   GGAPAAQPLSSDDDDMAPPKGGSLTTTSTRARGRGRGRGRPRGRGRGRGASTSTTVVHK
FT                   PDLEESDSEEPPNPLVFQCRCCFRLLGDSLAFVATDIDLGYVILSDVSEIIQQDTTYET
FT                   STEPGKDIGSTFARLRCAGCNAAVGRNYRTTPRDLDDLRDCFSLEVDAIYTYQLGSNYT
FT                   RQKEEDDEDQDALVDGGASGKPARASRPTHETVQAEDTKVLITKMERTRALTIELSDRL
FT                   IKAEEEIRRYSALVDKLMQSEQIASKALRIEANPKTSLAADSATIPPLGRQEQIQTDPP
FT                   QQLDPRGKEPSSPSSKDDPPASPQPIKLDSDLSQSSSLREASKEIRSKPSAPGTSTRTT
FT                   RRSR"
FT   CDS_pept        join(complement(424322..425497),complement(424170..424226))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010334"
FT                   /db_xref="UniParc:UPI000159534C"
FT                   /transl_table=1
FT                   /translation="MSSTLSARTSLNLKVLRRHDPSIVTILETASFVVLYNYNDGEWTK
FT                   TGVEGPLFLFRRRVPPYNGFFLMNRNGVENFSADITPDDDLEITPEFIIYRPETSNEVY
FT                   GIWVFEANQRMFVGDKLLKLQQMMDGPSEEELKQAESAEAESKSVAAGDEKQTASTAVV
FT                   AAGQKSAKDAEGKAVKTKANGKPKKNAKQVAGKSNDEDASARATAVSTTDVTVDSVEGT
FT                   QINLDDLFGTPAVPAQFETDAAEPLSEPVTESASKGAESNDASLLDSLFQKASLDTRIA
FT                   NTTNTTAEASKASAPEPTDHSQNLLALLSSATAASTKPSSTPPPNCASNPPSTEKTTQA
FT                   VRTSSSSPAPPKSGPKMSELIEQAIRDHIGLGDDNQPLSRREFVTELLSMIHTNPDFVR
FT                   QLYDGYLSRVS"
FT   CDS_pept        complement(426128..428884)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02950"
FT                   /product="putative protein"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003C1B27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAB3"
FT                   /transl_table=1
FT                   /translation="MPASIEVAGPQSIDIMMPKKRQQGFEPGTISSGSGVGFNTNTVST
FT                   MSSQNTQSSITANVSNFFGPFSTNGLPSSFIDTDILLNDDLWNQFSPATTNNSSTGTDT
FT                   TGQQHHQSALDVKADVEGATDRAFGESYVNIPHNSSLDMFALQSRTLGTVRPAHDALSR
FT                   LSKDASSIDDGDSPDGSNGETTSTIATSVISPSSMGTTVGSLPKGTATRHHRSTSNASS
FT                   THRSKSARSLSRSRTRVAAGASDRRTADRSPSLERGGVGKAPSSRARAGRRATVGPAAL
FT                   ANNFQPNASPHPTASTRPSSSMVFRGSNAGLSSSFQPQTHRWSLFGTPDAANGSNMHLN
FT                   FNGPASWKVPGQPGTTSASSSLPTPLNFHNCMAHLNLQTTPMPAAMPSPANRLEEDANA
FT                   NQPFNPFLFPPYTQDRSNYGLTSANESVHQPFASQATAGAEAPAHSNEAYEISEAQAIS
FT                   ATKPRRPSKMASQASREKLAKDIKLEASENELRKVSSEEPQHGDDDDDDDGVDDDDEQV
FT                   AVAGRGKTEADAKRLAEKRRKRRESHNAVERRRRDNINGKITELATLLPEAMLLDAIVT
FT                   STQGGNSGTFAPALAAKAALAAAEAAAAKGETMQDGSQGHLRLPKSSTEAYAAALAPVK
FT                   ANSAALAAAQAKPNKGIILRKSVEYIRHLQQFLDLQMGRIGFLEAELARSHQALAASGM
FT                   QAPPTTDPQQGLGMMHAFFADTGSGSDASVFGEQQEQQQQQQQQQRHGQQLHQQPPQDF
FT                   SAMNLLSLGMPMDQQPDPSQLHHSQSMSMHQGGLSVPHSNSNSHDAIGTAPALSAWLEG
FT                   FDQRTGLPRRSSVDPIKEEHESGQEDKELSRRGRSQNSRSTHDAHDEHWRGRSRCRLAR
FT                   SGQAQVQEGSWPELHTSEAHSPMQLVSGDDSQARASFSDLGDMKLDL"
FT   CDS_pept        432662..436417
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02951"
FT                   /product="Topoisomerase 1-associated factor 1 "
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="UniParc:UPI00003C1B28"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PAB2 "
FT                   /transl_table=1
FT                   /translation="MATKDDYSEDLENDADLMTDFSDDEYGYRHEEGHNDEEAAPNIEE
FT                   IREAAADLCNQIGEYDYGDEHDWDGEQYPRLKRWKHRPRALGSLRSLRKLWKMDDDDPT
FT                   RKVARAFAENEVLQHTILPALLESAGQGKEGDAIALACTDLLTAMTWPFDGLEELREQE
FT                   KQGHLDLAELSEITLLDEHLVNYKSVILRNRSLDQQHDVLGVVMRYLLLPNLATKHHER
FT                   STLATGIISMCLHLFRNLLAIRDPVTTSLSSVERLSNANLQSELILSMHKHHILDALLM
FT                   LSSSAETQAYNAWNAVASECIFHIFVGTMVKTIAEPTFSGSGTRMSHDSTPNASASNTA
FT                   GSSSNANAGPISSLAESLAMETKLKRASASGKIATRHSRFGTTINFVGPDGELRVARNQ
FT                   AALIKPVAQLADEANQKGRRRAQRRKDAQEKGAPKLKSKWTPDAALVLQEWADTFVQSG
FT                   FEPLAKSVLKDIRSERDKLGDLDVARVRIMQLGAFFLEYFLLRRTTAAKRRNAAKTAGS
FT                   VQSTFAQRALDLQEPDEQHERSGQSAEQPEEAEEWPFELVSQWLEPWAFRMVLVRTIQS
FT                   QETKAWLEFVASVRLWIVLLRLVDELANSKKESERDVAEGLQAEFYYMGETLEACHAIF
FT                   RSYTTQSFAFLDAIIAFAYVMPKMLERYASNRDHMYVQAKKQVHRSRQDGDLDTDQDEA
FT                   RQIKEQLQETRSEREFRFADFQRKLATKQLAKACIVYLRRWKDNNGTEDQLNELVTVMH
FT                   RIAIKANDYRQFFLATHRDYLRFMISGDTISAFEARAPTSAPNLRKLIDYILRKFSKLS
FT                   PEEQSIYNAGKQPTRQPKPPRMPAEIVVRPGMTPDQEIGVAVGLLLKKEKMPAVLWIKS
FT                   ALEMASAMRTELVLRYEEEEAQRSIQGAGDDMMLLGELEKHNESPVERFQPYELAYHGN
FT                   DELRTDASLMPELKLLCRLVGLEANDNELVNWRWSVPKEILPVHLDQKIETIERYIREP
FT                   LDTHGRELTALVMRIRKPRVAGEADADVLDPADLPDGWNGAQSDSDEDGDYFDRIRASR
FT                   SLVSADHVAAEGGLLRRSGPKKKLSHPTKGDGSRKKKQIQRIKQDIIDDSDDEFAFALA
FT                   DLQPQARTDADADSSSDDKEEEDDDDDNMDDQETPATSSVADLQEQFDQGKSNALDALR
FT                   TAKQQRSNTEQPPLQDAGERINRRMDTKRLFLADSDEDDDDVLALSSQEPADISATSDR
FT                   TATGPSVWAGIAKKRRLAILDDEDED"
FT   CDS_pept        437136..438755
FT                   /codon_start=1
FT                   /gene_family="HOG000138238" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10332"
FT                   /product="conserved hypothetical protein"
FT                   /function="hydrolase activity"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI000159540C"
FT                   /transl_table=1
FT                   /translation="MASSSVSSNSAILAHLSHALLRISRIPPRVIASPPTQPRRASVAI
FT                   LLRVRPTPEDEAWLAQSHDPEAQHDAARAVEANANHDLENSGVHISQASLGHAPNAGVS
FT                   SLASSMASADLSSTLSSFFELPWVKRGTPEILYIKRAARIGDNWSAHVAFPGGRKEEGD
FT                   ENGLYTAMRETWEEVGIDLAEKEFSCVGQLDDREITTSLGKRLLMVLSPYVFVQTSPFS
FT                   PLPDLQPSEVASAHWIPLSLLYTPKPKWGTTSVDISSRLAPKSPLVRWVLRALVGKMDF
FT                   KCILLPNDPVAVAEYDENDDDHVHLLADSAAVGGEKAGSYIARAEQGSIRPELRLWGLT
FT                   LGMTLDLLSHMTTFSSSSSFRSGAISPTPLEPSSPSRILSTFGSVPPLQDAASSSMPSA
FT                   SELVSSPLVSINRVIGRVRDEFHLNPPPASHALAPSLTSVFPRFSYPDVNFWIWFFGWR
FT                   YRNVVRGWESSVGTRTERKFNWSGMALGAFYSAVRRALVVAVILRALGTLSAGGIAAWL
FT                   VGRKVNRSRKGLPGLGLDELLS"
FT   CDS_pept        439108..440595
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007308"
FT                   /db_xref="UniParc:UPI000159540D"
FT                   /transl_table=1
FT                   /translation="MVTRLPRKQQSGAAGDVVQDAAWNSTDLRKAPRDMNRIPGSTASM
FT                   TVQERKKDARASTDSSTSSAAWSSQLATSSTLRGKTAIQAMQPFLDSSTTSSSPIQPTD
FT                   IQLLTKSILSNQERQRVILYYQEQLIHSEPSLSELKKSLLFLSSSSWGQILEERKLAEK
FT                   CSYPRCSNASPSRSGATNGRFRINLRNKSVKAIQDLDLGEAGNTWDDLKEMFCSKKCYA
FT                   RSEWILRWVLGECEIGLEKRDAQDRGARGGGGVLGGKWQKLTSQGGYEQVELLEDIERE
FT                   SGLKLEAGEMFVDRVLDSEPLKQEVAAKTMRQGALEPQSTGAACQVTNLLQDLTIVERR
FT                   KDSTCATPGASACTNSTNSTASHTSQSTPTSKTAYDVDVPNTLGSRFTRNCTDKDERTD
FT                   DDTHPSFEQRQREISHILRYASLAKASRLVLDRGMDSTSGAVDDAHLSVDTRDRSDDQE
FT                   HTPVLDAQAAAERAHLRRIMDDALDVRRDQRELGLLD"
FT   CDS_pept        join(complement(444078..444240),complement(441283..442796))
FT                   /codon_start=1
FT                   /gene_family="HOG000248355" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12200"
FT                   /product="conserved hypothetical protein"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniParc:UPI000159540E"
FT                   /transl_table=1
FT                   /translation="MLEVHQANALVYSTLCGFMLVGLYAGYRVRNANDFLSGLRTQSAF
FT                   PLTLNWFASNMSSSLLFGYPQLAVIPEAGILGLVAYCFATVAPLWFFAWLGPQIRRICP
FT                   DGFTLAEYIRRRFGWPVGVLSGLIFVGFMFCFMLVELNTYGSAVNLLGGVNPTIAALVI
FT                   AIITTIYTTYGGFKASLYTDNVNAIIILIFIVIASIAVGVKLDIDHARVESSGLLKPQR
FT                   LGGELWYILPAALIFSQMFNQGFWQRAFASKDNKTLYISVICATIPLFAVCMLVGMAGP
FT                   LAWWSGLFNGPTAEDDGSLNFFYILGTLPNWLTGIVIVLCGCLSSSAYDTFQSAQISTI
FT                   QNDVFLGRVNIWWCRAILILINIPSVVLAVKNIDILEVFLIADLAAIACIPAFLLGLVP
FT                   RLYFLNGVDAVGGAVGGFLTVFLFGTIFFGSASQGIALIGLPNGLYIDDYSVLGAFIAA
FT                   PLGSLGWTFVTCAIRAAVTWVWCKKTGRKFTVFEYREFDVSGWALPEDRPAGFAGLHGS
FT                   GNPNDGHKLDRDLEVDADVKRDLSDDGSSARELPAVQTQST"
FT   CDS_pept        complement(444980..450031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02954"
FT                   /product="putative protein"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003C1B2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA9"
FT                   /transl_table=1
FT                   /translation="MFAPQSPFTAARPASAASYHHHPHHQPYDTPLSPMSHEHGVATST
FT                   SFSWKPELGLPPPPSEIDSLGNSLDRALVSHSRPASRAHSVSPAVRIPSRYDLEFGGLE
FT                   DPVEHRDRAQDHMNMVTKHPKVKIDVVLSSNLFEAGGAINGKVELTCTTSQRLRIGQIA
FT                   LELEAVEQLTSRDHAATQLFLYNRTMFQGDKLPPSNAVLPAAPINGYWTARKGRTSFPF
FT                   SFRLPSSAPSCVTFAGNASLRYGLKATVQTWYNEEKMIVTARREAFVLEKWSDQLHPRF
FT                   REPVQAVGDTRLFMGGNGAVWLEAGVTEQLFWGGGQLLIRCGIKNNTKRHLGGIKVALA
FT                   RRLIFPVGSVEGFHDSPDKLSLEPRITEIVHDQIFKGREYEFHPDKESVCTVAVDVPRD
FT                   LRTIRKTRLFEVRTFAFVSLLLGSFAKDLTVEIPIYVAHTASAQPPAQLTLDNLHTGPP
FT                   LHSLPQRPNSSIGHSQGRVHGHAHHQHPQQHLYDHHDGHNAHGHPQMDAGMLEVERLAA
FT                   NRGWSPAPVMPGPTHLAGPMRPASAAPGMIQLPLQAQPFMLGPDGHVQWDPTANSWNAS
FT                   RLIPPTAAAGHSIQRSVSAAPDMVQNAVSAQSFAQHVDPVMAWTASQRAMSTSPGPAVF
FT                   AQYDHPASIAASPQQPFMPFPPTATASELRTSLPVAEPCSGSFPSQAAYQTTSHETLPH
FT                   MPEPQSIIVASPSMQQYSAPPPQPSMPMISGGGGAPPIAGLATIEEDGESQAGTVKTMS
FT                   KLPTLGKTGITDAKRTKGNSVSRNNIEQFEAMAEAEEDEEEVKRQMIAMGMQPDEDAFG
FT                   SGAGKAPEDAIPTPAPDPMHDSSISRHRETSHASSTGTFRLKASEIFESASAEDSTPSQ
FT                   PVARTHEMSASVEASAAILKHLQHEHPSAEVRQMNESQLTAARSITSLRRSSSSHGIGL
FT                   HALETNLVRSTTPKISNTPPAAVTMANIARAESSSSPLTSAPAVFDDSTRSRKSSALRA
FT                   AALAREEAERRSAEEQARAAEERQRQLQAEQARQTAAAEEEAARKEAARALAAQQQGLE
FT                   QERIAEQVRKQRDLREREEEQRLERKEAERKEEADRVQREREEALQQKRREETERQSRQ
FT                   AAEAATIQARTELQRIKETRSTASAASRPVERIKAAIGGAPGSVAPSVPSKTTAPISAT
FT                   PSRTSDRDRIALRQQAVNRVDGWLSNAGSPNDSHMNMPGTPSASVLSLMQKEEAPAASG
FT                   IHGDVDRSSFSHRSPSQVVNPLYEGKASRPKTTESVPRAHTMSDLALSQVSAASATADE
FT                   EPVPQLSAELRALVDGSDIRPPRKLGGALKEHPISRRLSGLGSTASATAAVVPSPSSAV
FT                   APSQAKRERQTSMPSWPRPGLPSFSGAGSNVQTAVSAAKAVPTCTTAPAANANTERHVS
FT                   REVGIPTRVEKMLAAPTSTKEEAGAYDARSARGGRGGRVASVAQLWSKIAGDEEEAHTD
FT                   KLTARSSDAAPRSVSSSNTSTVKPTPRTSALGGAPALDFSKKAMSSSATLGGVTSIAAT
FT                   FGGGSGGAKPELMKSNAAVEFLNTSTPKVVFAKAADASKPEKRPLPKPVLQPGALPAPQ
FT                   LVRPTAMRAQPSPKKDRSSKRLSTQLLSNFQKSPREGMKEEQEHKETMRDMLNGVALDT
FT                   TILDALNSGDTWRGVDGSEIKMSGRGTTKAIGENKYNSLRAVWGS"
FT   CDS_pept        join(complement(452684..452723),complement(451639..452483))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02955"
FT                   /product="related to RAY38 protein"
FT                   /note="DNA binding"
FT                   /note="DNA damage response"
FT                   /note="anti-apoptosis"
FT                   /note="cellular signalling"
FT                   /note="organization of chromosome structure
FT                   FunCat:42.10.03)"
FT                   /note="regulation of C-compound and carbohydrate metabolism"
FT                   /db_xref="InterPro:IPR006861"
FT                   /db_xref="UniParc:UPI00003C1B2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA8"
FT                   /transl_table=1
FT                   /translation="MSVATKNLFAILGDDDDVAAPKAAPAKAAAPAATPAPQRNIPGAG
FT                   NQRRGGARNGAPRAAAGADAVEGEQQKDARAGRPRNGESRGRGGRGRGRGAPRGRAFDR
FT                   HSQTDRVDSQKAVAQGWGGEDGKKELDNEQKAEADAQAEGAEAGATATPAEAEKVPEEE
FT                   EDKTMTLDQYLAAQAGKKLNIESKAPREVATDDSAYAKLTKHEKEEADYFASTKTQKAK
FT                   TRTQKEGKQLLDIEQTFNQPAVQRGGRGGARGGARGGARGERGAGRGRGGRGGRGGNVS
FT                   VNLADKNAFPSLA"
FT   CDS_pept        join(complement(456609..456641),complement(455067..455795))
FT                   /codon_start=1
FT                   /gene_family="HOG000210611" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10334"
FT                   /product="probable 40S ribosomal protein S3 "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /cellular_component="small ribosomal subunit"
FT                   /note="DNA damage response"
FT                   /note="ribosomal proteins"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniParc:UPI000159540F"
FT                   /transl_table=1
FT                   /translation="MASANISKKRKFVADGVFAAELNEFFTRELSEEGYSGCEVRVTHA
FT                   RTEIIIRATHTQEVLGDKGRRIRELTALVQKRFKFPDNSLELYAEKVQNRGLHAVAQCE
FT                   SLRYKLLGGLAVRRAAYGVLRFVMESGAKGCEVVISGKLRAARAKSMKFTDGFMIHSGQ
FT                   PVKDFVDEAVRHVLMKQGVLGIKVKIMQGWDPEGRAGKPFPLPDAVTILEPKEEAPISA
FT                   PVSESRNAPAEVAAPAAPAAPAAEAQPEAAF"
FT   CDS_pept        457414..458454
FT                   /codon_start=1
FT                   /gene_family="HOG000225260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02957"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniParc:UPI00003C1B2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA6"
FT                   /transl_table=1
FT                   /translation="MALTRKATHAGSWYTDDPRELDECLTEWLSDVQPDNLLSPLSVCS
FT                   DSSCSSSSSESLALPISSNRAIIGPHAGYSYSGPAAAYAYRTIDTSAIKTVFILGPSHH
FT                   VYLDGCAVSACSSYETPLGNLPINRSVTHELLSTGRFSTMSKTEDEDEHSIEMHLPYIY
FT                   KVFKGTGIQIVPILVGAINTARENEFGKLLAKYLNDPENFFVVSSDFCHWGSRFRYTYY
FT                   KPCGSNIAMNLTSRSSRSMFEGKPIHQSIRELDEAGILAITYPWSRDRQKTAEDARLAF
FT                   AKYLSETKNTVCGRHPIGVLLAALAELERRGQKTECRFTRYEQSSQCTTPQESSVSYAS
FT                   AFVRFV"
FT   CDS_pept        complement(458709..461249)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02958"
FT                   /product="related to SWI/SNF related, matrix associated,
FT                   actin dependent regulator of chromatin subfamily D member 1"
FT                   /function="protein binding"
FT                   /note="transcriptional control"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI00003C1B2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA5"
FT                   /transl_table=1
FT                   /translation="MANHQAHERNSQPSPKPSHLPVDPASASTLPSELLTSAPECTSSV
FT                   ATPLQFPDLASSPPPPSNLSRQQQLHHQQQQLLGSCTRDSSSSLSSVPSSSASEPSPKQ
FT                   GETTRLSCKRSAPSQSYTASRRTRSSVDLAAAASASIARQPVLLSSRFGAPTSLDSSDT
FT                   FPLRPLPSHLVSGHYNHAASLPSSPLARHQSRVHHQRTLDSLRFQGTFASVQAESHREQ
FT                   CLSRGSTLALIKPGSHLSPEVSEQTFPLQTLPTPSIASHRGVFREHSQLRHAFSLHPYP
FT                   LFNQLHPAAHYRMDTQAPMTQSQAHTQAQAQAQHQMQMQMQMQMAQAQQAQAQAQQQAH
FT                   ILRRKNAQDVLVGQGFRGLKRGRPTDRSLPPSLKRQVPESAFYSDLQRIEKNLDWTVAR
FT                   KRAELTDGLSRPPKIKRTLRIFLSNTCANQPFQLAEKQKVKDSAPSVETADGAEVKVEG
FT                   DKDAADSKEEDAVPSWTLRIEGRLLEPSFKSRANTALSAQASINRTGAHKFSNLIKTCV
FT                   VELMRDPSLYPDGSNIVEWHRPVPSVAPASGMQAGGGAGGLGGTQGMEAPLVASAEPAL
FT                   DGFEIKRKGNVPTKVKIVLYPAYTPERYSLSPELGSLLDIREESRAGVISALWSYVKEK
FT                   KLLDETDRKKVKCDSALRSLFNTDTINFHHMPEVVNRHLHPAQPIVIEYWVRTDKAEYK
FT                   HSTAYDIELDLEDLAIRQKQHNVLAQFDTTNDATSREIAELDDKIAQAAATIRNRASAR
FT                   DFLAAFAKDPQGHLRTWIASQARDLDAILGNNPVPGAGGSVSSFTAEEMRRAETFKGAW
FT                   VDEAVIVNEAQRLAEKLQELQSQAAQPNPGQAGM"
FT   CDS_pept        join(462737..462843,462940..462992,463093..463187,
FT                   463301..463319,463415..463461)
FT                   /codon_start=1
FT                   /gene_family="HOG000261845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02959"
FT                   /product="conserved hypothetical protein"
FT                   /function="acyl-CoA binding"
FT                   /function="binding"
FT                   /note="fatty acid binding (e.g. acyl-carrier protein)
FT                   FunCat:16.13.03)"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /note="lipid/fatty acid transport"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="UniParc:UPI00003C1B30"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA4"
FT                   /transl_table=1
FT                   /translation="MSAEAKFNKAVSIVGSLPKDGPVQPTQDDQLTFYGLYKQATVGDV
FT                   TSKRPGMFDLAGKYKWDAWNKNQGMSKEDAQQAYVDALLEILKKHEDEGDSAQYIEQIQ
FT                   NA"
FT   CDS_pept        join(complement(465480..465794),complement(463857..465302))
FT                   /codon_start=1
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02960"
FT                   /product="probable ser/thr protein phosphotase 2A
FT                   regulatory subunit A"
FT                   /function="binding"
FT                   /function="protein binding"
FT                   /note="MAPKKK cascade"
FT                   /note="PROTEIN SYNTHESIS"
FT                   /note="TRANSCRIPTION"
FT                   /note="actin cytoskeleton"
FT                   /note="bud , growth tip"
FT                   /note="budding, cell polarity and filament formation
FT                   FunCat:43.01.03.05)"
FT                   /note="cell cycle checkpoints (checkpoints of
FT                   morphogenesis,DNA-damage,-replication, mitotic phase and
FT                   spindle)"
FT                   /note="cytokinesis (cell division) /septum formation and
FT                   hydrolysis"
FT                   /note="interpretation of external signals that control cell
FT                   growth"
FT                   /note="mitotic cell cycle"
FT                   /note="modification by phosphorylation,
FT                   dephosphorylation,autophosphorylation"
FT                   /note="phosphate metabolism"
FT                   /note="protein binding"
FT                   /note="regulation of directional cell growth
FT                   FunCat:40.01.03.01)"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003C1B31"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA3"
FT                   /transl_table=1
FT                   /translation="MEADEQLFPIAILIDELKSDDVTLRLNAIHRISTIALALGPERAR
FT                   DELIPFLQDSLDDEDEVLLALAQELGSGFVEYLGGPPYAHLLLGPLENLAAVEESVVRE
FT                   KAAESIVKIAEVLSEAQIEEHYIPLLKRLSGGDWFTSRTSSTSLFSAVYPKAKPTTQEE
FT                   LRKMFTALCNDDTPMVRRAAARDLGPFAKNLSKELVVSDIIPLYRKLSSDDQDSVRLLT
FT                   VQDLIAIAESLNHDESKNYLLPSIRSAVQDKSWRVRYMVADHFVKLASAVGEDVVRDEL
FT                   VMAFVHLLKDNEAEVRTAGAGQIPGFAKLVDQDIILARLMPCVRDLAGDNSQHVRAALG
FT                   MQISGMAPLLGKEATIEHLLPLFLQLLKDEFPDVRLNIISKLEQVNEVIGIDLLSQSLL
FT                   PAIVELAEDKQWRVRQAIIEYIPLLANQLGVQFFDEQLSNLCMSWLGDTVFSIREAATV
FT                   NLKKLTDVFGVAWARQTIIPKVLQMGTHPNYLYRMTTIFAITTMAPSLDTPAITGDVLE
FT                   TVLPMVSDPIPNIRFNVAKAFEVLSSVLVKTPEGNEVIKSKISPALEKLKEDSDADVRF
FT                   FAQKALDAES"
FT   CDS_pept        467124..469787
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02961"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniParc:UPI00003C1B32"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA2"
FT                   /transl_table=1
FT                   /translation="MGGKDFNTALSRASRDASSSSNYTPTSRTGSNAPFYRQFLPAQLS
FT                   NISPNDSIPSLDELSALAKHLSRIKTESAARLSRLEARSTDPNRPIFFSAPNDLFSPPG
FT                   LSGLSSAALNLYSDSTRQTTPSASSSKNPKARERSFASPAPSLFSSNLNSSAIGSAASA
FT                   LASKNKAKIKRERDNDSTPIISSALYSDSRPPIKLAGAGNKANPRSKAAQANSRDVAGD
FT                   DESIASTDPEWDLDEDSMPSRPGRTYLKNKKRKRRGTGADSHDDESGSEFEAGVLLSAA
FT                   STSKHVGSSASSAAAHSAAAAATAAGTSSGGTSTPKIPSIGMRLKANTATGSTGAAQTP
FT                   PGFPRKASDTMQISTRRNSVLPSPSPLPSTPLAQPVIVPPVIYQPAPGWELPARTPATF
FT                   MPVLEKSRKPRAYPTKPSEVMEDFANKDWKEKERERDRLLERESVGPGTPGLVGPGQSM
FT                   VKEATTGRRGGRDLQQTPINTFYNYADAFFKTLTEDDLAWLSSKSDDHEPFQMPPLGRH
FT                   YKEVWEEEEALLAIGSVDAYNNPLTTISRSPSISLGAGTGLPLDVSTLAAARNGSADGA
FT                   GKHAARAELEIPPPPSFRVKQMSNQHLGLESPAVVDARSGPLAERLVASLLPSYNGDTT
FT                   AAVEDPDLTASGAGTNPVSALPPSLLANLNGHAKPDEDDADEDDADGEPDLEFEGAVLD
FT                   QDMATFEERIAKELKAIEVLGADENFDWSTRADDDISTTLRMVQRELARQQKINELRKG
FT                   RLFGIAKDRMAYQDYLNCLNSVEKEIEIGWTKRLRQIKASLSKRKKGGHSYHDDLNLSQ
FT                   SHGANGVSSASGTPQPGGVPYNGPVRPQLSENVVSAMERREKLRFAFKELFDEAKHAWQ
FT                   TPTESVYADLELDKVE"
FT   CDS_pept        471329..473119
FT                   /codon_start=1
FT                   /gene_family="HOG000193418" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02962"
FT                   /product="conserved hypothetical protein"
FT                   /note="lipid binding"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="UniParc:UPI00003C1B33"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PAA1"
FT                   /transl_table=1
FT                   /translation="MSAATDTPAVATSDKDASADEIAAAPEAVQMTDEEELGAASDKDQ
FT                   SDSGKLKTLMGILKRMVGVKDIAAIRISLPANLLEPVPNLEYWNYLDRGDLFTLVADLD
FT                   DPLDRMLAVLRFTFTKELKYVKGKICKPYNSILGEHFRCHWDFEPVKFIDSQVLPVQAL
FT                   STDKPEPLPLVANQARTPTLTAKKGSAPPSPLVQAQDNKSRPTSIKGVSLDTSNSASIP
FT                   KKGLSKLLGRKKSTVKEASETQTSAASATSADASDDLDNTPTSDNASVFGTISQPASKQ
FT                   RLCFLTEQVSHHPPVSSFFCEAKDAGVQLYGVDQLGAKFTGTSVKVFPGEQNQGIFLRL
FT                   TDKAKCGASGEEYQITHPSASINGLLRGSLWVAICDNLYVTCRGGKRDKPEGDDGTRLR
FT                   AVIEYKDESWITKAKYALEGVIYAYGPNDDPDEYTSVKQVPQDKVLFTIEGCWKGRITY
FT                   KKKGDKEPRLLLNVNDVDPISKSVRPLSAQEDMESRRIWEPVTQAILAKKYSEATKHKQ
FT                   DIEQKQRNAAAERKRKNETFIPRFFDADISDGRPKLTEEGRKALNGEYGLVGYEGASTE
FT                   KVDDVAHNDVDEDEFQDAEN"
FT   CDS_pept        join(complement(473850..474927),complement(473531..473679))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10335"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595420"
FT                   /transl_table=1
FT                   /translation="MSPKKATVDKSTTIRAASRNKQRSQPKIASSPFGSSANASLASSL
FT                   SSLFSPQPHGKDAALASLLASSSKPPVKLGQASGLAAFGSFSQPQTQALDTSVGRNLDD
FT                   RLKEKRKDVQSKTSNASGPANYQKDGAKQEPTPSSSTHAQPEIPPSPPKDRMQKHAKAS
FT                   IAAVPRIPANRKPVFRPVLASSTAVSWPEMPVAGSKVVLHTLLEILAESDVEPILFRDL
FT                   GRRSRRSSKTADSTSVEKMHVDGEAEHVASVQVLAGINSITRAIEGDIAYDLAHLQSEA
FT                   SASKSKEESLLTSVRVVFVCRHDLPQPALVAHLPMLVTARNAVLHACGPDQDLVARGVL
FT                   LFALPSGSERLLADALNLRPTFHQTVTHLPTGRSQRVQSCKKNPPQGKVEQLEEEKDGG
FT                   TATGEKPES"
FT   CDS_pept        475394..477076
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12201"
FT                   /product="related to Ras-like G protein RagD "
FT                   /function="GTP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="UniParc:UPI0001595421"
FT                   /transl_table=1
FT                   /translation="MESKRLQVPVIGLRRSGKSSILNVVYNELHPDDTVFLESTTKPNF
FT                   ILSDSFLPIRIIDTPSRVLLGDVRLEKGIPLSSATGARVGLPPPVPARNNPTHAHNVAG
FT                   GNVASGSITTSAAGIAAGVVGVAVTPEMLAWTEVSAIVFVIDSQDDYYEALSKLHTIIL
FT                   SAFAENQTIEFHVFVHKIDGYSNDYRQDTLSTIQGKVLDDLVDSSPSFIAQPWSYPEPL
FT                   LVKEAQSKKAKDRSRSKSKDVSFSRSPAAGGNSSSGGGGYDASASEFSSFSAGGYRSDI
FT                   APEPGQINLDQEVRLHCHATSIYDTSVFVAISQLQQSLAHKVKPEEPLDADTTSSVIGA
FT                   AADAGSTVNGDKPTRPEASVTPLRRKLSLAESMEQLCDSICSTCWFDSAFLFDLPTKTF
FT                   IGTDSAPFDAASFDLAFDYAGFLGKFAGLYAGVQSDAATSTSHAVTPSAAASSSAFQLS
FT                   TSPSSARRFLLGRISKDTTAKPAESPSANTSTRSSVTQKWASSVTRLQPDRSLCFWQLN
FT                   HRLALLALIQSGVHATQTGLIDYNITFFRRAVQGLYALAQNST"
FT   CDS_pept        join(complement(477720..478987),complement(477217..477601))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI0001595422"
FT                   /transl_table=1
FT                   /translation="MDDVSASPTSGKTRASLFSNSLFPSSSPSPSRRRLSSSSSNLGTP
FT                   SSEMSSSRSGLFQQTSMALQSFAIESVIAASAAPPRLPIAQNKEPLSLPTTTKNFRGFV
FT                   QKSGPMFWFQDGVEATLLWQDKSWTLMWMAIWAVVSIYPWLLLLAPSTILSVILIMTHR
FT                   ARYQDTMTPSIRMEVPNLPASKSPKSTASTAAASPAEVLSYSTTFPTSTGEGIVQPPLT
FT                   PNPPHEGTLKYYENLRDIQNMMKMIIDGYDLLVPTVPYLNWSSYSRSLHILQLSLLTTV
FT                   LMFFIAPYIPYRAVMLIAGEGAFILNHPWTKPALEGLAKRIDTSREGRKLIKIAKEGGH
FT                   RVREWIEQDRLDDYVWERGWRNVEMFENERFVGSKRAASSSGVVGGWSAHNLRMGERLP
FT                   WTKGPDGWSSEEVEVLPGHQIDISRQVAMKLEPGWEWIPGDEWRIDWGGSWSAVGTDDQ
FT                   GYVYTDASWQKPASYAYGHGGGVPDYPPSIFDVQQQQADGEDEETLLDHQDEESDVRST
FT                   LPPLSAGVVDHDPKMKAETRRRRWLRRAVRSAA"
FT   CDS_pept        complement(479537..480643)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02966"
FT                   /product="conserved hypothetical protein"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR006886"
FT                   /db_xref="UniParc:UPI00003C1B37"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA97"
FT                   /transl_table=1
FT                   /translation="MEEADQLFRGSGNDLSIEEPMDPHNVTTPTATSSLPTSSTTHLPP
FT                   DSELVASLPVYLSKSLLGDSSLHVFQYPIYPRDRPLPVPYSAAARGLKVSSRWRPRANR
FT                   VEVELPLDVREEVYNADRGIEFGAGAEVLAQKQARADAAHGGSTTSQAAVSSSKSRIKQ
FT                   EQDHEAQANRGPKKLEKIKLESTQVPNATEYMVGVIRDQALHLTRLESIVQLRPSMNYL
FT                   DALDEAREAEKRRDRAAMAGEFDSDEEDEDELIEMEAPGEGSSRSKSAKKDAKKPTAQT
FT                   LSVALRTDPNAKKGGGMGIGGGGSSEARDMLMAAQREADAERWIDLEWRDEGSHEAQQV
FT                   FDTQLFASSKTALTCHTKPRDYLLHALP"
FT   CDS_pept        480987..481658
FT                   /codon_start=1
FT                   /gene_family="HOG000224564" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /gene_name="ynk1"
FT                   /locus_tag="um02967"
FT                   /product="probable YNK1-nucleoside diphosphate kinase "
FT                   /EC_number="2.7.4.6"
FT                   /function="ATP binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /note="ATP binding"
FT                   /note="DNA degradation"
FT                   /note="DNA processing"
FT                   /note="assembly of protein complexes"
FT                   /note="cellular signalling"
FT                   /note="modification by phosphorylation,
FT                   dephosphorylation,autophosphorylation"
FT                   /note="nucleic acid binding"
FT                   /note="phosphate metabolism"
FT                   /note="phosphotransferase system"
FT                   /note="purine nucleotide/nucleoside/nucleobase anabolism "
FT                   /note="pyrimidine nucleotide/nucleoside/nucleobase
FT                   metabolism"
FT                   /note="regulation of nucleotide/nucleoside/nucleobase
FT                   metabolism"
FT                   /note="transcription activation FunCat:11.02.03.04.01)"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="UniParc:UPI00003C1B38"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA96"
FT                   /transl_table=1
FT                   /translation="MFARSAIPTLRAASVRAFSTQTASTGTASARRYMGAAALAAGGAL
FT                   TYSAFAAPTVHLEGPKTIAGELGTSTERSYVMIKPDGVSRQIVGEIISRFEKRGYQLVA
FT                   LKTVIPSAELAKEHYIDLAKKPFYGGLVKYITSGTPVVAMVWQGKDVIRQGRRLVGATN
FT                   PLDAAPGSIRGDFCVSVGRNIIHASDSHESATKEIGLWFHEKELATEYKPIAWDMIMAD
FT                   N"
FT   CDS_pept        join(complement(482529..482667),complement(482335..482450),
FT                   complement(482049..482240))
FT                   /codon_start=1
FT                   /gene_family="HOG000223544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02968"
FT                   /product="related to LSM1-Sm-like (Lsm) protein "
FT                   /note="RNA binding"
FT                   /note="RNA degradation"
FT                   /note="SYSTEMIC INTERACTION WITH THE ENVIRONMENT
FT                   FunCat:36)"
FT                   /note="assembly of protein complexes"
FT                   /note="fungal and other eukaryotic cell type
FT                   differentiation"
FT                   /note="mRNA synthesis"
FT                   /note="nucleus"
FT                   /note="protein binding"
FT                   /note="rRNA processing"
FT                   /note="regulation by binding , dissociation
FT                   FunCat:18.01.07)"
FT                   /note="splicing"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00003C1B39"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA95"
FT                   /transl_table=1
FT                   /translation="MDAHDIVSNIAFTTSGSLVDCVDKKMLVVLRDGKKLIGVLRSYDQ
FT                   FANLVLQDTVERVFVGNRYGDVARGIFLVRGENVVLMGEIDLDAEDEVPPSIAAPLPPS
FT                   ALPQLLAAKEAEAESKAKSEAKKADILRIAQGFCADKSGDGDMY"
FT   CDS_pept        join(483860..483903,484003..484082,484170..484606)
FT                   /codon_start=1
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10337"
FT                   /product="probable ubiquitin-conjugating enzyme e2-23 kda "
FT                   /EC_number="6.3.2.19"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="protein ubiquitination"
FT                   /note="DNA repair"
FT                   /note="assembly of protein complexes"
FT                   /note="development of asco- basidio- or zygospore
FT                   FunCat:43.01.03.09)"
FT                   /note="endocytosis"
FT                   /note="mitotic cell cycle and cell cycle control
FT                   FunCat:10.03.01)"
FT                   /note="modification by ubiquitination, deubiquitination
FT                   FunCat:14.07.05)"
FT                   /note="pheromone response, mating-type determination, sex-
FT                   specific proteins"
FT                   /note="proteasomal degradation (ubiquitin/proteasomal
FT                   pathway)"
FT                   /note="protein binding"
FT                   /note="regulation of glycolysis and gluconeogenesis
FT                   FunCat:02.01.03)"
FT                   /note="unfolded protein response (e.g. ER quality control) "
FT                   /note="vacuolar/lysosomal transport"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniParc:UPI0001595423"
FT                   /transl_table=1
FT                   /translation="MTSPKRRIETDVMKLLMSDYEITLINDSMQEFYVRFHGPQETPFA
FT                   GGVWKIHVELPDQYPYKSPSIGFMNKIFHPNIDELSGSVCLDVINQTWSPMFDCINIFE
FT                   VFLPQLLRYPNPTDPLNGEAAALLMREPKTYEARVKDYVQRFATREAANAAGQDEDEDE
FT                   EEEDEMSDVGSFSDHEPMGDMEM"
FT   CDS_pept        complement(485008..486339)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI0001595424"
FT                   /transl_table=1
FT                   /translation="MKASGMFRAAAQSNRSAASRRGGPAQSLKRAATIARTSSCSASLT
FT                   GPLSSQNPSYHPDSTARRQQHLFTAVRMLHQSHFLLKAQQSTSPSTSSSTSPVSESDKS
FT                   RQLATKNTSSTEVSAPKANKSLAERAKELWATAKYLFKFYFNGVKQIWANRTRVKLIQS
FT                   RVADGGAALSREESQLIHTHQADMRKLPLFLFILLILEEALPLVVIWAPSLLPSTCILP
FT                   TQLTKIRMGEEVKRAEVFAQLKQSESLKELLPVVQESNGGFKLTEPHVASADLVKKISA
FT                   EDLVRLAKMFALSTWGGSSMVRRRLDTHLAYLRTDDQLMCVDGFSAIPQHVDALAKACG
FT                   ERGLRCTGIEHREMFESLRTWLRLTTRNPDTRRMETSSLALLPLQLYNPAALQEVKSEV
FT                   EAESARGLIDKTKDVLREVVDEEKKVLDRDEKSKIESERKQQHQ"
FT   CDS_pept        join(489689..490312,490767..501821)
FT                   /codon_start=1
FT                   /gene_family="HOG000135916" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10339"
FT                   /product="related to fatty acid synthase, beta and alpha
FT                   chains"
FT                   /EC_number="1.1.1.100"
FT                   /EC_number="1.3.1.9"
FT                   /EC_number="2.3.1.38"
FT                   /EC_number="2.3.1.39"
FT                   /EC_number="2.3.1.41"
FT                   /EC_number="2.3.1.86"
FT                   /EC_number="3.1.2.14"
FT                   /EC_number="4.2.1.61"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="fatty acid synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /note="assembly of protein complexes"
FT                   /note="biosynthesis of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /note="degradation of glutamate FunCat:01.01.03.02.02)"
FT                   /note="degradation of glutamine FunCat:01.01.03.01.02)"
FT                   /note="fatty acid metabolism"
FT                   /note="metabolism of polyketides"
FT                   /note="protein modification"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI0001595433"
FT                   /transl_table=1
FT                   /translation="MSGIKTTPSDDSYVELSATSSQSSNNSNGLLLRALTIASATGIEV
FT                   NIPVPSQPFDAWIVADVLREEFQRSLASSEANDVLEVQEEQEQAGAADKAAGEAKINLA
FT                   AKFLGFLASRATLKTSSHELNLLQHAWAHFHDEFLATRGSVHDLVAAIDSDLRTPVLRS
FT                   YFEAYVQLESAGQAKPSLITPKLFSLSAQNKAEVHAVFGGQGNNEAYFKELRTLFDTYR
FT                   PLVQPLLESIQPVLDKLVQDAVKQGFASYYIHGMDVLAWLTGAAPEPAVLYLASVPLSL
FT                   PLIGLTQITQFLVSIRASGLTPAEFRSQIKSATGHSQGIISAVVLSASDSLESFYVNVA
FT                   KALELLFHIGKRGQEFFPTLAIDPALVKDTVEGGEGEPTPMLSVSGLEQTVLEKHIQKT
FT                   NSHLAESQAVSISLFNGPRSFIVTGYPKALVGLVGSLRAIRADTGADQGKIPFSKRKAV
FT                   FRMNFLPVGVPYHSSYLIGATEKMLQEDYAGRTIVWDASELKTTVKNTEDSSDLASYSS
FT                   EDILKSIADQIFVKHIYWSKVSDLPKSATHLIDFGTGGLSGIGGLSARILEGRGVRILT
FT                   PSGTHARSTELYNASTVKFEERWEDVWSPRLIKTKNGIKIDTPFSRTTGRGILMVGGMT
FT                   PTTVSANINAAVLNAGYVIELAGGGLHSEAGLRKRVNEILAQLEPGNGLELNGLFIDQR
FT                   RFGWQYPLWGQMRREGFPCKGFTVAAGIPSTEKAKEIIDGLKAAGIEYVGFKPGTADGL
FT                   RAVAAIAAANPDFKIICQWTGGRAGGHHSTEDFHQPILQTYASLRKQKNLILVGGSGFG
FT                   DAEGVWPYLTGEWSVKLGYAPMPFSAFLFASWMLVAKEAATADAVKQLLVDTPGCGDDK
FT                   WQDTYGKGAGGTITCNSELGESISYVHNRAAALWRQLDDQLFSLPREKQRVWLSEKKSW
FT                   LIERLNKDFQKPWFAAKLDGTVLMDVADMTYEEVTRRMLELLFVGHQSRWIDPSLKKLF
FT                   GDWCRRVEERFAGIETAGKKESLLQSYSVLDKEPSKFVDAFFAEYTGAKEIRLAAEDVG
FT                   YFLTICQRRGQKPVPFIPELGDNFQTLFKKDSLWQSEDLDAVVGKDAQKVIILQGSVAV
FT                   QHCTKANVPAGEMLGDIEKQLVAKVLAKYYDNDESKVPVADYVSNDPLAIDEADVYARY
FT                   GVEASIEGNLKTLKIGSQLPDTTEWLEALATRRTSWLRALLRNVSVVQGKNYADNPMLR
FT                   MLAPRKNQTAKIAYAADGEPISLTLFGAARSYGGHDDGFKALEITKSSDSAKIQVTLFE
FT                   ERLGESIPLHFYFTYRPDQPFASIHEVMNGRNDRIKQFYWQLWFHADMPAAAQLAAATQ
FT                   FESPVKSLDETAIRTFCRIVENRGEVFTKGQAPMDFAIVAGWEAIMQALMASCDADLLS
FT                   LVHLSNSFKVIDDARPLRAGDVCTATAHASSIKISDTGKSVSVTGTVLRKDASGDFVPV
FT                   ISVVSSFFFRGRFTDFDTCFETSQNEFTLEIKTKADATVLLAKEWFDWVAPQPLAPGTV
FT                   LHFNIQSLLKYKDSTSYSDVEVTGGAYVRDYKDDLIKVGEIEYTADAISYGNPVIEYIK
FT                   RNGGASTGGVAPLETGYTLGASGVPTTFVAPATNEPYSNASGDFNPIHINPYFSSFASL
FT                   PGTITHGLFSSAASRKFVEVVAAEGYPDRCLSFEANFVGMVLPGDELTVKLRHIAMRDG
FT                   NKVIKVETFNQNGDKVIDGQAEVKQPATVYVFTGQGSQEQGMGMDLYNSSPTAKALWDE
FT                   ADGHLRSTMGFSILEIINQNPLTKTIHFGGVRGHTIRERYMSMTYESTDADGNTVTLPL
FT                   FPEISASSQSYTFQSPKGLLFATQFAQIALVLVELSAFRDMKQRGLITPDAAFAGHSLG
FT                   EYASLAAVASVLEVKSLCDVVFYRGLSMQNCVQRDPVTGASNYAMMACNPLRIVGEGNP
FT                   AFAGQALAEIVDSISKESGRLLQIVNHNVAGQQYVTAGDLVALTTLGNVLNFIKIQKID
FT                   LKKLNEIMPIEEVREKLAEIVREVLSAALEEEMKGRIELKRGFATIPLPGIDVPFHSRY
FT                   LTGGVAPFRSYLSKRINVDAIRPQLLVGRYIPNLVAAPFELSKSYAELIFAQTDSPRLD
FT                   KVLKNWEKDEWESPDRVQRLTATLVVELLAYQFASPVRWIETQDIFFTDYNFERLVEFG
FT                   PSPTLVGMAKRTQALKYSAVDLAQGRKRVMYCSSKDKEALYYAFADDESEVEAAPAETS
FT                   AAAPVAAAPTPVAAIAAPAASGGAAAAAVPDEPLKAVDTVRAILAQKLKKNISEVPLSK
FT                   SIKDSVGGKSVLSNELVSDLLAEFGNLPERGEELPLEELGSALQAGYTGTLGKTTSNLV
FT                   TRTVAGKLPGGFNLSAVKSHFQKAWGLGAGRTDGALLVAVTMEPAKRLGSEAEAKTWLD
FT                   SVAQTYAQLAGISLAQASVGGGGGGSGGVAISSEELDKLKAQQDEHVRRQIQVLERYLN
FT                   MDGRAGGRLAESTKAELEAAQAQLDAIAAEHGDTYTNGIMPKFTEKKVRHFSSYWNWAR
FT                   QDAMTLLYDIIYGRLTTVDREITARCITLMNRADPSLLRYMQYHIDQIDANQGPTYALA
FT                   KEYGQQLIENCREACSEDAVYKEVHAPTAPHTEIDARGNIAYSEVKRVGVRKLEAYVKE
FT                   MAAGSRLLGAGSQVNLDKAQENVAKLWTLIRNEPSVSKLSKATIKSLYSEVVRSLGPAR
FT                   QARAPVRQAPRNRRLSSSTQRPQVSDAASTEDRTPFLHVKRKVAGQWQLSRKLTSVYLD
FT                   ILGEMASQGVSFKGRNALLTGVGKASIGVEVVKGLLAGGARVVITTSSYSRSVVEYYQR
FT                   IYQEVGSRGSTLTVVPFNQASKQDVDNLVKYIYGSLDLDLDFVVPFAAISENGREIDGI
FT                   DDKSELAHRLMLTNLVRLLGAIKTEKASRNFDTRPTQVLLPLSPNHGTFGGDGLYGESK
FT                   LGLETLLNRWESESWGQYLCITGAIIGWCRGTGLMSSSNTVAEEIEKLGCRTFSTTEMA
FT                   FNLLGLLAPTVSAVSQVEALLVDLNGGMDKIVDLAEQTGKFRAAIQEASSTKRALVADN
FT                   SADFKVIKGSAAEALHKKVHINPRSNFTFRFPEVGSLQLNREIAKSYSQMDLEKVVVIT
FT                   GFAEVGPWGSSRTRWEMEAFGHLTNEGVIELAWIMGLIKHHDGQLKSGATYVGWVDVKS
FT                   GEPVDDKDIRANYEEHIIKHAGIRLIEPELFRNYDPNRKGFQQEIELNHDLEPFEVSAE
FT                   EASKYKLEHGDKVDSWQDANTGGWFVVLKKGARIFVPKAVAFDRLVAGQLPTGWSGQRY
FT                   GIPDDIVSQVDRTTLWALVCASEALINSGVSDPYELYKHFHPSKVGSCIGSGMGGMTSL
FT                   SKMFRDRRNDTDVQNDILQETFINSVAGWVNLLVMSAAGPIKTVVGACATALQSIDVAV
FT                   ETILSGKAELMLAGGFDDLSEEGSYEFANMKATSNGKEELAAGREPSEHSRPFSTSRSG
FT                   FMESQGCGVQVLTTAANAIKLGMPIQSIVAYSNTHTDGAGRSLPAPGHGVIGSADGMQR
FT                   ALARFNLTADDIGVISAHMTATKANDKNESHVYQELFTRMGRTPGHAVPVMAQKWLCGH
FT                   AKGGAAAWALNGVMQALHTSIVCGNRNADDISPELQKFDMLLYNSTSIHRTPHHVNAAA
FT                   VSSFGFGQVGGIILVLHAAHILGRLSDKAFEEYVARRKARQHQTYTRMHSALTKEDLVR
FT                   IKDNRPWPAELEDQVLMNLNARAVEIGDSYGFKAPLPPMPALATVEDTIVPAKPANVAA
FT                   QQENLEKMMGHVAGVGIDCEKISTFPSDNDNFVSRNFTDVEIEYCRAQPDPRASFCGRF
FT                   CAAEAVVKSLGVRTQGAGASLKDVEIVPTPEGPQVKLYGEALKASNGSRFLVSISHGDD
FT                   TAMAIVHRLPSA"
FT   CDS_pept        503328..505070
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02972"
FT                   /product="putative protein"
FT                   /function="protein binding"
FT                   /function="zinc ion binding"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003C1B3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA91"
FT                   /transl_table=1
FT                   /translation="MSTNAETVTAVPGVPTPTIDDGANATSNANNPRIQQDGPSLTEAL
FT                   TLRRNLLQSLWMGVRQLPRGRRIVLMIRLAVSFAQIVAFIPILALPGSHHVSPSHEAGR
FT                   VCNPDSLFKYLVVHIVRLALDIPVELYLGLSPHRTRRGRRAGPEARAIAERDRPLGSEY
FT                   LDMKIGKISTVLGIASLVIFFVGNAIVYSSTECSQKPAEAVPLFWTALASLIVVYVFIL
FT                   EIALLAFLIVCALPLLIMVMRALGLAHRLPQRELHPETGKIDQKEVDKRVKLVYYTPAE
FT                   EEQDDAHHDDESTGVEAQEQLDQQGREGNIETVAQNESTPARPGIGSRQSTQVSVRTVV
FT                   HPALGRLRRLSRLLIARRRSETSSSRLNHLKSARDSGNASTLSSSTLSAETGAARSAAQ
FT                   SKLSARQRRGKQLKYPLHPLPAHRATCPICLCDFEEPQLDDEPESEIEPEPLRLLECGH
FT                   VMHKTCVDQWLTTVSGRCPVCQKAVIPQIVDESRVPSTTQGQVADAAGQTLGQQQPTEA
FT                   EHIAEERDPARIAAAPAIEAHPAEAHCQNSTASTHLAGASGSTTISDAGPQESHELQRL
FT                   PSGV"
FT   CDS_pept        complement(505276..506022)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12202"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595434"
FT                   /transl_table=1
FT                   /translation="MEAFLGIVFPCCFSSRRRSSLSGTSESTPLLHDALHATASCSHSV
FT                   CDHGVPTIQADARRKRKQNSVLPTPAYDAVVLRDIMDEFLSKLISVDASARGVAGTGEK
FT                   RARIRTNLLSTLEDRVAPSKAKHVTPIHTLGPTLSRSSTHAHEPKFVDIWCDHDSSAPP
FT                   RTACAPTTGAHRLNYSAAAKRAALISPPPSKKPLQKRPPPPHPKPSLDDPTIIQQSTYE
FT                   SLSLLARSKPLVHDWTLADHDPQSST"
FT   CDS_pept        complement(507026..508750)
FT                   /codon_start=1
FT                   /gene_family="HOG000163961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02974"
FT                   /product="related to AUT4-breakdown of autophagic vesicles
FT                   inside the vacuole"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003C1B3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA89"
FT                   /transl_table=1
FT                   /translation="MAQVQIPCPAAERSPLDEERISLRVFSDAESQASSRKNFANALLT
FT                   TSQDPTSSDSRFATGRYELWSFYIYYIGNCGLGPFNFAPSQFQNLLSQQATNLGAGQCG
FT                   QDGQNDCRLLFAGKQRTVESIVLLSNGISFAIQAFLFLAIGSFADYGKKRPYILIVCTV
FT                   VAIAISFAWLGVTKPQQWQLATGLYMVGLITYQLCLSYWTAAFPGLARDLPHMREARQR
FT                   LVQAREPTTVHVETVDDKVAMPSVEQSVPDDHFSADQYSLLETLSINRISNIAFTVCSV
FT                   GELVVLAIIQGMLYAIHADRDEQSNTIALSAVVAVSAAVWLLCAIPWFVMEKHRPGQPL
FT                   PPGTNYFTAAVKQAVLAAKHLRRLRQTLIYLVFYFLFSDALNTTVTVISTIQNQVVSFS
FT                   TTKLNLLLIVGIAAQAVGIYAFWLIQRHWHLSTLYMFCWIVLFTIILQLWGFIGIFTQQ
FT                   FGFHHEWEVYMYQAYYGLAVCPWYAVSQTMIAEVTPKGSEFLFFSLFSIVGKTSAFIGP
FT                   FVTQAIADETGNASTPFYFLLALSLASCILLWPLDIKKSKVEQATFIEHEAKDKNLG"
FT   CDS_pept        join(509841..509844,511247..512829)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniParc:UPI0001595435"
FT                   /transl_table=1
FT                   /translation="MVYTASSRQAVLDALSDVVTVSPNPDNDARSNAFSRHAPHASYDA
FT                   ESSYSGLQPLRNLDPPTMVPAKSPFEDRTLPPLPPPSEPSAKPPTTMANKFANAFRRQT
FT                   ADDKAKAKRAKEKRMNDEINKTTAKASRMDIIDRLDLSGINGSSMFHHDSPYDACTPHM
FT                   NKGKRAPVGAFDPNIDPMTGLPRNASAAKNQNHVAPETAHDNPENDKLPLRPGANANGG
FT                   RSRSATAPLVPSLSMHAQGSATELSLDEDVDADRDAEAERVWRSRQGYHTQPSNIPDSR
FT                   YDVSNPNADVWGVSAEPWQDFAQPKAPVRSHLSPYSNHHGERSGSTSAASSVLDMEAIM
FT                   TGQKKPSRAKDELATGSASPFPEPNYDDRLSASTASSEAPKRNKSLIKRIRSMRENPNV
FT                   PPPDNGGVELGTVRDRRRRAAQHKYSPSTPPLRSDYAAAADAAVGASVSSASYGRRSGR
FT                   TVVTPNERDVLTPRANRDDNASYFDRSQESRQDRDATNEAGLTRNGSLFNKLRRGGKSS
FT                   PKSAERPAAYA"
FT   CDS_pept        complement(513084..517250)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02976"
FT                   /product="conserved hypothetical protein"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="intracellular"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="UniParc:UPI00003C1B41"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA87"
FT                   /transl_table=1
FT                   /translation="MSASTEAERNNQDRIVDEASLSMQPLVQDTKSESITATLPADGSK
FT                   SESETTLAATTDDSMASPSHTLSSPIVPGAFASSSSSSSSSSTIPSSSSSLATASDLSK
FT                   AQDASDKPLPAIADSDAAITSPDTAVASSLQQQQQQLLHIPGPSMPKSELESSMITTVS
FT                   PVRRSIYKRKMSSQPKGILKPAPPPQKGFSFRRDILQSINTRLAQQGVNVQVPMPQSGT
FT                   AQATASYIGGMFRKIGGIAAGAAANVSGSNSTTVGGLLSNDPSFNSNGSSLYSQGSLDD
FT                   TNANKSGSNIMSSSGSTAIASQQNDSENGSTTSLVKNTVLSSTTSAAPLKKVQFQVSHM
FT                   SVTYPIVGAGTPEDEDLTRLRIEREHRRMLKARRGKPWTPEQLEALYRECCRTREEHPL
FT                   KKMRLVFQEAAQSIPPALKTMDLSFVPLDRHAVEPIADLLSVDFGLNKLVLENCALTDD
FT                   TVKSILHALLVSGTLPNLSIASNRKIRFRGWKYVAIFMRRARALRYLDLSENSIDRLSL
FT                   EHLLAVIIKPPSAVTYHRTQPSRAAKKTADAKPEADGKETSKDAESAEHQVKDGGEDDD
FT                   DDEDDEFFDDSGEPLMPTAPLLRDVSDDPDPPTSAVTSLRLENCGLKAASLEMLSQAVR
FT                   FSDIRHLSLRRNKIGQLASVALAIMLKDYPDSVIASDTQTSSASARKSYFDPASAPFST
FT                   ASGMADAEVFQRNGRTLRPSDGLTTSERFARSYSPGLPEVPVIVSSPGGGITSRKMPGS
FT                   HQVNGGSEQRPTTFYGVHTEQLQDAMQTSIAGPTAEIDLNLTPQQRLEIRSNSAPNLSE
FT                   EEAVAIYQAKRARRILADLPRVGNLLTLDLKSNDIRGGVVYLAQVLKKNRTLRVLNLSD
FT                   NNIEMPGLVAVAEALKYNSTLETLDMSHNPCSGPGLEGITTLRTAFALNSNLKRLFLND
FT                   TDLSSEAAIALAEFLPEARSLIHLDLAENFDIDIAGVMALAVSLRMNQSLRCLDLNIPP
FT                   NNPDFARLSQEILQSCVRNTELAQQRAAKKGLKQRIAAPIYRSVVARAARENDERLKAI
FT                   ETARATAMSAAAAKDRAAVQDLLTAAGECRSVLRDLLSGEEKRQLEAPEQKLTPPGEFV
FT                   EDLTVQSAKLRKRLGELAGTVEEEDLLESILTVHDELSEVSTRLERFYQYGIAAIGKPG
FT                   DGVRIEGEMTSVHLTTPDQGVVESGLTSPAFSIADSDEEDSEVESGSGKPRSRIAVGAS
FT                   GASANGEASNMPQHSRSHQGSLSDMMDGLGIQTHSVDRDSADREEREPEHEHEHEHELG
FT                   ADGSPLPPRAPTETLAKGQLSEEAELFRKTKCLQYDFHARHSQDDERLARLGTTPDLAC
FT                   TPTAPPSPHTDPLQAAVHNAHLSGEQLRKDLLRAHVPPKSLTSTP"
FT   CDS_pept        517987..519384
FT                   /codon_start=1
FT                   /gene_family="HOG000172735" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12203"
FT                   /product="related to CWC2-involved in mRNA splicing "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /note="splicing"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000159534D"
FT                   /transl_table=1
FT                   /translation="MSETQAQGVQSPGQVASTSYQPRPARKQVTQAKFDAIREAFSARP
FT                   DSAGTFNIWYENFAGVDREENEAQKAKRETRCDIARDSGYTRADITLKTQAARIQQGAP
FT                   VAPDEAVYCCIHFARGCCPHGAECNFLHRLPRPNDYPSQGRDCFGREKLGNYKDDMSGT
FT                   GSLSKVNRTLYVGRIHEEHGVSSPSAPANSAWRDGGKTLKGGRSIHDVRNKNGPRPRQD
FT                   PKSYRPQHNSVRPETDNATERVVRRHFSEWGEIDRLRVLTGRSCAFVTFKYEANAQFAK
FT                   EAMLNQSLDHNEIINVRWASDDPNPAAQKRNQEQMRRAGERAIMAGMSEQAIQAQQALR
FT                   ALEGLEHQRGEDADSKRRRISHQSYDEDMRRLEEENERGWVEFAQERQAAVAAAPTSQA
FT                   PSAASSASKNNITGSLLNSETMSHLASLQNLDQKQGGASDTYPPPVSSNGLGSLAGYGS
FT                   DSEDDDS"
FT   CDS_pept        520401..521519
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02978"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003C1B43"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA85"
FT                   /transl_table=1
FT                   /translation="MEDTSFVKRAGSAADTEEDFSTVPTTTAASESGIEDLNISETDSN
FT                   VRTTACDDTARVTADASVNEAVPPPAAARTADEPASRTTEADSTSLGTTSSGLVLFDLT
FT                   DKPSGKACFSPHTVKTLLDLKLLNIGYERQRLSFIQIRNELASRIADNVTVPALELSDG
FT                   SHIVDSWNIAEYLERRHPDGWKIFGDSATKRLAAMLNQFGKTVLAPHIGPLAQKGVHAM
FT                   LDEESARYFAEVKIGRQRWAKVSGMTQAERDVHVQQAVAKLEVINAILTCEGGADSTPS
FT                   HPIASASGGGTSTSTEGSASNGRSASRTRQSVWLAGGDQPTHADFVLFGWYVFTRAAGQ
FT                   KTAREIWHAHKPIATWVQAMLEWSGELADDFV"
FT   CDS_pept        complement(521654..522883)
FT                   /codon_start=1
FT                   /gene_family="HOG000157349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02979"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B44"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA84"
FT                   /transl_table=1
FT                   /translation="MSFGFQFDDSEMDEEYISGSLSSIQPSAASTSTSTSASSTTTAAP
FT                   FKSHSLREMLQNLPSRISYSAIDVSLPSTSREGEGEGGGKGRVQRLLRRDLFDARFQML
FT                   IDEEEDEATDSGTAQKSTRQQMVDGKVDAHSDLVPGVYEGGLKTWECALDLVETLDALH
FT                   STASHNDSSRSTWSHRLSGKHILELGCGTSLPSVFLLDQVLRDDPSTQPINLNLHLADY
FT                   NAQVLQLVTLPNLILAWYASPAASHYRSTTEATHLVHERNELVRRGQDHFHAEDELAIT
FT                   DQLVAAFDESLKSRGIQLNFYSGAWSNFPSSLFGDGGVHKMDIILTSETIYSLHSLPAL
FT                   VELLSRYTQTEAQHQPALVLVAAKVIYFGVGGGVESFKQTLAEMHPSATVEPIHSVTKG
FT                   VGRTVLSVTF"
FT   CDS_pept        join(complement(524836..525286),complement(524743..524750),
FT                   complement(523304..524638))
FT                   /codon_start=1
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um02980"
FT                   /product="probable dihydroxy-acid dehydratase "
FT                   /function="catalytic activity"
FT                   /function="dihydroxy-acid dehydratase activity "
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /biological_process="metabolic process"
FT                   /note="biosynthesis of isoleucine FunCat:01.01.11.02.01)"
FT                   /note="biosynthesis of leucine"
FT                   /note="biosynthesis of valine"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniParc:UPI00003C1B45"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA83"
FT                   /transl_table=1
FT                   /translation="MVNGEVELRTTSRTNGDAPAPILNRISRYITQSSDKGAAQSMLHA
FT                   CGLSVQDLDKPQVGISSVWWEGNPCNTHLLEFGRKIKQGCEAEGLVGLQNNTVGVSDAI
FT                   TMGGPGMQYSLPSRELIADSIETITLAQYHDANVSIPGCDKNMPGCLIACLRHNRPSII
FT                   VYGGTIQPGKHGMDIPALGRKKGDPCNVADNFEATGAYAKGLITAEERVDLIRNACPGP
FT                   GACGGMYTANTLSIAIEVMGMGLPLTSSTPAVYPEKMQECLRVGAYIKNLLAKDIKPRD
FT                   IMTKKAFENAIVMTHVLGGSTNAVLHLIAVARAGDIDITIDDFQRLGDKTPMLADVKPS
FT                   GKYYMEDIHKIGGVPRVLKYILENTDLLHGDVMTVTGKTMRENLVDVEPLEFETQDIIR
FT                   PLSNPIKATGHLTIMRGSLCPGGAVSKLTGKEGLYFDGSAVVFDSEDGITEAIAEGRVK
FT                   EGSVVVIRYVGPKGGPGMPEMLGPTGAIMGAGLGKTVALITDGRFSGASHGFCTGHVVP
FT                   EAALGGPIALVQDGDRITVDANTREINLHISDEEMEKRKQWWLKEKKPTLTKKHKRGWL
FT                   YKFARDVQNASEGCVTDRDLF"
FT   CDS_pept        complement(526952..527623)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR014733"
FT                   /db_xref="UniParc:UPI00003C1B46"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA82"
FT                   /transl_table=1
FT                   /translation="MRLSLLALCSALVVAAASAHIPSLNEASPSSSSLLSARPDSVRSS
FT                   VSSAGDISLHKRMEDVEVEEIDVEVDEGEDDQEYDNAASEGSTLEQRNQHDKKTHHRSD
FT                   KQAGRRRKSHNRHKHHDNRKRPSKGTFSGKGTFFKPNQGSCGKWNTANDKIVALSKDIY
FT                   QGGSHCFKRVKVCHGARCADATVADLCPGCKPTSLDMTPSLFKQLASLEAGVIDIKWSF
FT                   V"
FT   tRNA            join(complement(529303..529338),complement(529238..529272))
FT                   /gene_name="tRNA-Gly (GCC)"
FT                   /locus_tag="um14000"
FT   CDS_pept        complement(529737..534212)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02982"
FT                   /product="related to PLC1-1-phosphatidylinositol-4,5-
FT                   bisphosphate phosphodiesterase"
FT                   /function="calcium ion binding"
FT                   /function="phosphoinositide phospholipase C activity "
FT                   /function="phospholipase C activity"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /function="protein binding"
FT                   /biological_process="intracellular signaling pathway "
FT                   /biological_process="lipid metabolic process"
FT                   /biological_process="signal transduction"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003C1B47"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA81"
FT                   /transl_table=1
FT                   /translation="MSASDRHAASDRAAGRSVRSWLRSLLQGPSDQHADRGTYASSQGS
FT                   AVVSSTGPASVGTDMISFHHTFEDVERPSFAPPPRSFSGGSSNGSLSYDAAAKRTLAQP
FT                   IATPRAGAAHSSTNLLSANSLATSPSPSASPPKSPRIARTLTSSVASLTDRLHHQRRAS
FT                   ETYRRMRSGSTSAEVDSQQIVLSRSLSKTLDRDSPLLASPSAISENEPVSSPPPTHLSH
FT                   DSQLSPTGSLANPSDSNRYGPETSGVRRSDSSGTTTAIGESLSPSQSSAGAAPSTCEAS
FT                   HELLLPEGEQMLKVTHKKVKPRTFKLDPDRGQILWESKKNNRVNLESIREVRFGPSAAS
FT                   YRTSLNISSAHESRWLTIIYQNNGIYKALHLIALSDQSLSRWRASLLHLQSLRRELLGA
FT                   VGASSSLENRRHLWMRHHWKDADESNDEKLSIEEVILLCRRLGIESNKAHLRRCFNLAD
FT                   WRNRGFLDFQDFQHFVSLLKQRADIETIFAAWADQPLEQPLEQLRRGSGVTKDDHDLRG
FT                   QAPELEGSPALSDASSVDTQSCPAPSVMQTSRVMGPEPCRTQAMSIDSFRRFIREEQGN
FT                   HNFSNGQIDDLFHRHCNSRLSSSHHADAPTERAQMDYDGFLDFLSSSDNPPLLDQLPLF
FT                   STIVSNPVDATVLGRPPCSGSIDAVEYSDTQQCSQQQDTDANQCPQQRTPSRAFANTTD
FT                   ELIAAGASDSMANTRKVAAHLRKSTIQHDMTRPLSEYYISSSHNTYLVGGQWKGDSTVE
FT                   GYIRALLQGARSVELDCWDGPNNVPQITHGRTLTSRVPFQDVISAIARYAFVTSPYPLI
FT                   LSLEVHADPPQQEVMARILIDTLGEMLLSQPIDSQTLPGSTDELPSPEKLKFKVLVKAK
FT                   NVAAADGHQALPLPKAADGLALSAKQKDGTDVIPTMVLEPPTSATDTTSTTDSEIESRL
FT                   TSAKQLVCRVTRRSHRVQATSAGQAGYRSGDASDDGTAKASYETPGNGSRSSKATKKMM
FT                   STALASLLIYTIGVKCRGFNKKESYATQHMVSLSEKTALKMIRDPISNEALIKHNRSHL
FT                   TRIYPSMMSFARLHASRNFVPLDMWAAGCQLVALNWQTTDLGFELNQAMFSRNGRCGYV
FT                   LKPAALRTKEHGKTLQGKVVRFQLDLRIVSAQQLPKKNKAGASKDKDKDKGHSYHDNRE
FT                   PIDPFVVVSLLTPGCWGKQPKGLLQKASTPREAKELPLSPAPPVDHCEAAPDSVIQTRQ
FT                   TSVSEQSSGDGTIAAASSHTDKRLQHSADVGSSSEPSPGPQRAKSSAKTTALAPTHLLR
FT                   TPTVKGNGFSPEWHTHMSVLIDVPAGASNELAALVEASKASQGAALTYPELERLSRGLL
FT                   DLCFVRFEVFDDDLDDDVAEEQATSRTTRGSEDTLAPTPSISTAVVESGSRLSLNPTAA
FT                   IRQSNTEAAADDDAGSKAGSETSSTSSTSSIDAESVAAYSVSVGALQQGYRHLPLYDHQ
FT                   LSQFLFSTLFVHSRLRLVGLVDGVAPGKQS"
FT   CDS_pept        534754..535605
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02983"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B48"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA80"
FT                   /transl_table=1
FT                   /translation="MFKRVAKATSKKVDVDGLKEVTGDDTAIGIDKLVDESSSSEGEDF
FT                   DDEDNDSDSDSDDEEESKVKGDDQAQDKTSSKAGSKRKRSQDQDEEEQNEAAAQVSIEE
FT                   AIQDPIYVPTEGEKKHGVFASRCIVCEAAVLKTSHLVTAHLEAKAHKRRMERFQKYVEK
FT                   QLTETQRKALDARDAVEQMDVWKAEQVELEQKRLAEAPPSKKALERKQKATEFRKKKKE
FT                   QAMKRKAQKAAKGDKDAAKPDIIDPKDNKTAKVDNGTAEKVQADSQTVIAKKPAKKVKK
FT                   QA"
FT   CDS_pept        complement(535926..537257)
FT                   /codon_start=1
FT                   /gene_family="HOG000219186" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02984"
FT                   /product="related to Dibenzothiophene desulfurization
FT                   enzyme C"
FT                   /function="FAD or FADH2 binding"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI00003C1B49"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA79"
FT                   /transl_table=1
FT                   /translation="MAPTATTAGAGDNNVPAASKGSSRIQPDPEVVQYPKFDKDPVTPE
FT                   EVFARAEQVSELLHEDEAIRDRGNVVPYRQVQLLKDAGLVTILGPKSAGGAGLTWKEAY
FT                   QVIRIIARGDGSLGQLIGYHYLWSWAAALVGTDEQRTKYEEWITKNKYFVGGAVNPRDA
FT                   DLKVHQDENDPDKLIYNGKKTFSTGSKISDVTILEGSLPDGSHVFAAVLSRQPGIVYGD
FT                   EWVDTLGMRGTQSGGISISNVVVPWSDALGYVNKQFQPLGAYNTLNLPQIQLVFTAFYL
FT                   GIAEGALARAAAYTKANTRGWPYQPSPVARGTDEAYIQIGYGDLQAKLWATASFIDNVI
FT                   EEAAGILHTNPRQAITEEQRAKFAVRVAAAKINAADVGLAITSQIYELTGARAVAGKYG
FT                   FDVAFRDLRTHTLHDPIAHKRAEVGRFALHGPGKDGWPTPTWYT"
FT   CDS_pept        join(538875..539779,539879..540364,540472..540607)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02985"
FT                   /product="conserved hypothetical protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003C1B4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA78"
FT                   /transl_table=1
FT                   /translation="MAELEIIDAEIVPQAGRESSLSSNVSDVKHQHVAEDLTASLSSLS
FT                   PVYTQEEREAALRLLVPSAHDVVLGAGWTDVESDRDNIEASRRESYSSASSSASSPSTP
FT                   PSCSPLSQSTLYTSSDKRSDLTDALLVRSCSQGWSLSFELTPHQPIPFPLNPDEILIRN
FT                   DAVGLNPVDWKSVSFNFGIPAFPWILGRDIAGTIVQPPALNEEGWKAGDRVWTCADSRE
FT                   MRAGGYQRFSVHKKVTLAKVPSEMEDTDAATLGTGLITAAVALFAFFKLPFAPLQEVEG
FT                   LSQQLGKVSIDGEKDETEWILIYGGGAVTGIYAAQLASISNLRIIAIASPSNFDYLSSI
FT                   GVTACVDRHQPRTSILDSITRILSEHGGRLRYAMDCVSSSTADLCLDVLQTDALAGKEL
FT                   ICLAGNPKADAGAVKVHKISFSTTFYHPDGEFARNVLAYVTGLLQQARLKPCRPEVLPD
FT                   GLAGIRSGLELLRQGKAPRAKKLVVRVRDTPAADVTHLGVRTELGWNGVV"
FT   CDS_pept        complement(540885..541754)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02986"
FT                   /product="conserved hypothetical protein"
FT                   /function="catalytic activity"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023279"
FT                   /db_xref="UniParc:UPI00003C1B4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA77"
FT                   /transl_table=1
FT                   /translation="MELLSSRLSETSLAPLARLSTSQRESVIASAEAFVKAAFAQHDPS
FT                   HDYHHVHRVRQLALSLSSSAELEHVDLLVVELGALFHDLTDAKYTSASCTPSSVLAPFW
FT                   ASLSPATLVSAAQKTTVEKIVANVSWSKDERRRAMHPSHLSADDVALQEWLSKCPEFWC
FT                   VSDADRLDSIGSIGILRCAAYSAKINRPLYIPPSNPDDDPVPPAEQAEGYNGSAVAHFY
FT                   EKLLKIRGDRLYLQQARSEADRRQGMINAFLDELGLEWLVAKQGAEIALLRQAQEDEHE
FT                   DEDHVDAN"
FT   CDS_pept        complement(542152..545235)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10341"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000159534E"
FT                   /transl_table=1
FT                   /translation="MASIPSPTAAEVQEVLLSPHFKHAPLIADDNVASGSYRRPSLPSP
FT                   SHSFRNVTACSPLSSPDDEQKAAREADNASAATSERGGRRRMVRSGTSESVTPLPASSP
FT                   SDSTINSDRGSTTAASSNIVSPAVTTPGSDNKIDLHNRPTSASSMAVSVQKSATSSSDM
FT                   QPALTAQRTNSNRLRPHDVSTAATRSDGLLSVPSTPATDDPFRSPSQFSVASDADGYFT
FT                   ARPGSPIESNDIMPLSMLRFPSAKAHSVLRRERVSWSGRSYVSCTSDYEADLAAGTSKA
FT                   LSIDDEACYVDGEHTLPTLNRTKGKATDRTNGSSRRVDFLSRLPPELSLCIVFMLQEHT
FT                   DLLRASLVSKRWRALALDQSVWRHLFFSHPGWAIREDAPLVVQHQAELQRVEAKARRTA
FT                   AKEEADRLRRLQAQRKAASTSSPYLDRLAALKSWRETLHIPSFPQLAALSLTNPAAHTE
FT                   VDVDTGRPVGPPMSPLRSPTAATGRFGLFLSPARGAPSTPAGARRAQEAAAGSSYFASY
FT                   DASNVPLSRQGSVGSMSMSRRTSADSLHFAEVVEAEEFFAATLDWTRLYRDRYTLEQRW
FT                   MRGHLARKVDTVDASAAQQNDAGGMARTASVSSTNSELTAPPAPGASDSSRAIRDKRRF
FT                   EPRKRFLRGHQDSVYCIRQDDGVGTGTAGKLVSGSRDRTIRVWDVETGACKHILKGHTA
FT                   SVLSLQYDDQILVSVSSDGQVFVWDFASVLATPKASTPTTETPTSTDRANVDPECGALV
FT                   HEKADRVQCVLRDHTSAVLDVVFDANWIVTGSKDATVRVWRRSDVTSSSSSSNSSAPVA
FT                   WRKFTHTGPVNAVDLQGDQVVSASGEGSMYLWNLQSGEKVHTFNGHTKGLACIVLKGNT
FT                   LVSGSNDQTIRVWDTSSGECTHVLGEHQMLVRTIAFDPTRRLVVSGGYDRLIKLWHLDD
FT                   SRNATCHGSQEQQDAEAETQAQIEGSDIEQALQQQQNASEEVEDKPITGKCLRDIRCHR
FT                   ARIFDVDFNTTRIVSASEDHLICITHFGGQGVDTSLFA"
FT   CDS_pept        complement(545754..547313)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10342"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI000159534F"
FT                   /transl_table=1
FT                   /translation="MTLPNDSQRRFVKHVVRRATIVARAAATASASAAQNPKKPNAIAR
FT                   EQTSSLKASAVAILLGSFLGVFLLFVLVGITCKYANRPRSDTRPHGHAKAMYQPSAAGY
FT                   GSAAAGYSAAASMQDVSSPNVGLLDSAQPMGRGGPHDDGDDSLGSSNATPPAHAALGAI
FT                   GTFGMIPSNSAGSFSGDDSRRFGPARTNGHARGASSGIELPGPAASATFRRNVSGSHPP
FT                   IPPHSDDSYDSPQPGYAVASGSILPDGSGFTPGQLFDHNAINGGAPKASSEMREHRSSY
FT                   LRGDPGVLPRRASLVRDQAQQRSYLRGPPPSSSKNRRSRYHQNQPSTDSSAMRRSRIDS
FT                   VGPGTYRKSMFLPEGESAEFANGSQIRRTTSRNNDGSDPKPLRRVESIGKGEARRASRY
FT                   TPTNGSSRNPASVMPEDYHMPPAAHRDGGSSNGSVSPLGPLGPNDATYTMEQQQQQQQQ
FT                   YVSGDGVRMPYGAGFGGPTPRPSLPTTQISSPSLFASAAPLGAGLGGGMQPTSYAASRQ
FT                   IF"
FT   CDS_pept        complement(549545..551599)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12204"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595350"
FT                   /transl_table=1
FT                   /translation="MPVPETTSTALTGSQSSQVCVGAATGDLSLSQSISASASDLKRPD
FT                   SAASSNDESQLLSRTKTAKSHYGKAARAFLAKDVQTALLQSQHAADLLSSSNHLGSSLT
FT                   ASALLNGADLDLQKLVEKVAILRLTVFTQVYTDSQVAGSVRDKLVQVQKHSRSDAAAID
FT                   RILLLLAKQPPSLISHLWFEALRLCTQTSGEADAPSLDPTPETIHLAVELPASVVSSAV
FT                   LAALRLDALNPAARTGTNAARLIAEWYLASFSSAFGAAPPSPKAAAAYEKIVGLYSLHV
FT                   LASRLGEWEYAREFVGYSSLADSNKFDLLEQINEAQTHLTGQTEREQAAMASAQRTYAQ
FT                   ELAKRQEEEKHAKEAAAASASGGKGSSKVGGRARDLASGLGSFLTGNKDVSSETLSSSA
FT                   AGSKTSASSRSSSHATGESPSSSSGSGFEVGSRSRRQRSQSPTYFSPRNGATAESSSSS
FT                   STSPVISPGPTRSSASYAAKDEPKSERHSLHRTSSSRSSDYDGGNESSTSAASNHSRRS
FT                   TRSNGAETAATNAKEQRFKDDTGYASTRAHLSRYMEGYHRSDVSSSSSSNQKKPERELT
FT                   SSSSSWILSTITTLFDLRRKNQTRTWLASAMVMMLVFYRIARRAPAQSAATRTSGSGTR
FT                   RNAAARDARSKLVGKRSSTGGSMIGLDWLFVIWRKVMDTIKMGTQVTYL"
FT   conflict        550839..550840
FT                   /replace="g"
FT                   /citation="[1]"
FT   CDS_pept        552079..553266
FT                   /codon_start=1
FT                   /gene_family="HOG000012669" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02989"
FT                   /product="related to IME4-positive transcription factor for
FT                   IME2"
FT                   /function="methyltransferase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="methylation"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniParc:UPI00003C1B4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA74"
FT                   /transl_table=1
FT                   /translation="MLDDLAETEAVEAITSAFLSAPTAKQQLLTKLMKSTDNRFQEFCL
FT                   HLTRRDCPHGKTCHKLHFKPVLYPQTEPSYGHCSYLNTCHRTTSCKYLHFQLDTDPPHP
FT                   AFVFQTTDPRHAYAPDSEEAQHIGLIHPSRTLQEHGLDQWIRPSSPSACLQEAQWIDCD
FT                   LKNFDYSMLGKFDIILADPPWDIHMSLPYGTMSDDDMRSMPVPVLQDEGLIFLWTTGRA
FT                   MELGRELLAHWGYTRIDELIWVKVGQTQRLIRTGRTGHHLNHTKEHCLVGAKIRPTTQA
FT                   ATETARSSNPIAGSTQRYIGSRAAGVPPPLPEWVHCGINADVIVSEVRDTSRKPDELYS
FT                   IIERLCPGGRKVELFGRKHNVRKGWLTLGNQLKSDRVLDADLQKRLNDFRARGAQ"
FT   CDS_pept        554071..555039
FT                   /codon_start=1
FT                   /evidence="4"
FT                   /locus_tag="um02990"
FT                   /product="conserved hypothetical protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00003C1B4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA73"
FT                   /transl_table=1
FT                   /translation="MTGLSLAGRTAFITGGSRGIGLEIGKSLAARGANVVIAAKTATPH
FT                   AKLPGTIYTACEEISAVAAAAGSSNSTAHPVQLDIRDASAVEKAIDDVAAKFGGLDMVI
FT                   NNASAINMTPTVNSSVKSYDLMNSINARGSWLVSRFALPHLLRSSDQGNNPHILTLSPP
FT                   LTFETLSTTPGAANPAPAIFPHQFAQTASAYTIAKFGMSLLTLGLSAELLGKVAVNSLW
FT                   PYTLIATSAMKIVSKDAAVQERKWRNPQIVADAAVRIVQENAATFTGKFLVDELYLRDK
FT                   GFSLQDLYKFNVDESTKLDDLAEDLYISQPLRDAIATSRNA"
FT   CDS_pept        join(complement(559122..559407),complement(555273..558973))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10343"
FT                   /product="conserved hypothetical protein"
FT                   /function="nucleic acid binding"
FT                   /function="protein binding"
FT                   /function="zinc ion binding"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI0001595351"
FT                   /transl_table=1
FT                   /translation="MSAAVRAALAAKRAEHRSRSSSPTKSSPALPNDDDQLPHFGRDLD
FT                   ASIASPFGSPKPTPKPWKSAHAQPTSTSPAPGMDLNQKSEADVIRLSIQNGKVNLSSRS
FT                   PSLREVPELLLSLLADEPPSWFLHIPQDDRQPWYMREELHTLQLSNNELQSLPDKLGEF
FT                   RGLKRLELHSNKLLTLPPPLFQLSALTTLTLAKNGLTAFPTCLLALDNLVTLNLSHNKI
FT                   QTLWNDQQLASARSERQAWDKVNAAQENSVWAGLSPSKKDRKLLAPASEAHANTAMRSL
FT                   RSLDLSYNRLSNAALGIPDLANRRRNKPADVSSAESSLVHLPTGLRTLNLGHNMIRGPV
FT                   SVTLFQHLASLEDLGLQGNGIGDDVLAPDNAADADASCQVFPSLSVLDLSGCELDDLSK
FT                   VENFFGSRRIQSFDQAMGNVDAAPSSHGPVAPAPGMQARQLVRVRNRPTSADVVKMTER
FT                   SNAQVLCLLLEGNPLREEAFRQKRGGRSASPEKKSANAATLGTSVSKPNAIAQAPTTNA
FT                   PSTPPTIPTIPATVAGVSQLPPKPKVVKEDWEILAESGLNTELGRRKLRIEQARREQEA
FT                   AAAAAKEADAAGGDDVQGRGRKPCAADEAVSSDPDGGGSGAESKDRAMSHNRGESVDDK
FT                   DTGSALANAKLSSKKKEALGQVPCKFFRSNGCSAGASCPFAHTLPGDGGQKSVCQWFLK
FT                   GSCRFGHKCALAHVLPGQPMSMDRKNKRAAQHGQPLPQTPNQQHMAGPNAGMQSSLPHS
FT                   MQPGQPKAGQMPSSTQQRQASVQSVQQQAQNASQLPLSPPKGTPTRNDLVPGQAVSQLA
FT                   PQLRNRKTSFTTRDHDLPFGIPDDFQTSASTASAASVAIDPARAGFEGAQDPSLSTSFA
FT                   GSTSFQRRSTLSQSLSASLAAQTFGGMDSAATTFGTSTSASRAFGTSPFGHPSGHSLFF
FT                   SGSQDEEGGAGPLTRNNRDVFGARSMGRIDDAAKLWGGISAGANAQPIVSSRVEEEMED
FT                   AEDFLPSSLSDLLTPAELERRRRSHRLSSSFAGNDERVTVAQSMPSQAAQTFGSSLGFG
FT                   RSAIGAERAKSSNLSTGFQQQQQQQQPGKNDDLSPIGSGRRISGIDSIAFRESRSGLST
FT                   SASRSAAHHAPGQSLPQGLAAGLSRLHLRTGRPGDAGTNLVGGGGYGTIGSGATNDGAF
FT                   SQNSQLGNGASGGLRVPGSLDEYGLGPTAPSSVLPHRSPLSFAVGSATGGMSGSRLSGS
FT                   FAERQLGNGTFGSPGSGSVGSPFSPPLSAIGSHRAAGVGEGGIAIPDGDSQMHASAMGG
FT                   IRYAQHPATQRLRAGSSAAAPHSPLTLPVVTAEEDEEEAIFELE"
FT   CDS_pept        complement(560569..561936)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI0001595352"
FT                   /transl_table=1
FT                   /translation="MSTYGTRRLGRDVPALASSRRRRDAETEEDSDPQDVQLNDPQEAA
FT                   HSDQRAAAFMRSYRLITVNDTARKQAQQIGDAEIKKKAAELVRYALACEYQRTSIRKED
FT                   IRTKVLDEKTSRLFGLVFNAAQEMLYRTFGFHMVEVRAKGADNAELTRQAQEVLRAAAS
FT                   SANGLRSREKQPDESCATDGGLGTNIWILQSAFSPDLIKELVSVDDELTKAYASTSEPT
FT                   WTSDRRRQAASLAKSAVDWKRADRQDGEMGLLYVILALILVNGRTITDATLHMYLRRIH
FT                   LTSHTPLPAALRGTGPAQGSGSTGSQSTQTQSRARATQGTLEGFMNAMIKQSYLEKQRS
FT                   DIGIDHMTAAVNQAQAQGRRRGRTSGAGGRANNADDESTVWEWRWGSRAEAEIGEKKVA
FT                   ELISLLFTDPSVAQDGVQGAEEEDEETQAIDQDRLAKRRKMLLTNIASVAGSQLID"
FT   CDS_pept        563672..565162
FT                   /codon_start=1
FT                   /gene_family="HOG000203962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02993"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI00003C1B52"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA70"
FT                   /transl_table=1
FT                   /translation="MLRSLASTLRSRSIRIATVTMLLWTLVTYAAPAPIDRPGYLPPEA
FT                   HTPSESTQSSLTQQKWIGLTLAISSSLAIGTSFIITKKGLMDAADRHNGLASDGHTYLQ
FT                   NPIWWAGMATMIVGEVANFAAYTFAPPILVTPLGALSVLIGAILASFILKEELGRLGKV
FT                   GCTLCLVGTVIIVVNAPEDKEIQTIDEMLNYALQPGFLIYCTFVLGFSLFMIFRMVPKY
FT                   GRKTPLVYISICSLVGSISVMSVKGLGVALKLTFAGSNQFTHPSTYCFAIVVVVCILTQ
FT                   MNYFNKALDQFSTNVVNPIYYVFFTTSTILASVLLFQGFNTSTAPAVSLLGGFIVIFTG
FT                   VYLLNLNRIIDPVTQQPRMSLVTGEGTTRFSEQHERLLDQQRAMSSFANGRTSLSGPAG
FT                   RSATVFGHGRRSSAGSSVLFNAYENEEALGLARLDEDEYDEDARDTSPMFRPAKTHSAR
FT                   AHDVNGHAPSGEATARAHRPNKRQSLIDDSTPHYETGK"
FT   CDS_pept        join(566080..566795,566882..567068,567150..567620,
FT                   567728..568465)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02994"
FT                   /product="related to ELAV-like protein 2"
FT                   /function="RNA binding"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002343"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003C1B53"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA69"
FT                   /transl_table=1
FT                   /translation="MIPRSDRVIFHLEPSPEIKAKNASPPSLANMETKPSEASSGTSAT
FT                   RWNSSKRIAIAKESRKPRVVAPATPWRSRTSHRPPSTAADEHHFSPLDRKAAGSTLKLE
FT                   LGAKSEPVTVSSAPTSATLVAGGEKERQSAMEADAYRHTLQPVAPTMERGEEWRSDRWR
FT                   LLRPEPNSAADSFNRHVHARTDAYRQDQAAFNCPPQRTGLGVGSAAYQASARSAEMCWP
FT                   SDKNNETNVYVNGLPEEMNDHMLYLLGSACGVVISHKSMLDRQTGLCKGFGFLMYASSE
FT                   MAKKAIQWLNSHGFFASFAKESFSARLRRMADTSSTNVYLSNLPLKFTTQQLEQLFAPY
FT                   PIASLKILYDVHGESRGVGFVRVYDRATAKECIDRLHGRMLPGTTLPLQVRFADSEAQK
FT                   HLKHSMSQKHTLESLGLGPFVAGDARAVGDHALQYPGIERIRSASELDAAVAHAQKMAK
FT                   SKARLGTQLPTHPMWARTHVVGVHSPGMAPHLGFNSTGMMPSEESAEVMYAGPKGACTF
FT                   GRPLAMSPLVAGRWEQSNGLGGLPKAFIPPPGLTHPANAVQYLQDTGSLLAEETCDDRP
FT                   DTTKPLHGGSRHLRHRNRQASARVRCSANSGADATQRAVSDPMAMLAAQTRIREALGLR
FT                   ERVRAAVSADNSIDEAQHAIPTNNDGCMRRSESISSIDQDDGGVDNDDDVDSCVEDDSL
FT                   SVELLINGA"
FT   CDS_pept        join(569691..569895,570353..>570948,<571051..573471)
FT                   /codon_start=1
FT                   /gene_family="HOG000167495" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um15001"
FT                   /product="related to CHO2-phosphatidylethanolamine N-
FT                   methyltransferase"
FT                   /db_xref="UniParc:UPI0001595353"
FT                   /transl_table=1
FT                   /translation="MATTESIGAVSSDGLRNRLNPTVRLDDSPRSDSTVLAGATSDQDP
FT                   HDSKDNLSSHQHTKVLGRTPDGTVFTVPHTPDMLSSIFDPRQPKTPLDIVTVVSLSLQI
FT                   LLYFALSRRAAQIFFLLYFSFWRASYNAGLGWILKQQSEKGWIIRHVKQHGWMDANRRP
FT                   RVHNWIKQQLVTKMDVDYVFDAMPLDYNVWLMFRSIVDVILLNDFFAYSLFAFSCTRLP
FT                   EGHSVVMHILRWMAGWTFDLFTSGSDRRSRVVKTTLGMGDCFFLCMYSIGYAGYYGLSL
FT                   VSGSYAVLFVSLAAHFSQFLFMTFFEGPHIERTYGERKPIAARVPLRQAPFNAASRKAA
FT                   HARQDADTAPQTYSDDSVKIEERTSAKRTQQPHSTQITHDMELETPTPSQTQGSTAMTT
FT                   EDEASDEGHSRAFKRDALRASSSSNDAIKQHLLDKQQRPVTTLHDLHHRIFRKDTVVFR
FT                   NLDLMRANDFLLVISSIYALFPLLLPALSQTPRITLLFINALAWRTFHSFGLGFALSRQ
FT                   SESKWIVRHFLKHYHYAQPQDAVFEAFTHWKVVYNTSLVMTYISFGALAWNCYAPIGHS
FT                   DWTVGPELLRHTLGLLLVALHVWTANSSYEVLGPFGWLYGDFFVDEYPHQLYYTGIYRF
FT                   LNNPERSMGGAAFFGLALVSGSKLTLLMAIVSYIAHWGFLSYVEGPHMRKLYGEAALRK
FT                   DSGLTKQLKSQWVAAKDSDLFRLAQEHPTIRNFQGTIEKVQRDASEAFEEFFRQSRPRF
FT                   EGMLEETKVLLQQSKDRLLIVRVQDDQKLRSEGIDKSKYSLKVIRAQSTDDSTTPRFHL
FT                   GEPIAVEWKAAPNHSRRDWIGLYLLSRFGGKQGADEAGLVTKISSQGKWLGVAEEEWVG
FT                   DVHQGSAHVSGDVTAEGVSVFRDSKLPWVPGLYEFRYHHDAKHNVFARSDPIEIYVGSL
FT                   PADASTAKSADVIDKTADIIRTIVRYSAATTRPLRLSISQPATQRVLSSVSSSSIPEDA
FT                   LDDSSMEASAPLVNPLNSIDAADQDDFAIWDREQATRISTAIKCAFNIELSPEVIIAEA
FT                   NVKRLARDVVEGTRVLQPAFAPLMG"
FT   gap             570950..571049
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.101-um_contig_1.102"
FT   CDS_pept        complement(573722..577735)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02998"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniParc:UPI00003C1B57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA65"
FT                   /transl_table=1
FT                   /translation="MSESLLGVILATSSSRGHHIVFRWPNNPKLFKRYSKVKYYTESRP
FT                   SHSNRAHLEDELDPVRQKARWDHHDEDQDENGNIDSDDAGQSDTPSSSDVDESDGSMPD
FT                   DDDNRSARDRAETVASHDRSKTGAARSASRSKSKSRRPLLSMEEASPSVRSTDRQTGAL
FT                   KEAPDANDRAPDSEAGTSKELSPEEKARREEKAARAYKTYLGYDIDILASILNPRPELS
FT                   HKKFELVIDDLAFLGHPVTPNKNGVWGDQDDESQDDRVEARDEKTAAHAQQRGRSGLRK
FT                   EIRPYDPSDDRVASNDKIDKSAKTGAKSRNASLTRIEQTNDIPTSRSKAPLTQFHLVLI
FT                   LDRPDPSTAVPGVDLSSWLQLFYDNIVFKMTAALFAEQSKSDYVGRETEKLLALRERCM
FT                   DDGQAYAAYAAQCLGISSLARCIRDLHKSISISSDAFLTINDRIEVHLQLPPILQDPSS
FT                   LAKTVDIETELDPNDPIFLSGGGFEGLGKEGAHQDGSGGTYKRRMAMTPAQLSFEEWCR
FT                   TTGPYLLPWKTLLLLHDQVDEAPNRERAKSDTCSPAGLASPGEGASQALEAHGFDQLAR
FT                   KFTSFFTPSLYNTPNFSQVADMLGWDLYDDVYPMVRHLIYYRQARVIDVPRPGHVYAIS
FT                   PLFDFARLGSLSYNWAQTFPDVAPLPVFLSQLSSSTSRTLSNLFPARHQRELALEVLIW
FT                   LLRHEVVVKMHIRLRLIATESVKRRTAERRVERHERHRARKEKKRQRAAELEARRMRKS
FT                   QSEEQQRRRAAEQAEQAKQADEQQAQGHQRLTEERGRSRDRERSSSGEARQLGSSERKE
FT                   QDDDAAGRVDAAEGDVQTSGLSVSRPPILADPDSVAQASAIAAAAVGSGGEVRRSGDHE
FT                   HERQHHHHHHHQHAPQHRHHHRRHQNTSDPITGTDSTAAPSDKAPIPIAPRSQFDELKF
FT                   ERRPVLRSRSPSTAMAAGASAGLSVSFSNLSERGEITRRARADTTGSSSSGGGLRHSRT
FT                   RGDAISMTPTTSQHSRPSTPNVVGRIIPSHVRDRSIGGGGSNVSSSAEGGSVPRRARRT
FT                   TSSAGWGGRTGIPRSRSPSRARMRVKGFGADAEVEIDDDDDDGDEREEEVEEVMAMDED
FT                   VEPQDCGANELASELDLLCLDKGGKSERKKRRISSASERPELPPPSESHGSEGGNKSRS
FT                   EGVLSSSCSTSSSGVTTLSELSLSSDLDSEAVDSNLDSNVHESQYGQTHRPSPLSSTSI
FT                   SPTSPTHTHRFGNHSRISTHSRATHAHTPRGSAYSDSLIVEPARASRRENEYIATMVEN
FT                   KDATTTKLFFRLLPYLNGKHTIDEIEYRVLMRRRHIRRLLKTFRESIITFMHP"
FT   CDS_pept        join(578450..578610,578710..579358)
FT                   /codon_start=1
FT                   /gene_family="HOG000158234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um02999"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniParc:UPI00003C1B58"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA64"
FT                   /transl_table=1
FT                   /translation="MALEQALFLDSAIRDWVLIPILVVMILVGVLRHNVITLLNSPPKS
FT                   ISAPALREQRVMARAAALRQNYFQLPPTSFASRKAFLTEALSSGKYLQPRDKEEKEGSK
FT                   NPFEPAGGMEAMMEPMKKQMVMMIPQTVIMGWINFFFSGFVLLKLPFPLTVRFKVMLQR
FT                   DIPTPDLDVTWVSALSWYFLTLFGLNAVYRLVLGDDNAADGTRDMAAMSGAAAPMQAMN
FT                   PAAPGQAPDFEKLHHAERDNLELVGLEDSSVRWIGDGIEDRVLALYS"
FT   CDS_pept        join(complement(580224..580763),complement(579548..579958))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021036"
FT                   /db_xref="UniParc:UPI00003C1B59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA63"
FT                   /transl_table=1
FT                   /translation="MAFASRSSAFSAIRQLGSGPAVASSSQSVVAAFSTSASSSYATPT
FT                   ADATARKPPYSAASEASPAPTDLNAIGRGRKSAGRGRPKMLAPFDEWIQSDARAYKQPK
FT                   PGMGPNWIGDTPFPLNPSFNPPAPIRQSTKTEIWRLHASDPKEWTIRALSEKFSIGLQR
FT                   TEAILRLKALESEWTSKNKPLQSEFQSNMDRLLGAQDRKRMPESEPSVQSTSKSMRGAQ
FT                   HEEFSEADSLDAPSVIAPAMAEESLKRASMIAALPSGGPDVDAKSSTKVIKTQRAPLSI
FT                   TKVSGDSYKGAGRVERNVRRAEKRKGPKAHARSNK"
FT   CDS_pept        581501..584164
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03001"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1B5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA62"
FT                   /transl_table=1
FT                   /translation="MVTVGIPGTTGSGSSMNTRICKKLVVKGHASSSGATYTLFLKIQL
FT                   PATERGETHVLIEDSAAELQEAIVHLLDASGAAPTLSASAATAASALRIPLSIRHDLNE
FT                   SLIEYELRERGNAGSSSSSSEPSDLPTVARSDDGKITFRTTNRSSPRSKHKSASHPTSS
FT                   SYMVTLHLYTKPLSTPPTAPFSVKLAVPVCLNNYLRFTVDESIDSDFGLHGMAVEVDPP
FT                   ILPIPSQRRPLRRRSSTASSRRPSSIVSHSDDEADLTLLGSDSGDEADPEHDNTAIVGP
FT                   FHACKALILRMASQQAGDFVICHHPLYLLPNALRAEQGQSWIRYQLFRKAGDDSSDNAA
FT                   LRAYFVAKLKLDKPYFPGLDREVQLYIQLGSDLSILEWRPVKVDASRGILSWSFGSLAS
FT                   LSPLKSQQPNGAVDTNGDRVSGFEIGDLVVLPEPSQQAADEEDLLSVAPPKGIDNINLD
FT                   FSVDNGAAPSAKKRRFSLQSSSSTRHLPSTPPSEQSESALGNNNVLAITLNLLPVLQGS
FT                   EPLSVSVLGTLMLTPALSKAIRSRDFSDLPRGLSAPAVANLTKGPFDVALVDAKQDQWP
FT                   DAAKPNESLVDSRETVQKSQQEGKTGLVLHGTSATNAGEVEEILQQSQQEGKTGLVLHG
FT                   TSATNAGEVEEILQQSQQEGKTGLVLHGTSATNAGEAEEILQKALAIIAAHNEILSKAD
FT                   RGANSLTKQEHSKQGRQESGSGWVLHVSHLLWTLFLTAMILMLFNAGQTAHRTLSAKLD
FT                   ELSRLLQVPPRADVQSFVGVVQHTRPEPAVFEPASTAASASASALASEPQRSEAFGVHE
FT                   LDDAEMLTSASTPSWPDHAAEPLSDGPHTTASLDTALQMRTLHTSLSSLASTWIHDMLR
FT                   IPLSIIHRLWSILVRA"
FT   CDS_pept        complement(584590..585429)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03002"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1B5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA61"
FT                   /transl_table=1
FT                   /translation="MAPLHSRAPVAPQLLELPLQLAIVAFSVTLLGLTAWDYSRWQILK
FT                   EKSRINNFVELQDNGMLTVVFASMIVSAIGFAFGNLAAFLACLQFPKRRGERTGKGTYG
FT                   YVLVGLVELILSGAYLGIAAAITAFSVQRNPSFVRGPNFSEPFSENQRVFLRSIYEMFK
FT                   NGQNGNPATSTTQNLAALGPWANITTLQQANAFLDQNRYLNYKHYRVTTAIAWVTLATT
FT                   FFVMVVHFALPFVLKALGMTRPPKGQPPARSASRAPVGYGDKRNRQAGYRREEYDDY"
FT   CDS_pept        complement(586754..588691)
FT                   /codon_start=1
FT                   /gene_family="HOG000182736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="gup1"
FT                   /locus_tag="um03003"
FT                   /product="probable GUP1-Multimembrane-spanning protein
FT                   essential for proton symport of glycerol"
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="C-compound and carbohydrate transport
FT                   FunCat:20.01.03)"
FT                   /note="lipid/fatty acid transport"
FT                   /note="proton driven symporter"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI00003C1B5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA60"
FT                   /transl_table=1
FT                   /translation="MTARHQNGSNTYPPVASSESRHPTSSPVPSHPTVRKLLGSRGIAS
FT                   LTIDTGSLSAQAANKSATATAVSSNMSTRASGHVKRGRWHTLEFKFYYLVFAVAVPVMV
FT                   YVPVSLSRPSNPNFYSYSGHLKPGWIAGRLRDDSDFQYRSFRDYVPALIGIMGVYLLLS
FT                   KLFTLLPSSGNAQYTRIGNSNSNSNSNSNSNSNSNSNSHSPAVAAKPNRIAFLTVFTAI
FT                   FLFALHGFNSLKLLLILAINYGLTKALGGARVAPAVAFAFNIGALFAVHWNDGFEYSRI
FT                   SPALSVLEVFKGLLPRWQINFNITMLRLVSFAMDYHWAKREADAGGQAGRGMSEVVREE
FT                   REATYRERTRLTQHLEEYSVGKYLLYALYPPLFIAGPIMTFNDFASQLGRPCRIETGTV
FT                   VRYAIRFVVSLMTMELILHFIYVNAIKDSKAWVGATPLELSMIGFWNLIIVWLKLLIPW
FT                   RFFRLWAMADGVEAPENMVRCMANNYSTLGFWRSWHRSYNLWIVRYIYVPLGGSRNQMA
FT                   STLLVFTFVALWHDLSLKLLAWGWLITFFIVPEVVARKVCSYSEYGDRWWFRHLAAVGG
FT                   VGNVLMMMTGNLVGFAIGTDGMRYMVEQLLGSTQGVRFMLGACATLFVGVQVMFEYREE
FT                   ELRRGIDRKC"
FT   CDS_pept        join(589179..589184,589280..589612,589707..589817,
FT                   589942..589974)
FT                   /codon_start=1
FT                   /gene_family="HOG000185227" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="aps1"
FT                   /locus_tag="um11937"
FT                   /product="probable APS1-AP-1 complex subunit, sigma1
FT                   subunit,18 KD"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="protein transport"
FT                   /biological_process="transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /note="assembly of protein complexes"
FT                   /note="cellular import"
FT                   /note="intracellular transport vesicles"
FT                   /note="protein binding"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="vacuolar/lysosomal transport"
FT                   /note="vesicular transport (Golgi network, etc.)
FT                   FunCat:20.09.07)"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR015604"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI0001595354"
FT                   /transl_table=1
FT                   /translation="MAINWILLISRQGKVRLAKWFTTMSPKAKLKITKDVTQLVLARRT
FT                   RMCNFLEYKDSKVVYRRYASLFFVTGISQGDNELVTLEIIHRYVEVLDRYFGNVCELDL
FT                   IFNFQKAYAILDELIIAGEMQESSKKSVLRTVSQSDSIEEAEQSEDSLARIGSRSG"
FT   CDS_pept        join(591843..591935,592239..592313,592598..592798)
FT                   /codon_start=1
FT                   /gene_family="HOG000141680" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11938"
FT                   /product="conserved hypothetical protein"
FT                   /function="oxidoreductase activity"
FT                   /function="sterol binding"
FT                   /biological_process="metabolic process"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /note="lipid/fatty acid transport"
FT                   /note="oxidation of fatty acids"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniParc:UPI0001595355"
FT                   /transl_table=1
FT                   /translation="MSDFKSKALFEQITEGLKGMDDKEKKDIQKKTNGCFEMHVKNSKG
FT                   EELVWTIDLKKNAEAYEGKAKGKADVTINLSDDTFIDLADGKVNGQKAFMSGKLKVKGN
FT                   IMLATKLDGVLKSQKAKL"
FT   CDS_pept        594158..595180
FT                   /codon_start=1
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03006"
FT                   /product="probable Aldo-keto reductase yakc [NADP+] "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="biosynthesis of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /note="catabolism of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00001D8579"
FT                   /db_xref="UniProtKB/TrEMBL:Q6TRS1"
FT                   /transl_table=1
FT                   /translation="MSIPTREFGKTGEKVSSIGYGGMGLAAFYGEPAPQSTVDAILDKC
FT                   LANGVTFWDTADMYSPVKSRRLGYNEEQFGAYFKSHPEARSKVFLATKFVNRVKENGER
FT                   FLDGSPEWCHQACNDSLRRLGVDQIDLYYAHRSDPNVNVTETVRAMKELKDQGKIRYIG
FT                   VSEYNLEQLEAANKVAHIDAIQIEISPLTPEALTNGILAWAEKNGTALVAYSPLGRGFM
FT                   TGQYKSVEDFDEDDYRRFSPRFQGENFQKNLELVSKIKKIADKKSATAGQIALAWVLQK
FT                   SPIIIPIPGTKKEKYLDENINSVHVKLSDADVAEIDDVINSFEVSGTRYAPESMKVCAF
FT                   "
FT   CDS_pept        complement(595834..596940)
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="rbg1"
FT                   /locus_tag="um03007"
FT                   /product="probable RBG1-ribosome interacting GTPase "
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /note="GTP binding"
FT                   /note="TRANSCRIPTION"
FT                   /note="cellular signalling"
FT                   /note="fungal and other eukaryotic cell type
FT                   differentiation"
FT                   /note="protein binding"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI00003C1B5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA56"
FT                   /transl_table=1
FT                   /translation="MTTVQKIKEIEDEMNKTQKNKATSYHLGQLRAKLAKLKRELITPS
FT                   GGGGGGPGIGFDVAKTGVASVGFVGFPSVGKSTLMSGLTGTTSEAAAYEFTTLTSVPGT
FT                   MKVHGAPIQIIDLPGIIEGAKDGKGRGRQVIAVARTCNLIFIVLDVGKPLKDKAIIENE
FT                   LEGFGIRLNKKPPNIVVRKKEKGGIAITNTVPLTKLDHDEVKAVLSEYRISNADVSFRQ
FT                   DANIEELIDVIEGNRIYVPAIYVLNKIDSISIEELDLLYKIPNSVPISSQHWWNVDDEL
FT                   VEKMWQELSLVRVYTKPRKAAPDYSSPVVLKTGRSTVEDFCNAIHKEIIKQFKFAMVWG
FT                   KSAKHPRGQRVGADHVLEDEDCVTIFKR"
FT   CDS_pept        join(597532..597560,597656..597920,598012..598065)
FT                   /codon_start=1
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11939"
FT                   /product="conserved hypothetical protein"
FT                   /function="heme binding"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI0001595356"
FT                   /transl_table=1
FT                   /translation="MMEPTTKPTHPPKDDPISVEELKQYDGTDESKPVYVAVKGTVFDV
FT                   SPKREMYSPGKGYHIFAGKDGSRGLGMSSLKPEDAVADYSTLDDKQLKVLNDWHSYYTK
FT                   RYNIVGKVAQS"
FT   CDS_pept        complement(598170..598925)
FT                   /codon_start=1
FT                   /gene_family="HOG000242755" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03009"
FT                   /product="related to pyridoxamine-phosphate oxidase "
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity, acting on the CH-NH2
FT                   group of donors"
FT                   /function="pyridoxamine-phosphate oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /note="biosynthesis of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniParc:UPI00003C1B61"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA54"
FT                   /transl_table=1
FT                   /translation="MDVNVRATDATTTAITSHNQYRTSGLELDDLSPSPIVQFNRWFQH
FT                   ANENGVTEPEAMTISTVAIENGVARPSSRVVLLKQVDEQGFLFFSNYSSRKGRELEANP
FT                   YASLTFYWKQLSRSVRVCGRVEKLSAQESKAYYDSRPLGSRIGAWASPQSSTIVSRQEL
FT                   EDKVKEVESKFRVPGAAGLDEANKWQGDEKRVDVPLPDFWGGYRIVPDEVEFWCGRPNR
FT                   LHDRFRYTRSIESQVAANEDKWSIDRLAP"
FT   CDS_pept        complement(599693..600826)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B62"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA53"
FT                   /transl_table=1
FT                   /translation="MPARDQQVPELSYLPTYTQTRPPPDSGPPPAYANVIGKVYPYSLR
FT                   PVLLVTTFCTVLYLLLVSISNFKDIGHTGNNATMNLFDILTGALLMAVALFEVLGFVGA
FT                   LKANLKLATLYSKLTLPGFALVIACEVLNIAGHYMFKSRIIDDCIARNTGTVASSSGYN
FT                   WLGQSISSTVMSPQDATNYCNSSWRYDSTWQIVWLVVTILFGIPFVMFSFAFVRQLRDP
FT                   NSVRVRESNFGWWQRRHHQQPPSAQYANGYNSAPYDPQSQAQAYSYPPAPYGSGPYSAP
FT                   AGPPPGAFSTDGHRDLPGYERGDIEGDFDDDRKSPVTSPTSYGYSGTGRPSTSRDRDAR
FT                   QNDAAKDSQVTIRLDDDVDTKSKGHGRHSHDDDTPRI"
FT   CDS_pept        602078..603853
FT                   /codon_start=1
FT                   /gene_family="HOG000064644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03011"
FT                   /product="conserved hypothetical protein"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /note="RNA binding"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI00003C1B63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA52"
FT                   /transl_table=1
FT                   /translation="MAVKLFKNAIFFTAQAQELEAASLLKQDYTDPAALANRFAECIAV
FT                   DDSKLAYVGDEASIPSELKECAEVVDLGGGKLVVPGFIDGHTHLLNFGQSLDKVDVGKC
FT                   KNLEQIQQKIKEAAEAKPDAPRILAAVWMQNTTDGKALASWIDQVVPDRPVYIESFDLH
FT                   SHWCNTAALEELGITDETPDPEGGKIVRDLETGKASGLLLEMANILFVWPKLANLASQQ
FT                   EQEASFMRACNSYHESGFTGGIDMALDSLSLDCILRVKEKRNGNLPIRVAAHWLVRPET
FT                   DVDACIEQVKHAYELSKKHNDEWFRIVGIKLVCDGVIDSCTAALKEPYYNKTNAELMWP
FT                   LPLLSSVVQYADSVDLQVAIHAIGDLAVHTAVEAIATLGDKLADQGLSIRDRRHRIEHL
FT                   ELTDPKDVEKLGKLGITASIQGVHCDPSIMEGWCKMIGDPYNEGRCARAFAFREFVEAG
FT                   APIALGSDTPTAHHWILPNLYTAVTRRSGREPDLDRRTTPQFALPLAMAMAAATYGAAH
FT                   SCKADTWAGTLEKGKSADFVVLDTNLFKEHGGGKKEQTILKTKILQTWLAGEKVYERTE
FT                   TGTTKKTGKTGCTVL"
FT   CDS_pept        complement(604116..604376)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11940"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI0001595357"
FT                   /transl_table=1
FT                   /translation="MRSHQMAAFFAVSLMMMVVLGALSAPIPSPRPIEDIYPSQLPDAG
FT                   TAQIVAGDSGILPTLLAVGFDPNDRSVLKPVKNSMTQRNTA"
FT   CDS_pept        complement(606454..608592)
FT                   /codon_start=1
FT                   /gene_family="HOG000209028" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11941"
FT                   /product="related to VPS36 protein, involved in vacuolar
FT                   protein sorting"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="UniParc:UPI0001595358"
FT                   /transl_table=1
FT                   /translation="MDRFKQIDASNSSIGALLLQDEEVVSLQDSIGLYDGKEKTLHQNN
FT                   GTVYLTSHRLLYVDDLEPHRYSCSLDLSLVKQSEYYAGFLKSSPKITLTLAKPDNGAEA
FT                   TTDNLNLQQQQQQARSAGTSLQTNSAPLSKTPSRDWRANAPAADSTPLDASGYNWICAI
FT                   CGFSNASTRSVCELCGVTKEPARSTPKRNLHPSQLREAARLDPFSSPAKPDSISKPQDN
FT                   AAFTPTKKKDDGIACDVCTFLNHPSMTKCEMCSSHLGSSWQQEQATALASATSLTAPST
FT                   PIRKSIEADAMSLRASTAPSRASTPSSAVLSSSNDFVKLSFRKGGDKAFYSVLKATLRA
FT                   KAWVSNMPGIGAGGSKNSEADSARATRVAAGMVDLDGRSAALKRVGIDGILSSVDSTSR
FT                   TQNDDMQGALKDLEALMRKAKQMVEFAESLNAKLTKQEQAAAAAREAGMPDTAPQPDQQ
FT                   AATLIRSSLVQLGLPAPAVTEDMARDQEEYHRQLAHELAGLLLGNPSGGRRSGLMGTGK
FT                   IAAPGKSSELLPRVSDDNLQGRGLVGLDEVWCVWNRARGVALVPPQALRSAATFLPDMT
FT                   SPSIHMKTFRSGLSVLHTPRYSDNAFTSRILHYLDTLEWEHKMKRIEQAQSLRISEPGS
FT                   ISAASDQTASTEEASYGDNLSPWGAGASILEIAEKEDVPILLINEMMDMIESKTGMVVR
FT                   DDGGPNGTRWFVNHFSRA"
FT   CDS_pept        609968..614182
FT                   /codon_start=1
FT                   /gene_family="HOG000076715" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03013"
FT                   /product="Protein TIF31 homolog "
FT                   /function="binding"
FT                   /note="cytokinesis (cell division) /septum formation and
FT                   hydrolysis"
FT                   /note="mitochondrion"
FT                   /note="translation initiation"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023231"
FT                   /db_xref="UniParc:UPI00003C1B65"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PA50 "
FT                   /transl_table=1
FT                   /translation="MDPVTQAPAPEGVDAPEIDESLQPFEINLYLPKRPLIPSAAASAN
FT                   GLPETPSPLKVAVTPQETLNDLRVTITDSPEGYWLGAFCFRKPLASPNSTAKGGKVQLG
FT                   ERVPEWTELREIFEGVDKDKRELHVTHVPFNEADARAHVQRLRDLLSGGAADPSAIGVD
FT                   AALSVQDAVRNPQEWQQDAARQNANGRAVTKKGVNDAAEASSELPLPLVDWAGWPSVTS
FT                   IDLIPQVARRPRQLPVCVRQLSLASWNPPPQHCKLNGHLLYLQVGTLEGEVIFVTASTH
FT                   GFYVNRSSGARFDPSPRPDGQDFASCSLFDLLCGFSPLFLSSFSKLFNDPLSSRDYFSA
FT                   VPVTNALPAFPWLARNHTHHADALRSQAAFLLTGATSADALEGTRDWNDELQSARELPR
FT                   TTLSERLMRDRVLNRIYSEFTQAAARAIPKVAAGEVQAMNPMDKRDAQMFIVNNLFISK
FT                   GADGVDLYPHMGGDEAAHVAVGKDVQGVKTLNSLDVGGLCLLGTIVVDWKGERWVAQSV
FT                   VPGLFRRRDDADELPEADGETTELAEAAPEKKSPEAKLAQSNKADLNDDTQVVYGGVEG
FT                   PEVIRDNAAFHKLFHQVAQTLHLNEHQVEDAKGIKHSLWLSVDSKGLRGADGRRYVLDL
FT                   ARLNPVDINWLENDIDGAIHGSSSSPNQDAHYPHRMTLLRPELLEIYWDSEFRKWARAK
FT                   LAARQEAKAAKDAKAKEAASKEDGEKTEAPEVEAEEPERLDSSEFKLTFNPDAFVEFKV
FT                   ADTLAEEHSKVITPITDESDASIAAVRQASDFLRKVAIPRFVTDVAAGLFTAADGGALS
FT                   RQMHARGINVRYLGYVARLCSPEAKQELDQELIQKAGPGHEGFLNAFRLTVLQEMVLRA
FT                   SKRVLRGLIRDVEQVNVAACVSHFLNCLVGDKVNAHPKARPSVTPLSDVADAAWTKLTP
FT                   ETLREELKAEIRKRFRFELPASFFEQELRRAQLLREVALRTGIQLQLQEYVLEGKLADA
FT                   DGVVSDGCHGESQTNGNTTNKKNSKGKKKGGNEQQNGVKKSNVGAAAAKPTKAARATSF
FT                   EPEDVLNLVPMVKDSTPKSTLAEEAFEAGRISISRGDRELGLELLLEGVSFHEQVYGLV
FT                   HPEVARCYALFATIVHHLAGVAAMERAESINQAKSENKEITEADLPVVNEHLSMANAVR
FT                   YQRQAVTVSERTLGLDHPETLNQYMNLAVLERSAGNTRESLLCQRRVLELWSLLHGQHH
FT                   PDCINALSNVALTLQNARLFEASLRVYRSAHELALTLFGADSIHTANLAHELSQAYTLA
FT                   GDLKTALAVEKEAWRVFEERLGKDDAQTKESEAFCSSLAASAVRVAKLEKEASERQARL
FT                   PASRRGNSNAGGGAAAITGAGTTASGNGTANKSLDEIVRFIQGGSNGSVAKAKGKSKAS
FT                   RK"
FT   CDS_pept        join(616725..>617915,<618148..621171)
FT                   /codon_start=1
FT                   /gene_family="HOG000209004" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um15002"
FT                   /product="probable 3-hydroxy-3-methylglutaryl-coenzyme A
FT                   reductase"
FT                   /EC_number="1.1.1.34"
FT                   /function="NADP or NADPH binding"
FT                   /function="coenzyme binding"
FT                   /function="hydroxymethylglutaryl-CoA reductase (NADPH)
FT                   activity"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /biological_process="coenzyme A metabolic process "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /note="NAD/NADP binding"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="InterPro:IPR023282"
FT                   /db_xref="UniParc:UPI0001595359"
FT                   /transl_table=1
FT                   /translation="MSTSSTSSFSSGASSIGISAQPLSLPKIMLRRLARAASQNPIEVI
FT                   VTIFIIVTLAYFQLLHAVTHSNFFEPISIEATSLASSSSSGLFKWAGSANRKADAVPPV
FT                   PPTSTLASDPDTVYIRKAGAANLWQPLTQLATDNGVEDVAALIHSSALSFFVEPVLLTS
FT                   ARESFMASQIQDSILPSLSNDLASNLVGSHASATLVQHADSQYSAFVFGKAFADSSESS
FT                   NADDTLPRNQFLGKVVDPSLLSKSLSKATRSVPKPAAVAKAPAAELDELYDGLRIVPLV
FT                   PDGEFNPYAPNNLKAKRGAISNQEEIQRIRWMAYAVKALVIRFWALLKKADSADIFVML
FT                   SAYILMHGTFVNLFLSMRKFGSNFWLGASVLMSSTFAFLLAIHLASLLGVTGDPICLMS
FT                   REESFVRALTERLKSEDSLRWAEPTPMPAHEIVVSAVNRVGVPIIRDYLIEIAVMAVGA
FT                   TSGVSGLREFCQLAALILLFDCIFLFAFYVSILTVMVEVHRIKVKRGVRKPKVSAELCL
FT                   DSDSAPASPISDSSTSRDQSPSPNSRPFWKKVFSVILGSARSEKRRKSENPLGRLKLLL
FT                   VASFLVLHSFNLISTLTRQSAITRHHATYEPSPYQIVANQSPIFAPAASSAIAPLLAQL
FT                   SQSQPDDLDLVARISEPIILVLLESNEVVSSSRSTLANAALNASGVYAQATSTGVRPVP
FT                   VGRGSSSLAVLDSLMSGWTVIVGDPVISKWMSLALGISIFLNAYLLKGIATGNAALSEG
FT                   NAAGAAAYAAARFIGAHLDSEAKAIEEHSERNRRRWSARPENGKPGVQTRGHSADGISD
FT                   YHNRLAQISATQASVPLSKLTRDNDKLASKPTSMTGAAVNAVPADAIKPDAMDAVKKHD
FT                   VAPSSDADGAVATPGQQGQQICLQDATYVTPDGETVVRPLEELVEIYAGGAGVFFLTDE
FT                   EIITLSQNGKIAAYALEKVLQDHERAVRVRRALVSRASATQTLETSLLPHRDYDYGKVM
FT                   GACCENVVGYMPIPLGIAGPLNIDGQFMPIPMATTEGTLVASTSRGCKALNAGGGVTTV
FT                   LTQDAMTRGPALEFPSVVQAAKAKRWIDSQEGAQTIKAAFDSTSRFARLSSLRCVLAGR
FT                   TLYVRFATSTGDAMGMNMISKGVEKALGLMTEQYFPEMKVLSLSGNYCTDKKPAAINWI
FT                   EGRGKSVVAEAVVPGNVVRSVLKCTVRDLVNLNTKKNLIGSAMAGSVGGFNAHAANILT
FT                   AIYLATGQDPAQNVESSNCITLMEAINDDEDLLITVSMPSIEVGTVGGGTVLPPQRSML
FT                   EMMGIAGAHSTTPGANAQRLARIIAASVMAGELSLMGALCAGHLIQAHMKHNRSVPSTP
FT                   GTMTPLPRPETPKHFAASMTPLVAPSVGQSTRGSPTGTRTMSMTNLSIPASDSTGRASS
FT                   LT"
FT   gap             617918..618017
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.102-um_contig_1.103"
FT   CDS_pept        complement(621264..621944)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI00003C1B67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA48"
FT                   /transl_table=1
FT                   /translation="MSHNHTHTGACGQHHDHDDDSHVKPDQGDQDLLYSSIDRDRVIAL
FT                   NESVAGSAAATIKSWQHRTDPQPELISDTDDQLIIHIPFTSSVKLSTFLFRPSSQPLLT
FT                   PSVIKLYKNLHDNSINFDDISSLPDTKIVTKLESIPTVQDTTQIINFPLHAVKWANTDA
FT                   ITIFVESSLGGQQSGIQFLGFKGKSSGYSRAAPQNIVYESAPQLKDHSKLGADSLSSTH
FT                   GFGH"
FT   CDS_pept        623239..627015
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03016"
FT                   /product="conserved hypothetical protein"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00003C1B68"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA47"
FT                   /transl_table=1
FT                   /translation="MTKAKEGIHHTHNDYYSENSPIPSVQRFFKKGLSEVIAKRQDPDS
FT                   DSDDGPEDADHIAGFGNQPPELSQSTVTPADDATEDQSRSSKKRFSGLFSTSSSSRHGQ
FT                   PSEDQTEETNQQGNSDDDSAEAPHQVPEKADKAYKRSRKPRKVRDPVTGRSAWVHDVGK
FT                   REYRHTLARAEAGDKYGTEQVLRFNLDNNVTSKSFPPPTPLPSSVYRIDSRLAPLFGIW
FT                   SILTLFRLVPGWLSVALNAWMLWWGWRTFLSHTEDYRWHRERQRGEKLRSFDQVEEDEN
FT                   HHATTQGIAEGAEWLNGILEALWSVMNPELFSSLGGTLEDVMQASIPSFIHSVKVEDLA
FT                   QGSTPIRITGLRILPDEKVGSLARDMRQETSERNSAQYETDRPSEHGKPWPEDVDQRPQ
FT                   KDNHIEADNDDEGGEYYVNLELGFVYRARPTAQGVGGKSRNAHLLIKFWIGARKLLMLP
FT                   LPVWVEIKGFVGKVRARVQLTSDPPFVKNVTFTFCGLPRVGIEVVPLHINTANIPFISS
FT                   FIESSIDAAVGEFVMPSSLTMDVGEMLMGDNIKREVSAVGVVVVFIHSATDLEKQDLRG
FT                   SSDPYCTLSLAKVGKILYSTRVVLNELSPRWEERHVMLITRENLESDDKVSIALWDSDR
FT                   FSQDDMLGRAEVSLVALAKHPNKIFRRSDTLQGLDRERTKQGVVHWSLGFLTKTPSMRD
FT                   VHKPLEGQVGQEDHASKQDNDTDEIMRDGHEMDDESVESHSPLSQENIDREKNTQTRNQ
FT                   ATNVDFEPPDPSLPSGILSVQIHHIANLEVADGHGSMRSRRKDEPGQDVENVEMEDDPD
FT                   RAPSAYCRIILNDEIVFQTRTKALNANPFYNAGTERFIRDWRRTLLMVVVYDFRVREAD
FT                   AILGVVPIKLSDLFNERSQVTRFFPLAGGVGHGRIRLSLLFRPIERTSRSKNRLGWNIG
FT                   TVRMLSSPVAMDFDESKGASGRDVHLVALRAATLAGSAKIAASRARYVDRESKAAVEWK
FT                   LNEAELPFKVPARRRYSAPFVIEFRALSALGKRKTTHMCIIWQQDLCDDEVVDMQLPIW
FT                   RPKPGCDFHRLRQNYHDYRNEDEADKLGVERIGYLHVKMQFKSGLGKVHTKFDNNPGAK
FT                   AVMDAWRCCVALGIRSVSGDFANSRINTAGYLEDNDDDDQVELGETDEDDTDQESEPRA
FT                   GKRVENAEDMEDADDAGENDEAGLQRSRSLKQKFADWKAEKDELHRQHKGIQQFKPVRT
FT                   MAWLGQSAKSTGSGLMDRLDLQDRRSQHVETEL"
FT   CDS_pept        complement(628695..630095)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03017"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1B69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA46"
FT                   /transl_table=1
FT                   /translation="MSLPSQSHTLSLPDSNMTQDDAMRDDSSARKYNKTSLQKRTPQDK
FT                   LAKDAASSSTATHFVPPGDAGQPYDPVAEYRRGRALTADNLERIPNADQLAPGIRLPGR
FT                   VIDSHGADTDMQTSSDADGGAQSLETGHTSVGAFGEGGASVPGVPPELDPRTPAFRPHS
FT                   PGEASVLSVAVQPPASPKASILEPSEPPSPFVEITPSRSATSDRYGILASSASATAGSS
FT                   SYSTSARGSSPPLSVGYAPSEAFNSAMRLGPGPSMLGRNVASVAPSEAGSVSSTGTGGG
FT                   GPGSAGTADDQEVALRAAYIERQRMRERELMGGEAGVGGTTIPTFTLPTRGSTPLAFAP
FT                   GLSARLGGVSGTAFDNVSRAGSTAATTGTNSPPLSPTGSEIPDAVASPSRRGSVDSTET
FT                   LGSMRAPPSVQGFEPGSGIESRRMSRGGSSVGFDDLARRGSEGGLITNAMDEDILDAGS
FT                   VRDEPQPL"
FT   CDS_pept        631037..632044
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03018"
FT                   /product="Protein BCP1"
FT                   /db_xref="UniParc:UPI00003C1B6A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PA45 "
FT                   /transl_table=1
FT                   /translation="MPTDTKRKAHDQEPTADSSDYDSDGSEEPDFINVDFDFRAPEEID
FT                   FQALKRLLQQLFYTHNTKLDLSSLADHVVKTSTTQGVGTTIKIVDDEDQDPYAFVSAIT
FT                   LSSEKKEGSEAANSLSKYLLEVTSKPSSKSVHDVIKSAASSTSTNAPVIAVLHERMVNM
FT                   PPQVAPPLYKMLLEEVQASLVSTSATRPSHYLFFSRVFSADAFSDDEAMDEDDDDDDDE
FT                   PSGLAGARKRKAKLARREAKKAGAKKDAPKSRTISDGMALAGSSDEELGLFHPEDIAIS
FT                   KFASNSLTYRFPPPPDASDSFEAPLFGRIALVPADKMDALLQQIETDLSMPAPQ"
FT   CDS_pept        join(complement(632706..633145),complement(632418..632589))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03019"
FT                   /product="conserved hypothetical protein"
FT                   /cellular_component="integral to membrane"
FT                   /note="C-2 compound and organic acid catabolism
FT                   FunCat:01.05.06.07)"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI00003C1B6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA44"
FT                   /transl_table=1
FT                   /translation="MSYRQAFSAFYARNFERRPWVTLAVTNGTLGVIADGVAQSLERIS
FT                   QAQSRQQQLEQEGRTDTATSQVSQADVSGWDWSRSGRFLAFNVGMAPLLAEWNKFLEFK
FT                   FPLRSSALATGAAAAAAASTASSMSKVSLRALANRLVMDQVLFAPFGLALFTGAMGYME
FT                   RGSIDGVKDKFGEMYIPALLANWQVWPLVQLVNFRYMPLK"
FT   CDS_pept        633723..634649
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniParc:UPI00003C1B6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA43"
FT                   /transl_table=1
FT                   /translation="MPPKRKAADATTPPDSFNGSAPQRIGHWLMKAEPDTRYERGHDVA
FT                   FSIDHLAACKITKWDGVRNPEARTIMKEKMQFGDPVLFYHSNTKIPGVAGLARICSKQS
FT                   YPDPSAFDRNHAYYDVKSDPEQPKWWLVDVEYVQKLQRLVPLGLLQKLAGKGADAKPLS
FT                   KVERHDIAYLKNTHLQAIKDMALLNRGRLSVQPVSKDAYDAVIALSEKGGWDSWTGKWN
FT                   PRAGSSTASTSTAASKTTTKKAGLSTAAGEPLQNENMSKTEPPSKRDTPATKARRPTPA
FT                   KKIKPEEPSQACITEGVRRSSRRRSGA"
FT   CDS_pept        join(complement(636834..636922),complement(635977..636337))
FT                   /codon_start=1
FT                   /gene_family="HOG000111598" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10360"
FT                   /product="probable 40S Ribosomal protein S14 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /note="RNA binding"
FT                   /note="ribosomal proteins"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="UniParc:UPI000159535A"
FT                   /transl_table=1
FT                   /translation="MAPKVRAAATNEVSLGPNVGEGELVFGVAHIFASFNDTFVHVTDM
FT                   SGKETVVRVTGGMKVKADRDESSPYAAMLAAQDCAVRCKEVGITALHIKLRATGGTGTK
FT                   TPGPGAQAALRALARAGMRIGRIEDVTPVPTDSTRRKGGRRGRRL"
FT   CDS_pept        join(637743..637745,638486..638731)
FT                   /codon_start=1
FT                   /gene_family="HOG000188979" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10361"
FT                   /product="probable 60S ribosomal protein L38 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="ribosome"
FT                   /note="ribosomal proteins"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="UniParc:UPI000159535B"
FT                   /transl_table=1
FT                   /translation="MPQQITDIKKFLEIARRKDASAARVKSTTRADGKQVTKFKIRCSR
FT                   FLYTLSVDDKQKAEKLKQSLPPGLNVVEIGKPVKGRK"
FT   CDS_pept        complement(639665..640558)
FT                   /codon_start=1
FT                   /gene_family="HOG000197570" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03023"
FT                   /product="related to Ribonuclease Trv"
FT                   /function="RNA binding"
FT                   /function="ribonuclease T2 activity"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="UniParc:UPI00003C1B6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA40"
FT                   /transl_table=1
FT                   /translation="MKFTATTLAVLAAASAVAAEPLLGQLEQLGQQYAKKGQELAACAK
FT                   AGFQLSCHASYDIPASSAGSCCFNGALVEGGKQSGLVLSTSFWTTNAADTANNGPKDST
FT                   TIHGLWPDYCDGTYPQFCSSVSGIPTYTGEQIEAVMQKYDPALYAYYQTYFKDLNGDRA
FT                   DFLAHEYNKHGTCYTTMRPQCQPQLPWISQADFAMLNYFRQIAHKFKERPTYNFLQAAG
FT                   IVPSATQNYTLAQVQQTLKNAHGATPFVGCNKKGEMNEFWYFWNVRGQVNFGLFEPVES
FT                   TTKSTCPASLRYLPKP"
FT   CDS_pept        join(complement(644426..645091),complement(641893..644349))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03024"
FT                   /product="related to subtilisin-like serine protease "
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cell wall"
FT                   /cellular_component="membrane"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00003C1B70"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA39"
FT                   /transl_table=1
FT                   /translation="MKFLSLAAAAASAGLLLLNGAAEAATSPAAAAGPKPIQGPAVAPN
FT                   APPTLKHSRGKVAQLEKINYLPRGYIVELEASSSKSGKRSDPHAEVHEHLAKRAGPYKT
FT                   RYEFDDPQTFVGMSVVLDSDEDYHSLVSAPGVKAVYRTTLHSIPAFEPVVVSEDFVKAA
FT                   TGKDAAATPNRKKRRDEPKNAEQGYKDTFSPHVMSGVDKVHEKGFLGRGQVVGVIDTGV
FT                   DYRHPALGGKPGNQPCFGPGCLVIGGYGFVDDKFNGTNTPVASSDPYDCQGHGSHVTGT
FT                   IAANSTLGFTGVAPHAKIRAYRVFGCSGSTPDDIIIAALQRAFFDGCDVLSLSLGGPGG
FT                   WSEAPSSAVAGRIASLGTPLAIANGNDGAFGMAYASSPGTGSNVMAVGSVQNKDLTGIS
FT                   ANVVPSTLSQKNVTLLQGSPFTFADGQSKVLEVYATSSSLTVTDDACSPLPDSTPDLSN
FT                   KVVLIGRGTCLFATKFANAAAKGAKYVLVYNSLASITYVTTDVAGQQAASLTRDDGLFI
FT                   KQQINNGVKVSLDFSNTRLATVPDTSTGGLMSSFSTYGPSYENKLNVPVVSAVGGNVLS
FT                   TYPLAKGAYAILSGTSMATPFMSGSIAVFQSARGKTSPEDLNSIFANTATPIKNATGDA
FT                   TLYESVAHQGTGLVDVNKALYQQIVLSPTAIELNDTKHFKGTQTITVKNLGSKPLAYTL
FT                   SHIPVGTVQSQEDDSIFFNLGPVAVSSNYASVRFSKKNIVVPPKGTARFTATFTPPEGV
FT                   RTDKLPFYSGYIHLEPQSSGYSAANIAYGGYKADTSQTQILDNTSELFGVGLPVLAAAD
FT                   GNTYIESDNTSYSLKDVASWPQFVYRLNYGTPYLQIDIVNATTDFQPTYNVDGSFNAKT
FT                   TSAAAKHKRFVHHRRQNAHKTPLPMPVPGAPLPKPGPGGPPAHGGPGGPKPGPGPAPKP
FT                   GPGPAPKPGPGPAPKPKPDQPAGVQFSDVKTVGMLGNGYWNGRNSATGQLSDNSYNVQL
FT                   VSPDLTLPQNGSTKLTPGTYKVLLRVQRVLTEGKLESDYESYLSHAFTVTA"
FT   CDS_pept        complement(647697..650588)
FT                   /codon_start=1
FT                   /gene_family="HOG000196498" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03025"
FT                   /product="probable DNA mismatch repair protein MSH2 "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /cellular_component="MutSalpha complex"
FT                   /cellular_component="MutSbeta complex"
FT                   /note="ATP binding"
FT                   /note="DNA damage response"
FT                   /note="DNA repair"
FT                   /note="cell cycle checkpoints (checkpoints of
FT                   morphogenesis,DNA-damage,-replication, mitotic phase and
FT                   spindle)"
FT                   /note="phosphate metabolism"
FT                   /note="somatic , mitotic recombination
FT                   FunCat:10.01.05.03.03)"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR011184"
FT                   /db_xref="UniParc:UPI00003C1B71"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA38"
FT                   /transl_table=1
FT                   /translation="MSGLMYDGPSSSEKPDLGLDNAAESSFCQTFKSMPKPTPGTLRLF
FT                   DRSDFYSAHGDDAILIANLVFKTHSALKYLGSGGKDNGGLPSITLSVAATKNLLREVLT
FT                   SRQMRVEIYGNAGAKRNNQWSIVKQASPGNLQQMEDMIFVDADIVSSPIVMALKLTTRD
FT                   GVKTVGAAFADATNRELCVSEYAENDLFSNTESLIIQLGVKECILPKDDKGVDADLKKL
FT                   REVIERCGVVMFDSKRADFSGRNIDQDLRRLLKEESCGLNLTELDLKLAMAAASALMSY
FT                   LALLTDESNFGQYSIRTHDLSQYLRLDNSALRALNLFPEPGQTGSSKNTSIYGLLNRCR
FT                   TGQGQRLLGQWLKQPLVNVHAIEQRQNLVELFVNDNSTRQLIQNDYLKLMPDMHRISKR
FT                   FQKGIATLEDVVRVYQAILRLPGLIQTLADMETPSEALSELLKTSYLDPFEAHRAALTK
FT                   FNELVEATLDLTELSQHNFVIKPDFDDNLREIKEALDDTRDKLDEQHRLAGKELRMDTE
FT                   KKLHLENHHVYGYCLRVTRTDAGLVRNKKGYMDIATVKGGLYFTNEALRDLANDFKDLS
FT                   ERYSRSQSGLVKEVIQIASSYCPPLEKLNVVLAHLDVIVSFAHVSDSAPVPYVKPVVSE
FT                   KGTNADVDLREARHPCLEVMDDINFISNDTEMVRGQSEFLVITGPNMGGKSTYIRQVGI
FT                   IALMAQIGCFVPAAQGARLPVFDCILARVGAGDSQLKGVSTFMAEMLETATILKTATSD
FT                   SLIIIDELGRGTSTYDGFGLAWAISEWIATNIRCKCLFATHFHELTNLAAQQPHVRNLH
FT                   VVALVKQKEGGSRQDRDITLLYKVQPGISDQSLGINVAELANFPPSVIALAKRKAEELE
FT                   DYDVDEQTASVLDSLPEDVTKQGAALINEFLKTWAERSGLVAQQGVWVGKETKRSRLEA
FT                   DPEAELQQLRQVVDEFRPRIEANAWAAKVLESF"
FT   CDS_pept        join(complement(651536..651578),complement(651351..651453),
FT                   complement(651059..651269))
FT                   /codon_start=1
FT                   /gene_family="HOG000224438" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10362"
FT                   /product="conserved hypothetical protein"
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="cell wall"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR016198"
FT                   /db_xref="UniParc:UPI000159535C"
FT                   /transl_table=1
FT                   /translation="MSTTSPLYAVADFCLIPMGTPTTSVGEYITECQRVLEGMQDQGIR
FT                   YEVHGYGTNLEGTFGTVCKAIELCHEAVHRLGAQRIATDIRIGTRTDKPPPTMDGQTEN
FT                   QRKKQSVIRRLAQE"
FT   CDS_pept        651826..654489
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03027"
FT                   /product="Vacuolar fusion protein MON1 "
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniParc:UPI00003C1B73"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PA36 "
FT                   /transl_table=1
FT                   /translation="MPQAPKSLSIDSDAAVVAAAAADDLVRASSPRPRTTTFTPSRPTV
FT                   LLTKSWTSATVLPSTTSTRITVGANTSTATDAASSISQHEPSTSSNSTRASTPLPELSP
FT                   SPFSPQTAVAEALTREQQPAGPSDDSQSRSILPHASDHSTPCNSDQATEVAFHDAADVE
FT                   PEAVGTTVSSSIHALDLLHRVNDRAAAERASNSESLRSHLSRLSVSRASSKHRSRSNSR
FT                   DASTQTRALPPAFLGTKQAAPSAASAVTQTSLRDEAKDGDRQLYDTSSAPSHEEEQYPD
FT                   RKYYILSSAGKPIYISHASLSRRKRRREKRRRQRRAESNESDLNSNESDEEDESSTTQV
FT                   GVMQALISIFADEDSDKLRFIRRGDLLITFLLRAPLYLVCVSSWNEEPSTLRQHLEYLY
FT                   LQVISLVSASQLTRLFGRMPNFDLRRLLEGTEGIFDYLVNQLNANETEDDDAEQGQHQV
FT                   ATGGVEAKRAVTDWASCHQWWLQALQPIRITVPNLRDQLTAALQPPTAEAGSSTQPHRP
FT                   KDLLYVLLCANGRIVTLLRPRKHSVHPIDLLLLTNMVMGSRSIKRSGGSEDAEIWLPLS
FT                   MPKFAPHGFVHAYVKFLDPESWIGSRREGSEMVGDAKMTSSELAVIVVTGDKDAFPTVS
FT                   AWISSLVAQPPAHWADNTADDAGDAGDAGSIRTTDIMAKRAASKKQAGKSAKPTQTELA
FT                   SWMTHFQRHILTLCRHLTDASNIEQGSPRVSAYTCAELGLAGLRHFVYRSNSTIQLTSP
FT                   SLPDPYASDAVHRKRLLTLYSLVHHQIHHPLPASASHSESSSSSTTAPPTGMLNGVFGT
FT                   PASSHPRLSADTRLKMHLVKSHHEQILGWITSPFELYLCLNPQLSKSAIVAVANSLTKW
FT                   IKSNENDLFLVNAGSF"
FT   CDS_pept        complement(654579..657050)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008521"
FT                   /db_xref="UniParc:UPI00003C1B74"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA35"
FT                   /transl_table=1
FT                   /translation="MSTVSIDGDSGHPGAPFSVPTAIALGLMASFIQSLGLTIQRKSHL
FT                   LNESLPPARRKSEWNRPLWLIGFAIFLVANIGGTVFQIGALPIVMLAPLGAVSLLYNAV
FT                   LARFLLNDLLSKYMVMGTALIASGAVLIGYFGVVPSPPHSLDELLDLYARPTFVAFATI
FT                   FTFVFVGVLTVAHLADWQLHARVHRNSLPARPTKPKHRNAHSLRGRLRRRWSAPTLAPV
FT                   AEVNESSSGIATPVLAIRDEANRHSILGPSPQQNVLYGRSIVATPMPPLSASQLVPIVP
FT                   DDVSVARPKQVVPTTTTTKRDYGSISRSEFNARKRKKSVDVPHLELRQAEQRIDAETLK
FT                   QTKLGLSVAYGGASGTLSGACLLLAKSGVELLMLTFSGQNQFAHWQSWLLIGILLAAAL
FT                   LQLWYLNKALKLADPTLVCPLAFCFYNTSSIALGLVYFDQIGALAWYDLLLVAVGTAVL
FT                   LAGVWTVSLHGNDEPCEGGLVCGDGESQPLLSAYVSSDGSRSISDTDYEALLAANRAEV
FT                   TEAHLPHVSISPHSSSLVDHQLAPLTSPEEAPLTLHHHESGISTSTRCAPQLGAGTAKR
FT                   RSGSHGHRSAQRRPTITLEFPLRDDFFSPNHDATLQSPLDLEAGASPSAYHSLESSRSD
FT                   HDTSSSRRKPSLYNSILEHGLSIGISPSSPGFHLQPRSPSLSRVNSNWQRPARHTHRSM
FT                   SEADAPSNTNHGTKQRPTHPDASDTSSANADTQDSNASSSGFGIMLDQIDLSRRLEALG
FT                   LRDRGKRWWGRFRTRWATRPQESSQQAQRADDESVIITSNSNGSLMAVPSDEIHAGRGL
FT                   GIAVGADADGR"
FT   CDS_pept        complement(657746..658630)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03029"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcriptional control"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="UniParc:UPI00003C1B75"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA34"
FT                   /transl_table=1
FT                   /translation="MDDLIRFVKQHRRQITRFVKKAFTWYKKNQGGGGGGGQHGGSSFG
FT                   QQASYEPPSQGGYNSGHGGAGGYAGAAGAAVAGGYDHPPPQGSYGAPQPNQGAHTQGPH
FT                   YKYSQDNQVNQHDANYVNLRNQARSEGDKMAQCFDQSHKAYSQGDGARAKQLSNEGNEH
FT                   KRNMERLNKQASDWIYMANNEDSPQGTIDLHGLYTSEALERAEQAVKHAQAQGWSELRI
FT                   IVGKGLHSKDHRQHIAPAVEKLMRDYNLEAHLDPRNAGVLVVNLRGSGQGGAAFTRDLA
FT                   KQTTGNEDECVIM"
FT   CDS_pept        join(659388..659812,659883..660141)
FT                   /codon_start=1
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10363"
FT                   /product="conserved hypothetical protein"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="translational initiation"
FT                   /note="RNA binding"
FT                   /note="directional cell growth (morphogenesis)
FT                   FunCat:40.01.03)"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="UniParc:UPI000159535D"
FT                   /transl_table=1
FT                   /translation="MADVEISEAGPSVPTGPQPRQVVYCAVCTFPPEYCEFGPSPSKCR
FT                   NWLHEHQPELYAKLWSDEAISSNLANLTTKQAEDLEREAAKKERKTVAKEERARAEMAA
FT                   SRIVLKKEARTKRKVTTSIVGLHLFSPPLPALKVVAKALSSRFATGASVSKSVQNPGVD
FT                   EIVVQGDVADDVRDLILSRTKPFHELPSEKDGGPSEKNIAIEEDKKSAKKAAAAAAGAA
FT                   PPTDD"
FT   CDS_pept        complement(660314..663883)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12205"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI000159535E"
FT                   /transl_table=1
FT                   /translation="MALHQLFTLAFALHLEPLPTLDYATVPYIRDVDHSTDSLQEIETL
FT                   RVGANTKLDPIHTRHFPHTVDTLSFLLNHSRAIDAVHPFSKLIALLEEADDDPEFRNLR
FT                   EFFDARYDQNGSLIGADKEKEPHRRMRSVSRAASTKQPGRRPSHATEARKSSFATSLGG
FT                   TSALKLNWLRRNNQPDSQAHDASDDDDDTHSRLSSNGHAANPAPPSAPYIRLSKRPHSS
FT                   SSSVSHPSSSNHRHAEHDTTITTTTSVTFPIRLDLHSVGLAPPPPKLRSHRQPEPFNVG
FT                   LQRIGSGRSTSSSEWRKRRASKSSLSSTGVASRPVASPDSLASFGAISATVNGDSDVQH
FT                   AGLSGFSIDTSAHSEPTSMSKPKLTPSSEIPAQPPSAESQLPSISERSIPSAEKVVTPV
FT                   SCSKPARRPSMMSKLLDFGRKRSFLDRLGSDSHDARTAASTPSHPEEASDARSNLNGLN
FT                   ASSPCANFRSGLEQHPDQATPGNEEAIDLDDDDDNDDTGLRAHMMRHINIATSFENRRR
FT                   SSAGSSSKSHAAAKQNRPNLGPVHEDRLPDLTMVSSRSSVGTSYSEHAIPEESFGANVS
FT                   AEGAAASMRRPAAVMDGADFLSLFRAASSLALSTIQYPTDGCDGDGADVTTPSLENKEP
FT                   HVADTGSTNTPLTRTPQIKPKLSSLPATPGRSIRSLDLDRSPNPHSASSHPIDSNFKLQ
FT                   AALAQKDAEKKEAWWPCGDVDPLPISLASALGEALGWETIMHLCYGKASRAASEGNYAA
FT                   LGKAAALDQANKLQERTVQAWRTGVASAGTSPPKKNDNLPSLLELGGADTASLAHSLTQ
FT                   TLHLDAADPLHEPNNASVLERLHDKAPQRSSTVPQHVDTDALLQGNSANAATPGWASST
FT                   LLFGSKVKHTRTWQHWQALFKSIKAWVDEYEKTRVRGGLAREIGLDPPAQQSASTKGLG
FT                   EGDNNITISAPLHIDATSPDLQVPLIIGSPPTASTEVLKVARDKVDATMLSKVLGASLS
FT                   ISPCVLGDATNRAHGFRRRAGIPEGLPLGPENEETIDYTWSRKRLSVEHFATALTISCD
FT                   SALHYFGQLSSSKWLYRSAWELDYLEMCVFKSPLVAERFPPPGEAVVPFSQSYRPAPGT
FT                   QDRSRTCPNPDEAGAWNPDTWKQWLTSIREGDIIVPAIAWQAWWTLISVLNGADRTGRS
FT                   YDLQVKSLEEPFEALNDLSAVYL"
FT   conflict        662475
FT                   /replace=""
FT                   /citation="[1]"
FT   CDS_pept        complement(665593..666567)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B78"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA31"
FT                   /transl_table=1
FT                   /translation="MASPTAIPHPEKSAHYRPRSTCIAPADLSSEIRTSEGQRLSFSPP
FT                   ISFYSRSSAQSSVNALRIPVGMASTMGPPSPTDRFSKGFSPINPKLDDSRMSPPHVHAR
FT                   ARSQTTIGSGTIASSIESWDANRVEPRAMSDATGSQPSSYISASDLSFSRSPTSPGSSL
FT                   SSSGYSLGRVPSLPLGASYEQAQKRFNSGSWGQKMGWMNTMRPGPLSPALSRTSIDEGS
FT                   AATDGAGNGAVGNLLRRFSLGGSSYRANNGAISSSAAAPVAPVFDSAPPASPQAIPAMR
FT                   DSGVCLDEAKPVARGRQASFGGSAKRKPSPMGERLLMGHFNAH"
FT   CDS_pept        complement(668371..670056)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03033"
FT                   /product="conserved hypothetical protein"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI00003C1B79"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA30"
FT                   /transl_table=1
FT                   /translation="MNSKAAQDRQQRILLDLVRQPGNDVCADCKGRAPRWASWNLGIFI
FT                   CVQCAGVHRKMGVHISKVKSITLDTWTREQVDRMKEVGNLKSNRKYNPDEMRNRPPTNM
FT                   EESERDSELEKYIRRKYEFRRFVEGRPPPVPSKDATFLTSPSGSVEYSHAPRSPVEPIS
FT                   SSQSSSSLAQGSSIARSRTAPIPSTWSEAQQRVKANAPPLPNPTAAGYRAASGSQINGT
FT                   SALSTRSTALTQSSLQLPGASVPLRTTSALNTRDGGQIASASKPTTPTVQSSVFDDLIS
FT                   LNESSQPTATQPPLQMNPWASLQAQQQAVLSAPAIQEPTGLFWAGQPSPNGVASPMAPF
FT                   GISPSNNNMTFDPVRNTPQHANTMPSLSVSSAQNPLSSQATGMLSASNGGMYSQFEQQR
FT                   SVGLGSMAFSTSPLPSPGFAPSNPFNATQSNSAAPLPQTAGFVGVNSLFQHQPQQLGQV
FT                   AFQGQANILAPNQAFYGQQQYSIQIQPASNGVGHFQSSMMPNGFGQAQFGTSHLMQQQQ
FT                   RQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQNTQQFGQRP"
FT   CDS_pept        671965..673896
FT                   /codon_start=1
FT                   /gene_family="HOG000158970" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03034"
FT                   /product="conserved hypothetical protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="membrane"
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="C-compound and carbohydrate transport
FT                   FunCat:20.01.03)"
FT                   /note="cellular export and secretion"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /note="lipid/fatty acid transport"
FT                   /note="non-vesicular cellular import FunCat:20.09.18.07)"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003C1B7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA29"
FT                   /transl_table=1
FT                   /translation="MAAIEKNSSKLDERFGANKLATDDVSSHDASNSVTMPHSEDVKFS
FT                   NPLAGIPKEQLLCNVEAFAQEKGLTDELEMLQKGALLAQRPAEYEEIVELSQAEKDAVA
FT                   HEYAHKWSHPKLLYMTIFVCSIGAATQGWDQTGSNGANLSFPLEFGIPESSPVGVLPGQ
FT                   PGYVTDAEAQRNQWLVGVVNAAPYIASALFGCWISDPLNNYFGRRGCIFITAIILLVTP
FT                   ICSGLTQNWWELFIVRLILGIGMGAKGSTVPVFAAENSPPQIRGALVMGWQLWTAFGIF
FT                   LGFVANVAVIDVGKIAWRLQLGSAFIPALPLAVLIYFCPESPRWLMKKNRYPQALRSLI
FT                   RLRHNKIQACRDLYYIHVQLVEESKIVRGETYLKRFKELFTIPRVRRATVASTTVMLSQ
FT                   QLSGVNVIAFFSSTIFLESGSTAKQALYASLGFGAINFLFAFPALITIDTFGRRSLLLF
FT                   TFPQMTWTLLAAGLCFLIPGEDSKTRLGLVALFIYLFTMAYSPGCGPVPFTYSAEVFPL
FT                   AQREQGMSWAVATCLFWAAVLSITFPRMLKAMTPTGAFGFYAGTNIVAFILIYLFVPET
FT                   ARFTLEELDAVFGVPHATFIRHQNTKVLPYWFKTTVLRKNALRPPRLIQLDSNLVGAGE
FT                   KRPEASIA"
FT   CDS_pept        complement(674456..678772)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03035"
FT                   /product="conserved hypothetical protein"
FT                   /note="DNA conformation modification (e.g. chromatin)
FT                   FunCat:10.01.09.05)"
FT                   /note="metabolism of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00003C1B7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA28"
FT                   /transl_table=1
FT                   /translation="MLRATDAAGSNRSGSRAGMSGKFSLSNLSLKSADGRSGARTPKNA
FT                   HRQFNSASTSRYSNARTSNVSIPKSTDGNNIAQLYAVFGLPKDPAVWTLAEEDCTNGVH
FT                   HIENAVGRFWRPEVLGCSICPPLNPVDEQPAKAPLSPASTSEKKDAKTSAWGSDKKNGS
FT                   NPKFIEMADGRGGIERAETARVLSKALKLSFTREIEISSGPVHFPPSSTSHTFSFSVPT
FT                   VKSSASGGAARPSTDVRKATAPFSVGAANVHNVRSFSAVGEGFGLEGVSSRLAAGTTSA
FT                   GEDTPSVATFYGSVLTVWSAADEKRAKAIRKELSRLAKARANGRSGVNKSINNQGEDIE
FT                   EDFEATSALGHSLLPDNNAFFMPYAICIVSRYPIYNLLGDWNKAAWFKYSRNIEMHNRL
FT                   MAAILRHPAPRIGETFRLKSPDEDLSFICTFPGAIDWGRGLLGIDFSMWPLFKTLSIDN
FT                   VLTICEIALAPAGRILFMSRHPALLGMAVETIKYLVELCGWKGVAHQNCHARDVRIYLE
FT                   DPGSWLIAINTELRSIIKPAQEVCVVDLDINFVNCPRPPLKAPSKGTARDKKRRKLITA
FT                   LGFSSADYTIPREYVEAFPSGRFRPLSKVESSSRDAPYEHLDTPSWWDHGALVGVFDQV
FT                   LHEGTKPSFLKKFLRMRTESQLVASETEQAAVLALRKRASTFVDARDGLENKIGRLNKR
FT                   LAFLMSEGEMWRQQFDKIQQLVDRLTREASDLRIKLDKERRESKRLTSTLQQRDMDYVQ
FT                   AQIQLRETEQAREKAQNELLRMRTAMDNLESEREAMMDEIRNVLSSTGAEEFGMSSLNN
FT                   LQSLTQNFGRVDSPAASDASHNTEMHVLKARALAEQRISMGQPQINGQARKLPLVAPST
FT                   NGHTEPVDANANANGTSSNHFPDEQMNNEIQKRTTAVTDQIAKIQQQLESTLTQLEGRR
FT                   SATFERRRRLSSSSIGSARYEHGPASSIGHHNAVASSIGHGQALDINDRANQASMSEEV
FT                   ETMDGNHSGVFSRRQRAGSSANHSSSARSNYLAPSAPALTPKSPARSRGVSLGSTNAAH
FT                   TENSSTEANGHATSSPPSEVQAEPEAAKTAEASPSVPAVVGSAAATGVAAAIVGAAVSP
FT                   AAAAEGAQIQVKSVAVQGDEASGDRNRPTPELAGNQASEDVDMSKKLDELDLCSDLKTV
FT                   NANDDDDGSDEALNMFEEPEDFRPKTPPPTVTYYEFPGTSSKVTLNLVGSHPLWGHLAW
FT                   NASFILSDFLCAHALTLLKGKRVLELGAAAGLPSIVCNWASASHVVATDYPDKLLIDNL
FT                   TKNVVLNCQDESSALRGAGKTFVEGYIWGRDPSSLLEKVSEAGKPGKFDLILLSDLVFN
FT                   HQAHPALLETCEMCLADADEGAHVEACLTTPCVLVFFTHHRPHLAYKDMQFFDMAEVKG
FT                   WKFEELGEWFRQPMFPQDPGDEVVRSTIHGFRLWRA"
FT   CDS_pept        679777..681246
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03036"
FT                   /product="WD repeat-containing protein JIP5 "
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003C1B7C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PA27 "
FT                   /transl_table=1
FT                   /translation="MDIPLSSDALDLCFHPAAETNLLAVGLISGKIQLINYDDYLSSPS
FT                   SSRTPLAPPSKKSKPSTISSAVETPTKLYRKLYTSRPSKKSCRGLHFSTTGSSIFSISK
FT                   DKSLFSTDTQTGKVVQSWIEVHDAAPSRVLPVDESLVVTGDDDGVVRLWDVRKGGGKGI
FT                   KPVRMWEHHFDWITDMVYLADLPVPKPKSIKEAKKSKTQLKKQRRRARQAERLKEHDKE
FT                   KREQNASDTEASEPDSEDDAAIKVESRSRLIVTSGDGSLSSIDLLSSGPTSFEQSEDQE
FT                   DELLSITSIRSSTKLVVGTQLGILSLWTPSRGLLDHVDRVPGHPASVDTLVTLDNETVL
FT                   TGSSDGLVRVVQILPSKLLGVIASHNGLPVERMKRKQSVLASIGHTNAVKLTDLSPLLD
FT                   DNDDQGDDDDEQAGALGIVGLAEDDSDDDDDDDDDDDDDDDEKHLVVELDGAEQTDGDA
FT                   ESGQDDEQDPDSEDVTPSQNKAGKGGFFSDL"
FT   CDS_pept        complement(681386..684505)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03037"
FT                   /product="related to BOI1-BEM1 protein-binding protein "
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI00003C1B7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA26"
FT                   /transl_table=1
FT                   /translation="MASGNSVDRVWALHDFEAENPDEVSFKAGECILVVEKDDDYGDGW
FT                   WQGTNESGHTGLFPFTYTTLDRNLALSATSGNATPDALGTPVTANSKPGVMHTTMADID
FT                   NALTELQSDHKTPGVTSSGTRAVALGSNPAADTSRASFTSERTDADDQSDNFGESDDFA
FT                   SRSIATRAALAANAQKNLASDAERQKQEEQRRRAKAQREFEEEEARQRELLLEREKERQ
FT                   LKLAAGEIDPSEEKSKAAPIAGVDMSDESDSEGSVVGALDDFQDKTHSPLFGNLTSTST
FT                   EGLAAREIKSPTSNLHEIIENQASPSQPALQVKETPAQSFAPASAPLVSEDFAPSVAPD
FT                   ANTAPSATPQFDPAVDPAPVLAARVGDVALGGAAASAVAGVANHDRSTNASSVIEHAPP
FT                   AADESVRSIAGDSNHTGTGTGLATGTATAATSIAAPANEDSIQSSSAAVYAPKSVVTVS
FT                   ASLPDDPTEWNVDHVVEWARSKGWDEVAVVSKFREHEISGDVLLEMDINILKEIDILAF
FT                   GKRFQVANGIKELRAQKPVAVTTPGVAQPAPTDSLGSPAIIASGAGSATGTPTYSPYNT
FT                   GSNNGSNADGRSLSARMAETSLDQSLAPSSSRPESYGGDRDRDSFGGPAQAFGGQGFGG
FT                   AAGVAAWQAQQAGQTIGSRHLSDGFPRGSGDAPLSPPAGTSQFGMSSARYAPTNGIANE
FT                   DRLGALPTSPRKRESTGSAGTLEKNNRSSFFGLGQRNRKPPPNQAGGAGGPGSISHEDD
FT                   RGSNKGTLSRLGFARSSRNISSQSSQSNIKEHISLPTSSPHFDQNGDTARRQRQSTGGT
FT                   TAMGSPGTPGTLGMGMPTNVRPTSIGSAGAGSQAVASTAGAGTNAAASGPVMSRIQPVD
FT                   LEGWIKKKGERYNSWKPRYLALKGPDLVILRDPRAEKIKGYVNMKGYKVIADENTNPGK
FT                   YGFKILHETEKPHYFSSEDPILVREWMKALMKSTIGRDHNFPVISSYNNATISLKEAQR
FT                   MNPPPRPPSPTSRARTQRAKARPNPEQLTARDAAILMNLTSGQPTKPDDL"
FT   CDS_pept        complement(685983..687812)
FT                   /codon_start=1
FT                   /gene_family="HOG000164743" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03038"
FT                   /product="Diphthamide biosynthesis protein 1 "
FT                   /note="toxins"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="UniParc:UPI00003C1B7E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4PA25 "
FT                   /transl_table=1
FT                   /translation="MQSNAENPRKRFTATSPNGNRQNVSVDTSSNVAGPSRPRIANAVP
FT                   AEILDDPALNQAIKSILPSNYNFEIHKTIHHIRKASASCVALQMPEGLTLWATGIADIV
FT                   ERFTDATTVIMGDVTYGACCVDDYTAMALGCDMLVHYGHSCLVPVDQTAIKTLYVFVEI
FT                   SIDPAHLAATIRANFPNDRHDFRAKILGGSQSAAGKRSEVDESAGRAQIQIGEQASVAS
FT                   GAPPSTLTHLALVGTVQFINAINGLREALRQQQHRLADGQIVSTESPVDRLMLTAGTAS
FT                   SAPVQHITQAAKWKAWSSGEYKVTVPQVKPLSPGEVLGCTSPKLDKDEIDAIVYIGDGR
FT                   FHLESIMIANPRIPAFRYDPYTKRFVRELYDHAEMRRMRGEAVRLAQDSVGGLDLDPET
FT                   SIVKKNKAVVVDAEKDRVTASGWGVLLGTLGRQGSLRVLESLSASLSEHVPPIPHVPIL
FT                   LSELSPQKLGLFGEHLAAFIQSSCPRLSIDWGSAFAKPLLSPYEAAVSVKKVKGWQEDV
FT                   QGLGMSRTPAKQQQDGNGNGSDAVPAEDKHLPLDGDYPMDFYSDTSLGPWTPRHGMAPA
FT                   KKPVGAKSNLALLRSLRSKRAKASSTPTSAATA"
FT   CDS_pept        join(complement(691231..691371),complement(691092..691207),
FT                   complement(690916..690970),complement(690058..690870))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03039"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA24"
FT                   /transl_table=1
FT                   /translation="MDRDTQIGQEASRVSSRSPRHKHSDSAAKHWRIERSWATPFMMDF
FT                   GASSETQSTASCSVHGNLERPQLCCTFRVSLLVAPRFSSQCFGNSRFAVLRQTASPTAV
FT                   IRFGSLQRLLSSASSHVSSLLAANLSELRSVVVHNQRASSLCMEVTNRSVSQISPHLFH
FT                   QSIWIAGQFRVNDIGLPISEPIWKQNDGERPPSATWAATSFACTIKSGLASYAHACLVA
FT                   YHVTPYSESGGVSLCLQCKPSFNLQDNPAKCATAQTGLSWWRPLDVGSHHADSRLTTVA
FT                   SLCAEPIRSSPTLVILPRFLSLQYNTVTNTVCHKWTATRLLTPTKAASSFHSKQRNTEP
FT                   PSIIRHRKRAGMPPFVVQSRPEKKRRLSAKSARS"
FT   CDS_pept        693462..694925
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03040"
FT                   /product="hypothetical protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003C1B80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA23"
FT                   /transl_table=1
FT                   /translation="MSSISSGSSASGATPFSLGASSATSRSPSAEPSSSVASSSSTRQR
FT                   RLTLQDIHIPAGFEIAKNLGDAGTEYPSEENIQKAAQVLQSLRGRMPDGSDGQVAACDY
FT                   CRRRKIRCDRIKPTCGSCVASGRKCTTEDMLRKRGPPSKKERAILEAAGIIFRGTRPHR
FT                   RRRTATTSLGPGAASKQQEQLLRKVTEVAGTRTRANSTNSGENATFTNLVDGLDTATKT
FT                   SWMEMLSIATQSTNPFSDSPVSSPSDISTQDAFHVDAGACDYILPVPSRDNMNLSYSSA
FT                   QYTNVGTPFGTDFCDKHVSSAPVASTELPDLSAFACNANVDRKDDLFRTSLSSLDAGAL
FT                   DWSGSNITPAQYQLMFPQDIPASYRLNELHSHMPVVHLDPQMMVSSSQPHNLHLQPPQP
FT                   GHGLQPFINSPMSMAAEAVAFQTAMGHFFPKQHNLTSSSSISNMSSSSSATAEVSTPSK
FT                   LDQFISMADHHHHLQNQTQQQQLQFTLSF"
FT   CDS_pept        join(complement(695500..697364),complement(695346..695379))
FT                   /codon_start=1
FT                   /gene_family="HOG000164283" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10364"
FT                   /product="related to KRE6-glucan synthase subunit "
FT                   /note="cell growth , morphogenesis"
FT                   /note="cell wall"
FT                   /note="metabolism of energy reserves (e.g. glycogen,
FT                   trehalose)"
FT                   /note="polysaccharide metabolism"
FT                   /note="sugar, glucoside, polyol and carboxylate catabolism "
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000159535F"
FT                   /transl_table=1
FT                   /translation="MATDTTFQADEEKARSNGLRLATDPSCLQRRPPATTESGSESSSS
FT                   HNSTNSFLKPAAARPFATVSVPIATGVTAVDHDAYTPAASNSTLDLLAKHRSVQMIAWL
FT                   YDYTGGPEDDDWLHEPGVERKRSLAHLAFGWCNISVRGICNVGSLLLLSSCLLMLFAGY
FT                   PVLYLFLSRNPDQKATSFFGLGGTNGSGQVPALPLFSLVDSDTPFDAYAWTNPLDRVGY
FT                   HLVFSDEFETAGRTFWPGDDPFWEAMDLHYWVTGDFEWYSPEAVNTSNGFLNVWMQEEA
FT                   THNLNFRSGMLQSWNKFCFQGGYVEVSVILPGAHDTEGFWPAIWLLGNLGRAGYAGTTQ
FT                   GMWPYSYSSCDVGTLANQTNAQKTAPAAAINAHGLYSSSYDHKLSFLEGQRCSACTCDG
FT                   EDHPGPNVGVGRSSPEIDIFEIQVNGAHGAASQSFQIAPFDANYTWDQSPKVAQLHGQD
FT                   TMFNSYTGGVYQEAVSAVAKIPDTAFASSGGVPVTMGVQYDPDWTGDGTGSITWFLNGK
FT                   PTWTLSGHSLKANRYTEIGQRIIPTEPMTLVINLALSDGFQKVKWDQVEFPAVMKVDYV
FT                   RVYQKDGQEDRISCDPDDHPTSKYIHDHLDVYMNPNLTVWDQAKYPWPKNSFLGQC"
FT   CDS_pept        complement(698110..699006)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03042"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B82"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA21"
FT                   /transl_table=1
FT                   /translation="MSDVASASASAPSTRKSRGANPSTDYKSLFIKSKDKYDRVSTDHT
FT                   DLEASVAKATAKQQKLREELDYLLDAVASKRAQRAQIEQSHRDHALELEREAAAAVAAA
FT                   QAARLRASSLAQRDRDRDAYEPRSAHRGYEGGAEYVPYPARYSESSYHAYGAGSNRGYA
FT                   SPPPPLAPATGVSAGSRRISVSSQRDEDRYPTSEGSRKGSTQRDPHAPASYRPPTSQSP
FT                   PPPPANSMLSPRRSHAHDPHSSPSRSEAHRRYRESTPPLVPSSSTSSAVKRPRTFSAER
FT                   ELLDADNAYSTKRARND"
FT   CDS_pept        join(699486..699593,699721..699804,699895..699960)
FT                   /codon_start=1
FT                   /gene_family="HOG000191032" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595360"
FT                   /transl_table=1
FT                   /translation="MPVPFEAVLHMGMVVVMFGVAGTGYNVVRRLAEDGKPIRHSLDDW
FT                   ERMMMKRDERLTGSLRGQSTNPIAPKEFATNSAWSTEKLS"
FT   CDS_pept        complement(700203..703259)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03044"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007528"
FT                   /db_xref="UniParc:UPI00003C1B84"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA19"
FT                   /transl_table=1
FT                   /translation="MAMTQMGTATVATLEPHQLARYLAPPTLDQQIGYVVEHCNYILPQ
FT                   LASDSLTASLAPHPDDSQTPAIFATLPSSASLEVYLTQLSSAHQQAAERTANLELELRN
FT                   QLLSSLSGVKLLKEKLASLPDDIASTEDKLLDLCEDLVIAGSTASASPESSRDGAATLI
FT                   NRLEKLHTAIDQLQKAKAYFSILAQAEDLRLAIVQCDHDRAQRDHALHLLSELDALVRK
FT                   AEKLSKVGSEQLQAQEKELNLVAFLRAQRSAAYKALRKARCARLSEAIEKTGWSQDKAD
FT                   LSSQLDAGDSMKLVKSEQVQQSWSDVCQLQDTAEHLGLLKRATAKPSSRSQSTNGETIT
FT                   AGSDKYQPLLTTQCLIEPMLLRFRYHFDGDRSTNRLDKPEWFLSHIASLIRTQAPLFLP
FT                   AVHAVPGSGGVAVRLNRAYANAAPAASASRRSYRHIDTYAELIHGLLTPLRRKLASTMP
FT                   ALLDHPSLLAHTVFQALTFDADLADSFPPSLTVLNGAGTRKISDDILDNTDWFNRWLDG
FT                   EKEFALRRFEEIVNAPDAWAIGSSDSLADDDEQIFYSSVSDPNVSVEDMAGQRTTKSAR
FT                   STIEILDSVSERYRPLPSLSQRLSFLTIVQLPILRLYAQRLTRSLDAFESLSSAFARAM
FT                   PGEIVAGTGAVGGGSDSDMVKGLRGLGRLVKALLSAQYVCTELERWSETAAFVEMSESL
FT                   DSSEEGRALALGLRKDQVAEEDRELDAASLGMLLRRGLKRGAAVARPLAATGSDGGTSG
FT                   SPVTGSGEAGFGTPKVSDVGSKQVLNEFGRYGVWEEPRRKFTEIGSRAIAAIERLVTSE
FT                   VLEQLRPYILRRWDQEEPDSAEDGDHKDPYPTPTLIPALSIFSSHLAHLASILDKALLL
FT                   PIYRHISSSIAHALVDRVVMSGGSRRFNYAGGVRFDQDLKKGWFVVVRELVDANAVNAR
FT                   LLFGRRPQAIWKPAVDAAVLLSLPSSTSGTITGETWTLAKVVQIVFDATDEGAAKGREY
FT                   QGLLEKLGHVDDAKINVREVLRRRVEVWK"
FT   CDS_pept        703815..705998
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03045"
FT                   /product="related to BSD2-metal homeostasis protein "
FT                   /note="cation transport (H+, Na+, K+, Ca2+ , NH4+, etc.) "
FT                   /note="detoxification"
FT                   /note="homeostasis of metal ions (Na, K, Ca etc.)
FT                   FunCat:34.01.01.01)"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="vacuolar/lysosomal transport"
FT                   /db_xref="InterPro:IPR019325"
FT                   /db_xref="UniParc:UPI00003C1B85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA18"
FT                   /transl_table=1
FT                   /translation="MPRPPEQSNLKVPSLNPSSLTHDLAFSRESGATTHRLAPLSISVF
FT                   ILVVHPDSSHQLITTSKLSLPIIDPVYHTNAIAAIMARPGAPSRSHSQRSDELFAAFNG
FT                   PAETDPALPDHAQAGSSTSAAPSSSVDVFFDAGDALPEPDVQSSNASVNDPLGANRAAS
FT                   NASAAPTPSTFRPPSQLARCGNTPAYDFERPEYFPTATRRPPPSSNATSPRADPAALAT
FT                   SDATNPDHRTIDMSFQSANDADDSLHSASSSNVHRNGYSSLPTSSGGGGVSTDPSEHLS
FT                   RSDRMRFALGRFGRFVGMGIPGARYTSLSTQDGSRAGVHRPRVVGGGIGQDGVFANLSA
FT                   KPERRRRGQHGASAEDRGDDDDLEDDMQPPTYEIAAADAVPQYWETTILGGSVHPLANG
FT                   LGWTPGGAHVGAIEDLIVEGLAVGNFFGFAWNLLVSMTFQFVGFLLTYLLHTTHAARCG
FT                   SRAGLGVTLIQYGFYLRTRAAEIAEGKIIGSGDFGEGGVAISPGAGGGGWFDENPDGGD
FT                   TGGTRRRRGWISRTVQAAQSSADGATLADLFAAQADGQPVNVGDQNITDSMSQSTEWLA
FT                   YVLMVIGWTLLLSSTLSYWRIWRWGKSLVDAAHREQESSTNSNNDASTETSSGATPGAT
FT                   SFVNRFRTIFGTPHGASGQGSGEDWILFPGVGHRLGRNSRSASRQPDRSGASFDHPTSI
FT                   ADLEDEDGLDSQDAQLNQAERRLLNDMRRVGLV"
FT   CDS_pept        complement(707161..708021)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03046"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA17"
FT                   /transl_table=1
FT                   /translation="MYNLFSLFALCLAVAATVHASSQCDSGLSKRAPESPRVEHEGAFP
FT                   VAVKTLNLAAFFDCVNAAGYTADRVKYIVQAQALFVLVDLDDMHEKARKSFQDCNHVLS
FT                   DETNVLDYITFHGDVSMGGRTIASASEDETIVKSNIAEDQTDDALTATVDQVQSLEPLV
FT                   ARYSRDLRKRVANDIEISFYGRGSQNSCFGPANACINQCGGSGSVKTKALITNLHWTRS
FT                   WSHHFCVDKGRDDFGTAVAVSRRNRWYYMYAPTGKFFYSGGMSRDYMGVGWGDGRAGLA
FT                   CGFWR"
FT   CDS_pept        join(complement(710152..710277),complement(709686..709910))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03047"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA16"
FT                   /transl_table=1
FT                   /translation="MADFPSGYCSIERFGEAVSQILSCATCHLGLIPVEQRLTRTEARK
FT                   VVRSSSSKESLCRPKKSGGACAADSGRRRWRREVSAKVRRQDHAKTQSTDRNEVFKAVP
FT                   HGVEVSECYFTV"
FT   CDS_pept        711525..716786
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10365"
FT                   /product="related to YBT1-Vacuolar, ABC protein
FT                   transporting bile acids"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /function="ATPase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001595361"
FT                   /transl_table=1
FT                   /translation="MIPSIPPWLELHRGMTVQLASTATAAAMSPSIRVPLWDQYTISAA
FT                   ALASAILVILLFLLFLPASASSYPPSPVGYARFSNSDTESPPSSSRETEAPVKHEVDDY
FT                   PYELRKALGTPVDAASYEARRLVIHIFIAVLAVVGLAIDMSSIVTRVFADQGAEHPLQT
FT                   IVYFISSCAALRTLTVVLAMLHFNLAESTRLLLIWILTTLYLVAQLLVFLIEFMLFLPG
FT                   LGGDSNFILHSINIGCSFAIFLLAFLSPTGPLILVKATQSFSERAITRNALGGGSVAQH
FT                   LWGFLALPVVRKAYQQGRIDQDDIPALDYTYRSAVVAESVICEYRRSLAASIAKVPHGP
FT                   NRTESIKGRALLKALVRCNVAQMIETAVMLVIVTFSFYAPKLGLKLLLDGLEGYEASLR
FT                   RANGDVVDTVAKRARSTLIYSASFYLILFLENFLVYFYFRPLTVHLKTKMQTQLTTLLA
FT                   WKRLRQKEASAKEQQADPKQDQAAENKSATEDTDNSEGGGSISSPSQVINLVTTDVTRI
FT                   FSRIDMYVFGIMGPLEVLVGGYSAYYLLGNGALIGLAVAALMQPIAFVLGKVTARIDER
FT                   LQKTRDRRVMLLSEAIRAIRMIKYEAWEDEIGAKIMLERRAELKCQAQSWAVFTFFGGF
FT                   FALVPMLTIVVAFGWYTMVEGNTLTASVAFPAVAVLTELRWAVSYLPSNFLTVIQGWVS
FT                   MKRIAVYMETGEVYIPDQEYSPQTMDGARDVAVRASTGVGRVDLRHAEMTWPSDADVAP
FT                   SSQSSSSASAASSTFTLSIPDASFEVGQTNLVCGKIGSGKTLLLLSLLGEAQLLSGSIH
FT                   CPRSHPATTLYAARSASQSFANHRQWWIDLSLSAYAPQRPFLFNATVRENILFGLEYNA
FT                   RRYRAVIFACGLKPDLKIFKDGDRTEIGEGGTNLSGGQKARISLARAVYSHAGTILIDD
FT                   CLSALDSHTTKHICEKLFDGGNDGLLGGRTTILVTHHVRLMAPRCSKVLVLQEGRQAFF
FT                   GSAEQFTASAFYQGLENEDAESKEEEGHETPNFGSNSSTAANSANNSDAEEDGAATEVS
FT                   VLLDAVRDKHVNASAISQKTIGMGEVRRQPSSSAFSHISGLHDVQAEEEQAPEAHKHVT
FT                   EEARAEGRVSFAVYSGYIRAGGGILLWLALLGSFAGNAFTDLGANWWLRLWAQSSTTQE
FT                   HSTEWWLVRWVAIQVVQVIAMTFGYALVCIASLLAGSRLFKQLLRTVLRAPLRFHDSTP
FT                   SGRLLNRFGRDMEAIDSSIAEELTEAVKALLMALAALVATWLGGGPIVVVILLFMLPMF
FT                   YVLVATFTLAARDLKRLDSNSASKRITCFTDLITGVVTVRAFGSSAAYFATLMERLDEN
FT                   MTFYFWQGTVRQWQSLLLSLVSSVVVISTVLVVTLTPGFTAARAGFTLSFVQSLTSMLT
FT                   YGMRSLSNVEQGLVAVERVMEYFGIETEPLDSAPAYVEELPVPPTWPEKGAIEIRDLHL
FT                   AYAKNLPDVLDGITLSIRAGERVGIVGATGSGKSTLVSALFRFFEYRSGQIEIDGIDIG
FT                   RIGLKTLRSRMKIVPQDPLILSGTLRSAVDPLGSYADEDITRVLVRVGLLKDKVTSGYG
FT                   TFESSSRSAGTTGGGGSTSSSALLCSNAPSPSGEESDDSGTLASLESRIEESGSNLSSG
FT                   QKQLLSLSRILLSSCASSSIVVLDESTSSIDYTTDAKIQSLLDAHFAEHNTTVLAIAHR
FT                   LRTIIGFDTVIVLNSGKVVERGSPSELLAKEDGWFTRLANSTGDEEYAELKRLIGI"
FT   CDS_pept        complement(719195..721069)
FT                   /codon_start=1
FT                   /gene_family="HOG000217645" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03049"
FT                   /product="related to neutral amino acid permease "
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00003C1B89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA14"
FT                   /transl_table=1
FT                   /translation="MGFKEVFRRTKSVEIERTRHTSNKEETHQSDLPGQGAPGLTPVPA
FT                   LYEAPPQSGITLEEYMFYAQIQREQEKLYGAAGVAVEANANHGAGYLTDASNEKKPSSE
FT                   DTSQHSTVVQTGVDKPHVNNTDASTFDQLEGLSEIEKESRNAHRAIKTATWVGIFYLVT
FT                   TDILGPYGAPYAMAQNGWVTGNIMYIVMGFCAWWCGILLWKLFLNLDSARYPVKTYGDL
FT                   GERLVGYPMRWTFNALQTLQLIVNVGLLCLTNGQALSQVISGAPGNATLCFSVCVVIFA
FT                   LIGMAFAQVQTFRGLGFAATTAVYQNIAIVVISMAAIIKYGPYIAGAQASYGSDYPYNN
FT                   QPVMTSAFVSYDLTQKINGMMSMVFAFGGALIFPELISEMRRPMDFWKGMISAQALICT
FT                   VYLVYSNVIYAYQGQYVLGQSYNGIAKYAFQTVCNMLAILSGTIAAALYGNVGLKVIYV
FT                   NTVQTFLKGPALNSPRGRVLWAGISIVYWALAFVIASSIPQVQTVSGLIAAVAIMNFSY
FT                   SFPFMLALIFYIKRDAMQGDRLYTPSQPVQRQDNWSQWSRWQRGLFGGHYELIGVTIPA
FT                   ILVKAVLLLVTLGSFTLSGLGMYGSGESIKSTFAAGGAATSFGCSAPV"
FT   CDS_pept        join(724428..724481,724579..724678,724775..725241)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA13"
FT                   /transl_table=1
FT                   /translation="MSTKGDHPTKAQSSVPPKPPGHDRMPGWKRVASTFSRFVRRDPQL
FT                   APLAAITLGTIGLYIYFHHSKVSEVASQNSFPRHKDTKASSRGSDSRVATGDTPADKST
FT                   KGSYYTESGSAPGGLSKMLYPHLDTSEREHLDNLTVPHNEGTFGRSIKHAAALDQLKKN
FT                   RDADRHYKRQGDLVQGHEQRENGDRPLTSAQHLQDLHGQKRNY"
FT   CDS_pept        complement(725433..726380)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10366"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR019419"
FT                   /db_xref="UniParc:UPI0001595362"
FT                   /transl_table=1
FT                   /translation="MASLSSATSPSSPPHSDLPEQFGRKAYQAMQLFPSIAEKQEGWLQ
FT                   STVRTLGSYAQISTPAYSLAALFALSTPFGFASPAQAAAEAAAKLQYQKHIAQLAHSVS
FT                   SQGSNGLVARLVAQVQTQKAAKSQTHAPLRVIPPFWQLAFFAAAFGTGGYIIDQGDALN
FT                   GSGVVSAWSLTYLLFKTIPSIKQLPKNPLAFLLSSSVLSIGLGIHGCHYFDRTSWRGDI
FT                   PSLTAADAQEVETQGRSRLITIQKVGKVDSSDAPTSIFAAKPDSATASTTSSIHQATSA
FT                   PNLIHGCTRNNDDARTAAFLYRQGRRSPPGPIVL"
FT   CDS_pept        728381..731923
FT                   /codon_start=1
FT                   /gene_family="HOG000111632" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /gene_name="Chs6"
FT                   /locus_tag="um10367"
FT                   /product="Chitin synthase 6"
FT                   /EC_number="2.4.1.16"
FT                   /function="heme binding"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /note="cell wall"
FT                   /note="polysaccharide metabolism"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="UniParc:UPI0000EADF9D"
FT                   /db_xref="UniProtKB/Swiss-Prot:O13395 "
FT                   /transl_table=1
FT                   /translation="MSTKDAHDPFATPLETITHDPLAETAGLKADYDKRAYGEANPALM
FT                   GTLEKDDMANRPIDAVEEVPTTSIRKWWVRLTWFTTWWIPSFVLSKCGGMKRPDVQMAW
FT                   REKFTICAIIFWLCAIILFYIIAFGRLLCPDYDKAWNLSQLSQHAGENDYYAAVRGTVY
FT                   DFSKFYKGDHSDITNLQTSSDLMLQLAGQDLTGYFPVPLSVGCQSLVSDTSLALMPTAN
FT                   NTPLISQAIHTSGPLQGDTSSKLHDINWYPDRFLPFVKKLRKGYYVYSKKDLANQGQWR
FT                   NWAVIHGKVYDLSNYLNTVSTYQTNPAYSFLDSSIVSLFKSQAGSDITADFEDAMSTFN
FT                   QTYRGATQACLDNVFYVGRTDFRDTARCEVQNYLLLAFSVLLVTTVLAKFIAALQLGTK
FT                   RSPEQQDKFVICQVPCYTEGEEELRKTIDSLAGLEYDDKRKLLFLICDGMIVGSGNDRS
FT                   TPRIVLDILGVDPKIDPEPLMFKSVAEGSKQLNYAKVYSGLYEFEGHVVPYIVVVKVGR
FT                   PSERSRPGNRGKRDSQILLMRYLNRVHFDAPMFPLELEIYHQMKNVIGIDPAFYEYILM
FT                   VDADTRVEADGLNRLVANCADDSSIIAICGETTLDNAEGSWWTMIQVYEYYISHHLSKA
FT                   FESLFGSVTCLPGCFSLYRIRSSDKGRPLFISNRIIDDYSENRVDTLHKKNLLHLGEDR
FT                   YLTTLVLKNFPSFRTKFVPDAKALTSAPDRFGVLLSQRRRWINSTVHNLAELVLMPELC
FT                   GFCLFSMRFIVFIDLLGTVILPATAVYLVYLIVTVATKSAPIPYISIAMIAAVYGLQAI
FT                   LFLLKRQWQYIGWLVIYILAYPVFSFFLPIYSFWHMDDFSWGNTRIVVGEKGNKKIVAG
FT                   TDDEPYDDTMIPLKRFSEYQREVWEEEAAAPSMRSGMTGASGPFGNSQAILHSGPPSVY
FT                   RAGGSAYAGSVAGSDYGAGLGDYYQNTNVLQKPAHSRQTSAAALSQMGGSQAASMMFGT
FT                   GTPSVYGMAGMGSMYGMPGSSASMYGLPNPMMNTTASMYGLPPMLANPLGANHSPAHSD
FT                   IGVSMPVSQQNTGGSHIWAQPPEAATVAANSGRGSGMQARPVSTLSALNATNPFGVTAV
FT                   ARALAVNEASDPTDEEIKSAVQTYLANQPSLMNVTKRSVREALVAAFPNAELSYKKSMI
FT                   NKAIDDTLSGGAQA"
FT   CDS_pept        734524..737370
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10368"
FT                   /product="related to Heat shock factor protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001595363"
FT                   /transl_table=1
FT                   /translation="MAVSTVSHPAPDLVLTDLGASSKRITPLASATIPHNSPQLEGTPL
FT                   NPSQQQLALDALVPASALSTSSQPFSPISNSPQPMQPTKSSPATPTSLVKHSELTPSPR
FT                   DRSAASGSASSSTPASSTTPALPPKVAPVMAGMGTLPPNVPPPSASASASTSAFSASDT
FT                   LRAIPTNKNNPAFLNKLRSMVDDPNTDELIRWSPDGASFFVPNHVRFGDQVLPRFFKHN
FT                   RFSSFVRQLNMYGFHKVPHLQQGALKHDSPQESELWEFSNPHFHRDHPDWLSKVQRKKG
FT                   PRDDKDNHADREASATTGQELMHAGALMRTDFGMNNLGADANADGALQLASVLNAINAI
FT                   KNAQTSISADLRHLQNSNQNLWQEAVESRQRAKRQQETINKILRFLAGVFGNQEDTETP
FT                   VPGKKVSGKARAGKRVGVRPQQQQQQQQQHQQHQQQRSKSRLMIEDGNASSSSSHRGIQ
FT                   GLDLPLDQEEIEEMPYHLRFQEASNSDSPKVQSPSANLGASRFTQIGSPPSSSSAADFG
FT                   RQLSEAVSTPGGSRRLSSQASNQVLNALASGEGNAWLASLFGASLANQGSKSTGPASGG
FT                   GLKLDPHMVAALQQALASAGGVNSASDNTGDYFGSTTGAPADDGSSRFSAFPSSSSNAS
FT                   AVSSSNSAQANALGLDADALARFGASISHALVQSPARPNPNAGASNTQPTNYSVTSPSK
FT                   GGSANLFDMGNDEVTSSGNNNQQLALSLSRATRDLQNTSSDVDQVQSSINSLIQGLQGI
FT                   AGQAPASASASASDRAAVVPWQTTSGAAFDAAPATFGDASGSASVGNQFEAPSGTTPPS
FT                   STVDVGATSGTNAGMDDFDVDSFLSQFVDSSQAPGGGVTSPTPNNAYGESPSFAFSPAT
FT                   TAAFLHGAATSASDLPYAQQLTSKAESGTSSNSSSSRLNGKADSNAPKKRKPSTSGVEL
FT                   AVDVDMPDRPLKKSGRKA"
FT   CDS_pept        join(complement(740247..740317),complement(739134..740157))
FT                   /codon_start=1
FT                   /gene_family="HOG000278064" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10369"
FT                   /product="related to COQ3-enzyme of ubiquinone (coenzyme Q)
FT                   biosynthesis"
FT                   /EC_number="2.1.1.114"
FT                   /EC_number="2.1.1.64"
FT                   /function="2-polyprenyl-6-methoxy-1,4-benzoquinone
FT                   methyltransferase activity"
FT                   /function="methyltransferase activity"
FT                   /biological_process="metabolic process"
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /note="biosynthesis of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /note="metabolism of ubiquinone"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0001595364"
FT                   /transl_table=1
FT                   /translation="MNSATIRSTARLHLRSPSAALVCQRLTASARPFTLSSKHGLDSRP
FT                   VSSASAGDGVACQSAQTSSVHASEIEHFSRLSSKWWDEHGEFGLLHAMNAVRIQFVREK
FT                   LDEVWGYELAQQQVSARSGKTPTCTGPTSSTNARSAVDNLGQTQFLRNLDVADIGCGGG
FT                   LLSESLARLGARTTGVDASASNIGIATTHAARDALLSRRHALGGASLSYLHSTAEELVA
FT                   QNRSFDVVCAMEVLEHVNGPAEFLRSLDKLVKPGGHLFMSTIARTPLSWLLTIFMAEDV
FT                   LRLVTPGTHTHHQYINPQELVDFFQDDLKWYGKHSTLPERLHFEVRGTAYLPWKRAWTL
FT                   AKSQTSLPGTRECNYFFWARKPLS"
FT   CDS_pept        741145..741735
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03055"
FT                   /product="conserved hypothetical protein"
FT                   /function="catalytic activity"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI00003C1B8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA08"
FT                   /transl_table=1
FT                   /translation="MTSPFSSCFGHSKQPPSCVSSQEEHLNDASATPASRRAIDGIDAA
FT                   KCVFCNVTPDRFRIVIEDEKLICFTDRSPGAAIHLLVIPRNHIANVQSLTHNHTELVRQ
FT                   MQALGNKALDLVSTSNCAPERRFGFHIPPIRSVDHLHLHCLELPFKSQWKAIKYRLAEP
FT                   PNHNYIKGWSWFVEWQQTCALLNAGRKIKISSC"
FT   tRNA            complement(741894..741965)
FT                   /gene_name="tRNA-Thr (AGU)"
FT                   /locus_tag="um14005"
FT   CDS_pept        join(742608..743596,743701..743722)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10370"
FT                   /product="conserved hypothetical protein"
FT                   /function="catalytic activity"
FT                   /function="hydrolase activity"
FT                   /biological_process="metabolic process"
FT                   /db_xref="InterPro:IPR008262"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="UniParc:UPI0001595365"
FT                   /transl_table=1
FT                   /translation="MPVDKPRTIPPEIDIPNGGKSEQFWIETDYSDKTRFWAKRFYPTD
FT                   ASDAQVQPKSTTIFVHGFVEYVDRYRNIFRLWPSKGHEILGFDQRGWGNTCRSSSDPVK
FT                   NYGNTTWPQQFQDLEHVIRQTRQRLDEQWGVNKVPIFLLGHSMGGGIVTAFHTRSPEWI
FT                   QQHGANSPSQEAKEMVAGVIASAPWLTLTKPPPWFVVWGATKVLSLIPEMHWSVDLLGK
FT                   NISRDPVVASNFENDPLSDKKVYLKAIQGPLQGGIDIVDNAYAHWPESKPLLVLHGTAD
FT                   LVTSYKGSQKLVERVKANDKTLKLFDGFYHDLLNEPGQDKVIVGEYVLNWLDSHL"
FT   CDS_pept        complement(743867..745207)
FT                   /codon_start=1
FT                   /gene_family="HOG000135968" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03057"
FT                   /product="related to tRNA pseudouridine synthase B "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA modification"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /note="metabolism of cyclic and unusual nucleotides
FT                   FunCat:01.03.10)"
FT                   /note="mitotic cell cycle and cell cycle control
FT                   FunCat:10.03.01)"
FT                   /note="pyrimidine nucleotide/nucleoside/nucleobase
FT                   metabolism"
FT                   /note="tRNA modification"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003C1B91"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA06"
FT                   /transl_table=1
FT                   /translation="MSVQDDVSNNLVAPHTLVVDPPTNHQFQEKTVSKMSAVRPIHNAV
FT                   RSVTSSAAASASARPLSGIFGINKPSGPTSMSLLDDLKPLFATSPLFADADGNRVNDKS
FT                   RKRGKFGAKGKAKWAGGVAGAPKIGQGGTLDPLADGVLVIGVGNGTKHLQKYLDCTKEY
FT                   RSTGLLGSATTSYDSCDPILTRKPFDHVTPQMIAHLLPRFTGAVLQIPPLYSAVRMDGK
FT                   RLFEYARENLPLPRPIEARRVTIHELRLVDWLEPGKHAFKEPQREVPPEDKALVGRVLH
FT                   MAGRKEGQTDTVKEVDATAPQEPEESASTITTSWQKSPTTADANSSATENSESQADPAG
FT                   PPAFVLEMTVSSGTYVRSIVHDLALAAGSAAHVQTLTRTRQGEWSINTPSSDDKPSING
FT                   NCIDWSVFADAIAEMKREATDAQFKSARDAEGLRAWERQLLKVIVPV"
FT   CDS_pept        745803..747950
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03058"
FT                   /product="conserved hypothetical protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /biological_process="transcription"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniParc:UPI00003C1B92"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA05"
FT                   /transl_table=1
FT                   /translation="MSSTAHSPQKIKLCEHILLQHFGPIAARVGALLLKRGRLTIREIS
FT                   RFLNQQPTRTNRGPIDPFSNHSATNSKSTLVSAPIAGASSSSSTSDPNAPVPVPKLLIE
FT                   QTVMTLIQHGCAWHSSTDPDVADPNQEFFEININEVLLRLRFGRYIGIAEDELGQTAAR
FT                   IVKLVLQHGKLQANDIIDRVATEMDAQHKPTSLTADAQPNRGDPPNGTANGSNNKKRKA
FT                   DSATELSALQSQVARQLTLLLYRTYLRPSSVHQHVSPRDKEIKYEAKKRRELRGIPTPK
FT                   DLQKIKEQVRAQIAEERDADWDITATTVTLGPDGLAADHCGSRRGLLRKQQSAIAVASS
FT                   ASKSKRAKTSSKSKDKTKDKNGVNGIDGVHGSACRDTFDPADDFDIDPTVWLRVHFDRF
FT                   DVHLRDEVMIDAVREKYNNTAAEVFRHLIQAGDASTNKSVRDVRSAPISITTLCHKLPS
FT                   DLSLQKGFDRRSFGKDRASLPSKQEFLAEYSAIFSHSEDVSGRSKSLRLMAPASDSTTK
FT                   TAGGSKVASTLTIEFGNLAEGMRKDLLRNVVEEKFGTAAIRIMNILREKGKLEEKHISK
FT                   LALVSISETRDLCSRLFHASLLGLQEVPKTKDRDPAKTFFLWFVDEAKCRAWLLDHLYQ
FT                   SLARLGQRRNEEMRKQTPLLRKVERSDVKMDTLGLLTEWERHSWQRLQGVLQTLTVAEM
FT                   RTEMDVFVMRDLAAGTYVSQE"
FT   CDS_pept        join(complement(749663..750588),complement(749305..749575))
FT                   /codon_start=1
FT                   /gene_family="HOG000208395" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10371"
FT                   /product="related to LST8-required for transport of
FT                   permeases from the golgi to the plasma membrane "
FT                   /function="protein binding"
FT                   /note="CELLULAR COMMUNICATION/SIGNAL TRANSDUCTION MECHANISM"
FT                   /note="protein binding"
FT                   /note="vesicular transport (Golgi network, etc.)
FT                   FunCat:20.09.07)"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0001595366"
FT                   /transl_table=1
FT                   /translation="MAARRAPARMPTQTRSPPTSAAEVHQQHQAAQAAAATQQSPQQDA
FT                   LSVLLVTAGYDHTIRFWEAWSGICSRTIQHPDSQVNRLSISPDKRFLAAAANTHIRLYD
FT                   CSIASSSSIAAANAAAGGSAAGGSGTNNIGAPAQPIATLEGHTGNVTGIAWHCDMQWLV
FT                   SGGEDGLLKIWDLRTSRATRIYDHRGPVNDVVVHPNQGELVSCDQNGSVKVWDLGQNGC
FT                   SHELVPEEGVPIRSVTVAADGSCLVAGNNTGKVYVWRFINGVYDAQQAGQPPSPAGGAG
FT                   DFTELQPVTTFQAHEKYLTRVLLSPDVRHLATCSADATVKIWSTSRYEFALEKTLVGHQ
FT                   RWVWDAAFSADSAYLVTASSDHVARLWELASGETVRQYNGHHRAAVCVALNDASLGGP"
FT   CDS_pept        751242..752576
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10372"
FT                   /product="related to MRPL3-Mitochondrial ribosomal
FT                   protein,large subunit"
FT                   /EC_number="3.1.26.3"
FT                   /function="RNA binding"
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI0001595367"
FT                   /transl_table=1
FT                   /translation="MSVNKSFMRRLRPLSQTGTSTSTPAFCNPVRCRSVSLHVRPASTA
FT                   VASTSSSSSSSASVSVAPASSNTYVHDPTPNVHLPRLARTEPEVYAAVRPPPLAAFAAL
FT                   TARLGLIPSSVDSETRDRRIRLVHQACTHPSFQTLVDQANASANLQLEPGAAVSGLTKK
FT                   QGADELDAVQFLALPSEGVEHHAALATVGNSLLGMLATEHLHLRYPNLPTRVLKAAVSA
FT                   YVGPSTLSDVGSELGLAAQNILRWNKQARAPGSGFTQNRGGRGAAPRSTNSATRTLLSR
FT                   DVAADAMRAIVAVIFQEQGLSAARNFVTSHFLSRGFNLSALLKFNDPKHALSSTCAKYG
FT                   KSPPQSRMIAESGRLSISPVFVVGVWSGETKIGEGSGSSIRMAEFRAAEDALRRLYLAE
FT                   TPLGDFDLPSCTLDHEFGGSSQVAQFQPQPIGEAEVLAAAGKNSS"
FT   CDS_pept        complement(752851..754149)
FT                   /codon_start=1
FT                   /gene_family="HOG000209034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03061"
FT                   /product="related to TFG2-TFIIF subunit (transcription
FT                   initiation factor), 54 kD"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIF complex "
FT                   /note="general transcription activities
FT                   FunCat:11.02.03.01)"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003C1B95"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA02"
FT                   /transl_table=1
FT                   /translation="MSNYEDDIEPIADPIDASSSTSLGKRPRTNQDDSNSATVDASEAY
FT                   SRLSPEPDEDLNLAEGKHPVWLVKIPKFLLQAWSALRTDDLRLGTVRVYDPDHTGHQRM
FT                   ELLLPDPPSPAVPTEPGKPKNPRWDTIPRAYDLKLTSDSAATLKRNIYAFREKLEDVEA
FT                   AASGSHMKKSEDDSDDTDDDGSGRAKKRGKTRRITALCGTVTNEAALQPQIRTSSNLDM
FT                   KPSSSSSSGIGGGAPISDSYRELLRRRRLEASTPKRTIKMLDSTDTGRHNMLVAGVGGG
FT                   LANSQKSRFNAAIASKPSKSGSGGASSTEKFARMPKNELLDMLFGLFERWQYWSLKKLR
FT                   TETQQPESYLKETLLGIADLHKRGPYVGNWSLKPEYSNMRKEQEQQQQQQQQATSKAAG
FT                   ATQANNEDEEDDFGENDDSDDDDDDEEDFDDVE"
FT   CDS_pept        754685..757639
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03062"
FT                   /product="related to MPP10-component of the U3 small
FT                   nucleolar ribonucleoprotein"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="UniParc:UPI00003C1B96"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA01"
FT                   /transl_table=1
FT                   /translation="MPSSPRKGSQPDAALDVRLPQLDKAQQLAELLAAEPERLANGDAS
FT                   LSALSVTALKQIFDYSISSEKDSVPSICSFIETISPNLELFEQRASRSGGKRKRGTNTA
FT                   RSPLFEGTPLDELVTEGMNSDQLWEQIDLKAKNLSGIVERYFLQDFLREEEENDAEEEE
FT                   HNARAGPSRSRLRFTRQEDQDDEDDDEEEEEEDEEEDGDDSMSADHDDDDEDEELDLKE
FT                   ERVRLSQLSDADLRALGVDPALRDQLLAEIDEQSEDGDDSDEEGSAYAGASDISDGDPT
FT                   EVFYEPLKTEAEQLRRKEEEEMRMLPRLRSQIDSNDDAEEDEDEEDPDDEDEEEDREDG
FT                   SDDAEGSRSSSKNSAGIPKSLLEDLDRPGKATQRSSKRHPTLDDDFFSIDDLNRQLDEQ
FT                   DAQEEADADHDDNDDDDIADQVDYFKPISGDDNLDDDDQEDEDADQETGLVNAADAHYA
FT                   DFFLPPAKAAKFNKKFGKRKASARFAQEDAAADQIDDNDDESDADPEPAAERVYEEPDR
FT                   KRRIRFNTTIEYRRIKPRKKSADELTPEMLRMIGASADDLDVARRFDEDDAQDNDEDME
FT                   MDMDEVESETSSIGRQGSDDESEGQDTDDEDEDHTRDDDAEDDDEEQAFTDGEQDDGIQ
FT                   TARRVAGDLFADSDDETDAKDKLSTHEKRVAALKDEIARLEDENVAKKDWTLMGEAGSR
FT                   ARPQDSLLEQDLEFERAAKVIPQVTEEMTESIEDLIKRRILERNFDDVIRRREMEALPF
FT                   LPSRLLELSDSKSAKSLAELYEEEYQAARGADGGDGAPMAEADAKLAKEHEEITKLYDD
FT                   IFNKLDALSNAHFTPKAPKATIQTLTNAPSVSIESALPATSSSSTMLAPEEVYERSRHS
FT                   TAMDGAKSEMTPEEKQRLHNKLRQEKRQRNEKIQDTRRALEQSGLVRAKKVNEKEEKQQ
FT                   ALKKLVGNRGVSVIGKQPNAVGAGTGKNAKNKSKPINRAANASAKPTTANQFKL"
FT   CDS_pept        758330..760054
FT                   /codon_start=1
FT                   /gene_family="HOG000029869" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03063"
FT                   /product="related to TRM2-tRNA(m5U54)methyltransferase "
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /note="DNA repair"
FT                   /note="tRNA modification"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003C1B97"
FT                   /db_xref="UniProtKB/TrEMBL:Q4PA00"
FT                   /transl_table=1
FT                   /translation="MATGAPSSPELPPAKRMRSRSPEQASACTSNDFAQAASTSTAAAP
FT                   SMSAQDKQARKADARRLRQKRKDYAKQLTKTGREPIEFDIEELLGIRKVTDILSERLEH
FT                   QLKFERGTRLTLHIERLDAHGDGLAVAPEQDWVIAVPHTLPGEKVTAEIVGNERLYSKA
FT                   KLVQVLEKSATRNDELVRCKYFGDCGGCQYQMIDYAHQLEIKRGVVEKAFARFSGLDPS
FT                   LIPRVLPTIASPNQYNYRTKLTPHFELPYELRRGRRSGVRNNASADGNGVEADHEKPKY
FT                   SVPIGFDCIGTKKVMDIEECPIATKTINKALPDAKQKVCNTIESFKNGATILLRDSLRT
FT                   YGSFAEDLLVTEERATDGQVHKELDTEVVTDHKATVKERVLTTKFESPAGTFFQNNRSI
FT                   LPSLLDYVREAITSASSTTGEDSAQARYLVDAYCGSGLFSLCLASLFREVSGVEISSES
FT                   IKYATKNAELNGITNTKFLAGNAEDIFGKIEYPADKTTVIIDPPRRGCDQEFIRQLVNL
FT                   APKHIVYVSCNVHTQARDVGQLISKDPRYKIKSVRGADLFPQTHHVEGVAVLERRDA"
FT   CDS_pept        760416..762377
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03064"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1B98"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z9"
FT                   /transl_table=1
FT                   /translation="MASALNCSARRLRLSVFTVPNASVATSWYAHCRSLSASVQRFDDE
FT                   KPPRAVASDSSATSSSSQDGPKNDSSQGNSYTPPSSASSEWPFDSSASGASGTSFEDRG
FT                   QASSSSSASTGSDTNPYKGLFDGSDPFPTIAVPRLSSNTSCSDSSPAESGKASWLSDQL
FT                   DSLTISPRTSRTSNRPSLPSSADGRKKHSIPRSVLFADSENVRQSDDFRPRRSPEFTRK
FT                   RFDRTPLTQQEANAFMSLLNQALAGTSSTSSTNTGFGTTSSDEQAQHTPFGSYTSLISS
FT                   SKTQSGSRALLQAFAKRNRLKRFEEARAQRAKRFVREGLAAQIDPLQLEAGIDEAREQI
FT                   AMCENLVELLEWTKKQVWGIASCHAPTRSENPADLARMISQTALANLSDSTDSTTASVP
FT                   PKYGKDTPFYSSVLHLVFLAIRDRYRSPQVALSVARTTRSLGIESYVLGVTGSLYNEVL
FT                   KTQWDWLGDLPGVVQTLRQARETGILSAPVKHSPTPNESAQDSQKSAYATSEDETIRET
FT                   VDRIANDVRRYVLDQQLATDAQSKREYLYGENALDLLSAHGTSASEKKTPRIGTDWSQN
FT                   WLLLNAEQATNLAGRPFRTMYKHRSRSEREQNDDHRPTRSHGAGERRSSPRFYNDAHRG
FT                   PGERYPSTASRHLDQTSS"
FT   CDS_pept        complement(762871..765186)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03065"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1B99"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z8"
FT                   /transl_table=1
FT                   /translation="MRFSSSLLLILAAITATNAASVDESAAKPILTRSAVADVSVTDTV
FT                   KANVGNSDLAHLDKLAVVSARRRGLAHGAALDAVHADVGKVELKHAASIVHTLSASLEG
FT                   QSKEANSILKIKDHKHAVKKTHKLLHSIRADLKHAVKDIHNLTGKDAAVSVEDLQQRAL
FT                   LGLLDIDLAAVVKAIDGKQLPGATSLISLLAHINVDAVLQHDVLSVLSELNVLLAIHDV
FT                   VDIATVLTAVLAVPGSVYLFDHLKQLENPGEFVDSLADIKDLNALVDAAHGGPDSLSEI
FT                   EGSANLIAYAKKYGYTSIDGILDFAGIPCVLEAVKKIPGSVQLLNSLKSVVDVPALVSG
FT                   INVLGVTDFVDSIKAVDDVEALVSVVVSITGGVLRKRAELLSGVDSTVSGLTSGLGLSE
FT                   ILKRTELLDGVQVTVSGLTSDLGLNKILKRDVLNGVDATVSGLTTSLGLQRVLSLKRAL
FT                   AHISALPNSQVASIEVVNKKRALPHDVGVEAAVVGINVTPAKLLKQRRDLLDNVDLSVL
FT                   DNLDVAQIVSLKRDIADLSVLNTKAVDEVLEAVVKRAIVESAIGTVDATTGFATGTVGG
FT                   VLDTVKRDTASDLLGGKGNAGKLANTNGLLTDISAVGNGAIGHPDGHISLSDLNRLISI
FT                   KRSGILSTVDASVESIDLAQVLPGLKRTIAAADERVTPIQRVNYTPIFERSSDKALLTD
FT                   SIDTLTVSISALLPKLVKIVAVIDVELVTKTVKSDVIPLVALVASALDKLVNIQAPELQ
FT                   TKLHAIVKVADKSVKSLA"
FT   CDS_pept        complement(767428..772491)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03066"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1B9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z7"
FT                   /transl_table=1
FT                   /translation="MGQHQSKAPCHAPFPDVPRPYPIAASGWLKASRRRKAGPSTDTIS
FT                   LPHHHFIPHQQRQRSAGPIRTRPEPSEYALRPSLPPSFITASPSHDLDYSPSKREEELA
FT                   TTKMHPTDSGTETDDSKTVRRISAHRISASPRQPPLPEESEVRKDHLVSDTAASLLPNT
FT                   ELLSAPAPSPDSDPTLSYAHRIGLIDHPDTTSLTVPAGVAYFSDSTARHASNGSGEQAN
FT                   NVVASTHSNMLRASHGGYEPSSHSMRSTSERGRNRRDHHLKARGSPMNAISSSSGRPRA
FT                   LIDKLLGVKGSAPEASPAETSSITVQAQPTEAASNTASVRTRLRSASQKPSPDRTIKRA
FT                   SAPLSFRQPSFSQLQSMKQPVESSMVSQHSPKSSPPSERQNRGLSQAGSEASLVVVGER
FT                   RSSLPQAPDHARQLDGVFSPNDTCSTRPSSTRAVNYQRSVRSTKSLTSSNASLRARYSA
FT                   ARLSGSGLSQTRADLSTRYLSSPWWRSVSLKRKGSQGLGAGHQATKHGRSAASIAQYHA
FT                   SESAWVDALPEPIRHKLENENSAISQDSTEVSTAFTEASKAKQQGGLWNWPQRPSTARM
FT                   LRFGLSRTQSGRQPRVEIEHVPPNNVARVESRVFPCSQVNVVGMANDTALTPLRRDVSG
FT                   PSTENSRQSSFSSLAPPIHPSPLPPLRRPRRAHQQAQATFRQDRSGSEDSSLTLNPTDV
FT                   NNASSSRYLHPTPALIESHPSHSSAAGSAIPETVASTATSSTAAQASTAATSVITVSAV
FT                   MVPSSSTAVTKSPLRSPAAKRHAGPFTLSPEPTTYRRLSEDSDAGTREILLSDRESVAA
FT                   PTAGSDTSARASVDELNPNIQSFYPAGAFLTGSIKPSVAAGAAAASPLSGMTEQETAPL
FT                   PLRRVGALPDMPAPLSSSGHVLSFDTVENVHGQHDSEPSRSFRSARSYRSTSDGSILPS
FT                   RPLPAVPGRSRGFSLEPVISHRDASFATQSFANDILQRPKAQEIDGLPPRGTQPPFMLM
FT                   GMVAAATSPTQPTQPTHSSPDQNSVGRGHAHCARRPSRSSTGSRTSPLMGPRPLPSIQS
FT                   RSTNAPAEQTQALLNRSSPLPQSLAVKSDAQEGQPLSSSAFHESTHNKNARSTHSLMGR
FT                   GCSWNSAEEQWSTTVMAPSSTLSAVRGTNCPEKRSSEEQVHQDIPATPVETIGYPRLNA
FT                   ESGTVNDDQDAELARLEKSRSRSRTLPRNHSSDNIELPDSTERAPYADTGVQASLAALR
FT                   ARESPGESLRTILARQRILGEPEGAMIEFLRESHILDSETCLDDQEVRAASGPRRRRRA
FT                   APYPSRSDSRYSSDELSSSGRSLSHLRVEAARRRRQRNDTSMAEPPGSWLPELSGRGSE
FT                   SSNTVLAAIRLARSIIENAAINADAALSPSLREFRGSRLNVDANVSNQTQKANASLPPD
FT                   VSPDLSRGGHDVHPKRPSHQRYVTALSHTDLTAPSEERHAQDSDRVAVLGTSETPKTDK
FT                   YKSMSFHDNTASPVSIENPVVRSNDQCFAAGLLSPPIPTVTRTVLPSLKAHSTDRSGSM
FT                   QLEPARFAARNSSLDISHTLTAITPSCEQDDRMTRRMLAHQQHQRSRSDVQSSGARSSR
FT                   FTSYQPEKSRYDAQIEELLLLREKVLQLESSMTQTSRPSFNAGFKGPSGPMSTRAGRSF
FT                   ITEGSARPGTSFVSSNRISRPSKLGYTMPDIMAWQAGLGSTANDTSPNP"
FT   CDS_pept        775287..777197
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03067"
FT                   /product="related to CDC33-translation initiation factor
FT                   eIF4E"
FT                   /function="RNA binding"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="translational initiation"
FT                   /cellular_component="cytoplasm"
FT                   /note="development of asco- basidio- or zygospore
FT                   FunCat:43.01.03.09)"
FT                   /note="mitotic cell cycle and cell cycle control
FT                   FunCat:10.03.01)"
FT                   /note="translation initiation"
FT                   /db_xref="InterPro:IPR001040"
FT                   /db_xref="UniParc:UPI00003C1B9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z6"
FT                   /transl_table=1
FT                   /translation="MTSTSIRTSSMRIAQPQQPPSQHDENAMPSSFCSSQVAATASTFG
FT                   SMGRTRSPSKLPTLSDIAARLNRDKESINPNSGSPIKPHRLELTGRIANSPKMPQLYDR
FT                   KAAVLSTSPSKMSSPADTQHKHEKATVCSSPPKVPSSGTSSPNKRMLAKGLPSLEEIRD
FT                   RMSKKGLAAGSDQTSPELASTPSSPSKVPAAEDRSVQSESKPSPVQALVAHPVKVESNP
FT                   TTSDASKSASRVAARSLSIAPTVKLTHPLPPSPAAKPACHPLQHEWTLFFDCRTAGAPS
FT                   TPTFAPNCRPLSLPHTPTQAASTWEANLRTIGTYPSVETFLSCFAQLRRPSQLERHSTY
FT                   HCFKDGIKPMWEDTRNAQGGKWTLTFRHRHPALVDRSWLWLVLGLIGEDMDEADETCGA
FT                   VCSARPRGDRISLWVRDRSDVEKVNRIGRKMISLLGVENEPGISLEFSAHSERSDELKC
FT                   ERLYSLHNPMQMARTPTMSTFGDSAKLASSAVDSPPSPRAKTRTSTSPTPNNSSSSEPY
FT                   ARLTGQTPQNTVGGGMFRSRSPAMPSCSTAGLPTPPPTGAIGALGHSLGLGLGLGLGGN
FT                   NTPAANTNDAKAGMSPLSQQSSETSAFSWRTNTANRTLSPQRKKGTTDGMRSRSTSPFK
FT                   A"
FT   CDS_pept        complement(777494..778483)
FT                   /codon_start=1
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03068"
FT                   /product="related to NADPH2:quinone reductase "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003C1B9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z5"
FT                   /transl_table=1
FT                   /translation="MSTIQALQIQSQGGPEVVQVRCIPAPTLSGSGQVIVRNEYAGVNM
FT                   IDTYHFGGLYPLKCPIVIGQESAGVVEAVDADVTSVAVGDRVVQYGGGSYTEKQLLNAE
FT                   RVIKLPESISTKTAAAAYLQGLTALTLLKEAHPVKQGDWILVTAAAGGVGLLLCQMGKA
FT                   FGANVIAVTSTEEKCQLAKQHGAIHALRYNKQDPAQYIAAIKHITQDHGVDAILDGVGA
FT                   DTWESNFEIAARKATIVTFGNASGPVPAFAPLKLASKNLKVVRPTLFNYVTTREERERY
FT                   SQELFDLIQQGNVKINVHEEYPFTTEDMRRAFADIKSRKTTGKLVVKM"
FT   CDS_pept        join(complement(781532..781684),complement(779447..781288))
FT                   /codon_start=1
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03069"
FT                   /product="probable acetyl-CoA synthetase"
FT                   /function="AMP binding"
FT                   /function="acetate-CoA ligase activity"
FT                   /function="catalytic activity"
FT                   /biological_process="metabolic process"
FT                   /note="C-2 compound and organic acid catabolism
FT                   FunCat:01.05.06.07)"
FT                   /note="acetate fermentation"
FT                   /note="biosynthesis of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /note="cell wall"
FT                   /note="energy conversion and regeneration FunCat:02.45)"
FT                   /note="glycolysis and gluconeogenesis"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /note="tricarboxylic-acid pathway (citrate cycle, Krebs
FT                   cycle,TCA cycle)"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003C1B9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z4"
FT                   /transl_table=1
FT                   /translation="MVEADVPEVPTYDVPSRLLGKDGRPVPHVDAAKYKAEYPDSINNT
FT                   DEFFGKVAKEIIDWDVPFKTVRSGGFENGDVAWFNEGRLNAAYNCVDRWAHKYPDRVAI
FT                   IYEADEPGQHQEITYSQLLIQVSQAANMLKSLGVKKGDTVIVYLPMIPEAAVALLACAR
FT                   IGAIHSVVFAGFSADSLRDRTNDCGARVVITTDEGKRGGRTIATKSIVDAALKECPGVE
FT                   HVVVVKRTGGQINIDDKRDIWWHEACSRERAFCPPESVSSEDPLFILYTSGSTGKPKGV
FT                   VHATAGYLLGTALTLRHVFDVHPDKGDRFACMADVGWITGHSYIVYGPLMNGVTTLIFE
FT                   STPVYPSPSRYWEIVDTHKLTQFYTAPTSIRLLRRLGDEHVKKHDLSSLRVIGSVGEPI
FT                   NPEAWHWYNDNVGRQQCAIVDTYWMTESGSIMITPLPGATKTKPGSATLPFWGIKPVLL
FT                   DPTSGNVLEGNNVEGVLAIAQPWPSVARTVYNDHQRFLDTYMRAYKGYFFTGDGAARDK
FT                   DGYIWIKGRVDDVINVSGHRLSTAEIESALIQHPGVAETAVVGIPDEVTGQTIAAYVTL
FT                   KPEFSYDSEDALTKELVIQVRRNIGPFAAPKKIIIVSDLPKTRSGKIMRRLLRKCASHD
FT                   TDNLGDLSSLADPSVIEHIKEKTNAFDKK"
FT   CDS_pept        784586..786475
FT                   /codon_start=1
FT                   /gene_family="HOG000231935" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03070"
FT                   /product="Protein CLP1"
FT                   /db_xref="InterPro:IPR010655"
FT                   /db_xref="UniParc:UPI00003C1B9E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4P9Z3 "
FT                   /transl_table=1
FT                   /translation="MDGQAEGSSQYRRVHLPPRSEYRFELEPHERLSIRLVQGRTQSGE
FT                   DPDAEIFGAELVGGSQERWYPFGDEAKAAVSSWRGAEIEVAGSASTEYLAEEPSPVYTA
FT                   YSNLHLYLERKRIQARQALRADAKLLTTLASSVLDPSYIAPRTTDPNTETESDPSGTAA
FT                   ATVYRPEGQGPRVMILGPESAGKTSLVKLLANYALRSPAVASLGKGEAAKVAESLRTGG
FT                   DGIIYPNMEDNLSEEAKKQKREEEKRSDITGWWPVVVNLDPSDGAPPLPCCLSALPLSP
FT                   LPLASLPSASPAYAFGTNTSTTGAIPPGTSTAHGVAPLSLWLGKENLRENERHFRRVVD
FT                   WLAEGVERRFARDFRSRMSGLIIDTPGVITADARNKYAFIQHCVKAFKVDTIVVLGHEK
FT                   LNLEMTKLFASPAVTTVETAEIPGSAGQRLPRVNVIKLPKSGGVVELDETYRSRLKALQ
FT                   VKTYFYGGSTSGSANTDGGVPKPVLPGHSDPLGGVPSLSPYSTTIPFDLLEIYKVGQES
FT                   LAPSSALPIGASRTVTETQLVKLDPTNSAADQTSLLHSVLALIQPPRGGGGAGQPDSST
FT                   NPTDDEIIGAPILGFVHVADIDTVRKKITVLSPSAGRLPSKTAIIGSLDWQDV"
FT   tRNA            join(786886..786921,786963..786997)
FT                   /gene_name="tRNA-Gly (UCC)"
FT                   /locus_tag="um14001"
FT   CDS_pept        complement(787674..789407)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03071"
FT                   /product="related to enoyl-CoA-hydratase"
FT                   /function="catalytic activity"
FT                   /biological_process="metabolic process"
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="endocytosis"
FT                   /note="fatty acid metabolism"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniParc:UPI00003C1B9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z2"
FT                   /transl_table=1
FT                   /translation="MSDKRINTANARLGQVSGQISSTQPVAMSTSSANRASASASASAG
FT                   GSVDDSKLVKLLSEGGLRTILLNREKALNALNQEMVDLINSALDVCTHSSNCNVIMLRG
FT                   VGRALCSGGDVLAVVKAADSSDPKVRNTALDFFQSEFQLDYKIARLGEAANAHSAGAGA
FT                   EDARTLAERKGSELKKPKTFVSVMDGITMGGGVGLSVHAPFRLATERTLFAMPETGIGY
FT                   FPDVGVTRVLARLDGSIGQYLGMTGARISGQEAYLVGLATHYVASSSIDAIAHRLSTLP
FT                   AESALNPSLVSSALHEYSADPLSAVETIEKSAFFGDRRIALDYVFGQLSCESILGCLEE
FT                   ISSAQADSQAASELALLGLRSITPEVQQWAAQTLGDLKTKSPRSLKITHQAILEARRFD
FT                   VEEAFRFDMRLATAFCDLSIGRDFYTGVTHVLERDPKTGKRRTGIADWEPASLDKVSDT
FT                   QIRAQFFADLETARKAGLQLELPQLDSIPNPLTSKEARQARDSLLRGKGPLKWEQSHNV
FT                   FALPSEAECAALLEGNHPAAAAVKPDSSELVDCLKRHKGTLPGLEFKVRDWIERLDRRR
FT                   V"
FT   CDS_pept        join(790428..791014,791100..791145)
FT                   /codon_start=1
FT                   /gene_family="HOG000229253" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="rib4"
FT                   /locus_tag="um10373"
FT                   /product="probable RIB4-6,7-dimethyl-8-ribityllumazine
FT                   synthase"
FT                   /EC_number="2.5.1.9"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /cellular_component="riboflavin synthase complex "
FT                   /note="biosynthesis of vitamins, cofactors, and prosthetic
FT                   groups"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniParc:UPI0001595368"
FT                   /transl_table=1
FT                   /translation="MASIKGPAPAPTSFPGADKLRIGIVHARWNEECITPLVKGCVDSI
FT                   TKAGVKPENIVIESVPGSWELPFGVSRLISASQVQASSNVSDLMGATSLLDDSKPATPT
FT                   TSSATAGKASKAALDAVIGIGVLIKGSTMHFEYISESCCSGLMRIGLDTGVPVILGVLT
FT                   ALTEDQALERSGVGRGANKGHNHGLDWGSAAVEMALKTNRWAEGKLA"
FT   CDS_pept        791856..792560
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03073"
FT                   /product="related to GTT1-glutathione S-transferase "
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI00003C1BA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Z0"
FT                   /transl_table=1
FT                   /translation="MSASDSNRTLFYLENSRAFRVAWVLEELSLPYELRHYSRIDGKRA
FT                   EASMKTDSSNRLGKSPYLIDGDVRLGESSAIVKYLIERYASSRERSQLLGSLDSWQERG
FT                   DIEAWISFSEGMMVHTLAAVYPRWFADPTTAHVIEDSMTANIQNNLNLLESTLSAPNAN
FT                   AYLVAGRLTAADIMCAFSAEYTFYMDTGISSAGKRKEDWPKTVEWLKSLSKLQSYRNAL
FT                   EKGATNKFAISY"
FT   CDS_pept        join(complement(794257..794308),complement(793678..793851),
FT                   complement(792904..793178))
FT                   /codon_start=1
FT                   /gene_family="HOG000261245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03074"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   beta"
FT                   /note="protein binding"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="regulation of C-compound and carbohydrate metabolism"
FT                   /note="transcriptional control"
FT                   /note="translation termination"
FT                   /note="unfolded protein response (e.g. ER quality control) "
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="UniParc:UPI00003C1BA2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4P9Y9 "
FT                   /transl_table=1
FT                   /translation="MVLNQEKLAKLQAASRTGGKGTPRRKMAPKPKGPGGEDPKLQAAL
FT                   KKLQVEPVSGVEEVNMFKEDGNVLHFAAPKVHGLPTSNTFAVYGNGVDKELTELVPGIL
FT                   NQLGPDSLASLRKLAESYQAMNAQHAASQAAAAGTKDDDDVPDVVENFDEADKKETEVD
FT                   KLD"
FT   CDS_pept        join(795872..795895,796182..796362,797093..797166)
FT                   /codon_start=1
FT                   /gene_family="HOG000157483" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10374"
FT                   /product="related to TIM11-subunit E of the dimeric form of
FT                   mitochondrial F1F0-ATPase"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /note="anaerobic respiration"
FT                   /note="assembly of protein complexes"
FT                   /note="electron transport and membrane-associated energy
FT                   conservation"
FT                   /note="electron transport"
FT                   /note="energy generation (e.g. ATP synthase)
FT                   FunCat:02.45.15)"
FT                   /note="homeostasis of protons"
FT                   /note="mitochondrial transport"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="structural protein binding"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniParc:UPI0001595369"
FT                   /transl_table=1
FT                   /translation="MSSSPVLNVVRYSALVGGIGYGILHRRTLQAKADVKAAHAEYKHK
FT                   EQLIQKAKEAYKNKLVAKQSDSGIVTDPENPAFDLEKFLTKLEQDSK"
FT   CDS_pept        join(798876..799080,799200..800926)
FT                   /codon_start=1
FT                   /gene_family="HOG000135967" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03076"
FT                   /product="conserved hypothetical protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI00003C1BA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y7"
FT                   /transl_table=1
FT                   /translation="MLLSRFITTAIALAGAVSACPGIDHAQGLAPRKVDHSIQPSGGNS
FT                   LLRELTWGDLAVIATTDIHGWYMGHMKKSYPEPNYSGDWGDFASFVKHMRKLAKKKGVD
FT                   LLLVDSGDLHDGAGLSDGFPAGQVDGQVSNQFHAKVKYDLLTVGNHELYKYNVAWNTLQ
FT                   EFVPEARSRYLGSNVNISHAAPRGGNNVSYTYGERFVKFKTDHGRKVTSLGVLFNFTGA
FT                   DSGITVQDPAQMVLEPWFIDAIQEQPDVFLIAGHMPVRKDQFPVVVNAIRKVHPITPIM
FT                   ILGGHSHIRDCTQYDKYSMGIESGRYLETIGWMSMNFTNNGPTFSRTYIDANRRNYAFH
FT                   AGLAAKPEKFDTALGRKITKQMNQVADAWNLSHVYGVAPQDYYLQRVPINDSSSLINFM
FT                   TNKVLPTVISTSNPERKGVPNIVIANTGSQRFDLYAGPFTKNDQYIVSPFTDAFQYIKD
FT                   VPYKYASQVIHKLNGDRVAQATSRRRDLEGAESEQELYAKGHVSHIYNRWIQDQHVFAS
FT                   AHNAAARDLAILDARAAEAQANRTLGYVTKDQCPGDGDDTVHSAIPFASVPDYVQSPVT
FT                   GQNVSDTDKVDVIFLDFIAKNVVRILNSVQTETTYSLSDVAAYNQYTTQDIYPLYAEQI
FT                   WANNSTSA"
FT   CDS_pept        join(801294..802184,802290..802496)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um12207"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI000159536A"
FT                   /transl_table=1
FT                   /translation="MDSLERTTATAAATTSSSGTPPPSSAELMLALSQIQQLIPLLDYR
FT                   PGGLTHLLPTLLTPLLPNDAAAAESVQRYRANVDHAFRVAAELVGRVNDSASVGNALNL
FT                   AETLMREGDEKARLLRVRKKRRLFVEQEKVLEANHWGPPVPSRVAVASKIASATESKQE
FT                   AEQADQKPAQITAFLPSQNPTKVMLSPAQQNLPSPTHARAVQSYLIALHSYLQLTVEKG
FT                   LAPPTVALKQVRARILAFAPGGFTLEVQVAQVMKACIEANLTFVTKQQAERQELLPLLQ
FT                   SVDVAALTLGAVNESITSTTPSAYPIFRSLATEILAHTHRALSPSLRNNDTLSSTDQDS
FT                   LVWIAYKPITETVTRLILAAAQLQA"
FT   CDS_pept        complement(802582..804867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03078"
FT                   /product="conserved hypothetical protein"
FT                   /function="diacylglycerol O-acyltransferase activity "
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="UniParc:UPI00003C1BA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y5"
FT                   /transl_table=1
FT                   /translation="MSTAAAGSLDTASPAAKVKGSEAASPSTDAIKSVKFKSPKSSPNI
FT                   QSSSRFARINGISNGNDDGHTHNHGAETPPTTSKAFFPLFPGIVSALDESPWSSGHNTP
FT                   TLSTAIHNVAEHTEDAIQRVAATQPNGGIMERVAKQAINIADYIERLLQWEIFSRVNAI
FT                   GGLDNMWLLIDGISSLNPVCTATYTFKNPAKLDKLKEAMLEQIGHFPKYTQRLADVGRF
FT                   FHGTVFINDEDFDIDRHIRAYSLPGDAGTRELEAFASEFIAKGWDYSRPLWEVAVLENF
FT                   VDEHSGAKGACVIRGHHTMADGQGFVMSQLLITSLGPKLGSMMADGAQLLSDAKRGKAL
FT                   PSRMNKKLASLDRFHGTIALRLVMMALYWISWLVNLITDIAGCFTLAISTTFFFVATFW
FT                   RQRYVTASYDGPRKQEKEFSVSKSFTLADVKLVSKAFSGVEPGTLLDKVQGGKRFSRPL
FT                   IGTHLTVNDIICTVIADVINDELDRRPLQPGLLNKIRHYSHKILPSQIGILIPISIREP
FT                   GDWSLRNLSTAGIAYLPTTRGLSTDVKVLYRRLHTTHKRLNILKHSLLPKICFYLIQLT
FT                   GQIPAILPIPFGLLPKHRFNVLRWPTVWVVERILTSVTAVVTNVPCPSKQRIELAGQEV
FT                   VRWTALPPQAGKGTLGIGICSYGGDFSISISADRVEGSQGAAARLTKSFERRWEEYVET
FT                   SRRLIPKTDSESKGRKEKRSSSGAKDVSEKEGSAKRRRSSASASSASSASSTSSASKDM
FT                   SIIGDKQE"
FT   CDS_pept        805518..808658
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03079"
FT                   /product="related to TAF5-TFIID and SAGA subunit "
FT                   /function="protein binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003C1BA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y4"
FT                   /transl_table=1
FT                   /translation="MPASTAATSLAADEKTASKDKDKKASDSAIQTPKDATTPLPSTSG
FT                   ATASATPAHETSVGSVFSNPDMTAAVLAYLQKRGFDRVEAAFKAELDALASGATAEQAA
FT                   AAADVLGRAPTVGLEDLAAKNAPRTPADKDKEKDKDSDKDKDKDKDKDKDKDKDKDSDK
FT                   DKDKEAVDGPNKDKAAAAAAETDLTFAEDGDVSAAATQALLLDPTDRARGFAMLKSWCH
FT                   GSLDIYQPELLPILLPLFVHSFLDLVLMGHGPAASALYTAHAPSFFPTHTALLSQIRSL
FT                   ALPSHIQSDPLAQRFRSERYVVKMSSTVFSLLLGWLTDGGGPVSSASNAIEEAEGPARR
FT                   GREAMLKIINERCRIQVLAAQPYQIDAAVLEEGTGLTGAGPTYSSVTAGASGRSRIHSA
FT                   LAKNAVSEGDALAEFNAKAAGPQLKLHPTVPLTERLETEVQKELQEVERREKETVAAVQ
FT                   AEEEKNKDAAEASSATIASVGATQDGGETAKTAAAQQQDGDTTMQDATSTADAGEDGGD
FT                   AASRARTASVHPSELPSSARETAPPASAAEANSVSGGTSSGPDFSVGLLAASVSDLPPQ
FT                   APTFRTVDVKREVQRVRDARKRIRLDPSLLYGSSATLSAFTSGVRDPAINAMGEQGANA
FT                   ARVAALPSVCAYTFHDADDGITCSTFSDDITLMAAGFEESFVQVWSLKGEKLRAIRGNP
FT                   NLSSIRDSRTLAKQREAEGYSTRRLIGHSGAVYGVDFDPVGGSASAPRHVLSCSADSTA
FT                   RLWSLDTYSALVSYRGHQHPVWDVKWSPIGTYFATASADKTARLWSTERINPLRMYAGH
FT                   LSDVDCLTFHPNSLYLATGSSDRSCRLWDVQRGACVRLFVGHQSPISCLRISPDGRYLA
FT                   SAAAGNGTASQFAGVDGIDPTSQGGSINDVSISLWDLASGRRIKKMWGHSERIYSMDFS
FT                   ADGSLLVTGSADRSVRCWDVRAVGGNRKVATKGSLEAQQISDAAALGVQTAAATTQAQL
FT                   SSAGLTNAAIAAGQINAADMVNSSADCVATFHTKRTPVLDVHFTPRNLCLVAGVFED"
FT   tRNA            join(complement(809034..809069),complement(808964..808998))
FT                   /gene_name="tRNA-Gly (UCC)"
FT                   /locus_tag="um14004"
FT   CDS_pept        811385..812380
FT                   /codon_start=1
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03080"
FT                   /product="probable serine/threonine protein phosphatase PP1"
FT                   /function="hydrolase activity"
FT                   /note="DNA conformation modification (e.g. chromatin)
FT                   FunCat:10.01.09.05)"
FT                   /note="budding, cell polarity and filament formation
FT                   FunCat:43.01.03.05)"
FT                   /note="cell cycle checkpoints (checkpoints of
FT                   morphogenesis,DNA-damage,-replication, mitotic phase and
FT                   spindle)"
FT                   /note="cell growth , morphogenesis"
FT                   /note="cellular signalling"
FT                   /note="chromosome segregation/division FunCat:10.03.04.05)"
FT                   /note="heat shock response"
FT                   /note="meiosis"
FT                   /note="metabolism of energy reserves (e.g. glycogen,
FT                   trehalose)"
FT                   /note="modification by phosphorylation,
FT                   dephosphorylation,autophosphorylation"
FT                   /note="phosphate metabolism"
FT                   /note="rRNA processing"
FT                   /note="regulation of C-compound and carbohydrate metabolism"
FT                   /note="temperature perception and response
FT                   FunCat:34.11.09)"
FT                   /note="transcription termination FunCat:11.02.03.01.07)"
FT                   /note="translational control"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI00003C1BA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y3"
FT                   /transl_table=1
FT                   /translation="MADNTTLEVDLDNVIDRLLEVRGSRPGKPVHLEEYEIKYLCLKAR
FT                   DIFINQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
FT                   TICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPI
FT                   AAIIDEKIFTMHGGLSPDLQSMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDISGWSEND
FT                   RGVSFTFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNA
FT                   GAMMSVDETLLCSFQILKPAEKKQKYAYGGINMGRPVTPPRKQKKKSDGK"
FT   CDS_pept        complement(813097..817143)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03081"
FT                   /product="related to ARK1-Actin Regulating Kinase "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003C1BA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y2"
FT                   /transl_table=1
FT                   /translation="MSQYGQAYQAQPYDHAGQRNSPHQPGYAQMQGQTQYYQQQSQQQQ
FT                   QPQQPMPPMAGAYQQPYKGTLAPGTRVKVGSITVTVKRYLSEGGFAHVYLVTTSQPIPM
FT                   PSSVTGAVSASMAGSATAERGETVHVLKRMAVPDKAALADVRREVEVHKLLRNQANIVH
FT                   FIEASATSLQGGGYEIFILMEYCAGGGIISLMNARLRDRLREEEVLKIFGDVCAGVAVM
FT                   HHLDPPLMHRDLKVENILMAPSTEPGIIPGSRSTSSNLKATYKLCDFGSAAPVLSRKPA
FT                   KSMDEVKRVEADLNKHTTLQYRAPEMVDVYQRRVIDEKADIWALGVLLYKLCYYTTPFE
FT                   ENGGGPLAILNVQYRIPSQPVYSDRLKKLINSMLKEQSTDRPTIDQIIIDVHQLLGTRP
FT                   PQTALHYASAAANGKIATPLPTLVSGAATSPMSGAASVPAKPSPAGGIDANLISMGPSK
FT                   KELEQAEARQLELQAQSITPMRRGRPTKAPAEHIDPPAKKLDDVLIKSASPTSSAQEAS
FT                   ATSAPLWKVPDSKPSSVKTGLLIEGFGDSFAPAASTSSSSESPPVLPKRPTPSFVSPEA
FT                   SGGAVNASERPIDKNLLRASTSGAPSPALTPLRHSPALPGFSIAPSRTASPVSPASKDA
FT                   PRPPSSQKIGTPRDELTDRFPSLEDLDAKYAIPASSSPSSPAAASAASVASAPSSLASG
FT                   AAAGDKGHVNVPGLANRASVGAMTSRFERPFEPQKLGSVRTPLSKSATVSALSSSDRSS
FT                   KARSGSVSNRWQPSVIAHDRVSKEQPSQLSGAVSLRKAPASKDWLTGDMSDQEDDPNAA
FT                   SRADKREEAKMYATKPQDPSSKASAIQRDAAAQEIEVEEASSDEDEPAQPEEAVAQRPS
FT                   LPPRLSADRLSSFLVRPSASHTQSDQGDNVVNGASSKPERPRVVPGRVKAPSWLVDAVD
FT                   SPTAAERLISSSSVLSPGGVGSESLKSPVPDSLASPITDASAAEQLDEAARQAQDQLEA
FT                   LLRGPAQDTLASDDATVPTKQGSEQEPAEEPSPTLASVAKVKAPAWDDEDEENEREMTA
FT                   LPQPDLRASVVGKPSGIVAMSQHLDERKKVEVEAPTKSSCTYQIGSRWKPSVQQQARSQ
FT                   PKQTQLVDATTWSAGACESSETVKDLSDTVSLDRQTGRTEAEPATTARNVAVRPSDIVA
FT                   QRQQQYGVGSGGAAEAVEIQPKRPTPMRPHKGAHLRGGSGAVGTGGMKPWEREAAQSAA
FT                   AVKAGIVKSSALPAASTMRLHSADEHESTDPIRRTDAPIASRDEERFKGVSSLISRWQH
FT                   NVESNAPGWGHIGTTTPKTLPPIPTRLTHFRLIYHLEPHRLIPASTTSHPQVYPRMLIS
FT                   ICSPV"
FT   tRNA            join(817513..817548,817580..817614)
FT                   /gene_name="tRNA-Gly (GCC)"
FT                   /locus_tag="um14002"
FT   CDS_pept        818453..820438
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03082"
FT                   /product="conserved hypothetical protein"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniParc:UPI00003C1BAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y1"
FT                   /transl_table=1
FT                   /translation="MRHSLLLPTAQYIEHGQSGAPIVGLIKVTASSILEVVILSSVGYI
FT                   LARRGIIDKRTQTKINKLNVSFFTPALLFSKVAFTLNPARLAELIIVPLGFVIVTAIST
FT                   LSALVLSWTARLSPAQRNFAIACAISPNSNSLPVALMQSLVATVPQLHWDEQGEPEDTV
FT                   DGMLGRALTYLVLFSTLGMFLRWSVGAKLLSSVEEDTVEDNSQTEPQPSSPCSGSETDH
FT                   HPSRPQITLRRPTGERRRQERKRSGPPAWARSFPNSPYASSASSANFGAARGDDGRDSD
FT                   DEDEPLEAYEEEGQITLPGASNSRENRSCWKVFKTTTYKWFHNFVLRPLYAIGGFMTAP
FT                   LYAAVISLVVAVIPPLQKFIDSLEPVVGALESAGACSIPLTMVVLGAYFVADVSAVQQS
FT                   QGSIPKAVPPSAPAGDGSTSAMGPQPTAPTATSKSANDSGSDVDDPWRRTSLESSSASG
FT                   ESTLVPVKDTKRKGLGSWNPWNSGSSSGGSDIEEGGGRFTDEPSSYALASESSSARNTL
FT                   VAGNDEAARNADLNSRNSAGRFQNALSKQVSASNMERRTIAVAISSRMILTPLILLPFL
FT                   AWYAMATASNVMDDPVFVACACLIIGSPPALTLAQITSQSAQGNPSFERLISRTIFTAY
FT                   TFLAAPTTILLVLTALVITENDKNKG"
FT   CDS_pept        join(complement(821507..821578),complement(820686..821396))
FT                   /codon_start=1
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03083"
FT                   /product="conserved hypothetical protein"
FT                   /function="phosphatase activity"
FT                   /biological_process="metabolic process"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003C1BAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9Y0"
FT                   /transl_table=1
FT                   /translation="MSHLKYADAKYVFLTDFDGTITLLDSNDHMVDTVGMGYTERRKIN
FT                   VEIVEERLSYREGFKKMIESVHRPFAEMEELVRRDVTLDPGFKEFYAFAKANNIPVIIV
FT                   SSGMTPIIRSILSNLIGEKDANEIDVISNEVKFTDPEQKGTTWELVYRHPDNHFGHDKS
FT                   LSIAPYRELKNRPTLFFAGDGISDMSAARHADVLFVKDKEDNDLATYCRTNNIPHHMFK
FT                   DWTIPKKMLEQIISGELKIEDVAGKSSDNGDFKPASQA"
FT   CDS_pept        join(complement(825230..825239),complement(824831..825148),
FT                   complement(824462..824522),complement(824269..824362),
FT                   complement(823123..824184))
FT                   /codon_start=1
FT                   /gene_family="HOG000209050" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10375"
FT                   /product="related to HRB1-Poly(A+) RNA-binding protein,
FT                   involved in the export of mRNAs from the nucleus to the
FT                   cytoplasm"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000159536B"
FT                   /transl_table=1
FT                   /translation="MSEVEYNQENTHYAEVDNFDRDAMSQTRARSRSPVAGGAPSSDRR
FT                   DRDRTDRTDRTDRSDRPRSFNDRAIASQHAATQASRKSQKNCRVYVGNLSYGVKWNTLK
FT                   DFMREAGHVVFSEVLTLPNGSSKGCGIVEYSTPEEAQKAIREMTNKQLEGRQVFVREDR
FT                   EDEVRYGTSPGGPPRGGGRGGLGGSSGRGSFGPPVRGGFYGGPPPPPYGGFGGGAPTQL
FT                   FIGNLPFDVSWQDLKDLFRSAGNITRADINMGHDGRSKGSGIVAYADSNDASNAIAMYH
FT                   GYEFRGRMLEVRLDKFASAPPMDPYGRAGYGPPPRGGRGGFGGAYGGRGGYGGRGGYGS
FT                   GYGDPYGGGYSHEAYGGAYGGGYGGGYGDRHGAAGGYSTRASGPTSARAPAPPAAPSQQ
FT                   IFVKNLPWSTSNEDLVELFQTTGKVDEAEIVIGGGRSKGCGVVQFATVEDAETAIAKFN
FT                   NYVYGGRPLDIEFNRRWTKFGTGGGSVNGGNDGNAPMVEVSAQDDEDGDAPVPMQG"
FT   tRNA            join(complement(825785..825820),complement(825719..825753))
FT                   /gene_name="tRNA-Gly (GCC)"
FT                   /locus_tag="um14003"
FT   CDS_pept        join(826427..826955,827053..827144)
FT                   /codon_start=1
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03085"
FT                   /product="probable manganese superoxide dismutase precursor
FT                   (sod-2)"
FT                   /function="metal ion binding"
FT                   /function="superoxide dismutase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="superoxide metabolic process "
FT                   /note="cellular sensing and response to external stimulus "
FT                   /note="detoxification by modification FunCat:32.07.03)"
FT                   /note="heavy metal binding (Cu, Fe, Zn) FunCat:16.17.09)"
FT                   /note="oxidative stress response"
FT                   /note="superoxide metabolism"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="UniParc:UPI00003C1BAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9X8"
FT                   /transl_table=1
FT                   /translation="MSEHTLPQLPYGYNELEPAISEEIMTIHHTKHHQLYVTNLNNAIK
FT                   AYNSAISSNDVRKQIELQSAIKFNGGGHINHSLFWKNLAPASQGGGQLQDGPFKQAVER
FT                   DFGSLDNLKSTFNATIATIQGSGWGWLGFNPKNSKLEVVTTKDQDPLISHHPIIGVDAW
FT                   EHAFYLQYKNVKADYFKNIWSVINFKEAEERFKAAQTDAKARV"
FT   CDS_pept        join(complement(827431..828615),complement(827214..827339))
FT                   /codon_start=1
FT                   /gene_family="HOG000204444" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="UniParc:UPI000159536C"
FT                   /transl_table=1
FT                   /translation="MPSQEDEEQRLERLHFANVLKAFDDYLPYCLLANDARRKSFFSLP
FT                   RAHQHLLSEVGQSLSLPELPNGPPQIPKARGFKSRLEEIDDRIRRNADLLSLIADESRG
FT                   FLGLDALGEEEDAVAEESQAGHDSQRGANSSTDSSSGKAITGSSSRGGRKRRRLAGHEI
FT                   DKIQSTLKQVVRDWSREGEPERSAVYSPLMEAVSQRYGQIPFKDRWHVRILVPGAGLGR
FT                   LAFEYAAQGYSCQGNEFSFYMLLASHYILNKTSQVDEHTIYPFVHSSSNWRTADDMLRP
FT                   IRIPDVLPSSLPQTSEFSMVAGEFCEVYSKSDEKRAWHVVATCFFIDTAKNVLRYLETL
FT                   NHVLPIGGYWINAGPLLWHFENSGNSRGGTGDNLSIELTLDELVQLLPKMGFEIEERRE
FT                   LSPTPYTGMLNGMLQYHYLPEFFVCRKIRDVEAAPAV"
FT   CDS_pept        829553..832162
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniParc:UPI000159536D"
FT                   /transl_table=1
FT                   /translation="MDENGNIVYEGSSYEDTASDFSNDADAEELKQHRRTYREATQQYR
FT                   KSRRALLLSGFSSFASSPSSEELGTVSPTERDNSSQSPPASIYNPRRSSNAQDSYYQPH
FT                   LAEAVDSADAGGRADGLRFDYDSGGDTSRYVRASESHAHTPPQIKPEPQDFSKHAQVLD
FT                   NEAFLTPTGIPSNQKTPNGKFIDSHLMNGAVFDQHCARPFPPARTHSSRLSQSTLMTPS
FT                   PAQRAGEISSEGLQKRHSSQDLTPSPPILEHEAREPTEAYQTPRSSFAAVCEDIKFDRS
FT                   IMQDPLFEQRNKEEQTGPDAATVPRRQDHTPFSLWDYLKEEVLATDFDATQEMKWERVT
FT                   NFISIPFWMEKIIMFGFIVCLDSFLYTFTILPLRFGVAMWAWISNSARWILGGQKRYLH
FT                   SSHKCDILKMLLIILTCFILSRITDASKMYHSVRGQDVVKLSVIFNVLEIADRLCCSFG
FT                   QDLLDSLFSRSTLARRKNGKQPYLRPIGFFCLSLSYVLAHTLVLFYQLVTLNVAINSYD
FT                   NALLTLLLSNQFVEIKSSVFKKFEKENVFQMTCADIVERFQLTLMLSAIGLRNLIELSG
FT                   GSVEPSASPLPASFTVFPSLSLLETVLTPVCIVLASECIVDWLKHAFITKFNHIRPAVY
FT                   GRFMDVLCRDLVVGGPSSKENSRKHTFVDQSPIISRRLGFAALPLACLLVRLILQIISM
FT                   IGDTSHIDEFIDPVSPRISETGWIGVVARKLGASDIDNDWVRALDLFVRGSAWALTLVL
FT                   AWAFLVAIKLLLGTNLVSFASHRYATMHEREREEDLNARDRAPIGTNKDERSYEKSLGR
FT                   FIDKPDDDAILIKLDGTHVPPTPKDKDKAKDGGQQKAKQENSLMEVSRYNMVRSRIW"
FT   CDS_pept        join(complement(833042..833412),complement(832870..832942),
FT                   complement(832263..832778))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9X5"
FT                   /transl_table=1
FT                   /translation="MVQDKLALALIGERLGYWSRSPLHPIMLPVGALALVHAIRVSHAT
FT                   RQVAGSHKYCLTLWQGFLLNQILMFGGVIVSGMLLGISSPLLTACPVVALYGGMHVLLD
FT                   VVPIGKLLLRAQDSGVIGILMDLSFALLDGILRAEGIIDLGVEPVLRHPSPEISTSIFA
FT                   VLINSAIIGGGVPLLIDLLKLDSPTGEWGIRTPSWANNPFKGTNDIFSASLLGFVYLVL
FT                   SSSSVPAQFPFVYGVVELFGLDKLSNTEVRTFCSLLLGALLLAEKATMLLTAVRPVSKP
FT                   IATRTRDAVAPLKTPTARKIDTVNGSVKHRKQMSRKQQ"
FT   CDS_pept        complement(833713..834966)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3"
FT                   /locus_tag="um03089"
FT                   /product="Pre-mRNA-splicing factor SPP2 "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI00003C1BB1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4P9X4 "
FT                   /transl_table=1
FT                   /translation="MAGSLRDRAHKPSTRPRAFDDSDDDDAGLLASSSSRHEEEIVSFG
FT                   RDGAKGRGASPVSDAPRVIPVTSNLDWRQDRKERLGRASNLQALGPLVSMRRAGASAVP
FT                   GLASSSSTNDDINIDAINTEAQKRGLKLRSSKVTRADDTPQQLSGDVFDEQTADASAVP
FT                   KASADVAGEDAEAIKALLAGQGNDSAGTGGQLIIHQETESELLQHDIDSRPEAPTLDDY
FT                   AATPIDQFGMALLRGMGWKEGMGAGKGGKGPQQAAEPRKRAALLGLGAKERPTGPLNLS
FT                   KPSSSSGNLQPKDKRDYKYVPVSKSDPRDYSNGRSPSSDHQPREKRPSKSHSTDLPSSH
FT                   DSRRGDRDDRHARHSRTSHRQRSRSPTRSGVHDRDRRHERRRDGRDPERRSHPSSRSDR
FT                   DRRSECDRDERRSSGHRR"
FT   CDS_pept        836491..>837993
FT                   /codon_start=1
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10378"
FT                   /product="related to DIP5-glutamate and aspartate permease
FT                   (N-terminal fragment)"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /biological_process="amino acid transport"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="membrane"
FT                   /note="C-compound and carbohydrate transport
FT                   FunCat:20.01.03)"
FT                   /note="amino acid/amino acid derivatives transport
FT                   FunCat:20.01.07)"
FT                   /note="cellular export and secretion"
FT                   /note="heavy metal ion transport (Cu+, Fe3+, etc.)
FT                   FunCat:20.01.01.01.01)"
FT                   /note="homeostasis of metal ions (Na, K, Ca etc.)
FT                   FunCat:34.01.01.01)"
FT                   /note="lipid/fatty acid transport"
FT                   /note="mitochondrial transport"
FT                   /note="non-vesicular cellular import FunCat:20.09.18.07)"
FT                   /note="osmosensing and response"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000159536E"
FT                   /transl_table=1
FT                   /translation="MSSPANQAINALAPDMEKSAYPSSDNLEKGSTDQVALDRLGLNKD
FT                   SPDGHVQRNLKQRHLSMIALGGTIGTGLFVGLGGSLSSAGPVSTLIAYLIMGVVVYSMM
FT                   VALGEVSTLLAVPGGFTHHASRFLDPSLGFALGWTYWYSYGITIPTEISASAIVIQYWD
FT                   TSINPAAWISILLVLVIGVNFLGVKYYGETEFWFCLIKVIAIIVLIITSLVIDLGGGPR
FT                   GDRLGFRYWKDPGPMAQLFWTPDPETGKPLGGISGATGRFLAFFNVFVAAAFSFAGTEI
FT                   IGVAVGETENPRKNVPKAIKRVFWRILLFYVLAIFMVGLVVPYNDPRLLNGGSDASASP
FT                   FVLAISNAGVRVLPHIINAVLLVTCWSAANSDLYAASRTIYALALENKAPAFLRKCTKG
FT                   GLPIWALTVTSLFGPLAYMSCGSGGAEQAFEYLYDVSAISIIIAWIIILCTYARFYHGL
FT                   KYHGIARKTLPYTAPFQPYLTYFGIFFLSIVLCLLVSRVHDGQ"
FT   gap             837994..838093
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.103-um_contig_1.104"
FT   CDS_pept        complement(<838096..838953)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11943"
FT                   /product="conserved hypothetical protein (N-terminal
FT                   fragment)"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000159536F"
FT                   /transl_table=1
FT                   /translation="MVVSEEYKDLRVNHQTAGRFLVLTRDCSCFPSQQLPGEAVMSVKL
FT                   LTPLCNGISATRFVQSFQLPGRPGHFQGLLSTHPYQDEVEWPALKAWSFPGPDDRETLE
FT                   GLRRPETADLIVPVEISEPNVGYNAGSNKWDRIEMTFSLFLDAFIQRKIPWSHENGAEE
FT                   QQLVGYLAQFDLLSKAPSLAKEAPGLPHTLAGPKGAKEQWRSNVWIGPAGTFTPIHRDP
FT                   YENMFAQVVGRKRVHLFAPVLAPYLYIKEDGPQKNTSAIASEQELLSPPPDRPLISTAL
FT                   ASEGA"
FT   CDS_pept        join(complement(841702..841740),complement(841454..841582),
FT                   complement(841032..841211))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR013103"
FT                   /db_xref="UniParc:UPI00003C1BB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9X3"
FT                   /transl_table=1
FT                   /translation="MCSCASSVVAGLVVHKLKLDAQRLATRYKARRVAHGYTQPGLGYD
FT                   QTISPVVRLQTHPIIKIDGNLDRSVTSLGKAFSLQLNREAVYDDGPKQRVGISKGGGLE
FT                   IEHIACERNYG"
FT   CDS_pept        join(complement(845744..845800),complement(845638..845695),
FT                   complement(845184..845422))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03091"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9X2"
FT                   /transl_table=1
FT                   /translation="MKISVLEATRGASKLGVASKFGVAGAPPSNHECQLIKTSSQQTHR
FT                   CIPDQRTQGRLAGSDNHAQSRIMNVAQRFEQRRLLAQNASFGSLLACLNRRAERAFDDR
FT                   SAASSLPPIYKPS"
FT   CDS_pept        join(complement(848455..849278),complement(845932..848356))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03092"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9X1"
FT                   /transl_table=1
FT                   /translation="MSSHGRTQLYNLDVHTALLKQVSLPRLDDTPPYTPRSKSLDLLRS
FT                   DSNTPVASRTSLDTISTLKGQRISSPIFLNSSLGLKPFHEAPQLLGQLQDDRHELDCRQ
FT                   DETSVSFSALRSCATPGNASTRASTMPRYMTGTRALQSDLLLRTPSHRKQTSTDQLLKS
FT                   KFSMSPVQPSKRSKARNSEDRHAFTITVQRLTEGVANQDNTRSALGTWSHSLGMAARKL
FT                   QRSALPRKASDESYNDNVPLDVPQEAEAAVVTPEKGKSSLKSSTSLASIRRFITPSRRT
FT                   RKVSSTRGLAASRRAMPIVDKVVFASLPTSSNSSEEIAWIGAEGRASCDGLTEPREVDM
FT                   DVAGSCNRTHLMVPVAVATNRASKRHQNQAESITARRCAPLSPEFYEPPKQQSVPDQNG
FT                   TKGTADGTNDRHPPPPMPLSNSDSSHQQRVSEQALAPEHEAEPCSGASKLKTLQLLARR
FT                   PFSAFGKKVRGMERSWWPTRNSQEASSRSGSIAHLDQGELIGKTQPARRSEDLLSRASP
FT                   RVFDSTTTAQKSRSVELDRIQLPSKVVPILSTVKVNYKRRPTIPDVFAKANQDSVQSDV
FT                   VSSDTHTLDGRPRISNLRHPWMKQLQLPSGTRSGSIGEVVFADLSVKQMWPKMDTHEAL
FT                   SPRNIVPSMSLAAASVALSQPLPIVPQKQQSPRRPPASLLGQSLPIPPRSGRSRASTIS
FT                   SQSSTTSSPSGKVIVSRRSYGQRLRSISTREDAGSIRSVGTSILFTESPPNSPGMRKLM
FT                   SPHHVSRTPTTTRIRSPPMTVLLPRYSPHRSTKVPRLQKKPSTAFTDDSETGEEQEWMD
FT                   EVPIAGYATVGEELVAFRSRFSDAFPPKRPGFLEMSEATQTLSNLVKTFSGSSGSLSLH
FT                   SSPYKKSETPDHQRNGTACGLYGIMEADESGSTRASSSNHLTSSARRRLISIASMVSTE
FT                   ANSSFEDSEELQRLLDSIMAADLGGASHDVSGSKDMALLSPFGSPAEYSNSQSCDKRCS
FT                   SQAGEKPIHTARQVDERPPPPKFLLNDRPISPPDSSCTSDATHSHCAVATTAVRMDAIG
FT                   WTKRPDASTTIAATLHDDSGYASVNAYEGGYMQS"
FT   CDS_pept        join(complement(852326..852327),complement(851990..852120),
FT                   complement(851842..851861),complement(850873..851697))
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /gene_name="gcy1"
FT                   /locus_tag="um11944"
FT                   /product="probable GCY1-galactose-induced protein of
FT                   aldo/keto reductase family"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /note="NAD/NADP binding"
FT                   /note="amino acid metabolism"
FT                   /note="fermentation"
FT                   /note="glycolysis and gluconeogenesis"
FT                   /note="heat shock response"
FT                   /note="lipid, fatty acid and isoprenoid metabolism
FT                   FunCat:01.06)"
FT                   /note="metabolism of alkaloids"
FT                   /note="osmosensing and response"
FT                   /note="osmotic and salt stress response FunCat:32.01.03)"
FT                   /note="polysaccharide metabolism"
FT                   /note="sugar, glucoside, polyol and carboxylate catabolism "
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001595370"
FT                   /transl_table=1
FT                   /translation="MPATHFKLNSGASIPSVGLGTWQSPKGEVRDAVCHALKSGYRHID
FT                   CAWGYQNEDEVGEGIKLSGVPREEIWITSKLFEFHHNHVRQAVQDTLDKLDVKYLDLYL
FT                   MHWNIAFVPEDVPAGQLPRDSKKDPATGKHLLDLETTENFVKVWAELEKLVDEGIVKNI
FT                   GISNFSIRRTKELLKSCRIKPVVNQVELSFTFPQPELVGWLKKQDILPQAYSPLGSTGA
FT                   SQASLSVVDEIAKKHGVQGANVLISWQVARGCNPLPKSVTPARIENNIKLIDLSAEELD
FT                   QLEKGALAQTPKKVCDQSDLVVPSYDIFEANNPTNNDKVQAAQD"
FT   CDS_pept        join(complement(855425..855520),complement(853656..855107))
FT                   /codon_start=1
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11945"
FT                   /product="probable hexokinase"
FT                   /EC_number="2.7.1.1"
FT                   /function="ATP binding"
FT                   /function="hexokinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="glycolysis"
FT                   /note="C-compound and carbohydrate transport
FT                   FunCat:20.01.03)"
FT                   /note="cellular import"
FT                   /note="development of asco- basidio- or zygospore
FT                   FunCat:43.01.03.09)"
FT                   /note="phosphate metabolism"
FT                   /note="regulation of C-compound and carbohydrate metabolism"
FT                   /note="regulation of glycolysis and gluconeogenesis
FT                   FunCat:02.01.03)"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniParc:UPI0001595371"
FT                   /transl_table=1
FT                   /translation="MSFSSEKGSSRRGSISLASKRRGSGTEKLETHIASWHTSSHKHEE
FT                   NPHAHEEQLKQTYERFEKLFTITPQRLRMITDRFVGVLEEGLQKDGQTVPMLPAYVFGW
FT                   PTGDEVGSYLALDLGGTNLRVCHVVLKGAGKFEITQSKFRLTEEQKQTEGQELFDFCAD
FT                   CLATFIKDHFGDQNGDVILEEELALGFTFSYPMEQDKIDHGKLVRWTKGFGNPNTEGRD
FT                   CAAMFRKSLDKFNLPVKMVSIINDTTGTLIASNYVNRETRIACIFGTGCNAAYMEHMKD
FT                   IPKIKHLGLPEEEDMAINCEYGAFDSFQHEHMAEIRTKYDEHIDLHSNKPHEQSYEKMI
FT                   AGLYLGEIFRLCICDLIDEGTLFLGQNTYKLEKTNAFDTAFLSLIESDPTDELLTVTGL
FT                   FTHFFGIDTTIEERQFFRKLAKLIGTRSARLSSCGIAALVTKMGYLDKGCGVGADGSLY
FT                   SKYPGFADRLHQALEDIFGEKGRNIRTYQAEDGSGVGSAIIAAMTKARKEEGKYADV"
FT   CDS_pept        join(complement(858598..858678),complement(857095..858525))
FT                   /codon_start=1
FT                   /gene_family="HOG000133030" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11946"
FT                   /product="probable UDP-galactopyranose mutase "
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0001595372"
FT                   /transl_table=1
FT                   /translation="MSTTEVETLVIGAGPTGLGAAKRLNQLNHGPWLLIDANKEAGGLA
FT                   STDTTDEGFLFDVGGHVIFSHYQYFDDMIQEALPNKDDWYEHQRVSYVRSKNVWVPYPY
FT                   QNNISVLPVPEQVKCIEGMIDAAEERVRAKSPPANFDEWILRQMGVGLADLFMRPYNFK
FT                   VWAVPTTMMQCKWLGERVAAPSLKLVVSNTLNKKVAGNWGPNATFKFPARDGTGGIWKA
FT                   VARTLPQDKLQFNKRVKTVDAVAHTVQLEDGSSIKYKHLISTMQLDFMIDNIKLPAEDN
FT                   HAQLKAAVKEGLVSSSTHVIGIGIRGSLPPRIGDKCWLYFPEDDCPFYRATIFSNYSPY
FT                   NCPQADVKLPTLQYADPSKGTPSKDAKEGPYWSLMMEVSESHLKPVDAQTILAETIQGC
FT                   INTNLINADDEIVSTYHRKFTPGYPTPSLGRDAALATLLPALEKHDIYSRGRFGSWKYE
FT                   VGNQDHSSALGWEAVNRALLGTPELTLLNPDWVNGRRNHELRLTK"
FT   CDS_pept        860218..862563
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="Rec2"
FT                   /locus_tag="um03095"
FT                   /product="DNA repair/recombination protein Rec2 "
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="UniParc:UPI000006A9B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q99131"
FT                   /transl_table=1
FT                   /translation="MTGIAIADVGCISKRIKACCRRAKLFSTDEILLSPPQQLAHVLRI
FT                   SQADADLLLLQVATASAPPPISVLDALNGKLPATNLDQNFFDAVAAADDDDDDNDDDDD
FT                   KADSGSADASDTSDADDQHLNDARFASSCIVPPTQGYDGNFPGAQCFVYDSDAGSDSDA
FT                   RSSIDAVMHEDIELPSTFCRPQTPQTHDVARDEHHDGYLCDPKVDHASVARDVLSLGRQ
FT                   RHVFSSGSRELDDLLGGGVRSAVLTELVGESGSGKTQMAIQVCTYAALGLVPLSQADDH
FT                   DKGNNTFQSRTFVRDPIHASTKDDTLSDILQSYGMEPSIGSHRGMGACYITSGGERAAH
FT                   SIVNRALELASFAINERFDRVYPVCDPTQSSQDADGRRDALLAKAQQLGRRQALANLHI
FT                   ACVADVEALEHALKYSLPGLIRRLWSSKRQSGVSREIGVVVVDNLPALFQQDQAAASDI
FT                   DSLFQRSKMLVEIADALKRISAVQWRGASDCGSSAGRAVLVLNHVSDAFGIDKQIARRF
FT                   VFDSAHRIRTRRSHFARNDPGTSSQAPTSAFSGGTGSALPDQPLAMDVASQTAFTSGLL
FT                   ASIAPTLAEAVGARELDSACASNDVPLRTLEARTAQLGQTWSNLINVRVFLSKTRARIC
FT                   MRDDQAPACEPVRQNTNQRGTASKSLMNTVRKAAVVINPFGATMLDVGVDKSALRQLRF
FT                   VITPRKAVHVLNAYPSTVMHAMHATADSTPAPESQQQQRAAERHPAEQEDADQDLFGEA
FT                   LQEHHWLAIDELQSHTTARPTSRAAQAG"
FT   CDS_pept        complement(862874..865843)
FT                   /codon_start=1
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /gene_name="cse1"
FT                   /locus_tag="um03096"
FT                   /product="probable CSE1-Nuclear envelope protein that
FT                   mediates the nuclear export of importin alpha "
FT                   /function="binding"
FT                   /function="importin-alpha export receptor activity "
FT                   /function="protein transporter activity"
FT                   /biological_process="cell proliferation"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /note="nuclear transport"
FT                   /note="nucleus"
FT                   /note="protein targeting, sorting and translocation
FT                   FunCat:14.04)"
FT                   /note="protein transport"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003C1BB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W7"
FT                   /transl_table=1
FT                   /translation="MASATPSREHVQLVCNLLAQTLNPVERKNAEDQLTQAQSQHGFLQ
FT                   ILIAIIQNVLVPSNDAVRLSAAIKLKNICKSAWDQQSAEESAVESPINEHDKLALKQSI
FT                   LPLLVTISTSTGATPPAPTNVRTQLEEAIALVAEKDFPHDWPNLMDDLAPKLASQDDQL
FT                   VLGILRTAHSIFYRWRSAFRTDSLYSEINYVLAKFALPHLELLKRTDQRLLDPATPTAY
FT                   LAVLGDTMNMALQVFYDLSSQDLPPQFEDNMDPIMQILARWISQSPPELDSDPDEPCSL
FT                   QHIRSTICEIAELYAKRYLDAFSQLPVFVQAIWQMLGTCTLSQKYDTLVSKAVGFLSTV
FT                   VRMGSQREMFQSTQTLEQLCTAIILPNIAIREADEELFEDNPIEYIRRDLETSIEADTR
FT                   RKAASEFCTSLMEFFANQVTAIVGRYINQYLDQYRADPHANWKQKDTAIYLLTSIASKS
FT                   STAQHGVTSTNELVNVVDFFSDNVLADLQSSSDDSPSPILQVDAIKYLYTFRNQLTKDQ
FT                   LVSVLPLLVQHLESSQYVTCSYAAITIERVLSLKRDGSLLFTPHDVEPFAETILMALLR
FT                   NIERGTTPEKLAENDYLIKCMMRMLATVREAIAPAHRVILTHLANILSEISKNPSNPRF
FT                   SQFLFESISALIRFTVSAQPDSLSTFEAQLFPSFTMILSQDVAEFQPYVFQMLSQMLEL
FT                   HTQGLPEAYTSLLPPILTPACWENRGNVPALVRLVRAFLAKDAPRIVAQGQLSAMLGIY
FT                   QKLISTRINEAFALELLETLFVAVDSADLEQYKRAVLTLLLTRLQQSKTDKLVKAMIHF
FT                   VSIVALSQGKGPDYAVDMFDAVQPGLFAQIAQAIIAPELANVSERQRKVVSVGFASLLV
FT                   NSSAMRRAPNVSVLPTLLAALLRLLLTPSSATQTQDVDLLFADEDHAAGFQTGFTKLAA
FT                   SETIKSDATKHILHGAQVKVWFKSALDQFRAQVGDDTWSHIWNAVEPQLRASWDAQIGA
FT                   "
FT   CDS_pept        866666..867439
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03097"
FT                   /product="related to Mimitin, mitochondrial precursor "
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /function="electron carrier activity"
FT                   /cellular_component="membrane"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniParc:UPI00003C1BB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W6"
FT                   /transl_table=1
FT                   /translation="MLRTCVRLGLFQNIAKTLRIGNAKYIVGHDLAGNSYLELPSLSGS
FT                   TDPRHTRRSIQWAEKRELGDYDQRSIPVQWVMWLRHTRRQAPTIEELVQDRQRIELTQA
FT                   NAARLALEYQQSKEREQQLRAQQNSLHLQSGAPTLSTSAVIDETLDEHTDTRLAQQAQE
FT                   SHASFEPQRTPDQDVWAASRARLAAKAQLDASLHEPLPTSAEAQQLPETLQNAIDRRVA
FT                   IRAGRDEQEAERQRARREMSKSPLDAFVPMPKPRS"
FT   CDS_pept        867863..869164
FT                   /codon_start=1
FT                   /gene_family="HOG000135966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03098"
FT                   /product="related to CNS1-cyclophilin seven suppressor "
FT                   /function="binding"
FT                   /function="protein binding"
FT                   /note="protein binding"
FT                   /note="protein folding and stabilization FunCat:14.01)"
FT                   /note="unfolded protein response (e.g. ER quality control) "
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003C1BB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W5"
FT                   /transl_table=1
FT                   /translation="MAVIEAIQESTCSQPQPLSTSRAPLPKPPPRSGDFSYAQPSDGAP
FT                   RDLESTLKSWDSVPLFMKDLGSGSSEAANDTALEALQSLAFDGSPDEVASNFKSQANDY
FT                   FKAKRYREALGFYTQAIDANPADQTLLETLHANRAACHLELQNYGATLRDTSKVLGLNA
FT                   NNEKAYYRAIKALLALDRYQDAIECAKLGLKVNAANSAIASLKLQAEQKHKLAQTRQEE
FT                   NAERKRRQDLLSKALQNAFLVRGLWLETTPRPPDNPQAAHFDVQSLRGTASDPEMPLTT
FT                   AKAKSWTPPDVIRTPLVLPVFFIYPQYAQSDLITDYHEDTPLSSYLSTMFPTEARGSLR
FT                   WDVNAEYYDTNLQVYATTRKHRLLKLGRKLCLREIMDQAFQQADPAKGEHAVRDRDGLI
FT                   MRDGILSLVVLPKGNAEQAWVQKFKADRQTILNK"
FT   CDS_pept        complement(869387..872392)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03099"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI00003C1BBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W4"
FT                   /transl_table=1
FT                   /translation="MSDSESNSSAVPKDVQRKRKRSVDFQDGRESRANPAPREYIDMTE
FT                   SCSTVAPGQNPTSSQLDSQLQDSQSQQLRSLSASDYVASTRAEDAPSLCAPGTDTSSSL
FT                   RPLPSISTRVFEPYLDDTTGMDLEVAESGVSRDRARAEPGQVERSSPVESFSPAEEVQS
FT                   TRNACDVPRIGTWILPELTAENSNPNMPDYSSQHVLGQIPLDMDVDQRYDLDDLYGESA
FT                   ASQLSPSLLNTRLSRTQQVHRQGAGGSSVAASVIAGATSPIQSTPAFASDAAASVAATR
FT                   PPPDAQSDALLPSQPIASQQQESRSATPALPPTTNTTMHEPAPRSTGATGTSDASRTLS
FT                   SSVSIGWSALPRAEIVELVHESTQIPGFLKDEIERFVLRADRASSPKSSAPPQRGSPRR
FT                   RFQSQSQNSSNNNDDSETQEDGLLRTKKVWCMDLLVFAPSGSRSTAAGGGVSAITSDVV
FT                   RKLTQQTQASQACSSGSGVSQRGAVAILLLLDTVNMTFDVHELEESLASVLRNDRRYSV
FT                   GFDVNGRRWNAEQGTDTCGRAGTLVDATRQGDQDELEETRVEIVRLQSALESASREIET
FT                   LSETQTTLKKELAESQSQHDFVRSLYERASASALSAQASASAAHERVRSLQAQLDDGLA
FT                   LHRSMLELGIETWKNKLQRLEAQSALAHKQQQHHLADAAEIRKKAALWDAHQAHESELE
FT                   RHRQQRIRLHDEKQRMRQDASQAIRRAAATGGDRDGDGGGDGDSGGGGPFAPPPVPVPG
FT                   EREPSPMDELDELAALAREAAEAGDTLIIQDTASAGGSRRTRRARGTTDAGATQGAQRK
FT                   LGLRNASNRAPPYSGVQMAAQVEAAKLSSANALDDSRQELEDQFAMFDATPSAQDEQSG
FT                   VGAATVMMRDFDAAPSTSLFSTDDLFEQVTAHTHERARDFDASALDSRHLEVDVEPTAQ
FT                   AHHGDMPAWDESSTSIPLPPSFTQGSMLLLDTEPQSPPALASSASTITRPETSATGQAS
FT                   TASQPFQPHTQA"
FT   CDS_pept        join(872801..873032,873117..873202)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11947"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001595377"
FT                   /transl_table=1
FT                   /translation="MLSTLGRLTRAQPFRLTMYTGTDCQLCQVMQHEIIKASKTVPIEL
FT                   SMYNIRDDSLADVHTWRRKYQYDIPVLHLGDKEIFRHGVTAQQLIQKLQQESEEANADA
FT                   R"
FT   CDS_pept        join(complement(873989..873991),complement(873554..873904),
FT                   complement(873360..873470))
FT                   /codon_start=1
FT                   /gene_family="HOG000232033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03100"
FT                   /product="related to Dynein light chain 2B, cytoplasmic "
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniParc:UPI00003C1BBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W3"
FT                   /transl_table=1
FT                   /translation="MTESGTHVSIETGPNPRPLSSWPLSPDRKSPMPPCSSSTSTPPAE
FT                   IEATLTRLSSHQGVLGCLVLSRHDGLVIRSGGQMFDPSGPGAKQRAELLKSVTRLVKSS
FT                   VESLARDIKAIDDSDELGFLRVRTKKYEIMITPNDKYLLVVLQDPNTGTQ"
FT   tRNA            join(874376..874411,874445..874480)
FT                   /gene_name="tRNA-Cys (GCA)"
FT                   /locus_tag="um14006"
FT   CDS_pept        join(874860..874905,875056..875138,875269..875361)
FT                   /codon_start=1
FT                   /gene_family="HOG000234933" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um11948"
FT                   /product="related to ubiquitin-like protein Hub1 "
FT                   /function="protein binding"
FT                   /note="cell growth , morphogenesis"
FT                   /note="mating (fertilization)"
FT                   /note="pheromone response, mating-type determination, sex-
FT                   specific proteins"
FT                   /note="protein binding"
FT                   /note="protein modification"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0001595378"
FT                   /transl_table=1
FT                   /translation="MPMIEVLANDRLGRKVRVKCSPEDTIGDLKKLIAAQTGTPPQKII
FT                   LKKWYTVYKDHITLADYEIADGFSFEMH"
FT   tRNA            join(875603..875638,875670..875704)
FT                   /gene_name="tRNA-Gly (GCC)"
FT                   /locus_tag="um14007"
FT   CDS_pept        complement(875920..879159)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03102"
FT                   /product="conserved hypothetical protein"
FT                   /function="binding"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003C1BBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W1"
FT                   /transl_table=1
FT                   /translation="MPKSGFDPQRHQRKLHRHNPLSKSGSASASASNSTHASPSSVSSA
FT                   TLDVLQQATKIANASSAVPSAPAKDIVPLLSNLPAPDSDTGTTAASASKPISLADKVWS
FT                   LASVSLLLTVSPTQSAAQVKHNRKLLLSHNIVGRLLLALQSHTEVDVRREASGALRNLC
FT                   VDSGIEVRNQIVNKGGISTILSAMRWASNAFGFDASSSQSSSCNPSASFVDDTPTLQQD
FT                   LEAKCALLAIPLDQLNKKQKRHATKLAAALGKTLEQVAGQGLSAQDQQKLLLSASSDSS
FT                   SNDAIHTGTASTAHRSAEPFIGLDSNTRKGLLEMAENLVTLVWCLCESGDKAFIKLVTW
FT                   KWIDQDVVDCAVDEISGQGLAAWLSSSVALGCRAAAVLSTAGADGARASSSAAETLGVL
FT                   TNEELSLLLDLALASGNALCALTDGGEPDFIDGMLARRSSEQSCKKKGAKPALAALAVP
FT                   KSIDQQPASATRCLASIQSALSLLEACVQTDASDLHKLRRYVHSQSTMLGVLCAGVLRN
FT                   LAAAVDSKAAAALRSKSRKHGSVAASTMTSSSIFVPIGNAASGNGANGAPATAVSLKTY
FT                   EESLLLPTLTSLLCGVDMTKLAHDLDGRGDTSEAVALESTAKDTDESVLRAKMQAKAEE
FT                   KAQTLMLALEVLAEMAGSLDAHATGGGEEDADEWMENADADAEADADAAEEDDEDEEEM
FT                   DMFDHGERIESDDGADDDDMGVGCAQDTFADAVKRNGSLPFQAYAPVLSRMFGTSDGSL
FT                   GSALLTLSRPFEASFPSLTLSTSDKPTSGVLRALHLRSLSVLNNLLLRLATFSPPPPSQ
FT                   PVTDAKVQRRIGAFRTWIHAGPQNDVLKRVWLSLFEIAKGCASVPAVASAGAGLGTHVN
FT                   NVDVGVSGVTGGLHADEGCDGLTMVETCIGGMWSIARLLEGNLPLSTTSSIDVSHAAAV
FT                   QSEIVVALQSGYASASSDAMRVKCILTLSTLARSAQINASVNAHIGAFLVSILESIADA
FT                   ASNSTSGTTPESMVAAINGIIDTYADESSHYDSLAFRHQNLLSRIRLTVFNCKALAKHI
FT                   DRRKHPSLRESAQEAIENLLGFVQYRQALRL"
FT   CDS_pept        complement(879760..880245)
FT                   /codon_start=1
FT                   /gene_family="HOG000226301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03103"
FT                   /product="probable ribose-5-phosphate isomerase "
FT                   /function="ribose-5-phosphate isomerase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /note="C-compound and carbohydrate metabolism
FT                   FunCat:01.05)"
FT                   /note="pentose-phosphate pathway non oxidative branch
FT                   FunCat:02.07.03)"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR011860"
FT                   /db_xref="UniParc:UPI00003C1BBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9W0"
FT                   /transl_table=1
FT                   /translation="MAAPQQKWKIAFGCDEAGVDYKNALIKDFEADARVESVIDVGVPS
FT                   NADKTAYPHVAVTAARKVASGEVDRALLICGTGLGVAIAANKVNGVRAVTAHDSYSVER
FT                   AILSNDAQVLCMGQRVIGLELARKLAKEWLSYRFDASSASAAKVQAICSYEHAADKQ"
FT   gap             880778..880877
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.104-um_contig_1.105"
FT   CDS_pept        881334..882179
FT                   /codon_start=1
FT                   /gene_family="HOG000226412" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10627"
FT                   /product="related to triose-phosphate isomerase "
FT                   /EC_number="5.3.1.1"
FT                   /function="catalytic activity"
FT                   /function="triose-phosphate isomerase activity "
FT                   /biological_process="metabolic process"
FT                   /note="cytoplasm"
FT                   /note="glycolysis and gluconeogenesis"
FT                   /note="photosynthesis"
FT                   /note="sugar, glucoside, polyol and carboxylate catabolism "
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001595379"
FT                   /transl_table=1
FT                   /translation="MSSSSPSSASASSRRPLVGVSFKMYFDIPKTKAYVDETISLLSST
FT                   LPSLGQPIDVFVIPDFITLTSVAAQICSSSSTLLLGAQDVHSHDFGAFTGEVSPNVLSQ
FT                   VGVKLVEIGHAERRRYFGETDQDVANKAAAIAKNGMVPLICIGEVSRPKNLDQLSIQDV
FT                   DLVVNECWRQIQPALDAIESHVDVVLAYEPVWAIGQPQPASPDYVVKITKALRKRYNKE
FT                   YVDSHKARSDASLRILYGGSAGPGLFANIRDGVDGLFLGRFAHQPQAFIDTIKEIAGTN
FT                   "
FT   CDS_pept        join(complement(883161..883163),complement(882968..883032),
FT                   complement(882727..882859),complement(882582..882629))
FT                   /codon_start=1
FT                   /gene_family="HOG000206204" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10628"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI000159537A"
FT                   /transl_table=1
FT                   /translation="MGAGPRYPYPKEVWSPAGGWWTRPNNWVSNTAVCAVGIALATYGV
FT                   WTYSADREWRHNAPTKPIPSMKWARQFKEGQLSVKEP"
FT   CDS_pept        883629..884663
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10629"
FT                   /product="conserved hypothetical protein"
FT                   /function="binding"
FT                   /function="protein binding"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000159537B"
FT                   /transl_table=1
FT                   /translation="MMTSRFLVSGNPATDPKAAAQWLAEQRRRPIRAPHKTVQYGELVI
FT                   TRGGLSSVSKEDLWSILEQVAIAAIEVARFDLAELCISRLSSRFANSQRVTSLQGMLLE
FT                   GQAKSRDAIRLYESVLETEQTSLILSRRRIGAIKSTGDIKQTLHALNSHLDIFYNDPEA
FT                   WQELAEVYATQSMYAQSAFALEELLLQVPQNGFFQLKYAETLYTAAELTKSYKAYLRVL
FT                   EMCQSDAATTQPVAPNTTAAHGAWLRALWGTKMVSTQLHYFRTLQTETDPNPDDLICID
FT                   LAKVTTALIATPPRASSTDDAIDQAKVLKIDELVTKLLLTNVYTPQAVACKHLRDVARA
FT                   VLAA"
FT   CDS_pept        join(885573..885648,885747..887554)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03105"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9V8"
FT                   /transl_table=1
FT                   /translation="MVKIKYCLVVVAIGLASASAAAIVKGDAQGAIVVKRDSDLAHRDN
FT                   AGLTGDNPMSTSDQPMHPSGSGNGGSGNPADTDDAASRSGDGDSSRRNRIVGDRTVPSS
FT                   GDDKTKLNGKSTATGDSTSASSDSDVDVAGTQEQLKQVLFADADRQTAEFFATHGHCTG
FT                   PDTRTCKSQSCLLSDRGCIAYSADEQHEIDQQARGMLYKVAITGKCHPGDGAFCNRLGY
FT                   CDHFDVRAGDKCGFLSENEYPKLISLLRPQPDGSFDFVSDQDSDDQQKKPAHVQLVTRA
FT                   LSSNDNDDARATGSKADSLTQQQVFQTAHEIAVELVTQSSATDGICHHESATCQNSTCK
FT                   LGTSGCSALTPEEKDEFEQNITELMIELLSTGTCRRGSEGCDESGRCAMWNKRGERIRS
FT                   CREPTMEQMEQMMDQMFASDGEQTSSQSEDRSGSAESGEQTSDAKRTQATDESTSSHAN
FT                   RIVKRSDVQMLVKRINPLFQQGGHGPVMPSSPPFDDTPDQQRSDDYLTVPVSSLEYDVP
FT                   APTRRQVREFMKLCKQLSENPDQLEEIAFAADVHDQTSIQKLRERFAFLATNKRQAILA
FT                   LKQAKLAQMLGESKQTNHKADDDLSGGLAAATTAATAADHKHDNVQNAPTN"
FT   CDS_pept        join(complement(888294..890315),complement(887986..888184),
FT                   complement(887783..887904))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10630"
FT                   /product="putative protein"
FT                   /db_xref="UniParc:UPI000159537C"
FT                   /transl_table=1
FT                   /translation="MPPKKLSISRIRADSSVRSHDPDLNRRPSSLSHSQSTSSNSRVAS
FT                   QRHRSSASSTTPRKSTQSNAPSKSSRPKRSTQPKASARILHIYQDDIEETRVQNRFAPD
FT                   PRTQRQNVSYRPLTLTQKAWRDGSLFQYPTLSGMCCSIIASCFDALLPSRDHFNAAAAP
FT                   IDSSSSSRSIRNSHTHPLKTRSNPRKRSRARAFGETPDLDDDDEHDYVPSDDETLALTP
FT                   SSVSSHRRTFPARVSSSTSTKSDAISSQLLAGWTTSDLHYLTRKTSEQLKLLSPAASFL
FT                   LFQALVDQAPQYLTKTVVSNYFLPSILASSTSSSSATTAAKTHVWLPASIPLLSHDKSA
FT                   ASFLVAHLTNALTSFREHPPSILSQASAQDMPLAALPSTLVLARPATFALRCLQLHGLT
FT                   RLQDGTLARFFEAAIAPAQRQAILCLEIVSLRGCVAIGDRTVSAICRSTATTLRYLNLD
FT                   CTDITADSVTQIMKLLPDLHTLKLGYNDNLSDKTLQRALQAPSVGGTLPFSKLVNLRLR
FT                   QCGQVSDVGVACFLRYAYRTLEVLDISGTGVGGANAHQPDWSILLMSFFPMGLSDAPDA
FT                   ARTTTLALRKLNLLDTNVDYDSLIKLIDRSPSMDTLLLRQMRSRLTRDGMIGLLERLVS
FT                   HTDRGWRQRACAWKRLHLRILDVGDEFADLFPQLLSMFPRLSIDSLKSSQTQTSFFYHV
FT                   PHRMRPGTAIVEHLELAHARLCEHAWRFLGRITTLRTLDLSDTAVPENIVADTIAANPF
FT                   LETIDLTHCRHVSISTRRNAFRLVAHT"
FT   CDS_pept        join(complement(891683..891850),complement(890765..891559))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10631"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="UniParc:UPI0001595388"
FT                   /transl_table=1
FT                   /translation="MLQAIFPLVFPEEQEIEWGRIKSKILTMHRQYIAERQRLGQTGSG
FT                   LLFEHLSEGIPDWHRMALDRGDTTPSEVAQAGSYDARDASDSGSCNNTAANQKQDIETD
FT                   LEINATDDELESALNRRGWPSLDQLAASSQADSLGKRLSRPVTPNRSGRQSYMEDKDAA
FT                   EEEQLVADRQQSKSQSSPRLATLLRPAAKRARTSSRKATEERDALIATLVQSKQERNEA
FT                   RIKKEEEKTKREELKTQRALAQVQWEKERLDREERWKRDELDRQETQRQEDLAREERRR
FT                   KEDKQQSIDLASQIVELLQSRSQSQHQDSRGLYMLLVVP"
FT   CDS_pept        893310..897272
FT                   /codon_start=1
FT                   /gene_family="HOG000175116" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03108"
FT                   /product="related to Aminoadipate-semialdehyde
FT                   dehydrogenase"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003C1BC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9V5"
FT                   /transl_table=1
FT                   /translation="MPILDTKLDLNALFRKQVKATPDALALIDPLARYTYAQLDAKVES
FT                   LSLYFRSHHAVARDSLVGILMAKGADYVIACLAALRAGGAFLVLELAYPRGLLHEVIQD
FT                   AQPALVVTQSEHAKLVPKSVASILIDDPHQVDLLFSPVSSSSSPPSSSLPPLPDETDLE
FT                   RLAFVSYSSGTTGKPKGIANPHRAPVLSYDLRFAVNDLTPADRVACNVYFIWEMLRPLL
FT                   RGATTYAIPDHSSYDPVKLIELLATEKITETLMTPTLLAAVLARHHNLGTKLPDLRTLW
FT                   LNGEVVTTDLARRAIKALPNTRLLNCYSASETHEVACGDLRQMLPTLPDDAPYCPVGPP
FT                   MDKAHTYILDQDGNPLEPGHPGELYVGGHLLARGYLNLVDTTAKAFTPDAFASEPNARK
FT                   YRTGDLARIIPDSGLLEITGRVGGMIKIRGYSIVPGTVEKAIVDNFDVSNCAVVAHGEG
FT                   LERQLVAYVVPDETERANRTVLTIDDNGHSPSARQLLVAHLAHYMIPTLWVVLHSLPTH
FT                   EVSGKVDLKNLPNPKAAIAAASGTNSRARSPAPDETVNLKSIAQLWALSLNVNPNTILE
FT                   AGKTVSFFDLGGHSLLLADLATRISKTLGGFTVPLGELAGHPTLQDHVRITLAARDGYH
FT                   AAVQADLPTVLRDDMELAPEFKLHSPDKVKPTTLDEAKTILLTGATGFLGGFLLNDLYQ
FT                   TTSARIVCLIRFNAPYRTDRSAAMARLRRNMLDLGFWDHGMLDRIDVLPANLSRNRLGL
FT                   VPEVYENLVETVDVIVHCAAQVNLIYPYAALRDANVEGTREVLRLAFLGNATVQYVSTN
FT                   GVLPPSQTGWPESTIMPLQDVPGKLLDGYCQTKWVAEQLVLESARRGLPANVIRIGTLS
FT                   GHSVTGSTNTYDLITALIVESVHLGVAPEIANWHIEMTAVDYVSRGIIAIGNHVDANQR
FT                   IYHLGDSEPIDCRLLFQHLESLGYPTTRTSWKSWVSLWQEKRGSAKGGDHGLTVDILRS
FT                   GMPSEEFLLGIIALKDDATRPALGDLQRPKVDAKLLQTYAKHWYARGWMQRQPSSVPAT
FT                   PSGASNGVNSVSCGAVFDPQLPLRGKVAIVTGASSGIGAAVAKALVREGAHVALAARRI
FT                   DVLEKLSTELTTMSRSLHTRSKVHIHKTDVVDRKQVDALMQTTTQVLGEIDIIVSCAGV
FT                   MYFTMMHNVQVQEWDQTVDVNCKGLLNVLCTSLPRLLARNTGHIVAISSDAGRKVFAGL
FT                   GVYSASKFFVEATLQSLRLETAGTGLRVTSVQPGNTATELLGMSTDQEAIKKYGEPTGA
FT                   KILEPADVANAIVYALKQPEHVAMNEILIEPREEPI"
FT   CDS_pept        join(complement(898636..898959),complement(898000..898554))
FT                   /codon_start=1
FT                   /gene_family="HOG000190015" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10632"
FT                   /product="related to ph-regulated antigen pra1 precursor "
FT                   /db_xref="UniParc:UPI0001595389"
FT                   /transl_table=1
FT                   /translation="MQLIASFVALTSLAVSAVSAAPFSSLLATRALESFQPEGQIDSVW
FT                   RIHESCNGTQRAQISSGIDDMKKLAHNSINHILNYPKDEFFIKYFGQDADPAPVVGYYV
FT                   ELVYGNKGDALLRCDNPDDNCRLPEWNGHWRGNNATAETVICELSYVTRRPLEKLCSAG
FT                   FQLGTDNPSLYFGADLMHRAFHVPEFVHEKIHHYADSYADVLELAEHNSTAAVQNQHSL
FT                   QYFALDVYSRKLTKWGCIGDVKQSHDDHAHASSSSAAPAPTSTPAATPTPSAASSDCHT
FT                   HADGSIHCGTH"
FT   CDS_pept        900881..902401
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03110"
FT                   /product="related to ZRT2-Zinc transporter II "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /biological_process="metal ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /note="heavy metal ion transport (Cu+, Fe3+, etc.)
FT                   FunCat:20.01.01.01.01)"
FT                   /note="homeostasis of metal ions (Na, K, Ca etc.)
FT                   FunCat:34.01.01.01)"
FT                   /note="transport facilities"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI00003C1BC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9V3"
FT                   /transl_table=1
FT                   /translation="MLGINVKSKPAKAAALLLLAGAPLVASQSITTAVTVNGTPTTTVI
FT                   SPSPTGRGYCEFFIDHWDCDPTRSEAASGPSGASASAPSIQPSPVGQSCTLHGDHYHCD
FT                   GPTTATAAAAAAQASPTGQGECVFHINHWDCEGGDHSDHDHSGHDHSGHSHAGHSHAGH
FT                   SHGPSELYGCGLAPLEDYNLPLHIGTVFILLVSSAIGAFLPILVYTAGGATSQNKRGRW
FT                   ADEVFFICRHFGTGVLISTAFVHLLSHAMMYYSNECIGELKYEATAPAIAMGAVWLVFI
FT                   VDFFLLRALRKKSSQQMLQAHESHHDVHGVTKRESSSTLDRTHSPATEEDAATGMYGGL
FT                   TYAQAKVAEWDVFAVEAGIIFHSILIGVTLGVATGSGFVALLIAILFHQLFEGLALGSR
FT                   LSLLRWKSTAYKMLMASAFVLTTPIGVAIGIGVRKSFNGNSSGTLITLGTFHALSAGIL
FT                   LYTALVELLSGDFIHNRQMQKSSLIRAIAAVAALTVGIMAMSVLALWA"
FT   CDS_pept        join(complement(903667..903787),complement(903353..903560),
FT                   complement(902998..903310),complement(902737..902878),
FT                   complement(902619..902644))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI000159538A"
FT                   /transl_table=1
FT                   /translation="MILTPNRIHRAPIGFGPAPSPRQAPDGSRFDWSNARTTTIGLVLE
FT                   AHRDSINAMLPEGYVVDRLTPHPTVLFKVMELRNLPWLAGRGYNTLGIYLNDVICQRVS
FT                   PPVKASTGREELGFPKVFAEIADATITLTGEQEKRVHTLSWGGYEFLRLELTLASFDTV
FT                   QSPALQPDKRLYTHPTKTGFLHQRYIPAVGIPGQADANYATFCPPPPWPPSGAVKLEIQ
FT                   RGGFQHLPTLYNVVDALADLKIVECKEVALQQFIGASDLASNHRIEQ"
FT   CDS_pept        complement(904186..904566)
FT                   /codon_start=1
FT                   /gene_family="HOG000178752" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000159538B"
FT                   /transl_table=1
FT                   /translation="MWSTNRWPIDNQTPEDGAVKSIFTGRSHNDNGSVVRFVDLPPQAC
FT                   SPMHRTQTLDYGIVIFGEIELELDSGEKRTLRSGDTCIQRGTNHLWRNTTDKWVRIAFI
FT                   LLHSKPIVIDGKQLTDQGFPGQ"
FT   CDS_pept        908442..909674
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03112"
FT                   /product="conserved hypothetical protein"
FT                   /function="peroxidase activity"
FT                   /db_xref="InterPro:IPR000028"
FT                   /db_xref="UniParc:UPI00003C1BC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9V1"
FT                   /transl_table=1
FT                   /translation="MKLSFNLPLLLSAAFMAAPALALPNLHAMMAPGPNGEPSHLEKRL
FT                   LSANPLHLNNLFNDIKNKVAELNSNVTVPDVGSLLNTKITDITPESIYNTFGIRRDLGL
FT                   LPPAEDKYHPWQPPPKGAKRGPCPGLNTIANHGYLPRSGVINPIDLIVGTFLGLNLSPD
FT                   LAGILAAISFVGMGDLLQMKLSIGGRYGLGGGLSHHGILEGDASVTRKDNYFGNSWDAD
FT                   PKLVKQFIQETNTYGKGNVNIWSLANSRYRAWDYGRKNNPVFDFNPWRMLVAYGESGFV
FT                   HEVLRGSFVKFDETMIKNWFIDERFPKGWSKRIVPMTTPEILAWAGIVFVAKPTIPGWS
FT                   IGKGAFIPLPTTDGAYQELKSLLDPKTTGATLESLLCDASNAVLGFFPSQITNLLGVIG
FT                   IKGVGAQFKCK"
FT   CDS_pept        910970..916081
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9V0"
FT                   /transl_table=1
FT                   /translation="MVPLDIELLSRAAPVNVAEYLREQITTLSEAPVAQSLLHLVALEA
FT                   VPPDVVRIWLSITKDAHSLSAALQQNSSNLARTSAIQRFGAWFRSKHWRAAWEALGGAP
FT                   GIAQLFAQLSVSQVNKFTRILGRSVRGKAGQAKTEKRDVVTQLLLLLVPQLETGNDTSP
FT                   TQHLKAADADNRELVHLYSALLPACTSQMVHKVLFGPQMVMTLSGDQRHLLREHPNVFV
FT                   QDAAPTLPSKSRWPDQEKHLPALILAVMHNAQVDDPAKLVCFLTDAFESIFSKESARIS
FT                   SPTPVASLCQKLVQRRGLEPSLRMHMFQVILRILSKHTERVGPFAARLHKQALRSWSRA
FT                   ADMFEHILLELFHVSPSHQRQHLFCKLYKHVPPRQRWALLKLMVCPDQHASTNDLDEEQ
FT                   VVQQLLSCRHHLISLRVGVLLALPTPQALRLMGHLAARRLRDRVITVGRADSILGFTTA
FT                   HGYLNFDMVRFELQRDLVTQERISVATAAVQDVRARVSRSSDAGVREDLARSGLHWAIC
FT                   SRSIELYTSTIVWMRRFVRDVTVARSLFSEGSLHKREAIQLLSGIPEVLDQHVTAVHIR
FT                   DRIHDANNAIWEWFETVRKSLLEPSFSVQNTAGARLLVRPVVVERMRRIDQLQTHLGLD
FT                   TNAISELVWDETVDLLIRIEKACMEPDYRRLAMYHIAGPLGTELEPSFFATDALRIRSM
FT                   AGLSFVEKLFVARDALWKQHRISLNPAVARLPRGIPQGLPLHVAPSIWNLDYILARTPN
FT                   CFLLNKAREVVFADSHIALQPVAQDDATRDAVKDCHQDYLFSLLLLTKAHRSKIGKRQT
FT                   LEQAFVHAVGVLSHNRMTRQEAEAELRDHAFTVLVQCHKVPRFPSLYAPSRFPQLPTTQ
FT                   VDDRNSSIRIEWDPNKLGSPPMFAERQLETTVFDEMLSCSASLNLHDGTLCYYTSEFGG
FT                   YSFRTTPYVVRARHQVSAADVALAGCRNGDHPKDKIRCIREAQIVWHLMLFDELCVRPK
FT                   SDTSAITLPFPDKAHVRYPNMVLSRSFVNAMRAKMDDNSAMHHMLKHLGFQIPVSLLRE
FT                   FTQRLTTARREGRLSKGDQLATQFVRCLMASDRPSAALPFVLRAILDNSQDSSWHRVLL
FT                   SQRFLRQLPAQDTCKAVTHLAAEILQRTASDTKSGISVSTVKMLAQILGQADVIPASVA
FT                   IETLAKLLDQTDHVDVRFAALSSMLELICSRPSTHDAAAERLVPELDRFVRILAAIDET
FT                   RPSESEESWKDGVLPSVYESSIMPSSDLGSMKKLPRTFQLVSETMQKSALWAPILMQRV
FT                   MLPAMKRSIEVHGRWLDTFLQRHSLSVETLALPVPPTKLEMLNTLVTRHAALTPDWIVE
FT                   LYCKMLLFNVRPVAQVKQLRAQLKHTDHNAEKHWLAITEKPETKSIGSPPFLAEFVYGV
FT                   AESAQDKNAIRQVLLARQYAICKAQEVLEAMLDDMLDSAWIDEQSFDCIMAQLRYENHG
FT                   QRRTRWARDVAWELCLRPILEKVIAKVDSRRTTAWQRDPERKPRLLPDMFLYRLELLPY
FT                   PQVGESILTPDEKLNKCQTFSRAVIEQVKHLVGRATPYQDELERLQGAVTDCPVHLQAA
FT                   VALALGKLDTGDLTECLCIAMAIELLQTASCTECEIAAIQSMLDEWSRSEVEWIRVQLD
FT                   GLVGARSGRTIKDAKLERALRQSEVGVDQADSDRDDRSDLGGSLDSWRPLSGASNVGVQ
FT                   YVMQNM"
FT   CDS_pept        917957..919561
FT                   /codon_start=1
FT                   /gene_family="HOG000135965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00003C1BC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U9"
FT                   /transl_table=1
FT                   /translation="MKSNVDTVLDGYTSVPVGVLDSTLANTDILTRITLVFPSSLSLSA
FT                   LQESWYALVRSWPILAARVRATPSTPSGLSYLIPTPATLESLETRSRNSASKPLEKHIV
FT                   LLDQSSRSFSDYHPIVAKAVHSNLDRNNISIGGAPLVEHEKATICSNACTSWKQLIKQD
FT                   QAFVTAQATKFADATTVTISFSHILGDAFTIKHIFQGWQTALNGQAVQELQDVGKDPFI
FT                   KYLPKDTNDKKHKKNKKSEPAPDLPLQWFRYGLARKIKLISLLLWEVKVKKPEKTLGQY
FT                   YIYLPQAKVDELMAQARSDLEQLRSSSATSATERDLNVSTFNVLFAWLLQNIHASTAIK
FT                   PSKTSSVICIINAKTRPPAGHVPADYPRHQLWGGALGAPLRPLSAAEYVTLPLGQLALH
FT                   IRESITEQVDPENIRKSVVMALKHSMWKKPSGELLFFSQNPNTYWCGCTEWRSAKFHTI
FT                   DFSAAATPHHDAIQPTAAPAASVNPVAITTNMETPMTKRNRWALLGEANNGIWFTGGLT
FT                   ANEASNKNGFGRYIFVE"
FT   CDS_pept        complement(919823..921682)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03115"
FT                   /product="related to Sge1-drug resistance protein "
FT                   /biological_process="transmembrane transport"
FT                   /note="cellular export and secretion"
FT                   /note="detoxification by export"
FT                   /note="drug/toxin transport"
FT                   /note="resistance proteins"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003C1BCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U8"
FT                   /transl_table=1
FT                   /translation="MADEKRTSIEEPGTPMSYSTAASPELLSSSNNASALPAYPSSQTK
FT                   QDKESLSHDQAVRVEPESSTPLTDSVEDNESGAKVKKDLHFWIIFSALMLIAFVAALDM
FT                   TMISTALPAITANLPPSTIAANWITSAFLLPMVASQPIFGGLSCSIGRKWSINSALVIF
FT                   LVGSVVCATAKTFLVLVIGRGIQGLGGGGIHSMCEIIMSDLTTLRERGLFFGVIALVFA
FT                   VAGFAAPVLGGVFSEHSWPWIFWINLPIGAISLVLLIIFLNIRVPLLTGKEKWQKLDLV
FT                   GNAVLFGSVTAILIAVTEGGIKYRWSAWQIWVPLVVGLLGIMLFLVIEWVPNRIAPKPV
FT                   FPLDLFRNRTASVAYVQTFVHGVIFYGVIYMVPIYFQAIKDRTPLQSAIWSFPLSAPSF
FT                   PFAMGAGVLISITGKYKLLIFCGWMLMAAGIGWMTHWHVGTSKFEWAFSQVILGAGLGI
FT                   MFPITLPPIQAALPASRLESATAAYAFTRTFGAVWGITAATTIFSTQAAKNLRPYYDQL
FT                   NPLGLSDFTVVAFSEQLRNLPQPIQGVVKGVYADAISDSYWLFVPLAIIGFFTTFGMKE
FT                   LPLPDFIKSEAKLEQKQDVTPALKSSAAHAVVNVKTEVPSTLP"
FT   CDS_pept        complement(924453..926228)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U7"
FT                   /transl_table=1
FT                   /translation="MINNALRTLISSATEQSLDDVLEHEFRTAVQLQQMDQFEWHQVEA
FT                   DLWKRTCLGHEASASFNQNIAHGHTELSLMTSWRVHQPSSSRITGSELELDQLVARVRQ
FT                   AWIQARYLRPEVGVELDTHTDPTVAQTMCYRLLRDEESIQEWLDETFVVKRLGDPGVAT
FT                   PAELCAYTYNRPLATKGKKSMLYLILPRLDDEQRTAYTIWNVSHAVTDGGSLAEVFNTL
FT                   FQCVIDATPSEPYDSIYTPSAFELNVLPRMPRSVVMAYRQQYQPKPEEIAKAHKVAEVN
FT                   MRMITEKMGESLALMPSTSWPERKHETVCLCRELEANEVRELLKFAKQVHSGITYLASA
FT                   ATILSAAETFPERKASSKGALVGMVRNARRWISATPLDASLGASTPLGSDAVFLWVPID
FT                   THKTLEPSFSRMQELVTTARHIRHELDKHLTTPHCISSYPYVAESSIQGLNQQWSQIKA
FT                   VQSPSSSSSQKEIAGIIGAQAPGFSSVGMMRIRPRFEPVSANARASGLWLERTDFTHTG
FT                   RQINASPWISMFNVDGRIKLQLGFDTKFHEVEKMNQWLDRTVVWMRICAAAAATTSTSV
FT                   SSTSVDATAPVFARL"
FT   CDS_pept        join(complement(929489..929867),complement(927931..929438))
FT                   /codon_start=1
FT                   /gene_family="HOG000135964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03117"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U6"
FT                   /transl_table=1
FT                   /translation="MKVALLANPARGEINVLLATAYELIRLGHDVTFLTGSSFANAIAE
FT                   FRSEQNDPILAARIHFSDLGNARAVEDFTRGMQSHLKGLRKPPGDYSSMEICQIVALVT
FT                   EQEFRDAATMVRDRLLEIEPDMTNPVILIFLVRLAVAVDALSPNLVTGCRMTGLPWMFT
FT                   VPCSPSLTATRKSLFDPHPMGRRRQRTLMSALENLKLTFIETYRNATKKDLYARRALLK
FT                   NEFGLNSMGFNGDSAIVPPLWKDRNCVGGIHFNTPGLTDSIRQPHQIHFVGAGVTSDPE
FT                   NHDTPVFEAASFLKQLSPSSSTTFKPLFPPLSKTGRDLDVEWMDEAYAAGQLVVYLNMG
FT                   SMFLWTDAEVRSCLRAFERLYEQSGGKIKLLFKLNKPKRTPNNTGASTPTAPISSPDFE
FT                   EKQRTVMGSARPVGASNLVSEKLADAIKNVTPRRKTDADKGYSQFTLSEFEGLEYVRFT
FT                   RWVHDQRSIYKHPALRVVIHHGGGNSFNEAVHYALPQMILSQWFDTHEYAILAERFGIG
FT                   LRSKHAPKIDENDLVNTMTRLLQGPEAEKIRRNAKVWSIRSRNAGGAPAAARLIEAQAM
FT                   LFNQQKQLELAASEVRAAVDTLSGKSSVADLESETAFTPNMLSGAASTVGSD"
FT   CDS_pept        931611..932096
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10635"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595392"
FT                   /transl_table=1
FT                   /translation="MAFTIHELRSSILDPRSTIHGSRFAIAFQKARTCDLDFNHECTAL
FT                   RYKEASGCGRATLSCRKRGSRLRTLRKWVEPVAEDGLRYPISRYAQIPHWCMASFAATI
FT                   EGTSTTRDCSYRWFIAQQLPRCSASARRAAGLVFDRNTGRAKIARSITRQSCSTQEW"
FT   CDS_pept        join(934757..934867,934963..936504)
FT                   /codon_start=1
FT                   /gene_family="HOG000135986" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI0001595393"
FT                   /transl_table=1
FT                   /translation="MQADKHAWKEVSPNLAQRPLVGVEKLLNYAEYYQNGNFQLSAAIH
FT                   LETNLTTEKLQQRFGLAVWNVRCLLPEIGTWTVGTTGDAAVDLDNATFTAIQTVEEAQK
FT                   WIDETAVIVQDGTTAEELTILTTNHTIEPAGKQFRVYLVTNARQGSPAIIVNASHVLSG
FT                   HRIAAQLCTIVQALVDARLVSLLQAEPDPRAALRSIFVPENLARLIGKLPISLNTAYHK
FT                   RFNPTEGDLENGFEKLSERLANSALPSIGIPRLSSPATNPEYSLGTVNGEAMTIMNLRR
FT                   TIGSNEYRLLIDAHKKLGITVPSVIYACIVNSIDRRCKSNTAQDAETPGANLAYSAHAK
FT                   RWLPDETFMTRSPVNMAIVLGSAYVSPDELRSKQHGCDLSIDELIELAKTIRAKQDAYL
FT                   DTPHIISAMEQVGDEVSAMIADTAIKQRQAGTDPHVALFENSPAICPPTLTSQGDIAFK
FT                   RLYTAQGGSWDPEPAVAAGEYVYIGHSWNSGRTTDASVCFALVGFSGELRLTSYFDSRF
FT                   FDAKLIESILDDVLSNLRMIATTVPVDAPEAKL"
FT   CDS_pept        join(complement(939582..941575),complement(938558..939515))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniParc:UPI00003C1BCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U3"
FT                   /transl_table=1
FT                   /translation="MSIIATMEQVSSLYSTGIKEGWISANESSGIILADGFFPTENAAS
FT                   LSKWRDALSDIAANVSSANCLVLAANPIVSTLLQQHEASDSSDVIYLSRRRGMINTISI
FT                   FADAKSAIDFYTHANNSVQAPLQFVLRQESTLGLFHSNPRLLRNLARDIDARIFRFLAA
FT                   RMGQHSITSSSNPSLTTVPPGVLTRPSYSDNISGGALTPASIFTQHSQQVPQHYFVPSL
FT                   RAYESSSSHSIGNNTGSDDDASILAEKPILPSPVVTDDPITGEKKLQQDRKVRYLAPLV
FT                   TGLGLGLNVFMMSGFLAKIVIETLVDGNYARFAFIILLPFFMLVSQFLWENLAACLAQV
FT                   LFPIRQMHENSLYYSGQASEPLPPDHVLPQFTINMPCYKEGLSSVLAPSLESAMDAVRA
FT                   YRAVGGVANIVVSEDGLRLLPREEAEERIRYYNAMGVGWVARPRHSSEQGGYVRKGRFK
FT                   KASNLNFTYNLSLRTEEILETSSIDGDLEQRYSDALAQAVEETNGRVWASGNIRIGDYI
FT                   LLIDSDTRMPVDCLIEAAAEMERCPEVGALQHCSGVMYVQNHYFERFIGYFTSACVNFS
FT                   ISWICANGAMAPLMGHNVFLRWKAVQEVSNLDTDGERTFFSPHHVSEDFEMALKLQMKG
FT                   YVIRWATYSDQGFTEGVSFTPEDETARFQKYAYGCSEIVFNPLRYWFTRGPLSKLFRTF
FT                   IASDVNTSYKIATLSYLSTYYALAISFPVTVVVFVIQGLFLPYLDPIFLPSFDVLITVT
FT                   LIFTLAGGLGLVTARARSGHASFGRAALQAIGHAPAMAVFFSGLAFHVMTALAAHMFGY
FT                   NMTWGSTNKDFKQSSLKEVLRRFWTVYMVMIAFLVTVVVASSPLIPLKWRAESFQLLVP
FT                   PVLLCSMHILFPILLDPGVLEKYLPDIGQNEFALKLKSKHQAFFHTAGQRVKSRYITHF
FT                   SNAASRNDTSAVGVSHQSDAAGSEKNAQICRTPSLSSNTPPMRISAGAGAGGV"
FT   CDS_pept        942195..943655
FT                   /codon_start=1
FT                   /gene_family="HOG000213371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03121"
FT                   /product="related to beta-1,3-glucan binding protein "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /note="cell wall"
FT                   /note="polysaccharide binding"
FT                   /note="polysaccharide metabolism"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00003C1BD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U2"
FT                   /transl_table=1
FT                   /translation="MLFPQKQKSKAQLDSVLPPSGSQDNVSAETKSSDDGHSTDSRPVT
FT                   IDCLPITKAAQRDLLQPPHGFVSRRIDIDTWTPPNLWSLSKRGKRSKRMDYLFVLFGIL
FT                   VGVLASGAVIGLGIFSFMSDQHKYCLALDEQFDGPLNTNIWSREVQVGGFGNKEFEWTT
FT                   ASSNNSYTKDGKLYITPTLTADAIGEGAVTNGYTVNLTQSGECTAPRVPWMDRTDSEDI
FT                   RMASIRNADVNCQISSNSTLGTVIPPVQSARLTTNASFSMRYGRVEVRARMPTGDWLWP
FT                   AVWMMPRDSVYGEWPKSGEIDLFEGKGNQARSRTEQLSNTMRSALHWGNDATTDQYLKT
FT                   NQVSTLWRNLWNDEFHTFGLEWDEHGIWTWRDSRARRVLNVRFKEPFINQMPKVQLQNG
FT                   GGMVPAPNPWSKSTNNGAPFDQDFYLILNLAVGGTNGYFADVGQPWSNDDPRAAATFWS
FT                   QRASWLPSWGSVEKRSMVIDYVKAWKRC"
FT   CDS_pept        join(complement(944954..945785),complement(944575..944871),
FT                   complement(944310..944509))
FT                   /codon_start=1
FT                   /gene_family="HOG000213371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um03122"
FT                   /product="related to beta-1,3-glucan binding protein "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /note="cell wall"
FT                   /note="polysaccharide binding"
FT                   /note="polysaccharide metabolism"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00003C1BD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P9U1"
FT                   /transl_table=1
FT                   /translation="MLRRPTGASEFRSTRIPPAQIVEESIKKGKKEDNGNLYWTQSHAG
FT                   RRSRKHGCLVLMIGIIAGLLLGTLRVGLELFSYFKEQGKYCLVLEDHFDGPLNTSLWVP
FT                   EVSVGGNGNGEFQWTTDSPKNAYTEDGMLYIVPTLTADAIGEANVYDGYTVNLTADGTC
FT                   TTNEVKWTKIDKKVPMQVAINSTHTNCIARSNATLGTVIPPIQSARLTTKGTAAIRYGR
FT                   VEVRARMPTGDWLWPAVWMMPRDSVYGEWPRSGEIDIFENDGNQPKSRYDVHSNAMRST
FT                   LHFGIDAAHNLQSHWRGIRLLWRKYFNEEFHTFGLEWDEHGIWTWENTRNYRVLNKKFH
FT                   NFAIDRQPIQRDDKGAIIPPPNPWLTANNKAAPFDQYFYLIMNVAVGGTGGYFTNGPWS
FT                   NSDPNAQRAFIEAKDKTWGPTWPNDPKRRGMAVDYVKMWQRCG"
FT   CDS_pept        946509..>949604
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="Predicted"
FT                   /locus_tag="um10637"
FT                   /product="conserved hypothetical protein (N-terminal
FT                   fragment)"
FT                   /db_xref="UniParc:UPI0001595394"
FT                   /transl_table=1
FT                   /translation="MSHPPAVKDNQQHQGSTHNSVATDNPASEVMVASLASWSPKNSAS
FT                   AAALPNQEACLHTADSIGHSGSPIMDVSPAMPSMPFTPPMSSSPKAQDATIRMMLAHMY
FT                   RTGQREEWLHDDGADYEQEGVFMLCPTALHGIYAHPAEAESEIEWVKELLVSVQASCAV
FT                   IAKPASTYELLKHVSLHPSLILETGEEIPIVDDLSQVSMLASTSGCLLLRSTGMAVSYG
FT                   SAIDVLHMARQLDAALVTSLFAFTMPALPSSIHMAATVAQEEQQHDDEVRAVMHQQPNA
FT                   QQREWLSSLPPSDKPDKQASSDDSMLSGEKEITEKSVAPVVLFDQETGETVLEPERTST
FT                   HVAALLSGLGVAVNMVIMSLFARDVVINTLADSNYMRAVLLVAIVPRFLVAQYFCDHII
FT                   LILAQLIFPVSQMHRNSLYYSGAPSAPLAKDHRLPHFTVHMPCYKEGLQTVLAPSLKSV
FT                   MDAVHAYRAQGGTANVVISEDGLRLLGKQEAEERVRFYNAMGCSWVARPADGEKGYKRL
FT                   GRFKKASNLNFTYTLSLRLEQIIDEISTTRRQQRIAAQSSNASANFSETGAEIEAEDQA
FT                   IYAEALQRVLDESDGRAWATGNIRMGDYILLIDSDTRVPENCLMQAAAELERSPDVGAL
FT                   QHCSGITYVQHHYFERLLGYFVGVFTNFSISWVCSNGAMAPLMGHNVFLRWTALQQVAD
FT                   KRLLQEERQIFSSQHVSEDYELAMRLQMAGYCVRWATYSNQAFREGVSLNPTDEKARWQ
FT                   KYAFGACEILFNPFVRWYKGPFTSLFWRFMWSRNVRTAGKLSMLSYLFSYFALGVSLPL
FT                   TVLMTVIQGLFWPTLDTSFKPVFDTWISVMVVFNFAGAIGLVTVRARAGHSTLLQSLWE
FT                   GVKHLPAIIVFFSGITYHVAASILAYFFSVRMTWQATSKDFQQTSIKQVIRRFWHCYLT
FT                   MTLLLVVSVVAVSPLVPLGWRIGTFTILFPLFLAIIMHFLFPILLDPGILHKFIPRYYA
FT                   AKAKAVEPSRAFFYGANAEGAQPGQFRMTFDDEKAGMHKSSSS"
FT   gap             949606..949705
FT                   /estimated_length="unknown"
FT                   /inference="um_contig_1.105-um_contig_1.266"
FT   CDS_pept        join(951041..952036,952064..952528,952563..953444,
FT                   953474..953655,953682..953793,953918..954232)
FT                   /codon_start=1
FT                   /gene_family="HOG000135912" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um06506"
FT                   /product="conserved hypothetical protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022698"
FT                   /db_xref="UniParc:UPI00003C28D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P057"
FT                   /transl_table=1
FT                   /translation="MALDDFIYNAEHGVVVCRSCATCLVPREQSWRHHLRAKPHELLRE
FT                   SLQRTVDHLATYSLRSSDELRAQAKNASRQPHPCQVIPGLALYDGFICHCAPGDCTYMT
FT                   RRIKLMRDHLTVHDNKGKQHSDATPLWRVCKLQTYFTAKGMIDYFEVEDAAPTISQQAA
FT                   PLDISPSSSSSSTSISATAVQHARSQFHQVIKDQICHRSRLSDVGRDALRFDSRSDFEP
FT                   WLVTTGFPTHLDGLRDAEIRSSYLLPASLDGNALLDGSSEASSDSHLRRILIAAEHTLR
FT                   DAHRLCSDRSPDRKLTQQRALTLNYFRLNDASDAATSREAYLRCPKNKNLLLLTYYYRV
FT                   VYRSDGHFTSNAAGHPLRHDVIKPTLEQSQAMDAIVTALRLQDAFATSTASSADMAIDD
FT                   DPTATAELDDRLKKAIRDLFVSLICCRIGNRPFQSALLSFCAMRSRTLVQAVDGSLHAR
FT                   GRYKWREPKNYIGDLSALIWTSQLILFDAILLRLEQTCRTYCHAMAETPFGQMLQWSSH
FT                   LFAASMNTIAEQQVRWSIDGFTLDYKGTKMHMDHISQLVVSEYKVACRILYDDLLLGIT
FT                   DTPRIEPCQVHDDLDQDEEGASWLTDARNAELLADAQLAVWNKILASPELERTFVRQLD
FT                   PGSSNVGFCPRAIALYETRVQDFLERLLVMIHISSSPPLRSPELLSVIVSNTDARRRSV
FT                   FVWEKSVLLRVRYHNSLELTGAAKDNLRFLPSEIGSLFLTFLAFVQPLREVFLRQNQPE
FT                   ARLSPYLWSKMDGSVWKVAAYRPAFRERAAWWRQVAASIIKEKFSQQQRAHFDLDDVEA
FT                   SEEIEDEEDLAYLAGMSNHSVSTPKPCLCCLIHHAYHASDSWRTLLNIDAKLLAERLGP
FT                   GSCAAARRSLQPHVSVLGRLASLGQFAEASSQGQRSRLAFASPISVVAHWTARDRTTQV
FT                   LAGWSSIGPKPRPIHALSGTPKQSAMSLSNSILMVGKDSAGFDLRCAGLAPDI"
FT   CDS_pept        join(complement(957106..957135),complement(956519..957086),
FT                   complement(955837..956445),complement(955496..955789),
FT                   complement(954994..955451))
FT                   /codon_start=1
FT                   /gene_family="HOG000135915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4"
FT                   /locus_tag="um06505"
FT                   /product="conserved hypothetical Ustilago-specific protein "
FT                   /db_xref="UniParc:UPI00003C28D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4P058"
FT                   /transl_table=1
FT                   /translation="MKGYPFPDRGRLRRPTTISVTFRLPVSSALGSRSLLNASPSGPLS
FT                   SKNTIYLMQLNHLHLKDGINAERTDFFETVSERASDTLKRADSSFDEKSKHNELFTTHL
FT                   KSPLAALEREMKCIIAHMYPPNAHGGSSPRPPIIVAFDECVELNIEKNPDINQLNSLRR
FT                   AWNWINTQQASAKTTTFWLVLISTSSSAADFVKHAHPFLAPRKLLRTLTSFTTDDRCGR
FT                   HSILEASGMMANHKLMGGEDFAIRKTAHCFSILASRLALSLSPTESPNSELFARQKQFV
FT                   DSTVDRHMRIVTHVTSEGVMHVESPSEPVLAIAASNIMLAPYLQSAENARGYTYADILK
FT                   KFQQECLLNPDVALLKGSFGELALADHLDGCLRRREAQKNRTNRAKGIVGHPARGRQHL
FT                   RQAPNLAALRQRLEDVYDAGSRTERHAIPFRDQLQSASATLPMWINFTHFDLLPEAINK
FT                   ITPEFLWHCWKRGVAVQMAHTQHGIDGIIPVFVGHLDRPFVDEGERHAARYMTYIAWEA
FT                   KNRRDPQSTTVPASSAPVVAGPVIKSASMAPPNEKPLTEQAPVDRAFRPWHKHRVQESA
FT                   RRLSTASDAYYLVNSVLGCAFGVLLGPHAYPCLDLFEARSTLVEILSSSSDPAPNPLNI
FT                   IEKPMWNERIQPESDSI"
XX
SQ   Sequence 957186 BP; 217918 A; 258512 C; 258977 G; 220679 T; 1100 other;
     tggttcatcc ccgatgcctc tacatcactc ttgagcctag agagggcgag aggcacgctg        60
     cgcgctacat gacctacatt gcctgggaag caaagaaccg aagggatcca cagagcacca       120
     cggtccctgc tagttcagcg cctgtcgttg ctggaccggt gatcaagagc gcctcgatgg       180
     caccgccaaa cgagaagcca ctgaccgaac aggctctgtt gatcgtgctt ttcgaccttg       240
     gcacaagcac cgggttcaag aaagcgcaag acggctctcg accgcaagtg acgcctatta       300
     ccggtcaaca gtgtcctcgg ctgtgcattc ggggtttgct cggcccgcac gcttacccct       360
     gtctcgacct tttcgaggcc cgttcaacct tggtggacat tctgtcgtct agctctgatc       420
     ccgcaccaaa ccctctcaac atcatcgaaa agcccatgtg gaatgagcgc atccagcccg       480
     agtcggattc catttagggt gagttcgatt ctcgcctgct ctagggtcat cgccaaagtc       540
     aacgttcaac accgttctgc aggctcaagg cgccaccagc accctcgatt tcgtctctct       600
     cctgatcctt tccgaagctc tctcctgttt cgtttttcgt acgcaatggc aatgaacatg       660
     tttcccttta gctacgtttc gttgtgttcg gaccttactc accataaacg cgcacaatgg       720
     agaccttgag cgcgcgacgc tggctggaaa attatctgtg gaggactgag cgcggtatcg       780
     gcttacatca ggttggacat cgtgaaggtc atcagtaaat caattactga tgccggggga       840
     tacggtcgtc ggggcttgag ctttacccta gcatagttcg tttcgtactc gtactctata       900
     ggtcaggcgc acaaaccaaa agactcaaat agctctgttc ccctctatac agccatatga       960
     acacgcaacc tgtctcttga ccccgtctgc cgtctttatt agcaataaag ccgcattgtt      1020
     ccattcgggt tggtgtcgcc acacacatca acattgaaca catccaaaca cattcgaaac      1080
     ggccaacccg aagccgaagc cacaagtcga ttgaagcgga ctgtgcagtc aatctaccca      1140
     ctatattcca ctatggtcat taaggcatca cttcgtaccc gtgtgatacc tacgatatcg      1200
     aagttgagcg aaactcggtc tgatctcgcc aacgagacat catactgcaa gggttagctg      1260
     tcgacaatct cattcactag tgtcgtcagc tttgaccatg atggatagat agcatgtaag      1320
     acaaaatctt tgatgcattt cgatgttccg ttctgcctat gccagcggca aagtctctac      1380
     tagtcagtcg tctcctcggc aagtttgtaa gcttaacctc tccattaaaa atgtaccctc      1440
     acgaatatcg actcagtatt aataaataat tcgtgattgt gaatcacgaa tgatggtggg      1500
     tcagattgtc tcaactgtcc cgcctaggcg tctgacagtt gggaatcgtt aatgatgtca      1560
     cagctaagcg tcacccgccg gttgaatgca cgatgctttg attgcggctt aggcctatgg      1620
     cgagacatga gagctcgacg aagctccctg cccgctgaaa aagggggctg aatgagcgca      1680
     agggcgagcg acaagaggga gggagtacag ggggggacag ttcgagcgct aggctgacca      1740
     gcgctcagat tctttcacag tgacttacga ctagttgctc caggcgggag cgtgcgcgtt      1800
     ccagacgatg tacaatgtgt aaggtttgaa gcgcttcgaa gcacagaact cctcgcgttg      1860
     agccgaggat atgctgtgac atgcttcgaa acacaagaga aagctaagag gaaaattcag      1920
     cgtgtctact ttgagaagca catgttactg gaagcctgat cttgtatcgt taaaacggat      1980
     cctatccttc gaaatctcaa cagtcgtgag tcacgagtca gcgtgtggat cgaaaagtgg      2040
     ctccagggtt ttgcttgcta gccgaacggc caagattcat tcgcgattcg gtctgcgaca      2100
     ggacagcttt actgctgtga gtcaacagcc gttgaaggtc ccctcccaag gccacgcatg      2160
     acatgcagct ctcgtgcttg gcatcaaacg ccacctgctc cgtgcacaga cgaatcggat      2220
     cgtcgcctct agttgaagac gtctcatcag acaggctccg agacaccaat ccggatctag      2280
     tgctacttca gcttagctcg actttgatca gatcggttcc atagccacag acgatcatcc      2340
     tttctagcca tctccctgag tgattcaggg ttgggtcgca atgcagctgt ccaacacgtc      2400
     tggagaaggc tccgcctgcc cattccctac ctcgtcgccc gtgattcgag gacccatcat      2460
     gcaatcaagt ccggagccac tccagttcgc atcgtgctcg gaccaagagt tttgaatagt      2520
     ctaggtggat gtaaaatgtt ggcaagtggc atcgtaggac actgtgcggc cttactaaca      2580
     aggtgttttg tctcttcttg gtcaacttca atgccgatag ctcaagacat ttggcatttt      2640
     cactcttcca atgtctcgct ttgactccgc ccgcacctga gtaaaagggt tttgcgtctc      2700
     ttctatttgc gcttctcatg gcaaatgctg ctgttgctta agcttcggtt ctggccaaac      2760
     aggcgggcag ctcctcatac gcgatcattg gcactcgagg caccgaggag ttacagggtc      2820
     cttcgtcttc tgcagggttt cgcctcatga acgcaatatc cctttcccct atccctgtcg      2880
     gctcacagta caatcctcac acgttgtcct gccgatttca tactagatct caaatgtgtg      2940
     cacacggaac atcatttcct agaccgaccc tcagatagct cttaaccctt agaacccaag      3000
     tagctcgtga ctcgtgactt gcaattgtga atgtcgatct cgtgacaaat tgacggtcag      3060
     cgcaagctgc attgacgatt tcgacgttga tctcgcagcg tgtttcgtca aacggacgat      3120
     tgggtatctg aaacgcttga catttgtatt cgatatttcg tgacaacgtc ggtgatgctc      3180
     agtctcagtt cggttggtac gattcaacac ctccattatc ctacgcacgt tcatgcccat      3240
     caagtgttta caaaatgtct ccagagacat gctcaacagg tacgcagtct ctgccatgta      3300
     gatctgattt ggggctttgt ggatggtact ctccgtccag ttgctcggcc aggtagagga      3360
     caggaagcag tctacaatgg ctggaaacac tttcacgctc tcaagtatca gatcatcagc      3420
     ataccagacg gctggatctt tgcccagggg ccatgggacg gcagccagga tgactggtta      3480
     gtctggaaga tgtctggctt tgcagactgg ctacaagcat cttcattttc caatgacggc      3540
     aagatacttt cactgtttgg ggacaaaagg tatcatctcg atcatcacct catcatccct      3600
     tacaaaggga acaacatgag ctgtaaagaa actcgattca acgtcatcat gaacaagtat      3660
     cgcatcacag tggagcgggc cattggctct gttggtgttc tgttccctcg gctaaaaaaa      3720
     agacagcagc agaaattcct cttgaccccc attgcaggcg actatcttgt tggtgtcatc      3780
     ttgcgcaatc cattgtcgtg cttgaagggg aatacaacat cacgatactt tggcaacgct      3840
     tgacatgtac tttaccgaaa gggttcccta atctcactct gcatgagcat acgtaggacc      3900
     atatcaatct ttgaactaag accactgagc ccctgtttga ttccagtcag ctccgttcgc      3960
     agctggctga cctgactcct gattgcagcc acttcttgat ccgatgactg agaagtacca      4020
     tggttctgtt ggctcccatg gacaaacgta gctgcgtgaa gatcaatcag cctgttcacg      4080
     cctttgacaa gggtgtcact gatttgcatc tgtagcatcc gccgcctctt ttgtgctggt      4140
     gaggtatgtg tgctactgcc atcatctgtc tctccagtcc catcttgatc ctcgtcatct      4200
     tgagagtctt gacttgtgct tgcgtgctgc ctgtctcgat gtctctgaag ggcaagtggc      4260
     tgaccagtca agccagcctc acgtgccaga ctcactgact gttttctttt cagggtcgtc      4320
     tggtggcggc caatgggact agaagcaggt ctatggtcat ccttctcatg tggcttcagg      4380
     aacgccaatt tgagagagga ggtgttgtac gagtcaacaa gattgtagag cagccgatag      4440
     gcctcatcct catcaaagtt tgcaccggtt gccctcaatc gcagttgctt ttgactcctg      4500
     acatcatgga ccatcttgcg ccactgtgcc tcaaaggctc cagcattccg tgcctgcctt      4560
     ccatgtgttg caagagcctg gtttgtttag tccaatgcat ccgtccatgc tgttagagcc      4620
     tcttctcttg atgctgttgt ccatggatta tgattgtcaa gtgcggttat gaaacaaaga      4680
     cggtcaacag ctgaccagtt tgcacctctg ggacgggctt tacttggagt tactgtgacc      4740
     agctctatct cctgttcatc tgaggaaggt actggtgatg cattcctggc ttcattgctg      4800
     ctttccgctg aactgtgatc cagataactc cgtagctctg ctgattgact gtccatttca      4860
     agtatcagaa tgtcgctctg acttccagga ctgcacaaga gattgctggc caagggaggt      4920
     ctggagcgct caaaaggtgg tgatgaagtg gattggaacg acccaaatgt ctgaggttga      4980
     gaaaacacgg tggtgtgcgg aaagaaagag agggacgcgc cctagccccc attttaacat      5040
     tcaaaattcc cgtcagaagt tgttgatggt ctgctggaaa ttgcacttga agaaagtctg      5100
     aattgatggt gatggtcagg aagcaagatt gacgcagaca aagaagcgat ttcaaacttt      5160
     ttggatccaa aacctctaaa tccaattttg cccgtgagct aaattttgac tttggcttct      5220
     cgtcggatcg cgtctggcca aaacctctct attgagcttt ttctcgcgtc gtttttccac      5280
     acattccacg tgaactctgt tgtggagggt acagtctcgt gatcaaaggc aatcgtgaat      5340
     tgattttttt attgcaaaaa tgagatgaga aaaacaaaca tttattttca ccaatgtgca      5400
     tgcaggctct caacaagaac gaagatgaga ttggtaggtc agcgtgtagg cgatccggac      5460
     ctctgagggt gtggcggtcg tcatcagtct gattcaagta cttgaggagg taaagggatg      5520
     cggttcgtgc cgtattgact tgcctggaca tatgtcgtgc gagggcgccg aacgcgaaag      5580
     agatatccgg gcgggcggta ttggatatcc aaagcaattg accaacgaat tgttggtaca      5640
     ttttggcgtg ttccggtgaa cattcatcgt cgtcagtggc atggatgagg tatggcatag      5700
     ggatgtgaga tttagtggta gggtcattga gccatttgcg ggcggtatca cggatgttac      5760
     ctatcacatt caggaagaaa gtgcgttggg agcggtcacg atgactttta atctcgagga      5820
     attcttggac ggggcctttg tcttcaatct tccacttgcc cgcaacttcg gccttggtcc      5880
     gcctgacctc ttcgtgtgac agagatgcga tgaacataat gtcgacgtaa gccgtgacca      5940
     ccccgagggg tgtgaaccgg aaccccgagt gcagaggcat ggtgcgctgg gcatgatggg      6000
     aataggaata ggaataatac ttaacttctt gcactggcaa tcgcccaccc acgcatacta      6060
     cgaacgacag gcccaaaact ccattgtggg gattggtacc atcaccggac aatcactcgg      6120
     agtttagctc gtgctgtctc tggactcgac cgttgcaatt ataaccgtca aatcgaggag      6180
     cagtcgtgac ctcgaaggaa aaatgggggt tacgctcgtt gctcgacttt attatttcca      6240
     agcgacaatg ccggcgtcat gagcaagaac accaaaagcc gggtcattgt cctcaaacag      6300
     ctgacttggt ggtccaaacc cgaacgactc gttgttctca tcgtcagcat ggtcatgttt      6360
     gcgcacaagt aagacgttgt cgcaatacaa gacaggaccg aagcgatgag aaacgatcaa      6420
     tgtggtgaac cctccaaacg cggtggcatc gtgcaaaagt tgacctagca gtgcatcgcc      6480
     tgcttcgtct agggaagctt ttggttcgtc caagatcaac aacgtgcctt ttttgccgtc      6540
     gtggtttgtg cggatagctt gacaggcgag tataagctta gcaagggcaa gcagttgctt      6600
     ttgaccgttg ctgagttgaa tctcgccact ctgtacctgg tctagaggta tatccaagcc      6660
     gccaagtttg agagccaggt cgtccaacga gacgcgtttg agagcttgcc agagatccga      6720
     gtctgcaagt tgcatacgat cctcatcgac aagcacacac agattctgac gtaacgtaca      6780
     gctaggaacc accgccgcct gttgaggtag caccaagaca cgctttctca atccagccag      6840
     gccgatccag cttgcgtcgt ctccatcgag ccatatgttg ccggcggaaa gaggggtaaa      6900
     tcgtaacagc gccgagatga gcgacaattt tccactacca gttcgaccga cgacagcaac      6960
     cttttcactg ggtgccaagt ggaaagacag gttacgtaga actttggtag ggatgcccgt      7020
     gtcaggatta atgtgattga cgctgatgca tcgggcgacg acgttggctc caactaagca      7080
     cgaagttgca gatgttgtcg actgcgtttt gtgaggatct gcctctgcct ctagtgctgc      7140
     tacctgttgc agacgctcga tagcgaccaa gcacagttcg ggttgcgtcc acgccttggt      7200
     aagcatagtg atcgccgcag tcaggatcat caattgtgtc aacccaaccg ccacccagcc      7260
     cacagtagac tgacttgaac ctccctctcg tgcactgcgc tgtgctagcc cgacactgag      7320
     ggaacagagt gcagtcgaaa tacccgctac gatcaagcca gataccaagg tcaaccaacg      7380
     catcaacgac aaatttaaga agaatgccct ttgactgcgt gacaccagca cctcgttcag      7440
     cctggtaaag accctgtgac ctgcaaaggc acgaaaggtc acgataccat caatgtttcg      7500
     ccaaacagcg tgtacagcgg actcttgcac tccaagtcca gctttcgaac ttggcctgag      7560
     gtctgcgggt agaagctctt gatcagccaa agtgctagta gcaagatggg taggatgagc      7620
     aagaaccaag gcgaagccaa cgaaagcagc atcacgcttc ccagaactac accgaggttg      7680
     gaagatacgt tgaagatggc cttggtcata tcgttgtccg aaacaaacag atcttgactg      7740
     aatccgttca caatactttc cgctgaagtg ttgaggaaat acgatagcgg tacagccaga      7800
     gttgaagcta gtagtagaga gtgcacccta tgagcacacg attgggccac gcgtacgaaa      7860
     aggtagtaga tctgtcctgc caaggccaac gagttgagcg ttcaagtttt caatacaccg      7920
     agccatgctt tgaaatggat tgcggcttga gctcttccgg cgtgctcatt ctccatgcgc      7980
     gcaaaggctt ggcaaagatt tttcgctgtc atttgctgtt gtgattgcgc aaagaattgg      8040
     tgtacgcact ttcgatggca gtcattgcat ggaagaaagg tggctgcagt ggcaggcgca      8100
     cactttttgc gaatggatgc aacggtgggc aggagcaagt cgtgagtgag agacgagaca      8160
     cccgcaacta actcgtttac attccatgtt ggatgctcgt tctagagaca acatgtaaaa      8220
     cgcctgtcag accgtagggt gtaggtctgt tttatcttcc tgacgtgaaa aagcggcctt      8280
     gcttccatat tcttctcttc ggcacttttt tggtaggggt tgctgcataa catcgtatct      8340
     gtgcacatga atatgaatac tttcagtaaa aggcatgtgg ttatcgtctg ccgtaccctc      8400
     aaagatgtga gccaagtcta caaggtctta taccgaatcg tgggaagctg atgttggcac      8460
     cgcaaaagac tttgctgcaa gttcggcatc tggagcagcc cagccatcct gccacttttt      8520
     gcaaaagtct ggccaacgtg ggtacagacg tgtcgtcgcc atagccacgc catctctcca      8580
     caggattctc cacggagcca ttaaccacca acgctctagc cagacgtact gaaagtatga      8640
     cctccactcg tatgccacct tgactctcgg attgatccaa atccgcggcc tgagcggtgc      8700
     tacagcacga tggatgtcaa aagacatcaa ctggcattcg ctggaaaagc agcgtggcga      8760
     ggatctgaat cgaagcggaa gctccaacgg tggttctagg gcgtccgggt tgacatcttg      8820
     agctgatgtc tgtagagttt ggtttgcttg acttcggtcg agggttgctc gtttcgctgc      8880
     tagggtcgaa acagtattga ggtaccacct tgcatcgaaa gcgcttacac gttccagcaa      8940
     gcattgacca aaaggnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9000
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnncacac      9060
     cgttcagcaa gcattgacca aaaagggacg ctcatctcga agcgcttgaa tctcgcgctt      9120
     attggcaaag tagggccatg ttcgcttagc ggtctcgcct tgcacatccc tcatgaccca      9180
     gatgtcgtag aaaccattgc caataaaatc gagagcgcaa gcctggtcgt acctgcccgc      9240
     atcggtatcg agaagctgca gaatcgcatt tggctgaaaa taaacatcgt ttatccacag      9300
     aacatgcgta aaaggttgtc ctttgtcgaa cagctccttc aggggttcta gagctacgtt      9360
     tcggacatag gccaagaaat cgattcgacc gttacggtgt tgaccgaggc caacttttgt      9420
     gcgcttgtcg tccataagaa tgcgacgtgg tacgcctagc tgttgaaggt cgtggtcgat      9480
     cacagagagc atcggcttgg tcttatcgga ggagtgcgat tcgtaaatgc tgacgtacgt      9540
     gttgttaacg ccaataagct ggaccagttg ttggagtgct gcagaatagt aaggtagcac      9600
     atcttgattg ttgtgtagat tggaggcgat gaaaactttc ttgtctgtgt tggctcgacc      9660
     tgcagctctt gaaacggcga ctgcggatgg gtcgagagcg gattgaactt gacagagtgt      9720
     gaagacaagg aagaggagat agctgcaaac gaaaaccagc ttcgttcttg tccatggagc      9780
     aagccagaca aatgtcaatg gcagagcaaa gaggaacagc gacaggtaga agaagatagt      9840
     cgaaaaagtg tgaaagaaaa tacacaatgg caaggcaagc agcactgtca agatgctcac      9900
     tattggcaag atgccaactg ctcgtttcgt caaggttgac tcggcttcat ggtgatctgc      9960
     tctactgcga agcaggatat agtctgtatg cctgtatcgc tgctgttcac gggtcaactg     10020
     taaagacccc aagaaggaag agaacgcttt gagcttgatc atgaagagac gcagtaccgc     10080
     caaaacgtct tgactggaga gataaagagg caaagaagcc aatagtacga agcgaagagg     10140
     tggtgaaaga gacgcagcct ggagaatcca cgatttggaa gtgtgccggc taagcgtcac     10200
     tcgctggttg aacgctagat gcttggattg cggctgaggc ctgtggcgag acctgagagc     10260
     tcgatgaggc tccctgcccg tcgaaaaagg ggggctggat gagcacaagg gcgagcgaca     10320
     aagaaaggga gggagtatag ggcggggaaa ttcgagcgct aggcgatggc cagcctagcg     10380
     acgatgagaa agatgatgga ggagaagaaa ataacgtaga ttcatgaaaa acactgattt     10440
     acagcgcccg acatctatag atttctattt atagatgatg acatagatat aaagaaaatt     10500
     cggaggcgag ctccgctctc ccaggcgtcc tcgccctacc gcacgagacg cagctgttgg     10560
     aatcacagca gtcagtgctt tcatttcggc tgttgacaag gcggcgacca acattacgac     10620
     tcggcaaaag cagaaacaaa gaggcccgtg gaccagtctt cggctccttg aaaagcttct     10680
     gcaggaagac tgtgtgtcgc cttcaaactt cttgagctgc agccctagct ttccggcagt     10740
     ctttgtgaat ggacgaggct tcttgcctga aaagtgatca tcatcgacct ttttagtgag     10800
     caagtgagtc ggcagcaccc aacaggatga gaaccgaggt gagaccgctc gtatttgcac     10860
     acactcgaaa gacgcatcgt taagcggaat gggacgtcgg aagcttcaca agcgaagagt     10920
     agaccaacat cttatcttga ctgatacaaa caaatatagg attgcatagc atacagacaa     10980
     gagcattctc ttattctacc acacctcatc ttccgctacg tggtcctcaa aaccacccgc     11040
     tcgagcgcca acttcatccc ggcattatcc acaatgagcg cctgtccatg attatacccc     11100
     ttcatcacac ggatacaatc atctcccacc cctgcatccc tcaaataagc cacactggcg     11160
     ggtacatcga ccagcacgtc ccgttccccg aatacaaaca gcaaatcctc cggtctgtgg     11220
     cttggcaact cgtcagccca gaggatcata tcgaaccaaa ggaagcggcg ggcgattgta     11280
     tgggcaaccc ccagctctcg gctgacaaag tacccgagca ggacttcgat gccggttgcc     11340
     cagcggcggt gaatgaagct gtaacaaaca ctgccttccc acaagcagaa cgatacgggg     11400
     tcgaccagga tgtttcgtac aaaaagctcg ggcgctgtgc gaaggagcca gccgagaacc     11460
     attgtgccgt tgctatggct tagcgttgca cagcgcgaga agttgtgccg cttcgaaatt     11520
     gagatgagtg aggaagcctg ttcgtccttc gatgggggct cgagaaaata ccgggagaag     11580
     atgttggtgc taatgtgggg ctgtagcaag atcaccactc cgtcttggtg cttggctagc     11640
     ttgcggagca tagctatgta ctgccccaag ccgatcccaa gaccgtgaag gaagacaatg     11700
     ggcagactct ccttctcccc tttaatctta ctcggcttat tgggctgtgc aggcttgacg     11760
     aggaaactac acttgccaga gttttcgagc ctgaacccct ttgttagcat aagccatgcg     11820
     atggtgccga aggacacacc gttggtgaca acgtagtacc cgaaaggtct atgcatcgtc     11880
     ctcacggggt ccaatgtaag tcgaatcgct ttcacctttg ggttcaagcc cttcttcata     11940
     tcggtccaac ccaggcggag cttgaccatc tccagcccgt cgttgatcag gtgcgcgtat     12000
     tgagggtcag ccagagcgtc cttcagcgag cgagcggaaa aggcccatgc cagccactcc     12060
     ctcatgttgt cctcgtagat gtcttcgatg ggagcaaaga agaaccagct tctcagcctt     12120
     tcgcggcgag cagaggcgtc gtctgggtcc acatgcttgt ccttgaaagc acacaaaccc     12180
     attggctgct gctgcttggg cttgtcatta cctacgccgt tgatgcgttt ggtgagcttg     12240
     gattcgggag cagggccgag tccagcagtg agagactttg tgagaaggat ttggagagtg     12300
     tccatatcta cgttgagcgg aggagggcgc gcagccgcct tcttggtgag gaaccacaag     12360
     tagatgctga atggcatttc aatgagcgca tagatgtaac agaatctcgc ccagaatcca     12420
     tagccatggg ggatgtcgat gggatggccg gtcgagtaga agcggtatgc aagaatggca     12480
     tagcagatag gtgtaacgct ccagactagc gctgctgtag taaagccata gatgaaactg     12540
     aggcggcgct tggggttgtg ccccctgttg aagcccgaga cgggatctat cctgtccaac     12600
     ggaacaaaat gctgtttatg agtcgccatg atgagtcgtg tattgtcaat gatggtgggg     12660
     tggaaggcga ctggacgcat ggacgcaagg ccagctttca tatctgttga cgaggtgggg     12720
     cgcttgagca cagctgagcg ttaattttgg acgttgcgtc tcggatgcag tcggaaatcg     12780
     ccaacgtatg caacttgtga ctgttttgtg ggacgtaagg ctgcacgtca cctgcacgtc     12840
     tgattttcaa ttattatttt tccgctggtg atgatctctc ttgaattttc tccgagatgc     12900
     tttcacgcga aagaaaagtg gctgtccatg actgacgcct gctcagccaa aatcaaaatg     12960
     ccacgttcag atctcgcacg ctgccaggat gcatcgcgaa ccccacaatc acagaatcac     13020
     gctcgggccc tccagatact gactacggcg attgcactcc tgattgtgat tgtgcggaca     13080
     tgatctacaa tttggtacca accatctcga cccgtttttg ttcggaaaat tgcctcatcc     13140
     agtggtgaca cgcactgcag tcaattacgc acgtcccaat ctctgaatct ctgtagggac     13200
     tttgtatgca gctttctctc gtagacaagc tctagctcca aaagtcatga tcaccacaga     13260
     tcgatgtatc tcctctccac tcgggcttcc tgataagcaa gctaacaaca gacattcgcg     13320
     attaccgacg tcatacaatc tgtgctttcc tacccttcgg ctgcttgctg atcttgcccc     13380
     tcctggccaa ggccgatgct aaccctaagg cagccgcgcg ttaagttgaa gcgatcggtg     13440
     tttgcgggct acaactaact tagcaaaagg tggaacatac ctctactagc actcacgact     13500
     gttgatcgat tcattgagca cgacaaagca ctatcgtttt ttgtacacta aaattgtggc     13560
     ctcaggattc tggcaagacc acaagccggc acgcacttgg atcatgcttg cttgccggta     13620
     cccttgtctg ctgattgcat cctgccatca cggtttggct gtatgcaatc acgaatgtag     13680
     ctgacgatct ttgcggaaga acctgtcaca gaaaaagtcg ccgcaaagga tgcacgctga     13740
     cgaattgcaa ccaactgaca gcaacggatg aaagagagcc atccgagtcg gaacccatct     13800
     agcatcaact cggtaaagac tgccgcggcg gttccctctg atgacagcag caaaaaggtg     13860
     gtgcacgcaa atcaaatcag catgggaggc gaactgctgc tgtaatacag tactattaac     13920
     agtatgataa atatactcac gactgtacag tattttaaag tcatgaatgc ggtttgtgcc     13980
     aagaaaattg atccaacttt ttactcacga ctgtataagt gaacttaact tagcgcaagg     14040
     cccgtttcca tggagccgag cgttaccgaa cgggccgtcg ctttggcggt tcttatgcat     14100
     ggaaccacat catatggcgc agcagccctt ccgaagatcc agtggttgct cgcatgcata     14160
     ccgttccggt caagatcgcc aaacgtttgg caacagggcc ttgacctcgt agctatgagc     14220
     aaacggtagc taagaggcaa gaaaaggtgc ccacaaacgt attcccgatt ggattcgaac     14280
     cgagacgccg acataacgtt actgcaacac tttcacacac tacacttacc tcattcatgc     14340
     tgtcgaccta accacttctt tggcaattct cttacttctc ttgcacacgg ctttgacagc     14400
     aacaccgggg gccaccgtat tgcccaggca cgttcacgtt ctcgagggtg caaccttgac     14460
     gagcattgca tcgcagaaga cttgtcgctc tggtaattat cgaacattca tacagcaatg     14520
     ttgttcacca ggcttgaatc gcatacaagg ccttgccttt tgactagaaa acttcatcat     14580
     gctcaccatc ccactcgcct gtgtcctaat ttttaaccag tcttctctgc ggccaacgat     14640
     tctaggcaac atcacgtctt tattcgaaat tctctcgacc aactcaacta tgcagaacgc     14700
     cacgcttcac ttttgcgaat ccagtctgtt caacagtacc aactgtccag gtgcctttga     14760
     gcagggacct cctggtggcc gaagcaggtg ctatacgacc agccaagtcg atgtcccaca     14820
     gattgcgctt aactactcgc aaacgaacaa cggcggtcaa ggcatgtcgt gcaccgatcc     14880
     ggtgaacaaa tcggctggtt cgaaggttca acttatacac ggcctggtgt tgatcacctt     14940
     gatcacttgt ctcatgtcgg cggcttctgc cttgtcggcc gttggtagct gcaagagcag     15000
     ccaggacgaa ctcatggctc ctgctgcccc atgtgatgga caagattcaa acctagaacc     15060
     tgcgccgtaa tgtgggatcg atttttacag ccacaaatct tgtaccaaca agatcaactc     15120
     gaacgagctc aacatcaatc ccaaccttcc ttatggatgt ggtgcttgct taaatgaagc     15180
     tctcacatgt tttccccagg gcactgttta cgttaaaacc aacgatcatt tttacgcatc     15240
     tgacaagctc attgtcattg gttcgggtga atgcgtcgac tggggaccta acgatgtacc     15300
     cgccgagatc acccagacgg caaattgcat tcaactccaa gcgttgactg aaggagcaca     15360
     gtatcagtgc ttcctgaata gttgcacttg caagggcgcc aatgccaggc tagcgctctc     15420
     cggtcgtacc ttgaagaaga agcgaaatgc cacctgcaag tctttccgac ctgaaggtta     15480
     cggccgttcc acctattcga gatttaccaa agtatcggac gaggtcagtt gcaggcagtc     15540
     ggcttcgcca tgcaccattt ctatcgccga aggcaaacct gccaccttct cgagcgagtt     15600
     ttccctcaca ggcggaggca cagtgaaggg aatcgacgtt ttcggagcta cctttggagg     15660
     tacctttgga ggtggacaca cggaatcgta ttcaagtacc atctcttact ctacctcggt     15720
     accggtaaga caatgcgggt acctccaaag ccacagtggt gccaccaagt tcgacggcac     15780
     ttatacggaa tgtgacgatg gcgtggacaa ggcgggaact acgctcgtgg tgcgcgaaaa     15840
     tgacctacag tacggattga ctcttgtgtc atgttgatca atgagatggc tcgccatgtg     15900
     gccatcttac gcagatgttc cttgcgatat ccgccttact tgggtgcaac agtgccttgt     15960
     gttttgcaag cgctgattcc cacaacagga aatttggacg cggttcgcaa taaagagcgc     16020
     tgctggccgc cttcgtctgc ttccatttgt ccgtccaata atccccgtat ttattccccc     16080
     atgccttgac ctggttcgtg ctcaggctag ctcatatggt tgatcgtcgt cctggcgatc     16140
     ccctctgctt tgtccgttgt gaactgtaga gaatagattg cagttgtttg ccttcgaaca     16200
     atttaatgta gtcagtgaca tgcccctagc gtgcggacga acgagaacga agccagagca     16260
     gcccttgcat attcagccgt tgcgcatcac aggaaggctc agcctcctag agacgaatgt     16320
     cgtgctcggg ataaaggctc taggcgagag gagtgttatg cgcagaatga atgctctcca     16380
     caggacaaag gcgagacgca aaatgcaagt tagacgtctc acatgatagg agccttgctg     16440
     cacagcatac gctcaaggat caaggcttag agcgattcgc ggagtaccgc aaagggaaaa     16500
     tgcttgtcgt tgcaggtttc gctaacttat actgagttac attgtgagtg aggatgagca     16560
     aatcggagac gactttatag agatgctcat ttggtatcgt gtatgtgtag cttcaggttt     16620
     cagaaataca agcgatcctt tcaccatttt cttcgcttca acaagacacg agactgtcaa     16680
     gaaattatca cggggttttc acccctaatt gttctcaagt ataacagctg caagatacca     16740
     tttacagtcg tgagtgccgg ctattcacga ttgaatttcg catttaacgg tcggctagaa     16800
     atggttgcgc cgaggaaagg tttcccccgc aattttgcgt cgggcaagct gtggggtcca     16860
     tgatcaacta acaacagttc acagctttcc aagctgcttc atctccgtcc taaagccttc     16920
     gcctctctcc ggttctatct agctcgagct tctcttcttc tcagcttaac aaccacgcta     16980
     cttctttgtg cttcgactcg aaggtacgtg tatgcagcga gcgaccatgt tggcaaagca     17040
     cacattccgc cagatcgcct cgagcgctct tggtcgagcc ggtagaaatg gggtcgcaac     17100
     cgcaagatcc taccgggcag cttctcattc attctttcag gagcaacaaa gcgtgctgcc     17160
     gaacaatctg gatccgtcat cggacgagtt cctggccaac aaggcttata tggacggtct     17220
     ggtggaaact ctcgatgccg cacatgcaag gctagcgctt ggcggtagcg aaaaggcgag     17280
     ggcacgacac gtcgctcgcg gcaaaatgct tcctcgagaa cgtgttgctg ctcttctaga     17340
     tcacggatca ccctttgtcg agctttcgcg catggctgct tacgagatgt acggcgatga     17400
     cgagattcct ggcgcgggcg tgatctctgg aatcggacgt gtttcaggca ccgaatgcat     17460
     gatcgtcgcc aacgacccca ccgtcaaagg aggaagctac tatccaatct cggtcaagaa     17520
     acatcttcga gcacagacga ttgcgcgaga gaatcgactt ccatgcgtct acctcaacga     17580
     gagcggcggt gctgcgttgc cccaccaggc tgacgtgttt ccagacgaga accacttcgg     17640
     tcgcattttt tacaacatgg ctcagatgtc ggcgctgggc attccacaga tctcggtggt     17700
     gcacggcatc agtgtagccg gaggtgccta tgtaccagcg atggccgatg agaccatcat     17760
     tgtgcgcaac cagggcacca tcttcctcgc cggacctccg ctggtcaagg cagctttggg     17820
     agaggtcgtt gacgacgaga cgctcggagg aggcgaaatg cattgtagcg aatcaggtgt     17880
     cacggatcac ctcgctgtga atgatgccca tgccatcacg ctagctcgag aggccgtggc     17940
     ccacctgggt ctatgtggac gctcgaatga tgcacttggc gatgcctcgt ttgatcagcc     18000
     cttgtacaac gcttccgagc tgcacggcat cattcccgaa aatgcacgca agccgttcga     18060
     cattcgcgac atcatctcac gcttggtgga tggctcccgc ttccacgagt tcaagaagct     18120
     gtacggcaat accattgtaa ccggcttcgc caagatcgcg ggccaagacg tcggtatcat     18180
     tggcaacaac ggggtcttgt tcggagagtc ggccaaaaag gcgaccagct tcatccatct     18240
     gtgcaaccag cgacagacgc cgctcgtctt cctggtcaat gtgaccggct acatggtcgg     18300
     caccaaagcc gaacgttcag gtattgccaa ggacggtgcc aagatggtgc gagcggtagc     18360
     atgtgccaat gttcccaagt tcactgtgat cgtgggtggc agctttggcg caggtaacta     18420
     tggcatgtgt ggccgagcct acagtcctcg cttcctgtgg atgtggccga atgcacgtgt     18480
     gggtgtgatg ggcggagaac agctgagcca ggtgatgggt acggtgagta gcgataagtc     18540
     caagcaacag ggcctacgag acaggatcga gaagcagacg ctgcccgaat acgccagtgc     18600
     gcgtctttgg gatgacggca tcatccggcc tcaagacacc cgcagcgtct tggcgctggg     18660
     actcagtgtg gctaacacgg gcagatggag gagcgcgcag cgtggcgatg ccggtggctc     18720
     tcgacaccct gcatgggacg gcaataacta tggagatggc gtctaccggt aagtacaaca     18780
     ggtgcaactt gtttcctgcg acgccattca cccctacaaa gatgccttta actgaccgaa     18840
     tgtctgctgt tctcttctcc gtgactgcca tctgaacaga atgtgaacga agcccgtctg     18900
     cggtgccaac tcagcttgca acgcatttgc cgagcacaca aagttctttg acatgcctac     18960
     tgcggctgcg tcttgtccaa atttgggcgc aatcctctga gtaagcatca agcgtgaagg     19020
     tgcaatcgtg aatgcttgac ttggccatat ttctgtcgat gctattgtcc agaccatcat     19080
     gaacagtgtg cgcgtgtcac aacattgagg agcggtcaac gtagcgagag cggcaaccag     19140
     aacttgtgaa tttgcgaatc acgaatcacg aatcgtgagt acgcgatatt ctgacgtgtg     19200
     atcgtgtcta cgatgtcaca ttaacacaca gaattcacga ttcgtgattt aagaccgtgg     19260
     cccacagcgt cacccgtcac gcgcggctct tttacgcgtc gcgccagcaa aagcgacaga     19320
     tgaaagagca actcgtaact tgacgttgtt tcagaggcaa cgcgtggaat actctcgaga     19380
     tccctttgga ccctttgatt gtaacaacca caagtcctcc ttggcctgat cacctcttgc     19440
     ctactcccac agtgaatgct tcgagaggca ccgctctcat acctcgccaa gatgaacgag     19500
     ccgggtttgc tgaataccac tggccttctc gagctggaca gacccgccaa cggctccaac     19560
     ttatcccagg caaaggctga tgagctcttt gccagtccgg tcgatccctt tcgtgaacga     19620
     gatcttaacc ttttcagtcc ttcaggctct cagagcgaag cccagaaagc tctcaatgcg     19680
     tggtgctcgc acggatcgac taagctggac aatcagacag acacacggaa cctagaacga     19740
     ggcgaaagca tggacttcga cgccgaaatc gacctcgacc agctcctcga tcaggagatg     19800
     gcgctgaaac aagaaattca taaacacaca tcgcattctg ggactggctg cgcagaagga     19860
     tcacagatgg atgtcgacta tgacgagctg gaagccttcc tcctcgcgga agaggaacac     19920
     gcatcgtctc gaccgactgc acgtgatcaa gttcacggcc tacaacatcc cccctcgcca     19980
     cctcccgaca tcgtctcgtc tcgggcctct tcgcccatga ccgatcttct agaaagcaat     20040
     ggtctgttag gtggctcttc cttgccgccc ttacagcaga ctgtgactcc atccccaaag     20100
     tctacaggct tgacactcga gaccttccca acttcagccc agccgtcttc gagggccatc     20160
     gaggcactct cgtcgctgtc cacggaggac gaagagccat cgtctgtgct tgctgcgcgc     20220
     gatgtgcaag tgggaccgtc tcgacttggc gcccgcctcc aaccacaggg cattcccaag     20280
     tacattccgg ctggtttcat gaatgctgcc acgatggatg gtaccctggt ccgctttgag     20340
     cgacgcaaac gcatgaaagg ctggaagccg ccggctatca tgtccgatgt agacgcctcg     20400
     caacttctag atcgacccat tcaccagctg cttgatgctg tagaagcctt gaaggcgctc     20460
     gaagtggtcg aacgcgacga ggcgcatgca cagcaggcca gagaatcggc gaatcatacc     20520
     gcaatgcaca actcgaaggc tgccttgcaa atgtgggtgg ataagcatcg accagccaaa     20580
     ttcacagagc tcctcggaga tgaacgcgta catcgcgagg tgcttggttg gctcaaggaa     20640
     tgggacgagt gcgtgttcaa gcgaaagaat catcgcaagg agcgacatcg tcaatacatt     20700
     caatccaagt atggcttcag cgacaatggc ttcggtgaca agggcagcga gcattcttgg     20760
     aaggatccct acggccgacc aaaggagcgc atcatgatga tttcgggacc tcctggctta     20820
     ggaaagacga cgcttgccca cgtcatcggc gctcatgcag gctacaatgt ctacgagttg     20880
     aatgccagcg acgcacgctc ggcgggtgcg gtcgaggatg tgatcaaaat ggcactcgag     20940
     tcaggcagtc tcaaggatcc aagaccgacg ttggtggtga tcgacgaaat cgacggcgct     21000
     acaggaggtg gaggtggagc atcgggcgaa tcgcatggct tcatacgcgc attggtgcga     21060
     ttggtcgaaa tgggcaaggg agctggaccc aaggtggctg gcttgggtgc gcgtggcaag     21120
     aagcaacaac gcaagggctt taagccgctg ctgcggccca tcatttgcat ctgcaatgat     21180
     ctctacgctc cgtcgttgcg accgttgcga ccgatatcga agttgatccg gttccataaa     21240
     ccgccgacaa accttgtggt gaaacgcctg cgcgaagttt gcgaggcgga agcgctctct     21300
     gtggaagctc gtggactgtc tctacttgcc gagctgacca acggcgacat tcgctcttgc     21360
     ctgaacgcgt tggagtttgc aaagaccaaa aacattgctc tcacagaagc agcggtgaag     21420
     agcgcgtcgg ttggcatcaa ggataccgga ggtcacgttc acaaagcatg ggaggtgctt     21480
     ttccgccgcc agaatcgcaa gcaggccgca gcttcgagca tgaaacgagc caatgccaag     21540
     gcggcagatg cagatgcgtc gccttggaac tcgtcacgca aagcgtcggc gagtgagctg     21600
     actggtgacg gcaaagcacc aaaggatttc aacctgatcg atacgcctca ggagaacgtc     21660
     aaacgcatcg ttcacgaggt gacgagctgt aacgagtacg aaaagctcgc tcagggttgt     21720
     ttcgagcact accctacgct tcgggctgcc gatggcggtt ggaaacggta tcggcaggtg     21780
     cacgactggt tgcactttgg acaaagcatc acgtcgcgtg cctggtcgca gggcaacttt     21840
     gagcttctcg gcttcatgcc atggtcgttc gtctgctggc atctactgtt tgcacacgtc     21900
     ggaaacgcgc tgcccgagta tccaaaggcg gactatgaga accacctcaa gacgtctgcg     21960
     tttaacgaga tcgcatcgca gattgtcagc gtgcttcctg ccaacgtccg gtcgcagttc     22020
     aaccgacaat cggttgtcac cgagctgggg ccgtcgctga tgcgaatcct cacgccagat     22080
     ctacggccga tcaacaacca gctatcgcga accgaggaca agcaatcgtt tgcttcgctc     22140
     gtgtccatca tgacttggct caacgtccga tttgtccagg acaagatttc cgaagatgag     22200
     gcttcggtta cggggcagac ggcagggcag ttggtgtaca agctggatcc gccgctcgac     22260
     gtgtttacgc aattcgaggg caagcgttca aaagagattg ggccgtcgcg cttcgctgtg     22320
     cgtcagctgg tggcgaggga gatggagcgt caaatgctgc gtaggaatgc gggcgtcgaa     22380
     gcgcgcaatg acgatgctgg atcgacgtcc aagtcggcca cggcaatcta tcgatgcaag     22440
     ggtgacaagg tggatgctgc acgagacgca ctcgagacca agaaggaaaa gagcgccgtt     22500
     gatttttttg gtcgtccgat tgtgccaaag agcgcgtctc tgcgcgtagg catgtcaacg     22560
     gagcctatcg tccagtgcat gggcggtcag aagcgcaagg tgtcagacga tatttcttgt     22620
     ggcgcatctg agctgactcc gacaacgacg ctggcagcgg gcgacgtgaa tgccgcgaat     22680
     cacgacgcca cagcgccagc agccgtggat ttggtccgag atgacaagat caaggtgttc     22740
     taccgctatc acgagggctt ttccaacgca gtgcgaagac ccgtcaagat ctcgtcgctt     22800
     ctctgatgcc ttgctgtaag agtcccgagc tggttcggca atgcattttc agttgtacac     22860
     gatgggactt ggtctcagtt caactctcaa taccatgtgt gatcactcat gactgagaca     22920
     atcgtgaatc acgcttgcga gctgcgctgt ttatgagaac attcacgatg ggtgattgat     22980
     tctatctctg ttcggcatgc gagaacgaaa atgagaatgt tgcaaccaga aatgcaaatc     23040
     agatgtgtaa tgaatgcatc ggtgcaaccg atgacgccct attagtgttg tacgggatat     23100
     gaagagctac caggattatt tgtctttgtc acgaccaaaa gtgagtccgt agccaatgac     23160
     tcgatcgccg gattcaaggc aaggccaact gtggcccttt tgctgcttgg tgaggacgag     23220
     atcgaccttg aacttggtaa tgttgaacga cgagtcggca ggaacgatgg gagcaaaagg     23280
     cttgagtagt tttcggaagc gacgtggtcg agacgaagcg tttgttgggg gcatggagag     23340
     cgaaaagacg acggcatctt gtttgaactc gatcgagctg ttggcagcat ctaccgcctt     23400
     tgcatagaca gagagacgta tgtcgttggg agtttcgtaa tggtccatcc tgcaatcaac     23460
     cctctcttcg tcgtctgtag catcgagagc agcaggttta gctgcaccga cgaagagatg     23520
     gccgaatttc gaggtggtgc atggctggat ctgcaaaaag tcattgaagt cgagtactct     23580
     tcgtttgcaa cacgaccagc ctttggagcc ttcgtgaaag atgggtgagc ccttgtgatg     23640
     cttgcacgat tcgctggatc gatcacggac accaccatca tgcttgtacc cacagcctgc     23700
     gcgcttgcag acgactccag gcgaaagcgt ggcatctgca tctgcgggat cctgctcctc     23760
     gacagcttga tcttgggcgt gtggctggtt ggtgggcgag gatgtagatt gagcggcggt     23820
     tgcgttctgc gctgcaagca gagacatgcc ggaaagaggt tggagaatat cagctgtgtt     23880
     atccgccttt gcagacattt ctttggcgtt ggcacgcttg gactctgctt gaacatcggc     23940
     ggcagctggt agcgggtcgg cgtcgtcgac gacagctccg ttttttatgg tgggtaaagc     24000
     ttgcttttcg gtggaatggg cattcgtagt gctgcagccg gggatagcta ggaactgatc     24060
     aaactccatg acgggtttgt tggtgtcctt gcagcaggac catgatttca gcccttcatg     24120
     gaagacaggt gctccaggat ggtagctgca ggatgctgca gctgacgagg tggttgctgg     24180
     gtcgaattca atcccgcaac cgcggcgtgt gcaaaggacc atgacgcgat agggagaagg     24240
     acaacaaacg gacgagattg gaaagctcca aacagcaggg aagcaagtga tacgcagaga     24300
     agccgatggg aatgatgtcg gacgagttgt tgctggcttt ggaatgtgca acggaggtcg     24360
     ggcatttctt gctcgctaaa gccgcgttcg gctgctcggc attctagatg gattcgaaaa     24420
     tggtggaagc ctctcgattc ctgtgatcgc cgatgcgaag caaagaagcg ccaatcgaga     24480
     tctgatcgcg tgagttcaag aagccacaac ccaaagttaa aataaataat catatacgtt     24540
     aagttaacta tactgtaatt tacgagtagg ttaggcgcca gtgtggctcg agctgaagcg     24600
     ggcgagcgtc cgtggcgtgc gtgcgtcgga gttggagtcg gagtcggaga ttaccatgag     24660
     aatctcgatg gcgagcgatg gtcggttttc gaaaagaaga gatggaatct gcaaggcagg     24720
     gattggcgac ttggttgtgt tgaccaagat aggagccagg atggcaagaa gggttgctaa     24780
     gacaggctcc cgaggatcca agctaggatc aagcatggag agcatgtctc ggttgggata     24840
     ggtgcaaccc actcgctgac attctgtgat tcgcacaagc ttaccccggt gccgctgctc     24900
     gagtgcagat agtagagcat gaacggggag atgtactcaa gacagcagcg ctgttcagtg     24960
     cggtatgcac aacctgtctt tagcctgcaa acgagccgtg agtcaaggcc aagtgacacg     25020
     ttgaccttgg caattcgaga atcgtgaatg gcgtggaagc ggtgcgagaa aaggggtcgg     25080
     tgtggcgcgc ggacagaagg tggcttgcgt tgttgaacag gataactttg tcgacacaat     25140
     cgtgaatcac gaattgcact ttgaggagct gctgaaaaca cggcacatat tttcgataaa     25200
     gtgatagagg aagcatgatg acatttgtga ttctggctgg caccacacag agctttgact     25260
     cttggctttt ggctgtgatt ggccgagagc tgctgctgcg tgttttgaga aattgcattc     25320
     tatcaaggtc tttcgatggc gagtgacgtc gagaactgaa aggtatcgtt gacgaaccgc     25380
     cgtctgtaaa gatgactttg ggtcgaaaag ggagcagcat acgacgagat gtgtggacca     25440
     agtctgcaag gcaaagttgt agtgcagcgc gtggcgtgca cggtgggagc aggacgggtt     25500
     gtaatcacaa gtcacgaggt cgcaactcgt gattacaact cgcgcgcctt cgtgcttgtg     25560
     atgagggcgc gatcaaatca tgaatcgaga atattgtgga tcaatcacga atgttattca     25620
     gaaaatccta acgaatttcc agctttattt tgatatgtga ttcgtggttg cggttctgag     25680
     tggcgtgtgt ggatgcatct gccgagacca acacctgcaa agatctgcgg tcgcgtgtgc     25740
     ggcgcgcgtc ccagcacttg aaccgcagac tgtcagattc aggagcctaa gctgctgctg     25800
     atagctagtg caagatcctg tgaaatgaaa ttcacgattg gtgtagaggg tacgttagcg     25860
     tcgatggcgg gctttctcaa tcgacagcct tggtcgtggc ttgtacataa aaccgaccca     25920
     ttggagagga gtggggctgt tctcactttg tcacactgca cgttttgaca gagacgagag     25980
     acagttgtga ggtacggact gagcgctcga gcgttgttgg tcttagggcc gccctgttgg     26040
     tctgctctgc gattcgtggc tgtgagtgtg attgtggctc tcgtgtctgt gcccctgaaa     26100
     cgctttccaa ttccctttca cgcagctcgc attgggcttg cagaaccgat tcacgcttgg     26160
     atctgttctt gttgtattcg tgattcacga tgaaattata ataagttaat ggtgcttatt     26220
     cggtgtggct gttgtttttc ttgtttctgc ttgaacgtga tgattcgtga ctcacgagag     26280
     tcacgagttg caagacgacc gaccacgcgc caccagaagt cacagtcgtg agtgtgcgtt     26340
     ttctctttat tataatatta tttaagcaca gcgttgtcct cctaacttac tgtattgtta     26400
     atgatatttt ctttttcttt ctcgctgaat gtgaatcgca atcacgaatg ccgcttggtg     26460
     tttgcacgtt gggattcacg attctgttca ccaaagtcaa acacgaaaag gtaacaagta     26520
     actcgtcact ttatcacaga acgagtcacg agtgatacga aacgatgcgg tgtgatcctt     26580
     gttcttcctc ggcattttcg cttttcagac cctgaacgtc ccgcttgacg cttgcatggc     26640
     caaagccgtg agtgtgagtg tgtgcaccca cgcgcaccac caaacctgaa tcgtgaatca     26700
     cgaatgtgaa tcaatcgtga atcggtccat tcgtgatttg cgttctgagc cagcttggtt     26760
     tggcccgtcc ttctgcactt gtctcaatcc gcgttggtcc cctcgtcatc gtcctagctt     26820
     gaccttctac tgtcctctcc aacgaaacaa accgccacaa tcctgccaac gtcaacgtcg     26880
     gagcagcttc agttttctct tttacccgtc catacacgct tgtttgggct cgtcattgtg     26940
     cctcacctca ccatacacca ccacatatgc tatccgcttc cgctccttga tacaaccatc     27000
     tgtcttcacc tccgatgcta accagctcaa tcccctcccc ctccaattct cgttgatagc     27060
     tggcggcgct ccatagcgtc tctttcgacg tcatgatctc agcaactggc cgtcctggct     27120
     tccgaccgcg tcctccctgt cagtctcgat cttctcaccc ctcgccaaac accaccacta     27180
     acgtcagtac caagcatgac accgtcccgc catctccgcg ctcacctctc tccgatctca     27240
     gcaaccattc ttgtaccaac gccactcacg cgaccacctc tcgcgatatg cacgaatcag     27300
     cctccgactt tgcccatgct accaccacct cccaacgcga acccaacctc ttgtatgatg     27360
     cgcaaacgct tacgccatcc tcgagcgtcg aagacctcga tcatgcgcgc ctaggacgcc     27420
     tcgagcgaca cgagctcgag cagctcttga tcgaagccag tcgcaagatg cgagaaaggg     27480
     aggccaagct cgtcgtcgcc gccaacatcg gcaaagctct actcgagaag aacctttccc     27540
     tgcgaagtgg catcgagacc agcatcgcct ccagctctag cctcttcggc ctctcggata     27600
     tcgaggccat gatctccgac ttggcagatc ctacgcttcc ggatcccatg ctcgctttcc     27660
     atggccccac caatgacact ccatcccctc cgctgagacc catctactct cctcccacca     27720
     ccgatgtcga tgtccactcc caagctcacc gctctccatc cagagccgcg tcagacacca     27780
     ctccaacagc tcatcccgta tctctccctg acttccaacc cgactacttc agcagacccg     27840
     ccaacgatac aacctccccg cccgctgcgt ctacattttc catccaatct tccatcgttt     27900
     ttggcgacag agccatgtgg gtccccagtg acgctggcct catcgcctca cagccttgct     27960
     cccccagcgc atccatctcg agctttgcct ctcatgccct cctctcatct caggcatctg     28020
     catcacgcaa cacctccaac agaggttcgg caacaagtcg tcacagatca cgcccttcgc     28080
     ttttgcagct gcaggctctc gaagcacaga agcagcttgc ctccctcggc gaacagaacg     28140
     atgtgctcca tcagcagatc tccgaccttc aacgcgaagc cgagtgtgcg cgcttcgaag     28200
     gaagcaagaa gctcagccga ctcaacaagg agcttcgcgg cctcaaggct gaactagagg     28260
     ccgctaccca gcgcaacctc gaattagaaa ccaatcattc tgcctcgcga tcatctcccg     28320
     gagccaggtc agccatgcga agactcgtgc ttcacgatcg tcaagttgca ccgccgccac     28380
     agacctttcc aacgcccgct caccaccaat cctccttgct accccttgcg cctccttcaa     28440
     cttctacttc aacctcacca gagcaacccg atcccaaacc ggaccgctcc ggtctcatac     28500
     cttccacatc caacctcgag gacatggtgc gctgcgcaaa caccacagcc ggtgaaagtg     28560
     cccttctggc tcaactcctt gccaaggtca aggaactcga agagactaac accgccatgg     28620
     ccagagccga ggaagaattt ggcagtagga tgggccgcgc aatgcaggaa gacgagcggc     28680
     tccgcgacgc attcaataca gtcggtcaag atctcgccgt cgaatccgct gccctcgaat     28740
     cctggtcaag tcccgacaag gtgcaaaagg attccaacgt ttccctgctc acaccagccc     28800
     attcggtacg cagtctgacc tcacttgcct ccgcacatac ctccagcccc ttgtcttcct     28860
     tgtcacccag ccaaaagcgc agagctccgg gtaatcgcca tgtcatcgaa catcgcaaga     28920
     ccgtccgcat ggccttgcgt cgagcaaaga aggagctcgc tgccaatatt tggggcctcg     28980
     acactgatcc agcccctgtc tcttcagaca tgtcgcgttc ttccaccgag aaatcccttg     29040
     gcacctactc catcgatctc agcgcaaata gcagcgtctc ttcatcgcca cgaaccaggg     29100
     gcctcaacag aaagttttcg tccacttcca tggcacttgg cctttcagct aggcctcgga     29160
     tccgcatcac cccttccatt gaagatcttg gtcaacgaag gaaaatgcac caagaggtca     29220
     tcgctgggcc agaggaagca tccacatctc aacccggaga ttggcaggac ctaaccactc     29280
     cgacgctggc caatttccct caattcgcct cattgagccc tacagatgcc atgaaagcct     29340
     cccctgctca cttgcaggtc gggatccgac ccggccgaac aagtcagaac agccctcgcc     29400
     gagagtttga cagaagcgcc gaagagcccc tttccgaggc tgagccaagg tcgtcgctat     29460
     cgccttcctc gcaaacatcc ttcaatccca cagcacgtgt tcgcagatcc cgaaccaggt     29520
     cctcttcatt cagctcaaac ttttatttcc cgcgcgcgtc cagctccgtt gagcagagtc     29580
     ccgacccatt catgagccct gctgcggctc tgaatcgacc aggcttgcat cgcaatccct     29640
     cctccggctc gtctcatcgt ggcagaacct tggggagcga gcttggcagc atctttggtg     29700
     gcgacgaccg caagcacgat tttgacgacg atcttccgca acgccgtcga cttgccacta     29760
     cgatgcttgc agatgcagcc aactcttcca aggtacagtc cctcgtgctg caccgcactg     29820
     aaagcaccac agcattagag ctgcgctcaa aacttggcga cgttgtcgaa tctgatcgtc     29880
     ccacggccaa cgttggtcgg ctagtcccgc agagtgatga cgagcaacaa gacgatctag     29940
     aatacgtctt gactcagtcg gtctgcgatc aagtcgaaga tgtctttctc gaggattctc     30000
     cgctccgccc gcgtgacgct gcgctgctcg ctcgcgtcga ggctgaggaa agcggaatgt     30060
     ggctggccga tcagcccatc atcgaaactg gtggtttgca agaccaagac gagcctcgaa     30120
     gcgcccagtt tgacctcatc aatgctgtca tccgacatca agcagtcgcc tgggcagatg     30180
     atgatgatta tggtcgcact atcagccagc gcgaggctgt caagctcggt ctgttggcac     30240
     caaacccatc gtcccgagaa aaccgcaaca ttcgactcct caagggcaag tccaagcacg     30300
     ctgcctccga ccctggcatt atgcaagctc aacaggcgac tggcgccagg aaggcgtcat     30360
     ttcgactcga aattgaatct tgcgagcaac tcgagcgccg tcttcgcatc gagtcgctgc     30420
     tccgccgacg aaggcaagag ctgctgcggg agcgcgggtt tctcaatgaa tgggagactg     30480
     aagccgacgt acacaagcaa gaagcggagt ttgttgccac atatgcgccg agtcctcagc     30540
     ggctgcaaga gaggaggctc aaagcgttgt ccccaggaaa gtcggatatg tggtctacct     30600
     caccacaaag ggcttctctc tcaaatcgtg attcacgtct atccacacag gagtgggtgc     30660
     gagatctagc atccgtctca ccgtcaaggc aaaccgccga cggcgaccga gacgaccatc     30720
     atgacgatga agagaactcg atgagcctgg actgtgtacg tcctgaagac accgagttcg     30780
     aaatgctcga ctgtccatct tggaagaagc aaggcggacg cggcaccgac tactttccca     30840
     cctcatttcg cgcgcgctac cgtcccgcca tggtcaagca gagagttgcc cacgtgtcgc     30900
     aggtgaccta tggatgggtc gaggagtggg tgcagttcgc ttttgtcgtc ttcctcgcct     30960
     ttatggtcat ggtcgagcaa ggtccgaatc gcaacaaccg acgtgagatg caagcgtcaa     31020
     aggcacaaca atacctgctg aaaaaagcag agtgagcgat ccactcatgt atccgattaa     31080
     tgaaccgcac agagatatct tcaggcaatc accgatgttc ccatatgctc tcgcatctcg     31140
     aatgcattat gatgcataca tccagataac accacctatg aaggtcacta tattcagcag     31200
     cgtcgttgct tacgcatcag gtgtcttctc aatgtactgt tcgcttctga gcctagtcct     31260
     ggcgtcagtc gtgctgcatg gtcctttgct tcaatcacga atactagctg tttgagaaat     31320
     cctagtgaag cggcttctga ctgatttcgc gcctttagat ggcagtgagc aaaccacatg     31380
     cttctggcac tgtcgacggc tcacgatttg tcacaatatg cgataccagc ccaccagccg     31440
     tatccgagaa aaacgacgat gaagtttaat ggggcctttg ccgttcattt ctgaccatgt     31500
     agtccaactg cgatnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     31560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnacaagt     31620
     gatagcaaga aagagcttag acctcccact tcgagtcacg agtgggtggg actcaacgct     31680
     ttcccgtcaa tcacattcgc ctgtcgatgc ttaggcagtc aatcctacat aagaaccgaa     31740
     cccatcacat actcatgtgg gtagtatgag catgtagttc aacttgtgcc gggtaccact     31800
     gccctgttag gcaagctttt ttcctcagaa gctgcctatc tgcctttgcg tagagagtag     31860
     ggaagaaagt ataaaagttg acaagttggg gctttacgac ctcgtccagg aagtgcatat     31920
     cttgcatcga ctcttccaag ccaagcgagg agtcggcctt cattctaaca ccagcatcga     31980
     ggcaaaatca agcacaatgt ggctccgacc tatctcgacc attctgatcg gattcgctat     32040
     cctcgtcacc ctggtcagcg ctgatccgcc caaagccgcg gtagcatttg ttgatgtcaa     32100
     gttcgacgac aaggcggctg tttggtcgct tctgctggat cacaggtaca gcaaggtcat     32160
     tgcagtcact accggagtaa acgatcatgg tcgcgcagcc ttcgagctgg acgggtacct     32220
     aaatcgacaa aatgccatgg ccaacatcca atttgacaag aacaagctgc agattctcca     32280
     aggctccaac cccctgggca aagcggcccc tcatgaagca tggtgggatg gtcttgcgag     32340
     actccgcatt gcggcggctg acagatcctc tttaagacga tctctacatg gatatcacgt     32400
     gagcgtgttc cagatcgcac ccaccgctcc cgaacaagtt gaagcggtgc tccgtgcagc     32460
     tgacccaggc tcgatcgact cgtacatgct cttgcacgga tataacagtc gacaagcatc     32520
     gatggaggcg cagactagct ttctgcgccg cttgcgaacg tgggttcagg ccaacaatcc     32580
     cgaagccgaa gtgttcttca cctcgtccat ggacacttat gccgagaaaa atggaggcaa     32640
     gcagccatac agtgcgatcc agcacatgtt cccgcgacat gatcttgatc aagcgatgca     32700
     agacccgttc tggtcgtcgc agctgctccg ggcgcataag cagagagatc tgaacatcgc     32760
     acctttcccg gttcaggaca aggagcagct cgactcgatc atctattatg ccagaaccaa     32820
     tccggaacac cccaacagtc agctctggcg cgctgcgatc cgggattaca tctggacggc     32880
     tctcgcgaac aatcccggca aggaaaagga caatttggtg ttgaccaggc tgctccatac     32940
     gcatcttcct gaatttacag gcgatgcgac gctcgagcta gcggatgcgg cccatattgc     33000
     cgctttccat cgataccaag ctggtggtag tggtatgcaa gctgagccca ttgagttctc     33060
     tgcacatgct cctgctgagg gtgaaaaggt gaggttcttt ccagccacgt cggagctaca     33120
     cggctacctt ctccgaggag cgaatcgaga ccaggatttg gcgtacatca agtatttggc     33180
     aggagttcat ttctagtctt tcaactcgtt cttgactgat agcatacagt gtatttacaa     33240
     tcgtgaatct tagacggtgt tatacatgcg ctattcgcag tttgacgctc gagaaagcac     33300
     cgccgaatgg taggccacct ggatgacact tcaggcgcga aagaagaaag gtccgcgtga     33360
     ctcacagatt ggcacatccc aaacaacggc tccagtgagt tgaatcaacg gtcgtgggca     33420
     actatctcct cgatcagcca ggtcgtatgc caaggattcg ccgggattgc aaccaaggtt     33480
     gcagcgcttg atcacagact gctggccgtc aagcgcgcgg ggttaggagg cgccatcgta     33540
     atgccacgcg atagttcctt caacagtttc tcaggtttgc tggcgctgtc ccggctacgg     33600
     gagccgttcg tatcagcagc gaggtcagca cgacatccgt ttcacggcca gcttctacgc     33660
     atgcaccatc aatgacacca cccactgccg gaccaaagct ttcgccgaat tacatgtaca     33720
     tggtgagcac gcttgtcgat ctttgcgagg agtgtggcaa gagcatcgcc aaacaacgat     33780
     cgaatcgtga atcaaatcaa gctcacagct gaacccgatc attcacgatt cacgattcac     33840
     gatattctga ttttacccat gtgacctgcc gcataacacg gaatgggctt gaaaatttat     33900
     ccagattcga agagactgaa ctacaactgt gtcgagagca ttcgtgattg actctaaggg     33960
     aagaaggtag aagaggatga cgattggaaa tcgaagcgtg aagctcttcc gctcagggtg     34020
     aaatctgaga aaatcggggg aattaagccg ccatttttct gggctgactg agcgagtaaa     34080
     aaagcttcct ctgcctcgtg cctgttggcc gatgcaacag tcacaaagag agagagctac     34140
     gagccccgaa gcacgaagca cgaagcacga aagcaagacc cttcttgagt ttctttccca     34200
     gtcatcccag tcatacccaa caaccctgcc gagattggtt tgcgtctgtc taccaccatc     34260
     tcacaaatga tctgtcgcaa ccttgttcca cgcttcagcc tcttcttctc tcggcctatt     34320
     ctgtaacctt gccctttcgt cttccaccgt gacccacccg tcaacacttc catgtccgag     34380
     ccccatcata ctcgggcaca ttgacacctc gaccaagctt ccggaagttc ggcctgctac     34440
     atacatcgtc acttcgccgg ctacgttgtc tatcttgccc tcttctgtga agggcaggct     34500
     gtctccatct gtacgccgac acagacatgc agccaaaacc tagcgcaccc cagccgggcc     34560
     catctaccca gtatggaccc tccgaaactg caagtacgac cagctcagtc tcgcctcgcg     34620
     cacgctcacc ttttcgcacc gatactcccg atcgagggtt tggcaatgac aacggctctg     34680
     ttcccctgtc cgtctcgaaa gctgctgctg ctggtgccaa ttcaggtcct agtcgccctg     34740
     ccaccgcagc actcgccgca aaaatcgctg cctcacgccc gcatggcacc gttgcagatg     34800
     ccgttgcagc ttcgttgggt agcaagcgag aacgtagaag aaaacgcatc cattacagct     34860
     gcgcagaatg tcatcgtcgc aagcacaagt gtgatcgtca gactccctgt cagccttgca     34920
     tagaccgtgg tctaggcgac agctgccgac ctttcgaaga tggtgaccag tttggcgaca     34980
     tgcgtgatcg agtgcaacga ctcgaagaca ttgtcgaggg tcttgccatc gcccatgccg     35040
     agcttgccaa ggaactcaag gactctcgcg gtcagatggc tgcctttgtc gaaatggtct     35100
     cgagcgacga ggagcaagac gccgatacca acgaccccgc cgccacctca cgcccgaaac     35160
     ccaaaaaacg cagaaggatc attcgtccca gcaccgcccg tggtatcgaa cgagaggaac     35220
     tcttcaactc ggaggcgcag gccatcgctg cctccaaagg cgaagtcgtg gactcgacca     35280
     tctccaaggc aaacgtgcca cgctacgatc tcggtggcaa cccgctcgaa ggcggccttg     35340
     ctcgtgatgg cgacagctgg tttggcgcgc tggcactacc ctcggtcagc cgtggtgtca     35400
     tcgagaccga gattaatggc gaacgtctcg agcttggtgc caacttccct cgttttccgg     35460
     cttcggtcaa actacatcgt ctcatccacg agggtggtgc tcccgaaaac atcctcagcg     35520
     atcttatgaa ctctcttcct tccagagccg ataccgaccg tcttctcgac atctacttcc     35580
     gcgacatcaa tcacactcga ctgcccatcc acgaaggtac tttccgccag tcctacgacg     35640
     agctgatgga gttcagatgg ggcaatgcaa aggaggagcg aggcgatgac ggcgcaaggc     35700
     atgttccctt cttggcattc ctctttgcca tcctggccac cgccatgcgc tcgcttccag     35760
     aagcgtttgg aagtgattcc gaggccaaaa agggagcagt tcgtctgtac catgcttgcc     35820
     gacgcaccat caacattgcc tcaaccatcc gtgtcgacca cattgacctc gtactcgccc     35880
     atctctttgc ggctcgcttc ttgatatgcc agcgccagag cgctgagagt tggtcgttgc     35940
     tcggcaacgc cattcgcgcc gcacaggcca tcggtcttca cagagatggc agcaagcttg     36000
     gcctcgacgc catcaccacc gaacgcaggc gtcgactttg ggctatcatt ttctacatgg     36060
     acaagacgac cagcattctc ctcggtcgtc cccaagccat ccaggatatc cactgtgata     36120
     cgcttccgcc ttccgacatt gacatcgaca ccatgccaag gtcggctcgg ccctacgtgc     36180
     cacgtaccag gccgcgtccg aataccccgc ctggtgtttt cctctttgtc gccattcgtc     36240
     atgagcttac acgcctcaca ggcaaaattg tcgagcattt ccaaaacctt gccagtccgc     36300
     gtcggtatgc ggatgtcgtt gcgctcgatg aggagctcga aaagtttcga aaggacattc     36360
     cagacatcta ccgcgtcgac aaggcaacca acggtactgg tcccgatacc aacaaggaat     36420
     tcgacaccgt ctgcccctgg ttgccgctcc atcgatacct tctcaacatt gagtatcact     36480
     acgttcgcat cgccctacac aggccgtacg tgctgcgcaa ttcggaaaag tattcacatt     36540
     cgcgcacagc agcgttcgaa agtgccaaag cggatcgtag ggtgcgtcag gaatatcgaa     36600
     aggacgtcaa gtgggagccc gagcgtgcac gcaaggttca catgggcggt ctctatcgcc     36660
     tcttcaatgc caccatgatg atcggtattg ctcttcttct cgaccccaat ggacctgagg     36720
     cgcccgactt tttgtcgtat ctcgacgagt tcatcgagct gcacaagcat cgcgaaggcg     36780
     atgcggacca gtgcagcaag cgtgaagtca agatcatcga gctcttcagg gccaaagcgc     36840
     gcgatccgac gtggtgcgct acgtctgcaa ccggcgccag caagaaagtg cctggtgtcg     36900
     aagcatcctc caagggcaaa ggtggaaagc caaatggtgg cgcctcgaaa cgcagcaagg     36960
     atgcggctgg aaagcgcgag agcagcaatg agggcacagc tggtgtcggt accgccgcct     37020
     tcagctcagc catgctgctt ggtggctcca agcccagcgg ctcacagctg gcacgtgcta     37080
     attcggtcaa cacgaccgag agcatcacgc ctccgccatt tgctggactc tttggcgcca     37140
     atccaggcgc tcctactcct ggtctcgcac tcggtgcggt ttcaacaggc acaacaagcg     37200
     acgcaaccac cgatcttgcc cagagcatct ttgatcagct cggaggatac gagcccagct     37260
     ttggcatgct caatccgact cccaatgacg cacttaactt taattctggc tcgggtctag     37320
     gctttggtcc gagccataca tccaacagca tgggtttcga ctcggcggcc gggttcgata     37380
     tcacgagcta cttcaacacg cctcctgctg gctcgtcgga tccctcgccg aacgtgacca     37440
     ccaatgcagc cacgtcctct gccccggcga gctcgggtct ggcgcgcagt accaccaact     37500
     ctgttcacac ggccggcaca agttcgtccg agcctagcgg gttggcaagc taccagccga     37560
     gcgcacaccc tcatctacgc gcgctcaata ctccaggcgg tttcaacagc ttcgctggag     37620
     cctcggatgg tagcgttcgc aggacagccg atgcattggg tatcaacggc atcgcaccta     37680
     tgggtggtgg tactgcttcg ggcgattggg gcctgctacc atggggaggg ctcatcgaag     37740
     ccattgcgca gagttcgcat ggcatcgacc atcagcagca gcagcagcag cagaacggga     37800
     gcaatggcac gccgggatca catgcagaga tgaagacaga gacgcccgaa gaaccggaga     37860
     agatttgatc aaggtatacg tcttgtcaga tagcacagtt gcgaaccaaa agcgacggcg     37920
     gcagcagcgt tgattgtgat gcattggcag cgcgtgtgag gatgtgttga ctggggtgcg     37980
     gacaggaggg cgacggaagc atctagagcg agatgctagc accgtggttg agagcgacga     38040
     acgacttgga cggctggttg agtgagtggg gtgtgcgggg gatcgtgtgc tgggatctgg     38100
     caaagtgaat tgcgtgctga tggcaggccc acttgagctg gccgagcgtc ttgagcactt     38160
     cgtccggacc gcagatgaat gtgccccagt gaatcgccag cgccacgggg ttttgcgaag     38220
     cgtctgacat tttatcgaat acactgacgg cgtcccaggg aggcatgtga ttggctgcag     38280
     tcaagccgca cgagatgcgc gggatcggcg agatcgagtc tggaagccgc atgtacgagc     38340
     gcacgaacga gatggtcgcg cctaccgaga tcgggagcat cacaaagtcc ggtctgccga     38400
     gccgtgcgac gatttcttcg aacgccggac agccggggta agcatttggt tcatttcgtt     38460
     cgtcgttgac ttgcagacgc ataccgccct ggtacgtccg agtgcgtgtt ggcctgcatg     38520
     ccgagcctgg cagcgtggca tcgtcgctga tcgagctaac ctcgcctgtg tgcgtggtgt     38580
     cggtcgccac atctggctcg caagactgtg gcggcgcagg tgggaacgac ggtccgtgaa     38640
     actgacaccc cgtatcacca ccgaagtaga tctttgtcgg tgctccagcg tccgacctcc     38700
     ccggatgctc caggaaccac gacgaccaca acgcgcagtt ggtatccaca ccatatcgac     38760
     ccgaaccgtg ctgcgctggc gtgcaaacca ctcgcagcac cctatcctcg tcaccgcgct     38820
     gtctcaacag cacctcgtcc caccaatcca gctcggtcac cctctctggc gggatggcta     38880
     gattcgaagt ggtcgtggcg ttcatcacgc ccgaacccgc cgatgtccaa gaccaagaag     38940
     tcgaagatgt agctgtgcgc tccaagtctg cctcgctgct gctggcattg gcaccgatga     39000
     accactcttt gtttcccaga ggtacgacga accgaatccg atcttggttg gcagcccata     39060
     gctgacggat cgtttcgtaa tcgaggtggt cataatgatt gtgtgagatg acaacaagat     39120
     cgacaggtgg caggctcgaa atagcgcatg gagcagcata cgatctgatc gggccagcca     39180
     cctgggtagg agagcagcgc tgcgagaaga tcggatcgaa gagtacgcgg acaggctggc     39240
     cttgcgaact aagaggcggc agctgaacga gcacaccggc gtgaccgagc caggtcgcct     39300
     tgagttttgc atccgagtca aagtcgaacg atggagattc aacggtcagc agctgcttgg     39360
     atgccatctt gatcttctgc tgccttgtgt acggtgcggc cgatgatatg ctttggggag     39420
     tggtgcctcg gtctgcatgc gcaccttctc gactcagcga ggcatcttcc aggtctggcg     39480
     ttcctggccg actgtccgtg tacggatctg acaagacgct ggcatcaccg tttgttccag     39540
     cgttggcgct cgtgccaagg tctgcgtctt gcattgcata ttctatggct ggatcacgat     39600
     cctcgcccca ttccagccct tgccacactt cggtcacgct gggtttgtgc cagctcggcc     39660
     acggattgcg gaagccagtg cgtacaacct tgctagaatc taccagggct atcgagttgg     39720
     gcaagcaggc agcgttggaa gaatagtcat cgtcgagagc ttgcgtgctc tgggtggagt     39780
     ccggtctctg ctcctcacgc caggtggctg gttgaggatt ccagtgtggg atgtaggacg     39840
     agagggtggt gcccggtgta ggcgcgagca catggtggct aggcggaaga ccatctgagg     39900
     tgacgttgag cttgacttgt gccgtcagtg gctgactaga tttcggcgcg tccatctatg     39960
     cgttctctag cgagtgtggt ggtgtggtgg tgggaaggtg agccatgcgc cggttcggag     40020
     tgagccttgg ttgacggatc aagtggaggt cgaaccggct ttcacagtcc acaatccaca     40080
     atccacaatt cacgattcac aattcacgat tcacgattca cgattcacga tttcacgcac     40140
     ctggcacgct cctgacggat tcatgattcc tcagccgtgc ctcgtgcctg cggctgtatg     40200
     ttttagggtg tgcaatgtga gagttgcaaa gcgcactgac cctcgtgcct tgcatttacg     40260
     atttatttct ggcgtctttt ttgcgacgca gttttcgtga atttccgagc tgtcaaaaaa     40320
     gtgcagcagc agtcagcttc attcatgtga ttcctcatac tctccttcgt ccgtatcctc     40380
     cttgttcgtt catgctcacg acaccagtac agatggacga ggcacagttc gactcaatac     40440
     atggaggcat tactgccaat tcgaatgaac aatcagcgga tcatcatgta cccttggatc     40500
     acctccgttc gctctactat cggccggcgc taggatccgg catgctcgta ccttcgtctg     40560
     acgtgccact ggcttgttct tcgagacctg cgaccgggca agcaagcaac acgccgagtt     40620
     tagccatctc agcgaactgg aagcaacata ctcgggccga cagcgaccca acacgagttg     40680
     caagatcggc ggcatctacg ttctggtcgc acaatgtacc ccatgcacac cccgagtcgc     40740
     atgtcagcat tctctctcag gcacaagatg agggtgcctc agcatctcga gcatccacac     40800
     cgcagttaca gcaacggcag cggcagctga gctatatcca tgccgctccg ggatcaagca     40860
     tgtcgacatt tcaacccggc atgcgtcgca tagaagcttc cggcgtgctg cactccccga     40920
     acccgctagc atcgttatca tcgcacggct acctgccaac acgcgtcctg ccagtggaag     40980
     agaagaagag gattctgatc actggaggag caggctttgt cggctcgcat ctggttgatc     41040
     gtctgatgct gcagggtcac gaagtgcttg tctgtgacaa cttctatacg ggccagaaga     41100
     gcaacgtctc acactgggtg gggcacccca acttcgagct gattcgtcac gacgtggtcg     41160
     agccgctcgt gatcgaggtg gaccagatct accatctcgc ctgccccgct agtccgatct     41220
     cgtaccaagc caaccaaatc aagacgatca aaaccaactt tttggggacg ctcaactcgc     41280
     ttggtctggc caaacgcacc aaggcgcgct tcctgcttgc cagtacctcg gaagtgtacg     41340
     gggatccgga cgttcatcct cagcccgaga cgtacaacgg caatgtcaac ccggtgggtc     41400
     cgagggcgtg ctacgacgag ggtaagcgcg tagctgagac gctcacgtac ggatactact     41460
     atcaagacgg agtggacgta cgtgttgcac gcatcttcaa cacgtatgga cctcgaatgc     41520
     atccacacga cggcagagtg gtgagcaatt tgatccagca agcgttgcgc ggggagccgc     41580
     tgaccgtgtt tggagatggt tcgcagacgc gcagcttcat gttcattcac gatctcattg     41640
     atggtctgat ttcgttgatg aacgtcgagc ggttggcgcc tccaccgcac cagccgcacc     41700
     agcaactaag acacgcaccc ttttcagctg cgctgaaaca agccgatatt atgaccgaag     41760
     cgaacgacac cataatccca tccacctcgg ctgtctctat ccctgctgct acaagtgccg     41820
     ctgctgctgc agtaggccct tcaaccacca cgaacaacgc aaacgaagca tacttggatc     41880
     gcgaggcgca tcgtctggac gtacactcgc cggtcaacct cggcaatcct gctgaattta     41940
     ccataatgca acttgtgcgg ctggtgcaaa agagtgttgc caaagtcaag gcgcaagacg     42000
     tcgaggcttg tgcgtcggcg gatggcggta cgctgctata ccagccgcca tccgagatac     42060
     gtttttttgc catgccaaag gacgatccga agcaacgaag acccgacatc acgcgtgcca     42120
     cgagcctgct cgattggact ccgcgctgga agttgcacga cggactcgac gagatgactc     42180
     gatggtattg ggagcgcatc aaggaaggct cgctatgaat ttcagacact cccgtacaca     42240
     gacaatagac acacgcaaca gaggcaatca cgaatgcatg catctcgatt aggtacgacc     42300
     acagacacaa aagcgtgttg tttgattagt aacctgttgg gccttggata tcgtacctct     42360
     tgcctcggac agcccagaga ccccaattag ccttgacagc gactctggga tcgaaatcag     42420
     ccacagccca ctgttgagaa gcaaacacat tttcaccggg ggtgatgagc cagtcgaatt     42480
     cgccacgaac cccgtcgaca ctctcaaagg cgagcacgtc gcgctcgacg tcggcgggtg     42540
     agaagccggt agcgatcaga gcacagcgtg tcgagaggat ctgtccgatg gcacgtgccc     42600
     attcgcgctg tgcctgcact acgggtgctg tggtaagcgc ggtgaacgtg tggccgtcgg     42660
     gtgaagtaag cacgggagcg ggctcttcgg atggaatgtc accgccttga ggtgacgagg     42720
     tggcatcgat cgtgtaagca gcagctgcaa cgggtttgac tgatgcggca ctggaagccg     42780
     tcgagtcacc atcgaggcgt atctgctgct cggcgatttg cgcctttgcg agctcgacgg     42840
     cgtcgtcagc agccttttgc gccgatgcct cggtcgattc ggcagcttca gctccaacag     42900
     catggtaggt gctcttggcg cgtgcaaagt gcgcctcgtg atcgcgatct tcttgtcggg     42960
     ctttgtcggc ctcgtcgaca gcaagctgcg aagggaaacc gaaaccagga ctgaaagcga     43020
     aaaacacatc ggtgtaggcg tcgaatggct cgagctgagt gtgaacgtct tggtaattgg     43080
     actggatggt ggtgatggtg aggccttctg aaacgacgac ggtgcgagag ggtacgccgt     43140
     agttggactt gcggatgcgt cccttgtgca tcgagatagc acctgaacct gggcctgcac     43200
     ggtgttgctg taatgagagc tgcttgtcgg tagggatgtg tgcttcaggg ccaatgagga     43260
     atagatggag gggcacgttg gggaacatgt aggtcagctg atcccagacc gccggtggca     43320
     gtgttgactc ggctcttgca ccaacgacaa agatgcgcat cttgtcaagc attggcttgt     43380
     cgccctgttt cggatgaagc gtctgtcgaa gggcgatcat gctacgcagt ccctcgtgcg     43440
     tcagtctgcg cgactttttg gtgtagggac tgttctcgtg aatcacggcg gccatggtgg     43500
     tggggaaagt gagaagcttg ctgacgtgtc gtcggctgcg atctgactcg atcgagttaa     43560
     agtttcgcgt gtagaagaag acgtcccagt tggacatgtt gatcgtctct tcgaatcctt     43620
     gcgggccggg cagcttgaac tcggacattt cacggccgct gcgaaggtcg tgctcgtcct     43680
     cgttggcttc gcgcaaacgt gccacgtact tgccatgctc ggtgtcttga gcccattcct     43740
     tttcgctata gtgcgttggc cagccacagt cggggcattc aaagttgacg agacgacgca     43800
     ctttgtactt ggacatgctg actggacatg gcgctagcga tcggatgcgt tcgccacgtg     43860
     cacgaatcga tgcgatgggc gatttcgaga aagggtggaa aaggttgtcc tgtgccagca     43920
     ctggcttctt ggcagtgcga ggtggcagcg caaatgcatc cttcttcttg tcctttttgc     43980
     cgccgccaaa gagagagaag ccaaagaggg ttcggtgctg accaagctga gacgctggtg     44040
     tacaggctag ggtgtgactt gagctcaaca gttgtgcaga gatgcgccga gcgggagcag     44100
     ccgagcggga catgccactg acatgcgaga gtgagcgcga tgccgccctc atggttacaa     44160
     gataccttct ttctaatgac cagggagagt ggctaggttt gacaagcaag acgctgagac     44220
     gggagctggt cgaagtggat gcctgagccc gcctcgctcg ccttggctct caaagctggc     44280
     agatgactga aaaaaaaggc gaggagaggt ggagattttc tcggaagcag ccgctcgtgc     44340
     gtctaaactc ccgactcagt cattcaaatc ggcttgagtg ccgattagtt ggagtgattc     44400
     acgattttcg tgattccttt cccgattcac gaatcactca atcacgccaa gcaaaatcgt     44460
     gaataatgtt tgttaaagtc gagcaagctc gattatgaat ctgaatcacg atgagagtca     44520
     cgagtcacga gtgagtataa ggcacgaggc gtgaagctaa ctaacgaaac ctcacctcgc     44580
     aagcaccaag cgtgaagttg tgagagacgc agaagcgaac gggccacaaa gtcgaatgct     44640
     gccaagacgg attcatacat tcgtgaccga gtcaacgtgg caagtaaatc ccacaagacc     44700
     ctgctagact ttgtcgttat cttccacacg gctcgcatcc caccccctcc ccccaacttc     44760
     cgtctcggtc cattcatctg caagcaacgc ttgcattcga cgacgccaat cgtcaatgcc     44820
     cgcaatggat catggtgtgg tgcaaaaatg gctccgcagc gtgctcggcg cctatacgga     44880
     tcccgaccgc gtctttgccg atgtcgatcg tgccttgatt gctgtctcgt ccctttcacc     44940
     aaagacggag gtattcactt tcaacgatgg ccgaacgcag cttctgatca gcttggatgg     45000
     tacgataccg gtcgagtttc gcaacactac ctacaacatt cccgttgcct attggattcc     45060
     gcgagactat ccacgcgaac caccgatggc gttcgtagca ccgactcctg acatggccat     45120
     tcgtaaaggt cccaatgttg acccaagtgg agaaatcggc ggcgactacc tcagccgatg     45180
     gcgcagcaag ccggaagctt gcaacttgct cgacttgatt cacgactgcc agcacatgtt     45240
     tggtcgtgaa cctccggtct atgccaagcc aaaacctacg ccggtgtacg ctactaccgc     45300
     ttcctcttcg cgcttttccg cgaaccagca gctacgctcg catcctccaa cgccgcagcg     45360
     ccaagcgagt acgtcgagca actttgcagc acagcgtcct ggacctcacc cgccacagtc     45420
     agcatctcca aagtccccac atctagcagc agctccttct tttcacagtg cagctatgca     45480
     cgatccgcac cagaagccgc caccaccagc gcctggcaca cccgccagct ctcaggatgc     45540
     ctttgcccca caccgtcctc ctaagccgtc ttgttctctc ggtgcggagg cggtctatgc     45600
     tcccagatct cgccctcaca gtttcgcggc atctgcagat cagcatggtt ggtcacagcc     45660
     tgcagccgaa ctacactcac ctcaccactc cggcacagca cgctttgcgg ctgaccaaac     45720
     ctacagacgt tcatcgggag taggtttggc gccgacgggc ttggacgatc cttctcatca     45780
     cggtgcgccc agtccagcag agcatgcacc tcagtcgccc cagtctctgt cacaaagggc     45840
     accatggcag tatagcagcg cggaccgtct gcagggcgta caactggcgc atcacggttc     45900
     acaaccatat ctgccgcatc atccacaaga aacacagcag cgccaacagc atcaacagca     45960
     tcaacagcgt tctcacacat acccccacac atcattggaa tcgcatccag gacctcagtc     46020
     actttacaat gatagtaaag ctccagcgcc gcaacatatg cagccaaacg gaacggtgat     46080
     tcagcccgcg tacgtatcgg gtacgccgca gtcgcagtcg cagtcgcagt cgcaaccgcc     46140
     gcctctacct ggcgcgcatc cttaccaacc acgtccgagt ccagcagctg gcagcgtgtg     46200
     cgacagtgcg aatggatacc atggctcagc gcaggtggct gttgcgccga aatccaaagg     46260
     cgtcaacttg ttggatgacg aagaagatgc tgccggtgcg gacgcgggta caacaggagc     46320
     agaacgattg atgagcaaca cctcaggcgt tgctcctcca ccacgaccta tcaatccgga     46380
     attgcttgca cttcacgatc gtgtattcag caagattgat tcgagactca acgcgctcgc     46440
     atcgacgttg ggcgcttcga atgcgcgact tgaagtgctc tcgtccgact tggaccgcgg     46500
     gctgccggca atccaagacg aaatgtctcg cctaaaggcg gtgcgtgatg tatgcaagac     46560
     caccggcgac cggttggacg catcggtagc cgaaatcacc gagtcgcttc gtaccttgaa     46620
     cgcgagggaa gagccagatg cggatagcat ggtattggcc accagcatcg ttggtaatca     46680
     gctcgtcgat ctggtcgcag aggataacgc tatcgaggat accctgtatc atttgggtag     46740
     agcgttgaat gctgagagat tggatctcga gaggtttctc aagcagacca gattgctggc     46800
     cagggagcag tttatgaagc gcgccttggc catgaaaatc agtgaggcga tgggatgggc     46860
     gtactgacat atacgatagt ggcggtttcc gtcgcgtaca ctgtcaatcg agtcgggtgt     46920
     aactttcgct atgcgctctt gtgtgtgtag tgggtgagac catggctaac tgagcagacg     46980
     ctatgcaaag cacgtcgtga gtgcgttctc gtgcaaactt tctgactgcg aagcacatgc     47040
     accatgttgg agagcgtgcg attttgcggt ctggggatca cagaccacaa tcgtgaattg     47100
     acaagtaact taccgtgtta cagtcacgac tgacgaattc acagactgtg aatggaagaa     47160
     aagtgacaga cacgagagtg ttggtgtgga ggcagagtcg tgagttgctc gcgagctggg     47220
     ttcatgttgg gttgggatcc gattggattt tctgactgag cttcacgcaa ccacgaatca     47280
     atcacgaatc acgaactgca ggagttgctc agattgacca tcacacgtca cacgtccgca     47340
     cgacagctgt gagaagcata ccaactcact tgtactggtg gcgagacgaa cggctcaagg     47400
     tatcgtacgt gtatggaagg atgagtggac tcaagcgtaa acggggggat gcgatacgtg     47460
     ggtgcaggga tggtggtaat gctgattctg atcgtggcat cacggacacg gacgcggggg     47520
     cattgctgga gcgaacgctg gctgagctgc gcagctcgac caagcgcatc gagacgcttg     47580
     tgcacactgt ccgcaccact acaccgaggt cgccactgat ggcgttgcgt gcaccagttc     47640
     agcccacgca tgcgtctggc gctccaccgc gtctgctcgc gcaatgttcg tgttcgtgtt     47700
     catgctcgga gctgcaagcg cagctcgccg cattgcgcga acaagtcgca cagcatacgc     47760
     gagaccggca ggcgtggaag gcattcaagg cttggtggct cgactcgttg gccaaacgtc     47820
     aacgacgcgc ttcgcgcgca aaaatgtcca agcgcacacc taccgagcac gccaacatgc     47880
     gccagagtgc attgcacagc atggtagcaa agttggacga acagacaaaa cgcatctggc     47940
     tggatgctgg tatcgtgtcg cgagaacaag tcggcgaggt tgaccaagac agcagcgtaa     48000
     acgaggcagg tcaagacgac cgacaagtcc aagcaagcaa cgtacagcgc gcgacgaacg     48060
     aggtgatatc tgcacacgta tcgcatcagc agagcgactg caatgcgaac ggtaccaacc     48120
     accagcagcg caaccaccag cagcgtccat gccatcccga gacacccaac tctgcctctg     48180
     ataccgcctg tcaacctacc ggtgctgtcc accgtcagca tccacgacat ctcgctcagg     48240
     ctggcgctac atctcgcaca tgccttgatc atcaccgcac tgctggcgca cacatcgact     48300
     cgacgccgat ccgaaaccgc gttgcgcgtc caacactcat cgcctcgtcc tgtcccgact     48360
     gctcgctctt ctacacgcat ctcaaccaac tcaaccctcc cactacccag cctcaacgcc     48420
     aaggcgacac atcgtgcatc gcttctagtc ggcatcgatc caccttgcca cgcgcaacca     48480
     ccccggacgg ctactggaat atcgccttcc ccgataccca gcaggtccaa cacatcaacg     48540
     cgctcgccca aactcgtcgt cctccaccac gccgcagctc acctcaccac ctccattcgt     48600
     gattcccttt caagtttggc gctcaatcac acctcgacac tctatcacat acgcaattca     48660
     ctcatcgtac tcacgactgc atgactcgtg actgtgcagc taagccacgc ctacaaaaat     48720
     ccactctcct gtaacaacct cgcaatcttc tcgtcctctc gctcgcgcgg ctcgagcagc     48780
     agactctgct cgtacaagtc atcggcagac cttgcatcta ccagatttgc ctcaatgtac     48840
     ttttcaagtg ccgggacgac ggcaaggttg tacggggtag attgatggat cgtaatctcc     48900
     ctgatcacct cggctgtctt ctgtcgcttg ccaaagttga tcagctggtc gttctccttg     48960
     agtcgatccc ggttgccatc ctcgatgaag gtgaggtcac caaggtatcg ccccaaaaac     49020
     ggtacacacg gcggtttgag cttgtggatc atctcgcggt agttggccca attgcgtgac     49080
     gccgacatga gctgctccag cgattcaaac accagcacgt acttctgcga gacagcgtcc     49140
     cacgttcgtc gtagccgatg gatcggcgct gtggacagcg cagagacgat ggcccacatg     49200
     cccgagaagt tgttgagtgc acgacaccga tcggcaatgc tgataaagtg cttgataagc     49260
     gccgcgcgct tcttcagatc ctcctgctgc aagatcgtct cggccaccca cgccgagatg     49320
     cggttgtgcg tggtgatgct gtccatgatg cccttggcat gcacgtcatt gcccggcttg     49380
     gtccacttga gccccaagca ctcggcaggc ttgaccttgt tgtacaatct cgactcgagc     49440
     agcgtcagct gcctggccat ctccagcgcg tcgatctcga ggaacttgag cttcttgaga     49500
     ttcttgggca agatgggcgc aggcgcagag ttcggcagta ccatcttgcg gatcatctgc     49560
     tcgccctcgc cctgcctcct ttccaccaac ctctgcagat gctgcgaagg cgccttcatc     49620
     gccggcgctt cgcccatctc ctcgaccgca aagcgtcgaa cctggtccag gtacggctca     49680
     tcctcgccct cgtaaaagtg catctcgagc caactcttga gtacgttgaa tacccgaagt     49740
     cggatcggaa tttgcttctt ctcggtccaa agcgccagct cgtcctcgct gagcccttcc     49800
     ggcggcagga tgcggaatcg ctgcgccaat agatccagca gcgtctgcgt cgtcgtaaac     49860
     gagcggtacg tcatcaggaa cgtgttgttg aacgatgcgt caaacgaatt gtgcatcgtc     49920
     agacgcgcca acaacgcctc gagtgtagcc cccttgaccg agccgtcctg agcaatcaca     49980
     atgtcatcgc ccatgtagtc gggctcgagg aaccacggca cctcatcctc cttgcgtcgg     50040
     gacatactcg atggcgctgt aatgccggtg ccagcgctgt gttcgctatc gtgcgtcgtg     50100
     gtctgcgtca gaggtgcgtc gtcgcccagc gtacctcgac gactgacgat ccgccctgaa     50160
     gtgtctgtga acgactgcag tgaacgcacc gagccgcccg tggtaacaga agtggatcgc     50220
     tggcgatggt tgttggaagc ttgcatcggt cccagtcggc cggcagccaa gcttgggaca     50280
     ggcgagttgg acgtcgacac agaggtcgca cggctgccgg acctggccct tggtccattg     50340
     gggacagcga tgccagggcc caagtacatg aattcggcct cttcctctgg ctcgtcatcg     50400
     ttggccttat ggtagcgggc catctcgtcg agctcttcgt gaagaccatt gctggtggtg     50460
     ttgaccctgc gtgaaaagac gcccgtggaa ggcagaatga tgccatcttc agagccgttc     50520
     ggcgaagcgc gaacaccgag aaaaggcgag gcgtcgcgta gctgctcttc gcccaccttg     50580
     gcgatctctt gaagcgtctt gaccaccgct gcagacagct tggccagctt aactgtctgc     50640
     ttttgcacga ccggggccga gctgccgtac tcctgtacag ctaggaagag ggagcctgag     50700
     gcgtcatacg cgatctgttt aaggaccaca aagcgacgca ttaggtcgcg cgccttgacc     50760
     gcattcgcag cattgcgctc gttgatggac gaggatttgg cctccttggc atgagggcca     50820
     tcgacgtcga ggcctgaggc tagatcgatg ctctcgatca tagcttcaag ggcgccatat     50880
     tgggacagca ccgacaaggc agaggtagcc acgctgctgc ctggctgagc ctcgagccgg     50940
     atgagcgctt gttgtagctg ctgaatcatc tgctgatcca atcgcttttc agggatgcgt     51000
     cgcaacgtta gcaaaccgcg caccaccgcc gattccacat ctctgcgctg atcaaaggga     51060
     ttgcttcgcg cgcccttgcc ctccgctttc atcagagcgg tctcgcactt ggaaggaagc     51120
     acgaaaccgt tgcctagcca acctgcggcc attccgctgc cgtaggatgt tgagccaaca     51180
     ccgttgaggc ccaagtcgct ctctaggctg ccctctaccc tgcgcaacca cccacggctg     51240
     taaggtgccc caagggcggt gcttcgcgag cgttcggctt ccgtgccgag actctgaagc     51300
     gttcgcgcga gctcgagtgc gtcttcgcgc aatcgttgtc tgcattggta gagcttggaa     51360
     aagacgtcgg cgtcgagatc ggtcatggta ctttccatgc cggacgtagg cgaagaagct     51420
     agggtgacgg tgtgatcaat gacttggcgc gaggagagga caagcttgga cacgacagcg     51480
     ttgagcttgc gtgcgaccag atgcagggac cccggcgttg gtgcaagcga atccttctgg     51540
     ctgacgccaa tgacatgcaa gtcagaagga tcagagccat tggtcaaagt gcaaagtgtg     51600
     tcgagcacct tagagtacaa gttgaggtcg acgtctttgg tcacatgggc ggtatcggag     51660
     agggactttg gaatatcgct tgaagccatg ggtacggcga caagcttgga gacggaagcc     51720
     acatcgctgc tcgagagcga gagtgagcca gtggcataga gcacctcgcg gatagcagct     51780
     accacgtcgg cagtagcata cgccaatctg ggcaggtaga tgccgtcggc gctgcagacc     51840
     gagacatccg cctgtgccag accattggtg ccgatttgct cggtggcaat ggcggccaag     51900
     tttcggatga gttcattggc gcgtcgaacg agggagctga caggcggcac aggaggtggc     51960
     tggagcgcct tctgcatttc gtaggcggag gtttcctcgt gtagcaagga gaaaggcaag     52020
     atcttgggtg atgaaagcac ggcgtgattg gcgagggcag ccagagtaga tgctatgctg     52080
     ccaacgcgat ggcggccatg tctggaagag gacggcttgg gtggcttgcc gggtagatgt     52140
     ggattcatat cgccgtcgat atcggattcg tccgatccga gctgaagctc tgagacgccc     52200
     tgggtgatgt tgaggccagc gcccagattc ggcgcgcctc tgctgtgttc gataggcgcg     52260
     attgccggga tggtggagtg tcgaggcgaa cggctgcgag gagtgacgtt ggagagaatg     52320
     gtcagcttcg tctttgcatc ggcatggttc caacgaatct cgtgggtgga gcgatggaca     52380
     tagaaaaagt acttttcgtc gtcggtcaat cgcaccctcc aaggtttggg cacggcggta     52440
     aggtcgggca tgcgatcggc cgtgttggaa cttggcgctc gaacgggtgc ggtgccgttg     52500
     tgaaagatgg ctgtgttgct gctgttggcg gaagaggggc gcgactctgc actggcattt     52560
     cgggatgtgg gtctgcttcg ttctggaccg aggtgactcg agtcgtagag gtccttgcga     52620
     gagtcggccg agctgttttg gtcggacgag gtggtgcgaa tcatgggttg cggctgcaat     52680
     ctgctggtgg gtgacgagaa tacggcagtg tcgttgtgag tagagcgagt atctgggggg     52740
     acctgtgccg aagtggctcc agtgcgggta ttgtaaaaga cggtgtgtcc tcgctgagaa     52800
     gtctttaaaa cccaaacatc gccagaggga gaggtatcgg cttgagagcc cgtggcagct     52860
     ctaggtctgg cagcggcagc agcggcagca gcagctaagg aagtggacgc cgcggaatcg     52920
     ggctgaagcg gatttgagac ggaagcggct ctggagcgtt cgcgttccaa ggcaagcatc     52980
     tgatccgagg ccgaggagga agaggcacgg gggtattcag ggatggcgga tcgagaagat     53040
     gttgatgcta gtgaggatgt gtcgcgtcga tagggggatg cgtctggaag ttgcaagaca     53100
     ggtgtgtgag cgagttgggg actagctgga tcaaagatgc gtctctttgg atcgagcatg     53160
     gcagcttcgg caagctgact gaaggcgtcg ctgtttccga tgccgtcacc tttgatgagc     53220
     gcttggagcc catcaaagcc agcgccgagg ccgagacgtg agaaggaatc cgagtcggcg     53280
     gaaagatgag gcgagaggcc caaactgtac tgtgcgtgca tctgtgcgcg ggagatgagc     53340
     tcgagctcag cttcgtgatc cgagatgggc tcaacatagt tggaaggaaa ccaacctcga     53400
     acatggttgt ccagcagacc atcccaccaa ccggattcga gctgagtgag tacctcgatg     53460
     agcgcaccct tagagaagga gagcgagctg gcgtcgttgg attcgaaatc gtagagagcg     53520
     cgcacaaaga aggacgatgg ttcgtccgag tcgtctccgg tgctaggagt tggatcatcg     53580
     aaagacgcag ggacatatgc gagacgcggt tgagacgtgc gtgtataagg cagactgttg     53640
     ccgagggcgg cagcagaagt cgaggtcatg atgagactgt gagcaattgg cagtgggaag     53700
     cgaaagcgtg ctgagagccc tgagaagggg gagagagggg tgatgctagg agcgcaaacg     53760
     actcgagctg aatggtcagc agcgtgattg gaggtcgagg gcgcgaaagg cgggtagcat     53820
     ggatgcaggt gtgtgcgtga caagtgcggc gaatgataga tgtacgttag ctggcgtggt     53880
     tgtactagga cgcagacaaa gaaagcgtcc aaggccaagg gtggggtaga acgcgcgcaa     53940
     ggcaagaatg gtattggtga tgattacgac gatgcgagtg gatcgagggt gcaggttgaa     54000
     tgagcactga aagcggcgca gatggcgggc aaggagcgag ctcggagcaa gaccggtgga     54060
     gctaaatgaa agcgttgaga aaaagaaagc gagtagttgg ctggggaacg gtgggacaaa     54120
     ccgaccaaga tgaaattctg agtgggtaga gaggctgatg gatcgaaacg tttcagagtg     54180
     gggcagccga tgagcgataa cagcgatcgc tgtagggaca cgaagcgagc cgcggggtat     54240
     gacggtggtg atggtggtgg tgagaatgag atgaagggtg tgatggatag aggactaatg     54300
     acgtgaggaa aagagtggtg agtgatgagt gcgatagagt atcacaaagg gtcagcgaca     54360
     gcgaaccgac gctaacttag ttcgtgattg tgattctcga ttcacgattc ttacacgtga     54420
     caaaatctac cacgaatgtg agtttgcggt gcgtgcgtgc gtgtgtgcgt gtgtgtgtgt     54480
     gtgtgcggtg cgtgtgtgcg ccaaaaaaca agcgtgaagg gtgaagctgc agctgcggtg     54540
     ctaacactag gtgcgtgtgt gtaaaaagta atcaaattcg cgtgtcgcgg ctattcgtga     54600
     ttcgtgattc agattcggct gattattcga gggcggctaa gtcgctcgct tgattaccat     54660
     aactatcttg attcgaccag gtgagtgacc gttctgcgtc ttgcgtcttg ttggctgctt     54720
     acacagtaac gtcgctgaat catgaatcgg ctaatatatg gcttgtgacg cctaattaat     54780
     tgcttttgct tggtgatttg tgccagacac accttgacgc ttgcaaatgc tcgtatgtgc     54840
     ttataccgcg tgttggaggc ttgttgatat gtcgcagcga tggttttgat tggagagtag     54900
     agctcgagcc tacaacttcg atgctcaacg tatcataccg caacctaacc aactcagttc     54960
     aaccttatat atatacacgt tctactcatt cgtgattcct ttgtgagtcc gaggcgtctc     55020
     tttcatgagt atggatcgtg ttcgagtact tgtttgctca acttgtggga tgcatcacga     55080
     atggtaccga gatagtctac gatttcagcc cgcgacccac gtcaagtcgc cagtcgcggc     55140
     gtaggatgct cttatcaaac ctttgttgca acctcccacc agcgctccga ctgctggtca     55200
     acacaggagc cttaatcgcg cgagctcatg ctgagttccg caccaacaag ttgcgccatg     55260
     caatgtgcat cgtcaaggca tgtttgcatc accatccgta atcaaccgct cacctggtca     55320
     ggacactcgt gactgtcatc cgcatctcgg tctttctatg taatactagc cgcgacagat     55380
     tcttacattc acgagtgaca ggtagagatc cacggcgcca gtcagcgagt cttattcacg     55440
     attgcacgtc aaattaccat aaatttcgac tccgactcgt gactcaaatg agtcgggagt     55500
     gtgggcagca attcgtaaat cgtgaatccc attcgtgatc tgtgattctg gtttttgtcc     55560
     tcgttctcat tcgggcagcc aacatcgctt gctcgccgca gtcagtgcgt acgccgcaat     55620
     cgtgaatagc ccaatatgtt tcattcggta tgtcgttgca tttcagcaac agcacacaac     55680
     ttgcgcctct ctcggtacac ctcttgtgtc gaatcaggct cgtcgtatca agtgtgccaa     55740
     ctcacccact cgctccatca tttcacgtcg gtacaaagta gaacttcatt tgctctagat     55800
     ccaccttcaa ttgttgcgag cagtcattct gatcgacatg ggaactcgcc cgaacaacca     55860
     actgtgagtc gtcatcggtc tttcggcttg cctatgcttc atcgtcatcc tcgaccgtcg     55920
     ctgtcttgct cactgcagca ggcgcactgt ccgcgccgtc gcgcgccgat gctgggacgg     55980
     ccactgctgc ttgagtcgct tccgttgtcc cttttgacgg ctgctgctgc tgctgttgtt     56040
     gttgcgactg agcctgagcc tgagcctgag cctgatcttg caacgcctgt agctgtgcac     56100
     gcgcttgcat cagcattgct acctgctgcg gtggcaggtt gggtggcagt ggaccttgca     56160
     tcagagccgc caattgcgcc ggatggatct gctggccgtt tggaagtgtt accctagcat     56220
     ctgcacccga tcctgtcatc ggcaggctga taccaggacc atcaggtgca cctggtgctc     56280
     caggcgcatc gggacctcct tgcgaacctc gttgaatctc gatcttggtt ccaggtggtg     56340
     tcacgagcgg tggcagctcc actgttggct tgggtaccgg caatccctga tcttggagcg     56400
     tcttgacctc ggccgcacgc tgacgctgaa tgtcgtagta gatctctttg tgcttcaagt     56460
     gcgccaccat ctcgcttgca gttggaaaga tgagttgtcc ccatccttct ctaaacgtgt     56520
     tggcctccga aaccacatcg aggatctcgg cttctagctc cttttccgcc aatgtaaatc     56580
     gtgccatggt ttcgtcgccg atagatcctt tttggagcag tgttgccaga gcttgcttgt     56640
     catcgcgcat acgcatgatt ctgcgaacgt ctgtcatggc tcgattcagc agcgccgcct     56700
     tgagcacctc ttccggcgcg ggcggatctg cggctaccag cgtctggtaa atgtcgcgtg     56760
     cttcgtgtcc ttcgccaaac cacggttggt acgacttggc caactttagc gctgatcgtc     56820
     gtcgatagat gcgtgagaac accagcatcg acactaccag tgtggccaca tacccaatcg     56880
     gtacaaagat ggaaagcgcc atcgtattga ctgcgcacgc ttcagtgtgt cggctaggct     56940
     tttcgagagc tgtttgtgtt ttggtcttga tgcagttgcc tcggatgcag atagaatgtg     57000
     ccttggataa ctttgtcgga tgttggtggt acaatgctat ggcgtaacaa tctgatcgtt     57060
     tcaactgcaa acaccaagtc ccagctgtga tggttgagaa agagccactc gacgatccat     57120
     tcacatttca ccccttgcag ggcctgagtc caaaattcac gaatcaccaa ttggaccgtg     57180
     acacgaccac aactcgcttt gatcacgaat ccaacgctta ccgcccgcct tcatttcttc     57240
     ttctcgtccg actcagtcct ctcctccaaa aattacacgt gtcattcgtg attcgtgatt     57300
     cgtgaaggcg cttttcggtc cacaaccgac aggacgcaat tgacgcacgc ccgcgagccg     57360
     tgtgcgctca actcgtgact cagttgtctc acgccttcga tctaaccact tgccgaaaat     57420
     tcgtgattgc acgttgcgtc acgagcgtgt accacgcatg cctcacaaaa caccctcgaa     57480
     gccgcagacc ttggtgcttg gaaaggtagg gccgaccacg acacatcacg agtcgctgtt     57540
     gcacacacct ctgggacaac gtggtgcaag cccaagtcgg aaacccgagt caaaacagag     57600
     gagtgtgatc aagatacagt tgcaagtgcg agtatggaac taaagatatg caaggtagga     57660
     gatgaagcga aaactcaaac tatgtgtata tgtatttgct ctgtatcaag ctctgaagcg     57720
     gatcgagctg cccgctgttg ctgctgtggc tgccgctgca tcttttttca tctggatcag     57780
     cgactcgagc tcgttgcaaa cctcggtcat gctcggccga ttcttgggcg tctgatccca     57840
     catgcgatct agaaggtcga caatctcgtc accaaactga cgtcgaatga agccagtata     57900
     gggacgctgc ctcttttgac ccacgtcctg gtagatctga tgctcgttca tgccctggaa     57960
     cggatacttt ttctcgggct ggtgccactg cagcgcctcc cagaacgtca tagccgctga     58020
     ccacacgtcc accttttcgt tgtattgcgg tttgggtacc catagctcca ccgcctgcca     58080
     gttgaccgtc cccaccaacg accgcatcat ggatcgcgat gtgttcttga cgcgtgccag     58140
     cccaaagtcg ttgatcttgg ccgtcttgcg tcgcgtgatg agcacgttgg tcgacttgca     58200
     gtcacggtgg atgatggctg gcgtccgcgt gtgcagatac tcgagcccac gcgccgtctc     58260
     gagcaggatg cggaacacct cggcatcgct tggcgccgcc gtgttgcgaa tatagtcaaa     58320
     tagatcgcca ttcgagcaca gctcactgac aatcatacaa ggaacatggc gcgggtcctc     58380
     ggggatgctg acgccgatga aacgcacaat gttttcgtgg cgcagatcac gtagcaggct     58440
     aagctccttg atgtccatct cggtcagctg gtcgcgaatg tcggcaatag ccaccttgtt     58500
     gacgcgcgtc ttcgagatgc gatacttgcc tacatacaca tccttgaacc cgcccgagcc     58560
     gatcttttcc agcttctcaa gcttggacgg tgcaatctcc ttgtccgtca ggttgaggct     58620
     ttctaggtcc agaccgttga gctcgtcaac accatctccc acttgcggcg cagccgcctc     58680
     ttcgttgttc gaggtcagcg gaggtgtgag cagcttttcc gaagacacca tcgtgctgcg     58740
     tgcacgcagc aacaagggct gatcgctgtc ggttgccgaa gcgtgtgcgt tgcttgtagc     58800
     ccgcgtgttc cgtcgcctag taggagtgcg ttggccagcc tgagcttgat cgtcttgagc     58860
     cacagcggtg gcattcgaaa tgtccgattg tgtttcgtcg ccatcgtccg cgtcagaatc     58920
     cgcgttcttc gccgcatcga gctccgagag ctggaaccaa tccagcaact ttttgatcaa     58980
     gtttgccttc ttgtcatccc catccatgtc gatcgctcgg tcaagacata attgtcccag     59040
     ttcggacttg cgcagacgtg tgagcgtcgc aaacgtaggc tgagccatca cactatctag     59100
     accctccgat ggcgctgtgt cgctgtccgg agattcggtg cgttgctcgc gacttctgtc     59160
     tgcgtgctca gctgcgcttt ccatgtcgac atcgcccagt tgctcgttac cgctcgtacg     59220
     aacgtcgctg tctccattcg atgcgccaac aactagacgt agctttccgt tgcgaagctt     59280
     gcggaacttg gtcggagtgg ccgcaacatc gtcgtcgcca tggtcactgt tggccatgtc     59340
     gacatcgccg tcgcgctcgg cgactagatc gtcctcctgg gtagcagatg atgctgcctc     59400
     cgacgaggca ctgcggctgc gaggcgggtg aaaagtgaag cttgcctccg attccgccgt     59460
     cgaccgcctc gtgcggagtg ttcttcgcgt actgcatcgc gtcggagcgt tccgcaccgc     59520
     agtgtgctca tgttcatctt gcagcaggga gattgatctt gtttgcagac cgacggcaac     59580
     atcatcgctg cccgaggata ggtcctccat ccactcatcc cgatcgtact cgccatgttg     59640
     accaggagag gcagcacaga acttgaccga cttcttggta cgctgcggca gacgatggcc     59700
     gactttgggc gttgccatgg gatcggggcc tgtagacgcg ccatcaatag aagcgctgac     59760
     gacgcgcgtg cccacttttc gccttgatgg cagacccgcg gtaaggcgag cggtgcgtga     59820
     tcgtgtgcga atgggcgacg aagcgacaaa gacgccaagt tggcgccttt gcacgaaggc     59880
     tgaatgcgaa gtgttagaag cgcgcgagct gcgacctcca aagatggaag aagaggtgga     59940
     tgcagacatg gcttcggagg cattgccgat gagctgccga cgtgccacgc catttcgcaa     60000
     ggttgtcttg tcgcgcagct gacgacgcgg agcctgatta gctttggaag gctcgaactc     60060
     gtcaaacgtg gacgagtcca tgcgtcgcag agcgcctccc tcgtaggcct tgagacgggc     60120
     ttgtgagggt ctgcccatat gccgtcggct gctgggagaa ccgtgaggtt cggcctcggt     60180
     ctcttcgcct cctgcctcgt tggacgcatc ggtcaggtcg gcttcgtcat catctgccga     60240
     gccggtagga gaagcgcaaa gagatgatcg ggcactgcga tgcaaagatt cacgagctgg     60300
     caaggccatc cacaatgcgt cgctctcatc tgcatgctcg tcaggcaggt cattggaacg     60360
     ctgcttgtac gtgtgatatg agctgcgaac agagcgagac tgtcgctgca ctgtggtgga     60420
     cgcatggagt tcgtcggaac gagagtgatc gagtcgggac cggcaagtga tgatctgatt     60480
     gacgagatcc tgcttggtca cgagctcgag ctcagcgtcg gtgggagagg cgtcccaagc     60540
     acgagctgaa aggcagagct gcacgagttc gtccttgcgc aaacgatgga gctgccaggt     60600
     tggtgcggac gagacgagac gtgcctgctc tgcttctttg tcgtccatgt caatgcttgc     60660
     ctcgctgctc agctccgagt caggcacttt gtgtgcactg acaatgcggt gtgaagccgc     60720
     agaaggaaag ccggtctcgt tatcattgcc tgcgttgaga ttgctattct tccggctcac     60780
     cgaccgagat tgagatctgc tggacctggc caaactacgt acggatgcca agctatcctc     60840
     gagcgtcatg ccatccagtg ttttgtagag tgagttgcgg ctcgatcgtc gagtctgaat     60900
     gccgggacga gacagctgga ccgcagcaga ctcttcagcc cttgaggtgg gtacccgaga     60960
     tgctgttggc gatgtagaaa cgacggacga ccagtcggac agctcgctgg cagaggagga     61020
     aggcttgtcg cgaggaaggt ggggcgaagt cacaatgtgg atctgcttgc cgctgcgcct     61080
     gcgaggcgtg cgtggagcta tacggcgaga tccgtctgca gtggaagcct ccacctcaag     61140
     tttctcgaaa gacctgttga tttgggtggg ctcatgagcc actccgccga gctgttctcg     61200
     agcgcccttc ttgcgtttga gaccggcacg gacctgcgct atctccctag aagcaaaggg     61260
     cattgcgttg acaagcggaa gctcggtggg acaagacttg cgggtagaca gtgacggaga     61320
     acggagtagg gtggagctgg cgtgagcgag tttggctcga agtgcggacc gtgtggtgtt     61380
     ggcagccgag gagcgcgagg cgggaagagc atcaatcttg ggagtgaacc gctttgtgat     61440
     gacgtcgacg gactgattct gggaaatagg agagagtgca gtgcatgtcc ggttcgtaca     61500
     caccatggcg ataccaaaaa cacaaaccta atccagtgag atggctgtgc tgaacgcggt     61560
     cagagggaaa gtcatgtggg agaggtaggt ctagcagtgt ttgccgacca taatgctggg     61620
     cagcgtcgag cttaacagtg agctgacaaa ggtgccgtta ttggtttggc ccgcggcggt     61680
     ggagagtgaa agatgcaaag gagatatggc cgaagcaaag agtgcagcaa gacgaaagat     61740
     ggcggtgagg ttggcctact gtatgcagac agacgacaaa gcagacgggc aatatgcagg     61800
     gtcaagagga agcaagtgag atcaccttta cacgatgaag ctgccagtag cctgctacga     61860
     gatgctgaac gtgtacgaca aggtagaact agaagttgaa atcgagttgg tggacgatga     61920
     tgcgttgctg tgttgctgtg ttgctgtgtt gttgtgatgc tgcgctgtgt ggagtgaatg     61980
     agacgaaatg cagggagatt ttcagacaag aagagcaagt taggacaaga tgaacgtggt     62040
     agatggagaa gcgtgaaggt gttggtgttg atgtcggcga tgaggatcat gtcaagttgg     62100
     ctgtaagtga ccgtaccgta cgcagggagc gcgtcatttt ttgcggagaa gctaagctat     62160
     cggcctcgtc cgctgctgct gtgactgagc cgtgtgttgt gcaactccac cagagtcagc     62220
     tccttacact gccgtctgct gccgcttctt gatcgagacc gccaactgcg ttcattccgg     62280
     aatcgcgaat gaattgattt gttattaata acagaaaaaa caaaaaaaaa aaaacaaaaa     62340
     aaactaccgg tccctgtgcc ccattcccag tcacagtcac gagtattaaa taaacaaaaa     62400
     cacactactc gtgactgtga gacagacagg agggtaagtc gtgagtgtga tttccggttg     62460
     gggtgcgcct tacaaccacg aaccctcgat tttgggaccg tgcagctaac agcagctgat     62520
     cgaaatcaca tatttgcact cacgactcgc ccgaatcatg cgcgcgtgtg cacaagctga     62580
     gcgcgtcgcg taaatggttt agtgtaaaga caacgtgatt gtcgaaaaat agagcatgtg     62640
     atgctaggta tacagtaatg atgacgatcg cgcgattcaa agggagagag agaaaagagg     62700
     aaatgactaa ctataagaac catacgagta cgagaagagc aaatgcagag agacgcaaaa     62760
     tatgatgtag aacccttgac aaacagagtc gagatgtgcc atcggccatg gacgaggact     62820
     tggtcgttcg catggccagc ttggcgtcaa agtggaaagg ttacgcttga aacgcaacag     62880
     gtttgtgtga aacgacagaa acagaattaa gagagttaaa gcgctcaaga gtgaaagggc     62940
     tggccctcga cgccgatcga cgccaagagg ccattgagat actcctgcgt gctggcgtcg     63000
     ttgctcagat cgctgccctc gttgagcaga tgctcaaagc tgttgttgcc cgagtccagc     63060
     ccggagtgta cgcccatttt gccgcacata tcgaatccgc caggcgagag cagcgacatg     63120
     ccatggttca tgttgccgcc cggcaccatc aatccaagtg cagagtcact ctgaccatcc     63180
     acggctgccg ccatactcgc cgagctcatc gaactaccgc tagcgtcggc ctggttgaag     63240
     cccatgtcga gcggagaggg caatgcactg gcgagcgggt tcgactgact cgcccagtgc     63300
     ctctcgagtc gctccttctg catgcgcgcg tcgtcccccg tgttgagcgg cggcggctca     63360
     cacagaccgg cgcccatctg agggaagggc gtgatcggcg tgtgcacagc gcgttgctgg     63420
     atcgcgcccc acgcagccgg cgtcgggctt accgcgggcg acagctgtgg atgtgggctc     63480
     agcatggcgt cgttcgaaat cctctgagcg ttcagatacg actgcgctgt cgggatcgag     63540
     accatcaggt tgggcttggt catcgacagg ccacgtttgc gtagcagcgt cggtgcttgc     63600
     agattcgcgt tcgatccctc cacgtgagga gaagcacgga agccgaaccc aggttgcggc     63660
     gacgcttggg tatgaatcac cgacggaggc ggatgagcat gtgcaaaccc acgcgcgcca     63720
     gctccgccgt tgagcgtatt cagctgagct tgcggttgat gcaccatcgc ggcgtgatat     63780
     tgctgagcag caccaccaac gttgggcggc attgacgtca agccgtgcgc tcctatctgc     63840
     aagcctgcac ctgcgggcag cagaggagac attagaggag cggcgcgacc catgggcgaa     63900
     gcgctagggc ctgcagtgag aagtgaaaca gtgggggtgc cggggttggt gcccaacgct     63960
     tcgacacact cgaggtccca agcgatgaca aggacaacgt cgcccacctt gcttccaggg     64020
     ctcaagctgg aaccagcgtc gttgagaagc gcaggtgcac cttcgcggcc agtcgtagca     64080
     gccaaggctc cagcagcgcc ctcacccgcc acaacgagct cctggatgat cgtgacgccc     64140
     gacacagcca tgccaagagc agcacgctcg cttggttcct tgccaaacga ctgtagaccg     64200
     tctcgtccgc cgtatgcgtt gacaggatgg ttgcgactga ggaagtcggc ccaaaagtcg     64260
     gtagcaaacg gcgcctggtg gcaccatcgg tggcgaaaac tgctgttgga ctcgttgttg     64320
     gcgtccaagg gtgtacaagg cgaaacaggt ccgctcgaag tgcctgacac ggggctgagc     64380
     gaggcgacgc tgccgtcact ttcgcggcgc tgaatgctgt tgttcttgat gggcgtcgag     64440
     gtggtcgcat cctcctgcgc tcgaaccttc tgatcggcac tctgcgcgtt ggcgttgctg     64500
     tcggatccct cggcgccggc cacagtgctg gtggagctcg tttcaccacc attcctgccc     64560
     gaaatccttc ggggagcttc taagggctcg accagcgaca aaacacgctt gccgtgtgag     64620
     tagaccgtgg tcactgaggt caaacgcaag tcttgtgccg atgtcaacga gagctgcgtg     64680
     ctaaagtggt cgtagcgtgg catcataacg tcatggcgtg ggatggacag cggcacatgc     64740
     acgtggagga actggcaggg catgtgatgg tacatctcgg caagacgcgg gaatcggaag     64800
     tggcccacac gcaccgaatc gagtgtcatc ggaggcaggc acgtctggtt gttggcatag     64860
     gtggtcatcg agttgcggtt gaggttggtg tagacgtgct tctcgtcacc ggaagagcag     64920
     tgcacccaca tggagaagct agcaggaagg atgggacatg gcgtgttacc gctcgtgtcc     64980
     ttgacaccgg tctgctgagg gaggtgaagg tcattgaggc ccgaagtgat ggcgtgtgtt     65040
     gccgacaacg gtggtgcgcc gggcgagagg gggctggcaa ggccctgacc gccagtgaga     65100
     cccggggtat aaggtgagag gagaccgctg ctggcattgt ccatcgggag gagcgaatag     65160
     gtgcctccaa ggccgccgta accgtagccc gcaagcgtct gtgcgtacat cataccgcca     65220
     gcgggaatgt agaagtcctc ttcggtggtg ggttcggcaa tgagctgttg gaactcggga     65280
     tctccctttc ggatgttctt gagcacctga atatgactcg agacttgctt acgagtgcgc     65340
     accttgttgg tcttgcgttc gatatagtcg gcgatcagct cgttgcgacc gcaaggcttg     65400
     ccgtggacca acacctttcg acggccaagc ttgggtatga gacgaagcgc tgttgggtca     65460
     ggtcgtgagc cagtacgagt gtcaagcaat gagaagaaga gtcgagatga gagtggtcgt     65520
     gagaaagtgt atgagaagga gaagaaagca agaaagcaag agagatggta aaaggtagag     65580
     ttagtacaac agcgtctcta gagcgtgtgc aacactttct agggaccaca cggaagcacc     65640
     aggtcctcct cctcaaccac tgttctggtg gagaacgggg cgagacagcg gcaagcttca     65700
     agcatgcatt catgcaagca cctcggagca acatcgagat gtcactcttg gctgctcggt     65760
     gttctccagc aaagcagtcc aaaagcgcaa gcgcgtcttg gcaattacaa aacgaaatcg     65820
     tcaaactggc actttgaacg gctacacgcg cgcgttcgac ttggttcgac tttcggaaac     65880
     tgaaattccg ccgaggcgcg ttcctttcag agttgctcgt gcaagacggc gattcgctgg     65940
     cgctaattgc acttccaaca gcgcaagcca aatcgatggt tgtaaagcaa gtatggcaac     66000
     gagcgcttgc gaatggcgca tgcatgcaca cggtgctcgt agccaaagaa tccggaatat     66060
     tgcaatgatc atgacactta ccttcccaga atgcgacctc gacgtcatcg ggccacacat     66120
     cctgattctt gccgttcgag ttgccgctcg gggtcgcgtt gccgcccgtg gtattattgc     66180
     ccgaaacgct tgtcttggcc ggagttgact tgtcgtcggc ggccttcctg atcagggacg     66240
     actgagattg tgccctctgc atggcgtccg ccggggcacg tggaggcgca ctcctgggcg     66300
     ggtgttcgcc gctaaaccct ggcaacgcaa ggtttgcggt caggttggca atgtggttgg     66360
     cacggtccat agccgtgagc gaaagacgcc gcactcggca aggcgatgct gtcgactgtg     66420
     ccgacgccgg agtttctagc cctccatcaa cactagatcc gaccgaaaag tgcgcgtgtt     66480
     gctggtaggg gtacatgttg ggtggcgtct gttgaggcag gtagcgttgc tggtgggtca     66540
     agtgatcgac agcgcgctcg ggggtagcat cgacctggga cgtgcgacgt cgcttggcat     66600
     cttctgcaaa gccttgaaca ggagtaggcg tcgggctgtt gcttgaagac atgctcaccg     66660
     tgaggcgtgg tggcgacatg aggaagccgt ttccagaggc gttctgcatg ttcgcgctcg     66720
     tgtctgttgg catgttttga gagtaagcga aagagccaaa agcatcgaca gagatgctca     66780
     tgcttctagc accagcgttt gggccaacta agctggcgta atcggccaat gaagagctcg     66840
     aatccgccga aggcatcagt gtctgaatgc tgtgacgacg acccgagttt gagtcagcac     66900
     ggatatgcaa catcgatcca aatgcaccct tcggctgcga agtggtgggg cgcttgctgc     66960
     taacagcgag gctgtcattc ccatttccaa aggccacctg catatccgcg ttaatgcgat     67020
     caaagttgag cgcggctgag agcgactgag catcaccgct catgtctgcg tccatgatgc     67080
     ccgaggcatc gtgcgcaaac aagaggctgt gatcgtctgt ggcatctcca gtcgtgttcg     67140
     cgtcgctgcg cttggcggca gatgcaaaag cagcgttggc tgcgctaatg gaggtgtggt     67200
     catgatgaag gcgatcgctc gactcctgct tcacgtttac catgttgttg tctggggtgt     67260
     acaagagtga cgaggaggac agcgtcgaat cagaataggt gggtgaagga aagaggtgtt     67320
     gaaggtcccc tttaggagag ctggtttggg cagtagacat gtgcgctgca gcctgacgtt     67380
     tcgaccaaaa ggtgctttgg tggccgacgt ctttcaaagg aggtcggggc tgagttgaga     67440
     cgctgaaaaa tgtgccagcc tagtgatgag atgtgagagc ggtgtagcaa gtgcaatggt     67500
     gtcagaatgt gacgaagcga ttagacgaca agagaataaa cgatggtcga gagtacgctg     67560
     aatgagggaa caaggacgga ttagtggaga ggagagaaag gaaacgacag caagacgatg     67620
     gaggggtgag gaggctagaa aagaggccgt tgataattcg acgtcctgaa tacgtgaagg     67680
     gtatgcggaa gcaatcagcg aaaggtagag atgatgacgg aatgggaacc aatagatgag     67740
     gaacaacgag gaagtggcaa aaggggatcg acgactagca tgtacccttt taaggtggaa     67800
     tggagtgtac cacagaaatg tctcaagcag cagtcgggct tggaacagat gttaatcctc     67860
     ccacttacca aacaaagtga caacaagggc ggcaaatttg ggcctagtga ctgcgtcgag     67920
     acgagcttgt tcgatgaact gcagacatgt aaggaaggcg ctgcactagg gagacccagc     67980
     ttggacggga ctgaagcact ggcggcaatg tcaagcagcg taagagcaag gggcttgagc     68040
     caccaagctc agagagatgg gatagctgac cgtggtatcg agcaaattgc aaagcgacag     68100
     gctaagcggt ggtaagggtg cttgctgctg cgatggcgca ggcgtgcatg agaggggaga     68160
     gagtgtgcaa atcgaggtca aaagacgaga aatgagaggt gcaaggggtc acgtcaatga     68220
     atgtcacatc gtaaagaggg cttctatgca ggagaattgc cttgaccggc agttggcctg     68280
     tcctcattgc tgtataagtc catcatagaa gcttgcctgg tggaaccatt cgggatcgac     68340
     aagtgaaaca atctgacgga gccaacttga accgccccgc caactatcaa aagtaagtgc     68400
     agacgtgcaa cagcagcttc agggatacga gcagcaagtc acaatgaatt ctgcccctat     68460
     agttaagttt ggtcatatcg ctgcggggag gtcaatattt cctgcacacc acgtcagttt     68520
     ccactgtgaa ggcaagggga ccaaggcgac agatacggga ggcagcagag ccaaagcgaa     68580
     agaattgata gggtgtggat gaaaccacgg cagagcggat ggcggctggc tgctggatgc     68640
     tgactactga ctgcgtcgat gcagcatgcc ttcatgcatc gagggacgcg aggggtatgg     68700
     cttggacatc gctgcctcgc caggttgcca gaggaggaac gcgccacgaa aaaaaaattg     68760
     gtttcaagaa atgggactgc aaacaaaaat caaaaatcgt ggacgattcg tgaatcgttc     68820
     tgctcgctta agcgaccgcg gcggcgagaa actcagctcc tcgcgttgtt ggcaattcaa     68880
     cacgattttg agagcaactg tgaaccacgc acgacgaaca atcacaattg tgagcttacg     68940
     acaaagccac aatcacaatg cgccgcttga tgcagatcgc cttgaaggag cagctaaggg     69000
     aagcaatctc ctgtcgcctc caacagagac tgtacgttgt acgttgtaga ggcatccgtc     69060
     caattcctgg acgtggccaa gcaaggcgac aagaaaatcg atcgcattgt caatcgtgtc     69120
     cagttctgat ccagtagcga tagcgataga aacaagcgag gcttggcaga aaccttggcc     69180
     aggccgtacc cgtcggctgt ggagagagag tgactgatca ttctcatgtg tgcgtggctg     69240
     aagtggagca gcagggcgtg atgaagccaa cgatcacgaa ggattgcaga caagagcaga     69300
     aacaaagcat cgccaaacgg agggccacga ggagcagaaa aacgacagat cacaaagcgc     69360
     tcttaacgta tggttaagtt acttgcggct gttgctgcag cttctgcaca tctcaagatc     69420
     cgcattggcg agcctcgtga tgcataatca gggaaccgac ggtggttttt gacccctgcg     69480
     tttcagctcc ctcctcaacg acatgttgag agtatcagac ggatgataga tgtacctcgc     69540
     cggaagtcag agaagatgag acaccgtctg gcttggaaca aatcccgtga gctgtctgca     69600
     aggtagctgc acagctcgac gaatgccgct tcgcctccag tgatcaaacg atcgaggggg     69660
     tggtgacctg cagtctcgcg atcagagtca agtggagctc tgttcgggtc atagtcctct     69720
     tttctacaga tgtgagcacc acttgaatcg acagaaaagg tcgtgtcgat cgatcggggc     69780
     aggtctgaga gaacaggggc ttcaggcgag atagaagaac acgacacgac cccagggtca     69840
     tcatgctatc tggcaataac gaatgggacc cgcggtagat tccgtcgata cgaaggcaga     69900
     aggcagtagg cagccagggg gtaagcggtg gcatgggaac ggctgaaaag caggaaccaa     69960
     ccaacggccg tgagcgacgg taacaacgct cgaaaggcat gtctagcatc catcaaggac     70020
     gacagaccac ggctttggag agctgagcca ctgcgtgact ggttgatctg gagtgcttcg     70080
     tgctttgcct ggttcaatgt cgacaagcaa ggggtcgctg cctaataaat tcaaaaagga     70140
     atttttcgga acgcgaggtg gtgtgtgaga ccaacacttt ttggcgcttc tcgacgcgtt     70200
     ctaatcgtga gtcgtgagtc gtgcaatgcg tgatgatgcg tgaccgatgt caaaagaaag     70260
     acggttgcca caggggcagc gacccttgca tatcggatac aggcatgtac aacagcatcc     70320
     acgattggct ttcttggtcg cctcctcgtc tgaaggacag cgcaaactgg catgatcgca     70380
     cgcagcgctt tgacgagcca catgtgctgt tggcttaatt taccttgacg acaaccagga     70440
     tttgcttgtt cgcttacgta gagctcaaaa tgcataccat tcctcccctg gcttgaccca     70500
     taacattcag acttgtctag agcacgacta ggagatcaaa gtcggcccga agacaagttt     70560
     gccgtcaaga ccactttcgc gcctacgtcg cttgagatta gcgaagcaat catttcgcca     70620
     gacgcttccc gctgcaccat agccccttgc tcagatgagt cgccttcgaa gacatcactc     70680
     gaacgtgccg gcgtgtgctc tggcctgttt cccttttgtc tatccacctg accgtgatgc     70740
     cggtgtcggc gccggcacgc ctcgcatacg tcctgaggtt attgtcgcca cgttcggacc     70800
     atcattgccg aacgagacag ctgcacatca cctcgtcatc gttttcatcc aagcgagacc     70860
     gacaccgggc gcaaatcagc gaaagtgttg gtctccttgg acttggacgc gccgatgaca     70920
     cccaattctt cagacaggct cgcatcaatc accaacctcg ctaacactgc ccttcagcaa     70980
     aagctgcttg acccgacttc gctgaatgca gcagcggctc gcatggtaga ttcgcagcaa     71040
     ccagactgcc gtttgagggc aacactcctc tgcttcgatc ctcgaccgct gtggaacagc     71100
     ttgcctcgac acaaatgttt tgggcagtgg acttaccaaa ttgtacaaca agcgtgaaca     71160
     gagctcttgt caagtggccg acttgtcgga ctgagcgaac aaaaaattac ttcgaaacgt     71220
     tttctgttcg aacgctttag ctttcgatac caccaagcgt tgcgatacga gcagacactc     71280
     tgcgtgagta gagctcagat gtgagcttcg ggacaaggct atctgagttg aggtcgatct     71340
     tggagtcgca cgatccaatg ctagattagg taaaccagct tgcggtcggt cgggctcctg     71400
     attatccggc ttgagattca gcgaaggata taggatacga gagctgaggt gaagagtggt     71460
     acggcgttcg atgatgggaa ggtgatggaa agcaaggggc tggaatcatg aacacctgat     71520
     acggactttg caaatgtttg tgacaagcaa ggagttgtgg ctcgtcgatg cgagggatgg     71580
     ctcgccaacc ttcttccgtc actgcattta ccgaaagtga gtatcgacag cctaaaacga     71640
     acaatcacag aatggatcac gaggttcctc ttcgctttac tcagatttgc atggaaataa     71700
     caaggctcac cagccaccga tagtcgtaga ctcgattggc cgatcgacat gtggtcatcg     71760
     tccttgttct tccaatgcaa aggccggcta tcattctctc gattctggtg tagatggttt     71820
     tgagcgcctt agtcttagtc tttcgaaggg gaagtcagac tgacacagtt ccaggattta     71880
     acgacaaagt cgcctgagac cttcttgcag ggctttccga cggatcgtct aaagccaacc     71940
     tgtcttggcc tctttcgaaa ggctacttgt cactgtcgcg agcaagccta ttcgaactct     72000
     tcttcttctg atcgcggaaa tcactttcgc caaggttgtg agagatggcg ggtgtatgct     72060
     tagaagctgt ggctaaacag tgtatctcac cagaagagtt tcgcgatttg cacgagtgcc     72120
     ttcgattgcc gattctgaca ggccgtaaaa tgactacaca ttcctcgctc cagcagatct     72180
     cagacaattt tgtctcgcca acaatcacaa cctcattcac catttctgcc atgagggtat     72240
     acgcttggca agcgagcctt attttctgaa tctagcgtct tatgctatcg acgatgttac     72300
     tcgcatggat tagcggtcca gcggtccagc ggtccagcgg tccagtcgga tggatccatc     72360
     atggtcatta taacagagaa ggtgacttcc gatgaagctg tctcacaaac tggcctcgcc     72420
     gcagtcttgt tcatcgtaat catggaagtc cacgtctcag atgcaaagcc ggctggaggg     72480
     ggcttcgatc ggaatacgca ttgtggagcg tttcggcggc tcggccgctt ctgttcagct     72540
     ttgcactgct tatatgacag tagtcattgg aacgctttga tggcgtgaca gcgtgagtgt     72600
     cttgccactt tgaatgccga attagcgtga gaagcccttg ccacgcgggc atctcctatg     72660
     ccatctgcca tggcaatgtc tcttgcagtg ccgttggtct cgaagactag tggatgaact     72720
     gccggtaagg cagtggacca cagtcaagtg tctgcctttc caaagcagcg aggaagtcaa     72780
     gtggtgcctt ttttgtccca caatttcaca acccttttgc aatatcaatc gtgaatcttg     72840
     ctcaggcctg tctaaaactt gtcttatgct gctccggcta tactgcagcg ctctaccgac     72900
     cgcaatcatg aatacgtgct ttgttcatgc taccgatatg tgcacataat gccttcttgc     72960
     acaacgagca gctgctgcca tactgttaca cagtagtacg ctgtgatggt catacgatct     73020
     tgagcgcgta tcaccgatgc tacattcaca ctacccgatt tcactcgaat tctgcatgct     73080
     gcaattgtga atgcttgtcc atctggaccc tgaatcttcg aggcagccag cttcacgctt     73140
     ctctccgcga agccgacatc catacatcat cggcgtgagc ctcactctgc agcaacgcgc     73200
     tcaaggatgt cgtacctccc gcctatcaat acgctgtggg accacgcatc tcatccatcg     73260
     aaacgagcat ggtctcgatc gccttcgccc gagccagcgc atcacgatac cgtccataca     73320
     caagcaggcc ctagcacgca gcttactccc ctaaggcaag ctgccattca gcgtcgactc     73380
     gtccgacaat caacacgagg cgatcatcta ccaatgcgaa cgaggagcgc cgaacaagca     73440
     cgcctgctcc gtgccttgaa aggctatccg cccatcggaa gttcagccga tgcagatcaa     73500
     ctgagcgacc tcgaagaatc gattgaagtg ggaaggttcc aaatggtgcg cttcggagaa     73560
     cggtatatcg ttcagattgg ccgacgacgg acgatgcgcg aagaggagct ctcgaacgaa     73620
     gaggacgacg gaagaagagc tggcttctcc gctgtagatg ccggactttc gttcgcacca     73680
     gagggtggag tgttgccagc gatgcaagac gcgtcgctgc agacgaatgg aggtgacaac     73740
     gagggtataa caggtccagg tctctttgtt gggggtcata cgggtcatgc acaggcagaa     73800
     ttcaaccaga gacggattgc agaagcggaa cgaagggcta gagatgctga agcgggggcg     73860
     aatagagccg ctgctgccgc cgaagctgca cgcagccagg ccgaaagaca agctgcattt     73920
     caagaggagc aagatgcagt ggatctggac gcagatgtcg aggatctcga cgagggtgac     73980
     gacgaggtcg attttgatta gcgcacaaaa gtcttttgca gaagttttac actgttcgtc     74040
     gcaacagaag caccttgctt gtcttcagct tccaaagatc ccacgttctg tccttaacgc     74100
     cgtcatctct cgattctgat ctatgctgag cgtgaggcca ttagatcctt tctataattg     74160
     catcacgccg tgtgtatcta cgtgagtatg ttgatttggt cttggtggtg ttcctgtctt     74220
     ataggcaaac acgaaagtgt ggagaaggaa gacgcgactc aaggctgact cgggcgagaa     74280
     agagcgtctg cgcaggaaat ggtcgtgtcg gcaggtggat cggcgaaagg acgcacagac     74340
     cgaccgtcaa cgagcgaata tggctgtgtg tcaacttgga aatcggtcag cacaaaatat     74400
     gtatcaattc agcaaagcca tccacagtca actactccac acgcgctctc actacaccaa     74460
     cgatcatcca actttggcca ccctacacac tccttcttgg aaacacatac ttaaccagat     74520
     cgtaaacgca gcagctgtac ccaaaatcac tgtcactgcc aacgaaggca aggtcacagc     74580
     aggaaaacgc tcgatcgacc gtcgacgttc gaccacaaag gcgtgcaacc agaagaacag     74640
     catcttgacc ccctatttgc tggttcgaaa gcattctttc ggctacttga tagcgcatag     74700
     ctcattccct gtgtcggatc tttcgatcga atctcgttct tcgtcaacat gatcttgctc     74760
     ggcacggaaa acatcatcat ccgcgatgtc ttgacagaaa agttcgacaa gtaagttgca     74820
     taacgctgac ccaaatactg gttggtacgg gatcgtcaac aatactggcg caagcaatcg     74880
     ctgacacccg cttccgacat ataccttgct tccgctgtac gtgacagacc cgcctcggtc     74940
     gaccagactt tcacagactt tgacggtgta gcataccatc ttgagtcaac cagcaaggca     75000
     gggccactca cgctttcgat ggacattcga tgttggtccg aacttgtaca ggctggtgca     75060
     atggaagtgc tcaagcgcga atacaactca tggattcgag acgcagtgga gccggagtac     75120
     agtgtaacgc tcgaattcga ctatgccaaa gtgccagctg cgggaccgga acgtgatgcg     75180
     ctcatcgcca gcgtctcgct actcaagcgc aatgctatgg cagcaccttt tgagcgagca     75240
     tttgcgatgc agaagcagct tgaacaggag gcggaaagca atgtgcctag cacgggcact     75300
     gaaatcatgc ccatcaacta ccgtgatgac gaggcgatct acgtgatccc gtctgcggat     75360
     cgtgtcacag tggtattcac cacgacgttc aaggaggaga cggacaaggt acttggcaaa     75420
     gtgttcttgc aagagttcgt ggacgcacgt cgacaaccct cgatccagaa tgcaccacag     75480
     gtattgtact cgaatcgcga acctccgctt gaggtgcgta atgtagccgg cctcaacaag     75540
     ggcgacgatg tgggctatgt tacctttgtg ctgttcccaa gacactttag caacgctgag     75600
     gtgatggcga gcaccatctc gcgtatccag ctcttccgcg actatctaca ctaccacatc     75660
     aaatgttcca aggcctacat gcacagcagg atgcgtcatc gcgtcgccga gtttctcaaa     75720
     gtgctcaatc gcgccaagcc cgagctggcc gagaaggaga ggaagacggc cagtggtagg     75780
     acgtttcgtc gcgcgtaaac acgatgcacg cattatttag acgactagcg tcgatggcga     75840
     acaataatcc attcacctcg agacaccttg gaatcatccg atcgttcagt gtgttaggac     75900
     cgctgtgagt tactgcgcag cgagtgcttg tatgtttgtg agtagctggt gtctagacga     75960
     tgcaaatact ttcgccaggc gccaattgtt tcaagacgca atgcagcctt tttacagtgg     76020
     gcgctcgaag ccgcgacaca agctgggtag cctgatccaa agagaagtgc tcccttctga     76080
     gaagatgtcc aaccaggcct tctgcttgct tatgctcgtc gtgggtagcc agtatgagat     76140
     gcggcttgaa cgctgggatc agttgtaaga tgttgggcaa gccacacgag actacaccga     76200
     tcaaaggtag ggtttgacgg tcgaagctgt ggatgagaat gcgtttggca tcctcgtcgt     76260
     tttgtctgac acttgcggta agtgaggtag gtgtgattcc atggggcgag tatacgattt     76320
     ggacgggtcg ggctgtattt tgacacctaa tcagaatcgc accgtgcagt tttgaccaag     76380
     ccggactcaa tgcccaatcc ttagccggca gatgctgtac tgatatcccc tggggcagga     76440
     ctcgattctg atctgtatcg tgcccaaaat caaccgaaca gagattgaca accttttcat     76500
     ggtccacagc gactttgagc catctcaacg cggcagacga atctgtggtc gtaaacaccg     76560
     taactcgtcg cagcacagcc aatgaagcat gatcggcgag agtctgggga tgaatgtgat     76620
     cggtgaaaga atggctgaag aggatcgcat ctactcgttc ctcaccttgg cttcgatctc     76680
     gaagccattc atcgagggct cctatcgatg caaaggctgc aggctcggta cgtgtctgac     76740
     gagaaaagag cggcgaaccg tcagtctgcg gcgtcggatg cagccatgga tcgaggatca     76800
     cgttgtagaa cgtagcggta gcatccacgc ttgacaaaca gggcagacga aacagccacg     76860
     acgtgtcacc gttgagtttg tgcaattcaa ccgctgccat ctcgaagagc tgcgccatgc     76920
     gatatgtcat tgagtgccat actgtagcat ctccattatt gaattcgcgt tttcagatgt     76980
     accagagaca gagcgggagc aagcggcggc gatgggagta tgacagtcgc agcgatgacc     77040
     cgaaggcgac agaccacgta cgaatatcga cgtgggacgt gcgtggtgga acgtgcggaa     77100
     cacgccacgt gtgccggcaa atgcactgtt aaatcataac tacacttgtg actcactcat     77160
     gactcgtgac ttgtggcagc tgcacacgcc gagtcgtgca cggtgagtcg tgagttgtgc     77220
     acagacgcca tgttcacggt tcggtgtgga ggccaagctg tactcaacag taaaagacgc     77280
     aagaatcacg agagtgccgc cacactcgtg actgagctga gcctagcatt cacgattggg     77340
     cgcgtgactc ggcttcactc aactgagtcg cctttctcac attcctgtcc gaccacttgg     77400
     ctggcttcgc ctcgcctcgc ctcgccgcgc cccaacacca ccatcacctt gcacctcttc     77460
     atagttggtc aacagcaagg caacggccct tggatcctcg attgcgcgga ccgttacaag     77520
     aacaatactt ctcgtgaccc gatacaccac gctcagacac cctagttgat gatgtcgaac     77580
     ctattgcaaa gcgtgctcag ctcgcggctg gccaacgcaa cccttggagg cggttccaac     77640
     gattcttctg ccgacagtcc acctcaatcc aaggaaggct tgaacgactg ggagcaggtg     77700
     gataccgacg acgagcttgt caacgtggga tcggcgccag ccacagctgc aggtacacca     77760
     ctcgaacgca gtcggccagc gtctccaaca cgtgcccact catcgtctcg cctaggtgta     77820
     gagacggaca cgaccgattt cgaaagcgac gtcgacagta acactggatc gtcatccaag     77880
     cagctgagcg ccagcaaact gcgcaccacc actagccaca ccaaaaagcg atgctccaag     77940
     gcgagcaaaa ccgaccctct gcgtgcgttc acgagcgaaa tcgctcagca cattttcctc     78000
     caactgcccg tggaatcgct cctggcctgc tctggcgtct gcaaacgctg gcgtcgatct     78060
     gctacgctca attacagctg gtatcgccac taccaacaca gttttgccgc cagttcactc     78120
     gactctgccc tacccgccct tcccgcctgg ggaagcggag gagcgaaatg gacgcgtcgc     78180
     gaaagcaaaa ccgactggaa gacacagtat ggccgtcaga aacgcatgga ggccaaagat     78240
     gcagcgaggg cagaatcctt gcctggctca ggcacagcga cgccctcgag aacgcagagg     78300
     atgcaggatg ctggcataca gaccacgcac gaggcgagga tgcaacagtg gaaagaagag     78360
     tcggatgcgc aatggacaaa acaggaaatg cgcgattact acaaatccgg cgccaagggc     78420
     ggcaagttta agggcaagag ggaaaaaggc ggtgtcaaga cgggcgctgc tggagatggc     78480
     gggttgtggg agtagcatgc atcttcttgt tttcgctcgg ttcgttggac gtcatgtcgg     78540
     atgtcctttt ttcatccacg tttcatctta ccctcatcat tttattcgca atgctgttta     78600
     ttcttccatg cagtgtctat cgtagtcagc ccgatcgaca gagtgttgcg tttgtgtgcg     78660
     ttctgcacgt atcatcagag gatggcagga tgacgagcaa tctaatacac acgcttgtcc     78720
     tggtccatct cgtcgtctgc atttgggcct cccaggctga cgtcgtccat ctcgccatcg     78780
     gcgtcggcgt cggcgtctcc gtcttcgtct gtttcgccga gggtttgtat gtgggtatgt     78840
     gcgccttctg ggctggtggc agatgctgct ggctcgtccg acgtgagctg ttcttgcgac     78900
     tcgctcgaag tgataatcac ttgaggaggc ggtgggacgg tggtggcgga agatggtagt     78960
     tggacatcgg catcttcgga cggtgctgag gtggtaatga tcggtgtgga tgaagacggc     79020
     tgtgaatcag tcaggctgag acctagcgct gaaccagaca cctcgggcgc ggctgcggcc     79080
     gagtcggcag cttgctcggt gggtggcgag acgtcctctg cagcaggcgg tgctggctgc     79140
     gttgcgactc ggtcatctac cacctttggt gtagccgcat ccttctcgag aggaggagga     79200
     ggtggggaca cattagcggt ggtgttggct gcagactcgg ctgcattttg ggttggtgca     79260
     gtcgttgacg ctgatgtgga tgcggatgtg gatgtaactt gcttgcccag cacctggtca     79320
     atgctctgcc tgattgtgct ggcgttgggt ggatcttggt caaggtagaa agccgaaatg     79380
     ccgaccatct ttttctgatc gtgacatgca aagatccaat gcggcagcac agctgggatg     79440
     ctcaactgca ttgccttgct atacccttgg ccttgcgagc cctgtggcgc gttgacatct     79500
     cccggactcc ttggatcggt gcagacgtag tgcgttgttt caatctggat gcggtcgtgc     79560
     cattttgcct tcatactggt gagcgccttc ttagctgctt gcagcatctc ggcatcgtgt     79620
     acatgaccga agcagacgct gattccggag gtgtcgttga tcgtgtgagt gcgtgtcttg     79680
     atcacgggcg acgagaaggt accggcagtg gtcttgagta cgagatggaa agtgtactct     79740
     gcattaacat ccagaccgga caacttggta gatgtgttgt gaagcggatt cggaataggt     79800
     gccagcctct gaccgtttcg atagatgtcg agtgacagca acgtggcagt cgccagcgtc     79860
     aggcgatccc attccagtgt tacagaagtt tgggtcacat ttcggagcct gagcgctggt     79920
     ggcttgggcg attgttgacc gaaagtgtgg agaatatcct cttgtagttg atcgaactcg     79980
     tctttctggc gtcgttcctg ctggtcattt cgcagtacac ggatgttgac gacgctaccc     80040
     gaagacacac ctggtgggag gaggagagag gggaactcga tcagggaagc cttgtcaccg     80100
     atgaggatgg ccatgccagc atcaagcttg ccgacggtaa aggtgaaaga atcatccgaa     80160
     ctgttggact gcatcgtgga atggatgtag ttaggtgcga tctgtcccac gtagtgagcc     80220
     gacatgccgt ttcaatagtt gaaaggagag gagaggagag gatcaggaga gcgagaaaag     80280
     gctgcaatca ggacgagaga agaatcgagt ctgagcgcag tttaggaggg tggaatcgcc     80340
     aacccaacac cacacacgac ttggccatgt gcacgttggc ccacgcgctt cttctgtcgc     80400
     cgatcagccc gatccaacca caaatacacg tgactcttgg tccacgatcc gcccgcattc     80460
     ccgatatttt ggctatgccc agacgcgcga tgtgccgaaa tgaagaaatc acgattatta     80520
     atttgtgatt gacaggatcg gctgtgcttc tttttggcgg atccgaaata ccaaacggga     80580
     ctccgctttg gtggttcatc catcttttct tccacctccc ttcctccact ctgtcgtgtg     80640
     acgcttcacc aacgggcagg aatgatcaca ttcatcccgc tctcggtacc ctacgccact     80700
     gcggcctcag cggccgcgga ggtggaggga tctgaaaaga gcgtgcgaac caagctcgca     80760
     tcggattcag catcctccga ggaacaagag catccacgcg cactcgccta cctgctgcag     80820
     atggacgatg tccgagtgct catcgactgc gggtccaccg aggactttct tttccatggt     80880
     acgtcgtcgc agtcagacga tagtgcagac gctgaggcgg aatcacagcc gcaacctgaa     80940
     tcttcttcta tggctcagca aagacaagct tccgacctcg acatcaacca tctcaaagcg     81000
     gctcctctcg acacactcct tcgacagcta gcatccacaa ttgatcttgt tctgctctcg     81060
     cattcttcgc tcgaccactt gggcctctat gcctacgctc atgccaactt gggtctgcgg     81120
     tgtcaggtgt acgctaccat gccggtgcag agcatgggca agctcaccgt gctcgaagcc     81180
     atacaaacgt ggaggagcga ggtcgatatc gaaaaggaat gcacgtctgc atcgacacgt     81240
     cgctgcctcg ctacgcccga ccaagtggaa gacgcattcg aagagatcaa gacggtgcga     81300
     tacatgcaac ccacccatct cgagggcaag tgtgccagtc ttacgctcac agcctacaac     81360
     gcagggcact cgctcggcgg tgctgtgtgg aaaatccgca gtcctacctc gggcaccgtc     81420
     gtcattgcgc tcgactggaa ccacaatcgt gagcgtcatc tcgacggcac gatcctgctc     81480
     tcgtcttctg cagctgcgcc tggcgcgcct ggatccggag caagcgcttc ggacgctgtg     81540
     cgacgtccag atcttctcat caccgagatc gagcgtgggc tggtcgtaaa tacgcgtcgt     81600
     aaagaccgag acgcagctct gatcgatcta gtccacacca ccattcaagc gggtaattcg     81660
     cttctgttcc ccgtcgacgc ctcggcacgt ctgctcgaac tcatggtgct gctcgatcag     81720
     cattgggctt atgcttatcc tcacgctcgt ttcccgctct gcctgatcag ccgtacgggt     81780
     aaagaggtga tcgaacggtc tcgcacctac atggaatgga tgacgcgcga atgggcgacc     81840
     aaagccaacg agacgattga ggcagacaaa gatacgttgc cagccaaaat gcagcaacgc     81900
     aacgctcgcg gcggcggtct tcgcccagct gctgcttctt cgcccctcga cttcaagtac     81960
     gtcaaagtgt ttcctacttt gcaagcaatg gacgaagcca taccgcaaga tcaagccaaa     82020
     gtcgttctcg ccgttccacc gtccatgact catggtcctt cacggaagct tttggcgcgc     82080
     ttcgctcaaa atcccaacga cgtcgtggtg ctcatctcac gcggcgaacc cggttcgctc     82140
     tgtcgtgagc tgtgggatgc gtggaacacg aaccagtcga aaggattttc ctggtcacag     82200
     ggcaaactcg gacaagccgt cgtagcgagc aacacgtcgc ttcggtttga gctgaaaagt     82260
     aaagttccgt tggaaggcga cgagctgcgt gcgcatcgag aggcagaaca agcggaacgc     82320
     gagcgtctgg cgcaacagag agcgttgcta gcgcgatcga gaagacggtt ggaggcggac     82380
     gaggatgatt cttccgattc ggattccgag ggaggcgaag aaggtgaaaa cgaaactgtc     82440
     tacgacgtgg ccggcggtgc ggatgaacca ggcggagcga tgattcgcaa acgtccgtac     82500
     ggggtagcct tcgacgaagc aaccaatcct ggtggagcat tgtctggtgg agcaggcgca     82560
     agtggcgaca cgaaccagct ctcattcgac atctacctca aaggcaatgc gagtcgcgcc     82620
     acttcattct ttggctcaaa agcaggacaa gaagggccgt ttggtctggg cgtgcgctac     82680
     cgtttattcc cggctatcga acgcaaacgg cgtgtggatg ggtttggcga ggtgatcgat     82740
     gtgacacgct ggctttcgag gcgtcgtgcg ctcgaagctg ccgaatccgc agctgctgat     82800
     cctctctcgg aatcggcaac gctcaccgcc gaagccaaac gcaaacagct tgctgctcag     82860
     gaagaagcac gtgcggctgc ggttccttgc aagttcatca cgcaactcgt ctcggtacag     82920
     ctcaactgca aggtcgcctt tatcgaaatg tgcggcttga acgacggacg cgcgttgaaa     82980
     acgctgatcc cgcaactgca cccacgccgg ctgatcatgg tcaatggtga tcgcgagacc     83040
     aacgccgaca tgctcgatgt gctggatgcg atcaagtcgc tcactcgcga catttcggca     83100
     ccacgttggt tagagagtgt gcagattggt caggtgacga attcgtacac ggtacagttg     83160
     ggtgagggac tgttgtcaag gttggaattg agcaggtttg aggagtttga agtggcacat     83220
     gtgcgcgcgt tggttcgaag ggggatgggt gatgcagaga tgggtggcgt ggcgatgttg     83280
     gagaccgaag aggatgtggc tgctgcgacc gcagctgcgg ccgagcaagc agagcgagag     83340
     gatacggcca agcaaaatgt gctggatgag ttggctttgt ctgggattat gagaagcgtt     83400
     gcttcgcaga ccatccgagc ttcgcgcttc ggtgcttcga gtagcgtcga ttgcgcgcac     83460
     tcaccagtgc agggaacgct gttcatcgga gacctcaagc tgtcaacgct caaagcgctc     83520
     ctctcgtctt cgccgtaccg tttacctgcc gactttgccg gtgaaggtat gcttgtctgt     83580
     gctccagcca ccatgaccgc tccagacgct gtcagcgtgt ccaaaagggg caaaggcagg     83640
     attgtcatag agggcaacgt caccagaaac ttcacatcgg tcagaaacgc tgtttatggc     83700
     ttgcacgctc gcgtcgccgg tggcgtctcg cttgcgcacc aaacgcatga gcagcactga     83760
     tcatcgcact gcgtcaaggc tcggggctca aacatcctgt tatcactcac aatcacgaat     83820
     gcatgcaatc tggcacctcg atcgtgaatc gctcttaaac gggatgcgac gctccgatgc     83880
     gcgtgtggaa ttgcgcgcga tccgcgagcc ccggtagcgg tgaatgagag ttggcacgct     83940
     tctcagtgac acatggacag gtgtgcgcaa gtgcgtggaa cgtggcacac gatggtcaag     84000
     caagtgcaca tgcggttgtg gtacacataa tgcggacacg tggtgtaaaa acgtagccac     84060
     atgcataccg gcgttaaggg ggatacaagg cgtcgtgagg tgaaggtcgg acgagtcaag     84120
     cgaggttgtt gtggacggta gcggggccaa ggttggctgc ggccttttga ttctgtgtgg     84180
     gcatttttgt tcgagccgca gtcaaggcgg gtttggaagg gtcgatgttg acgagggctt     84240
     ggatttcggc ttcggctggt ggagccactt ggctgacgaa cgagaactcg gaagcagcca     84300
     tagtctcgag gacaccaacc acatttccgt acgtgtcctt gaagacctgt ttggtgtcgt     84360
     ctgaatcttg acctatattg gcggattcgt actgcaagta cttgagcagc atgtagaagc     84420
     ccgatgtgac gatcgccgcc gagtacggag cgatccagta gatccagtcg tattgttgaa     84480
     atgtggcgag caccgtattc ggtcccagcg tacgcgcagg gttgagcgag cctccggtgt     84540
     agttggtgcc agccaattcg gccaagaaga gagcaaggcc gatgccgaca ggcgcaagga     84600
     acgtgcctcg gtgcttctcg gcggcaagca agaagatcgc caggatcagc tggctcgtca     84660
     agaaaaattc aaacaagaat ccttgcacga cgctcgtacc gttggccagc gtagttcgcg     84720
     cgttgagacg gccaggtagc aggccgtcag caagcgcagc agcggcgata ccaccagcga     84780
     attgggcgat ggtcaagtga accagctgga gctttcccaa agttcccgtc aaaaacaacg     84840
     ccagggtaac cgccggattg aagaggccac cagaaacacg gtagaacgtc caagcgttga     84900
     ccgcgaggga gaagccgaag ccgagcgagg aaaacaacaa cgccgacgtg tccaccggtg     84960
     cgttctgcgc gagcgacgta gcctcactat ctctctgcgt ggcagcttga gcgttggatg     85020
     cctggctggc aatgatgaac gagaacaaga ggaacaaaac cgtaccgata aactcggaga     85080
     cgaacgcaat cacattattt ttgagcacga gccgacgtcg aagtgcagcg cggtagtgat     85140
     gtcgatgttt gtgctcggtt tggtcgacct gcatgaacga tggcagctgc tcttcgatca     85200
     tgctgctctc gcgccgttcg agcatagtgg gctgctcctg cgtgcggtcg ccgagcgaaa     85260
     acatggatgg ctgtgctacc atctcacgca cattgctatc tccgcttggc accggagcgc     85320
     cagtgcgagc cagtgcgaga cccgactggt gctcttcgcg cttgcgtgcg ccatgaacta     85380
     aagtagtgtc tgtgcaaccg cgatcagctt gacacatgtg cgtcggttgc ttgcctccta     85440
     cattgtagac gccgctgcca gcagcaggag gcttgggatt cgctgtgaat gtcagccgtt     85500
     gcaaataggt gaaagatcga tcatcagtct tgagacctgt accgcgttgc ccgccactcc     85560
     aatgaactct ctctgccact cgcgaatgca gaagcgtact cactcatgtt ggtggtgcga     85620
     gaaagctgct gtggcttttg gatggtggtc attttgaggt tgatcctgga gctatcctga     85680
     ggatgctttg tgggaatatg ttgggctgtg cttgcaatcc aacgatgatg ggggccagcg     85740
     cgagaggcgt gcgctttgcg atacgttgag cacggagcgt cttgagcgct gctctcaagg     85800
     gagggtcaaa gggtcgaggt gacttggagg tagggagaga tcgagtggtt agaagccagc     85860
     aagtcgtcga agctctcaca ttcagaagga cggatgaaag gcggaattct cagtcgagac     85920
     gttgacctac gatctggcaa ccagccaagc tcatggatca gtaagtgacg acagactttt     85980
     gctgcttccg accggcttga atttgctgtt cctcttgctc gctcgattca gcacgtagag     86040
     agactgacga gatggctatt catgattgcc agggaccttg aggcatcaca gattcgacca     86100
     catcctcgct tgttgcagca tagccgacat ggcccagttt gatcgctact tgtgcgcggt     86160
     tgttttcgat gccggttcag aagctggaca gacacaccca agacatgaat cgccaagcta     86220
     catatggtgg tacgctacac acacggcgca aggcctgctc gaggcgttat catctggaat     86280
     cggcacaagc caaccaagaa cgagcatcaa gatgagcgtg ccacccaaga ttacctcacc     86340
     cgccaaacga ggtgcgtgtt gacagccatg ctaatgtgtt caaacacgaa agagaagcga     86400
     tcacgcattc tcttgcatct ttcacgaatc gtgaatcacg aatgttgctc gatcagtcaa     86460
     tgcttcgcaa acaagactca ggccgagtgc ggagtactca acgttttttg ggattgtgtc     86520
     ttcccattga tcaacatcat acccaactgc ttgtgctttt cctcggcgct tcgtgctgga     86580
     tatcagctgc tctccaaatc tcgaatgtgg ctccaactca cagacagatt ccgcacaccc     86640
     aaacaccgca cgccgtagtc ggctgcgagt tacgtcactc gtgacttttt tgttgttgat     86700
     tcgtgattgt ttgacagctg catcgtgcat gcactctgca ctcaccactc acgcttcgac     86760
     ccagaacagc cgcgcgatgc tatttttagg cctctctgaa acaagcaagc cgctagacga     86820
     tccgtccaaa catgtcttcg cattcacaaa tccgcgtgcg ccaaggccaa gcaatcatct     86880
     gctgacacac gcctcgtgag gccacgcgta tcgctctgcc acaccaaccc acggcgacca     86940
     attgagtgcg ctttacaaga tagagtcaat ggtggaaagg ttacatgtgg caaactgaga     87000
     ctctcgagat catttctgtc ccgcgccagc aagcagatcc ctgccctcgg cagcatcttg     87060
     ccagctgcct tcaccggctg agccggctcc agatccgccc gagggacttt cgtcttcatc     87120
     ctcgatgtcg acaatggctg cagttgcggc tccactattc tgctgagtgt caggaccagt     87180
     gcgtgcggcg tctacgtcgt cgtcttcctc ggcgtcatcg tcgtgtaagg caaatctgcg     87240
     atcgccatca tcatcatcat ccaggtcgtc acggtatggc tcgtccgtgc gtccacgacc     87300
     aagcaaaccg cgaccggcag aagcttctgc ggcctgatcc tcgtcgtcgt cggaaccctc     87360
     agcaaacgca tcatacagct cctttgtcct gcgcgacttc tcaccgcgtc gcgatccgcg     87420
     tccgtcatca tccaaatcgc ccatagccac ctcttcgtcg ttggccagcg actcgtaacc     87480
     accatcacca ctgccgcctc gtcctcctcc accactgcca ccgcgacgca tcttgcgttt     87540
     cctcatcaca aagaacgccg cgagtgatcc ggcaaagatg atcaccaacc cgccagctac     87600
     aatcacccaa ctgctgtttt tcttgagtcc tgaaatgtag ccggtatccg cttcgggctg     87660
     caccgcgatc ggaacgctgc cgttgtggtt ggtaaaatcg acgtgagact ctccttcggc     87720
     gatgccatgg ttagacggaa gatgatcggt aggcttcttg agttttgctg aagatgtgta     87780
     gctgggaggt agcttgatga tcgttgtctc gggtgcggcg ggcagctttt cgtggtactc     87840
     gatcgagtct tcggggaagt tccacggcac cgctttggac ggatcgatgg attctcccca     87900
     cagtgacatg ctccatgcgt aaatgttgcc tactctgttg ggatgcgctg gatcgaacac     87960
     acgaagcttc cactcgccag tgggcgactc accccagtgc ttgagcgtca tgaaggacca     88020
     accagggaaa cctgtcgtcg cgtcatcgta gcgtctcgac ctcgccaaag ccgacttggt     88080
     gccatgcgga gagatgagct cgacgttgac atcacctcga cgctggtggg tgatccagac     88140
     acgaaccgtg acgtgctcaa cggaggccag attggctccc ttgaggtggt cttcggtgac     88200
     ggtgtacgtg gattcggtgc cagactgtgt gatgagcgtc tctgttgccg gtagcgtaat     88260
     gttgggcgac tcgtaccaag cttgcggatt gacaagcttg tgacgcttgg cttcttgaac     88320
     aaactggtaa gcgtcgagga gaccgtaacc gtacttgtgg ttgaaatgat gacctgcttg     88380
     cgtctgttgc caatcaggat cttctgggtt gaacttgacg gcgctgcgca cagcaatgtg     88440
     ctgcacatcg cgccacgtca gctcgggtcg gacgctgaga ccaagtgcga tgacaccggc     88500
     tgccaaagga gcagcagcgc tggtacctcc gtgcgaaccg gtgcatcgat tgacgccgtt     88560
     ccaggcgaca tcggtagtat gaatatgatc accacttccg gagctccagc tggtagcgat     88620
     gatggccgag cacatctccg agtaccacgg gtgttgcccc tcgcggtcga cggcagcaat     88680
     ggtcatggaa tagatcgagt tggtgtagcc atcaaagtta cactgatcat ccgaggcgcc     88740
     tccgtttccg ccggcaaaga caaagacgct acccttgccg tctcgtccgt tttgcacacc     88800
     attgagcatc gccttggcaa tgagaccttt gggcgcgtcc atgctgcgac cgtcgtcggg     88860
     tggtccccaa ctgcagctat aaatgtcgtt ttcctgatag gcatagttga gcgacgcagc     88920
     ttcgtcgacg tccgagatgg gccctgaaag gatacgaacg ccagagactt tggcctcata     88980
     cgcgacaccg acaccgcaaa catcgttctt gacggcagcg atctcaccag cacatcgtgt     89040
     gccgtgctga tcgtcactct ctcgcggctc ggggagctct gtgtgcgagt tgaagtcgta     89100
     actgcccggt gcgtagaagt tgtccctaag gtcggggctg tgcatatcga ggccatcatc     89160
     gatgaggcac actttgatgc ctttacctag aatgccctgt tcccaaattg cggtcacatt     89220
     gaggtcgttg cccgtcttgc gatcgttggc aagatgccac tgatcggtga agatgggatc     89280
     cttgatatcg aacttggaca tcagatcggc cgtcttggca gtcgggatca tgggtggtcg     89340
     aggtgaggga tccgccgatc tcagacgaaa aggccagccg tcgactgctg gtagtggatc     89400
     acgaagttcg gggtatagat gtggcatctc tgatggatca tagatgacgt tgcgcttatg     89460
     acgccgcctg acctcttgac gctcaacagc ttttattgac agtgcagcag tgtgctgacg     89520
     ctttgagagg ttgtacgttg tgataaatcc gggctctcgg gctgagcgac gaatacgaga     89580
     ccaacgctgt aagacggggt cctgcgactc ggggacatcg ggtcgtgcga gtgaagccga     89640
     agccgatgcc gatgacgagg ttccggcgcc gccacgcttt gctcgtgtgt cgctgagctc     89700
     tgggaagggc ttctctgatc gcacgagcca gtggttttgc aattcacctg ctctttcgac     89760
     aaattcggca cccagcgcct ctgcaattgc gcgcgggtct ggctgctcgc ctgagcgagc     89820
     gtgcacctcg attacatagt agtgatgagt atcgtacgac cgttttgcgg gcaaggggac     89880
     ggagcgcttc tgatgcgacc atggatggag tgttgagcgc ttgtgctgct gtgtgacgcg     89940
     ttgtggtgct ccttcatccg agcaggtcgt agcagcaagg gagctgttcg cgtaagcatt     90000
     aggctgcgca gccgacactg tgagaaaggt gccgagaagg agcaagaggg agctggatag     90060
     cttgatggct ttcatggttg gcgaaaacga aaggagcctg tagagcagaa gcgacaacct     90120
     ggcaagcgtt cctctcgacg attatgtaga ctgagagggc gagatgagtt actcgactgc     90180
     acgagacaga tctgagcgct accgcgttgg tctgaagcaa tgtcgatcga tgccaaagtg     90240
     gccgaaatag cttgaagatg aagagctatc acgatctgtg cgacatgagc gagcaccaat     90300
     gaaggaggga ggtggcgttc gtctggaaat gaaccccttg atggccgaga gacggaggga     90360
     gctgtcgaga tggacaggtc gtagattgag ttgaaggatg agaagaacaa gacgatctaa     90420
     tcgtgtgcga ggaaccacaa agtgagcaat cacgaatcaa tcgagagact cagagtcgtg     90480
     agtctcaaga cttgtgacac gctttgaggt ggcctgtgtg gcgtgtggtg tgagctgagc     90540
     tggaaattca gggttcgccg cgtacgtttc tttctatctt ttggctggcg tgaagcacag     90600
     tcgtgagtag aatatctgag ggaaacccaa aaaattgcca actcgtgact tgtgagtggt     90660
     gacagtcacg agttgtgtgt gtggtcgagt gtgtcctgtg tgtgatacaa ttcgtgattg     90720
     tgaattgtga attcgaatcc gagctggcag ttgagcggca aagctaggtt ttaagcgcct     90780
     cacgagaagc aagaaccccc ttgcgattct tctgcagcca gccagctgtc caatcgtgaa     90840
     tctgctcgaa ttgctcacaa aagcagtcac gagttggcac atcgcctcgc ctcgcctcgc     90900
     ggtatggttg tttcaatcac gctgatctgt cagggcgttg ctttaacttg tgattcgaac     90960
     actgtgactg ttgctgcggt tgtctgcaag ggttttgcgc atcgtctgtc cagtgctttc     91020
     gacttgcttt gctcctctcg atcgttcatc acacacattc gtgattcgtg attcgtgatt     91080
     cgtgattcgt gattcgtgat tcgtgattcg tgattcgtga ttcgcgattc gcgattcgat     91140
     ttgagaaggc tacgttcgat gagagcgaat ctatcgatcc cgcccgatct tctgtactgt     91200
     ctcagccccg atgccacgct caatttcccc tagcgagctg ctcctatcat gtgtctacac     91260
     agagtcaagc gtcaatatga caatgaagga tacagagcaa aaagtccatg catagtattg     91320
     cgattgagac agatggagaa aggccgcgaa agcgaaacgt cggtgtcaac acactcacag     91380
     agcatcgtgc tcactcgcaa gcgagcgctt gtcctcgtcg ttcgacagcg gcgcatagcg     91440
     tcggatcaaa ccatcagctg ccgcagcgac cagatcaatg gcattcacct cgcgctgcca     91500
     cgtagccatg tcgattacat ccctcttggc aagctgtctg cgagccaagc cagctgctac     91560
     actttgatcc gcctcggcgc catccgaaat ggcacgacga cttccaccca caccaagtgc     91620
     gttgcccaat acgctaccca atccgctcag tatattttgc aagttgactc cggacagtgg     91680
     gcacgggaac gaaacattgc ggttaaagtt gacgggcacc gtgatgctga gcacttcaac     91740
     atccacctcg atcttgaaca ggaagctcaa atcacccgag ccgatactcg atccaccagt     91800
     caaatcgagt ctgcagtccg aggcaatgtt tcgaatcagg ctgccattcg gatcctcgct     91860
     ttggttgtac ttgatctgga atggaaactc gaccgtcgtg ttggcgttgg ctcggattgc     91920
     ctggtcggtt actaggccgt ggccgagcgc cgtcgactgg tcctccgaat cgtacgctgt     91980
     cgcttggagc tttttgatgt tggccgagat cgagttgggg ttgctgaccg agatgtcgat     92040
     gctgacgttg aatgagaaag caccattctg atagttgacg ccgttctggc tgggtacacc     92100
     tatacccgag atggcgatgt tgggtggtcg gacgaacaag gcgagcaggc agatgatgga     92160
     aaccacaagg atgatggcga ggatcagatt gcctatcagg atcctacaca gcttggcagg     92220
     acagctgcgc gactggaacg cacgcttgtc gtccttggtc cagatcgaat tgccactcgc     92280
     acgcttggca gcgtacgggc tgccagagtt ggccttttcc gcgcccatgt tgtagttgtc     92340
     catctcacca gcgccagcgc ggaggtggtt atagtgattg ccgtagtctt gctcgtagtc     92400
     ccgatgcagt gtacgcgacg gattgctgtc gtggctctca cccacctcgt cacgatactc     92460
     gtcgtgatcc ggtcgagacg aaggaggatc gtagggctgc agcgaatcgg cagagtaggg     92520
     atcgtgagga taattgtcgt tgatatgtgg caaggtcgaa gaaacttgtg ccctgggact     92580
     ctgaaacgcg tatgacatag tgataagaag gacaagatcc caaacctgtc cgacctggac     92640
     ctgcgatgaa tgcaagtgcg tgcgagcagg atctgtaaag gctattcaga cgaggaatcg     92700
     tgtcgattcg actttgtgct agctgcgaaa tagcgcagcc gaaacgcgtt ttctcaacaa     92760
     cgatggtgtg cgtacgatga gctaaacgag aaatagacca aacccgaaac cgagtcgcga     92820
     ctgttgtcga aagcacgaag cacagcggcg gatgtctgag agtgccaagg cgaaagagaa     92880
     gaggcgacaa gtggtagctt ttctggccaa caaccgtgaa cgagtgcagc aaagacggtg     92940
     tttcacagtg gtgaatttta gtggaggtca aggtgtcttg gtgtgtcaca gagcagcgtc     93000
     agactcgtgt cgctgctgag ctgcccgaac gtgagtcgtc aatcacgaat gtacaccgcc     93060
     ttggattttc gacttgactg gggtctgcaa ggatttcatg gctgtgttgc gcgaatcgtg     93120
     gctgtacgcc agagtcatga gtccgataca cgaatactaa cgatttacgc ttgtgattgt     93180
     gatttagtcg cgagttgata aaatcgtgaa ttggttcaaa atcaaacttg gagtgtcgag     93240
     ctattccata ccacggtcag ccaacgttct ggcttgccga atcacgagtc gcgaatcagc     93300
     tgcatgaaaa caagtttggt cattctccca tcacgcatgc tgtcatcacg aatcacgagt     93360
     cacgaatcaa ggatcatgaa tgtcaactgt gcatggagcc tgcgtgtgcg tgtgcgtgtg     93420
     cgtgtgcgag tgcatgagct cctgcttctt cggtgattga taaatcgccg ttggatggga     93480
     ttcacagatg actcgtgact gaatcggggc aggcaggtca cgacgaaatc ctgcgactct     93540
     gccaatcatc gtctcgatcc gggttcgtgt ctaatttcgg caccgaccgc caacttggta     93600
     gacaactccg tgaccgcacg ctggcttggt gcttcgcttc gaacctcatc tccactaccg     93660
     actccaacca agatcgcagt cactcctccg atgtaacgtc cccgatattg ttccgtgttt     93720
     cgatctccca actacgaagc acaagttttt gtctgtatga ttggcacgat ccgtttgtga     93780
     ttcaggactt gctgttcctg aaggcactcc agttccgagg taagatctcc aagcagatac     93840
     acagtgggtt agcaacgggc tacctgttcg cagacaaagt atacgttcgt tgaaaaggct     93900
     agagaacatc gattgcaaca tgcttcgatc ctcgtggtct cgtcgtggtc agcactattt     93960
     cttctttgcc ttcttcttct tcttcttgtt ctttttgctg ccggtgctag gaccgcttcc     94020
     gacggctgaa tcattggttg tctcgttcgt gtcaccgtcc ccatctgcat catcaccaat     94080
     gtcgtcacca tcgcggtcgt cagcggcctc ttctgtcgtc atggctgagt ccttcgaggc     94140
     ggttacagct gctacagagt cactagtggc tgagggagca tcctggattt cagcaagctt     94200
     cgcatcaatt tgctgatcgt caccaccagt atggctgagg ccatcagctt cgccaacaac     94260
     ttcagcagca gcgtcggcac cacttgagct ttgtacgatc acttcggttt gctcgctgat     94320
     acctccgctc gtttctgttg agcctaccgg tacaatggcc tcggcggcct cagtagcagg     94380
     ggcatcagtc cgcgttcccg atgcatcttg ctcggagact accgatgatg cgatccgcgc     94440
     cccttcttcc tttggctcct gtttgctggc ggcaaccggc tcgcttccgc ctgccatgag     94500
     ggcattttcc tcaacttgcg gactcggcgc caactccgtc ttggcagtta cctcttctct     94560
     cttggcaaaa gaagcgtcgc gaggtgcggc gagtgtattt gtctcggcac ttgactcgac     94620
     gggctcagcg atctggttag cacccacatt tttgtcttcc accttctgct cgcttacagg     94680
     cttgtcaacc ttgtcagcag gcgcgagagc tggctcgact ggtgcagtct ctgaaggttg     94740
     tgcaggggcg gtgggagtcg tcggagctcc gggcggatta ggtggctgag ctgctgagct     94800
     ggaggactgc tgtgctcgct tcctggccgc ttccgcaagt cgctccttga gcgacattct     94860
     ggcaggctta gctggcgttg atgtcggcgt cgctgctggc gtagaggcac cgctacgcac     94920
     tggagacgcc tcagttgaat tcgctattcc gccttggccg ttgtacgcag aagcgacatg     94980
     cctgtctttc ttgggagtcg acggtctttg cgactcgatc ggttcactgg cggcaaacgt     95040
     accaactgaa gatgtgtttg tcacccgtct cgcagtatcg tcgtgctgag gtgcttccat     95100
     agacactttg tgatcggctt gtttgccggt cgcactctgt gaagtggccg gaacatcagc     95160
     actttccgtg gcttgatctt gttgatcacc agagacagct ttggtgtctt gtcctccgtt     95220
     agcatcctcc tgttggacag actcagccgc ggccatggat gcgagcgttg gcgcagtcgc     95280
     tgtgagctcg gacgatactc gatcgctttc agaaagcacc tttgcagcgg catctggagc     95340
     aggcacgacg gacaccacag aatcttcaga ctctgctgca tccttgtcct cagtcttgac     95400
     aacagctgtc gactgcatag ccacgttttt cgaaggtgga gtaggtggca cgttgtttac     95460
     ctcctcttcg acgctctgag ccgctgacgt tgacggcctg atggagggct ccgtagcagg     95520
     cgtggccact tctcgtgctg cttcatcaat tgcctcctga accacaccag cagcttgcgc     95580
     agtggtcgcg gactgagact gctgttgctg gagctgcaga cttgtgcgtg gcgttgactc     95640
     cacggatcgc tgcgtctcag ccggtgtcgt agagcccggt gcatctgtgg atccgcgagg     95700
     actcgccgcc tggctgagct gttgttgttg acggcgagaa aagatattgg gaatgcgcgg     95760
     cttgtatgtc accggcccaa acggcgatgc gaccggcttg tcgcgcgcag gcgagcctgg     95820
     gacagtttca ccgttcgggg tcgaggagcc agtagatgcc gtcacagtga cagctggcgt     95880
     gttcggcaca tgcttggccg ccaacacctg ttgcaatgcc tcgtctttcc actcgacgtg     95940
     cttcaagaca gacagcttgg tgccaagata gcgaacatcg gtctgcatcc gatccagcgc     96000
     ctgctggttt tgaatcggaa tcttatcgag ctcttgagcg atacgtgtat cgatcgcgca     96060
     aagcacctga ccgatcacgt gctccacaac gacagcttga agatatttgc tgagaacctt     96120
     gtgcagcgtc gcagtctctt tgaccaaatc ggcggcgtac ttgttgggtt cggggtcttt     96180
     gcttatgccg ccttgctgct cttgatcggc agccgagttg tcggcattcc agtcgagcgc     96240
     gctcagcgta cggcagtgta cggtgagacg atccgacatg atggcgacga gcttggcatg     96300
     aatttcgtac tggtgctcct gaaaatcacg acgaagcttg tcaaactcgg tgagcatgac     96360
     ggcttgcttg ggtgaaagat gacgacgcac cgtttcgcgg atgtacggga taagcgagat     96420
     cataattgac agcgactggg atgcaagcgc aaggtgcttt gcggtaatgt tcttgagacc     96480
     cgcagatcgc atggctccgg cgccgagcac gacttggcaa gtgcgcgagt tgaactgctt     96540
     gagaaattcg acgaccctcg ccatggcctc tgtggtgagc aagggcaggt tgatgatgac     96600
     tttgagatag tcgacgagca gtgcaagcac atcgagactg gcatcgacga caaagtactg     96660
     acgattttcg atgtccaacg tcttggctga aatggtcgcc gtctcttgat cggctacatg     96720
     gtcgcctgct gctttggctg gcgcatccaa ccgactttcg ccgccagtga cgacgaattc     96780
     agagggatct tgaacagcac tgctgacgat gagtcgaatc tgcgcttgta tgttgatatc     96840
     gacgtcggct tgcgcccagg tctcctcctc gacagctttg gctgcgcgtt cgatgcggcg     96900
     gcgatgaaag ttggcaagga agcctttggc ctgaccaaga acggtggctc tgagaccaac     96960
     gatcatcttg cggcacagct gttcggatga tagcacaaag ctccagcaga gctggaagac     97020
     gacaagaaac ggaggcaatt cgagagcagc atgcgtcttg gcacgaagcg acagcagacg     97080
     tgcacagagg gtgtgcgcct gttcggcgga agcgactacc acctcagaaa gtctggccgg     97140
     aagagttgtc ggaacacctg atggcatggt aggaggagac gcaatatcag atgcggggac     97200
     cgtacccgga gaaacaagat ttacgacgct ttcactctcg agtggtgggc tctgtacgga     97260
     tgatgtgccg gaggcgaggt cgtccaagat gcggagcacg agcttgcact gagcgtcgat     97320
     ggctttgagg cattccatta ggatttcgaa gagcttttga ccaatgttga ggaaggatgc     97380
     atgtttgaga tctctgatgc gtgcagcagg cgctggtaga tcttcacgat cgtcaaactt     97440
     ggaaagttct tcggcaagga gccacttgac agtttcggcc atttctgcgc ttgactgcga     97500
     gagtgtggct ttccacgtct cctggactgc ttgaatagca acttctcggt aggccgagac     97560
     agtcgcttca atgccacctg tccttgcgag tccgacgacg atgggcgcga tgcgggaagc     97620
     caactcggcg tcggccgatg agagcatgcg ggaatcgtgt gtgaaggacg atggagttgt     97680
     tttggacggc gtgagggatg gttcagtgat tgtagcatct gagttgaggg atgattggct     97740
     gtgctggacg gtattcgggg taggggagct gccggtgcta tcgggtttgg ccattgaaca     97800
     tactcgttct tttgtgtaag tggcgagtcg tgcatcaaga tcctgtttga gtatcgcaac     97860
     aaggtcttgc tctagcatgc cggataaggt ctgttccatt tcatcgagct gcgcaggaat     97920
     gctggcgaga ctctgcagat cagagaggag gggctcgtca tccgccgtcc ttgtgccgtt     97980
     gtgctcagtg ttggctagcg cgtggtcggc agcggggcga ccgaaggtcg ctctaagctt     98040
     gttgagcagg tcgagggctt cttcggtctc gccttgctgt agaagcagac gaatgaggtc     98100
     acgacgctct acgagctggc gcacgctctg gatgacggtc tgtttgcgtt cgaggtcttg     98160
     tctgtgctgc tgttgctgaa tgatgcgtaa gcctttcttg gcttgattct tatcgatgct     98220
     ctcgagctcg gacttgagat ggtggatctt ggctaagcag ctctcggctt ctgcattgag     98280
     atcgttgagg ttttcaagcg cggcaaagaa ggaggatgac tgctgaccaa tctcgatgat     98340
     gagatgctgc tcaatgacgt cggaatagta gctgagcttc tcctgaagca tctggttcaa     98400
     agcaacgtcg taggtgggag cctttgcgcc gttctggtcg ccaggtgatg ggacggcagt     98460
     tttatagcgt tcagttacct ggtcgaatgt gtatgggttg ccgaggtcaa aatcttccga     98520
     gaagaagaat tgcggaaccg cgctgaggtt gggcagtcgt ttgcgaggct gtggtggggg     98580
     gagagcttgt aggtcggacg agagggaggc tatgctggat gttgtgcgat ggcgtagatt     98640
     ggggttttcg agcagatccg agtcgtagga agagtcttgg gtggaagaga gtgattgttg     98700
     ttgttgttgt tgctgttgtt gttgtagctg ttgttgctcg atagtagcct tgccttgcct     98760
     tcccatgctc tgattgcgca tgaagcggtc ccattcggga cgaacggacg agaggtaggg     98820
     gtcaagctca gccttcttga cctttggaat ttctgcgggg acatggttag gtgtgacggg     98880
     tgggaagcga gaagatttcg gatcaatggg atgctgacgt ttggagggat tgttgagaac     98940
     ggtggaaatt gcattgaagc cggtcagggc gagagtgggt gagttgaagc cgagccggag     99000
     atgctcagag ttgatgaggc tgcagccgca gaggagtaga tgtctcgacc gagtcgtgaa     99060
     gcaaggaggc ttggagcaaa agcagtgctg ttgatggtcg agtcggcttc ggagcctgga     99120
     cttgctgggc tagtgatacc attacgaaat tgaattgagc cagacgtctg ctctgctgcg     99180
     gtggttggca ctgcgttttg agcagctgtg tatgccaaag atgggccgat actgtgagtt     99240
     gaagaggccg aggcttcttg agcgcccgta gacatggtgg ggaccttgcc aagtaccttg     99300
     gtcgcagccc atcgagcaag ctacgttggt gccaaactgc tcagccgaag ctgctttcaa     99360
     gagtgtattg cgataagaac gatccaagat gatgatgatt gctagacttg tgaccgaaaa     99420
     cgctggatga gaataagtat ttgtgtgtgc ggtgggtgag tgagtgagtt tgtcgagcgt     99480
     tttgagtggg tgagagtcag gaacgagtga gtgttggttg gtcgtggttg gctcgtgtcc     99540
     agtctgtctc ttccgatccg caatcgtgaa tcacgatatc gtgaattgcg aatcgggatt     99600
     tttgaagaat cgtcaacgtg acgaatcgtg aatcgttgaa tcgtttgtcc gctttagcgt     99660
     tacgttacgc caagccacga gtcacgagtc acgagtctga cggtgttgcg tgcgatcatg     99720
     aaccagaatc acgataagtc tcgagtcgag agtcacgagt cgtgagtcag agagtcgtga     99780
     gtcgtgagta gattcgagat tttgcaaaag agtgttagga tccccaaaac aacattcgtt     99840
     cgaaggatgc gtaatgcacg atgcacgatg aacggtcaaa ccaagttaac ctaactctat     99900
     gcgaagcgct gtcgaaagcc atgcgctggc tgcccacacg cttgggacga cttttgctcg     99960
     gagcgagaca gcacgcgacg ttgagtcgtg agtcttgtgg gcgtggcaca acaatccaag    100020
     tgctaactta ctgcatactt acggcagaaa gagacacaga ggatcgcagc gtagttgtac    100080
     tttagtccat ccatgccatc acgaatcgaa atagccgagt caagcgcagg caggcgcaga    100140
     aggtccaacc cgcgcaacaa tgagagacag gagtagttaa ggggtgttgc cttttcgatt    100200
     gattgcctct gaactgaacc actcgtcact gatgttggcg aaacatagcg acgacgtacg    100260
     ctttacaaga atcttttatc cgtccgagcg gcgagttttt ctctgaatca caatcggcgg    100320
     atctctgatt cacaattctt tgatctctgg atctgtggat ctgtggatct gtggatctgt    100380
     ggatctgtgg atcaaaatct cgtggcgttg tgcggtgtga gcagtgacag tgcgagtgtg    100440
     cgagcgcgga ttcagctcaa gttaaacctg aacgttgttt ggtgcctgac gctaaagcca    100500
     gcccgattct accccaagaa aaaaggcggg gcggaccgcg ttttcatggt aatcgtgaat    100560
     cgtgaatcgt gaatcgtgaa tcgtgaatcg tgaatcgtga atcgtgaata gtaacagctc    100620
     ttgtcccagt gcgaccaaga ctcttctcat cttggaccgc gaacaactgt ctctctcctc    100680
     agccgcgacc agcgcatcgc tctaatcaaa cgccaagaac actactgact tgggctcaac    100740
     tgacgcaaca gcgacccttg accgtcagtg cttcggtgga caagtcacaa accacagggt    100800
     tggctatctt gctatcttgc cgtttcctgt atcatagtct tctttctttg ctgccatttg    100860
     ccacgccatc cgagcctcat cctgtcagcc ctaccgctcg cacaagccgc cttgttgtgt    100920
     ccaagccttg gtctgctacc agctggtctt gatacgctca tggcacattc ttgatccgtg    100980
     acctcggcta tcgtcatcgc ttctggacac aactcattgt gctagcatgg tatcggcgac    101040
     gaccctttcg tagcatcgcc atcgctattg ccgacaccat caccaccgcc accaccatct    101100
     ccatcgacgt ccatcggctt gctcaagatg gcgtattcta tggctttccc acccacgtcc    101160
     atgcggcctc tgcccggtgg caccacgctc gtatcggcac agcaaccagt tccagcagct    101220
     gctgccgtca tgaccaccga gtcctttgac gctcctgaag gcatgtacgt ctgcacctca    101280
     cgatttacac cgccgccgca acccatgatt catctcaatc ctgtgcctac cacccaactc    101340
     ggtttgtcag ccatctatcc gacacctcgc gtctccagcg tcagccttcg atatccagcc    101400
     tcatccaaaa aggcatccga ttctattacg gctgaattgg ccgcagctcc ctcccacaat    101460
     gtcctgcttg aagcaccact cgcgtctcaa ggcatcgatg ccccctcctc cagccttact    101520
     ggaggttatc cgccaggcac tgctggttcc tctgcaggca ttgctggcat tggcggcgcc    101580
     ggaatgggct tttcagggct gggtgagacc atgggtaaac tcagcgccaa acccacccgt    101640
     cccaagaaca gccttaaaag cacctcgagc aactttgtca atcgtatgat gactcacccg    101700
     gatctcgcaa agattctcgc cgctcgtacc gactcggagc acttcacctt tctcaccaat    101760
     gctcgctcct tcttctggct cgccgacacc accggcagaa ccaaagagag tctagcgcgt    101820
     atcactttca gtgcgtctcc ttcagcacac gacgtcaacc aattcactcg cgcacacgac    101880
     cgtctcgaca ttgtcattgg ctttgtcact ggcgatttga tctggcttga ccccatcgct    101940
     tccaagtata cacgtatcaa caagagcggc tgcatcacca actcggccgt cactcagctg    102000
     cgctggcttc ccggaagcga aaatctcatc atggctgcac atgcagatgg tagcgttctc    102060
     atctacgacc gcgaacgaga agattccagc gatttcgctc ctgctacctg ggaagcttta    102120
     gccgccagca ctccctcgtc gtccagcgtc gcccttcagt cggccatagc tgtaccagga    102180
     accccctcat ccgctgccat gtcggccagc cagacctccg cctccaacga ctcgtcttct    102240
     tccaaccctg ctgcttcggc acttgggtcc gccatgtccg attcgcgtcc catgctcggt    102300
     gctcgaaccg tcacgagttc aaccgccacc actactaccc agaccgatat tgcggacacc    102360
     aatctctcca tcggctcgag cagcgccgcc aaccttgtca agcccagaac cggccttgca    102420
     ccagccacgc tctctcagcg acgtcaagcc gcagacccta cttctgaagg ccagccgctg    102480
     ctggtcgtca ccaagccagg tgctgtcccc atcacatccg gcctgccatc tggtgctgcg    102540
     ttgccctcgc ccgaatatca acaggcagcc gccgccgcgg ctgttgcagc ggccaattcc    102600
     aactcgtacg gtaatggact ctctggaaag ggaaaagaga cgtcgtggtc gcgcctcaac    102660
     ccggtctctc attgggccgt gtccaagacg cgcatcaccg actttgcttt ttcaccagac    102720
     tactcgcatg ttgcgcttgt cgcagaggat ggcattctac gcatcgcaga cgtcaactct    102780
     gaacgcctcc tagacacgtt tgaatcgtac tttggcggct tcaactgtgt cgtctggtcg    102840
     cccgatggca aatttgtact cacgggcggc gaagacgact tggtcaccgt gtgggcgcca    102900
     cgcgagggcc gcatcgtcgc cagatgccag ggacacacct cgtttgtgac cggtctcgca    102960
     tgggatcctt ggcgatggtc gtcggacgat cgcacctatc gattcgcttc ggtgggcgaa    103020
     gactgcaaaa tgattctctg ggatttttcc agcgccgcgc tcaatcgtcc caagacatac    103080
     gcgccgcacc acgcgggtca tcgacgaagt tctgtcgggc tgggatcgac gtattcactc    103140
     gcggacaagc atgtttgctc atccattatg cgctctcctg cgtcggtgca cacaggtcgt    103200
     cgcatgagtg ccaacaacgg ctcggcgtcg ttgacgcccg cgaccgtgac cgacgatacc    103260
     attcgacatg cagcactgcc acgttccgaa gtagccatct tgcagcccgt tgttaccgtc    103320
     aacattgacg gcgagattcc agccggcgtc cgatttgcgc cggacaaagt tagcattatt    103380
     cgtaagaacg ctgcgatcga cacctttact cgtcctctcc ccgaacgccc ggccagcgtc    103440
     gttgcctcgg catcggcggg aacgcatcga gcttcattgc cggcaggggc acgtacgaac    103500
     cgtcaaccgc ccgcatctca agcgtcgcgt gcacctcctc cgcccctgaa ccttgctgtg    103560
     agcgcggcca tgtcggctca atctcaacag tctttggcag ctagtccgac cactccaagg    103620
     cacgccatgc cgagtagcac atctgcagcc aaaaatggca tcactgccta aggtagctgt    103680
     atcactcggc tgtcattgaa tcaacagatt gcgcttgcaa gcattagaac aaagtgcctt    103740
     ctcgaacagc gtcattggcg ctctgtgctc gaacgatgtt gttggtgtta gtgacaccat    103800
     tttgggcggg ttggagatag ttgagttcca actcgagcat ttccatgagt gtacgaagcg    103860
     ttcgctgttc ccattctccc cacaccacgg cactgtagag cattgtggtt cctgcccacg    103920
     cggccacgac tgcgagcaat acaaagactg gattgactgc gccgagcggc tgaaagatgc    103980
     ttgctacgat cagaccgaga gcgacgagca gtgctgtgcc gaagacgtag aggtgagacg    104040
     attggttgga acggctagcg gcgaagcctc ccgctagcgc gtggagcgaa caagtgagga    104100
     cacgccgctg cgctgttttg cgggcgtcgg agtcggaagc ggtaggcgat ggagcgccgg    104160
     aagaaggtgg gaggatatca aaggtggaag caacgccgaa gtggtctgaa taggaacaca    104220
     gatgttcggg tatggtgtcc gtgatgacga ccgacgagga tttgcacgtt agccgaccgc    104280
     gtgtggagtg agatgccgag taagctaggg cagaagaaac ggtagatgcg tttgattcgc    104340
     tcgagtgttg ctgatcgaca gggccacggt agaagatgta gtcgagacgc ttgccggcgc    104400
     ctcttgacgc tctctcgtcg agaggtttgc cggctgtcca ggtgttgagt ggcgagtcac    104460
     atgttacacc taattcctca atcgcacgct gtggatccgg cgctgcagtt gcgcgatcac    104520
     ccacttgcgt tgatgtctct tctggatcca acgatactgc gtgctctggt agctgaggac    104580
     gcgtatccaa aaagctatcg tacaagccgc caatatgcct tagcaaccca attgccagag    104640
     aaggcggagt ggaattgaga tcgcccacac aaaccacatg tcttccttta ctagcactgt    104700
     tcctgcaatt cgccgcaagc tcgtacgcct gtgtgatgcg gtgtgacctc ttgtattctg    104760
     gaccatcctc gcctcccgct gctacgaaat gcgtgttcca cacatctacc aatcccaacc    104820
     gcggatgatt gatggtaaca gacccacagg ctttgcccac gaaccagtct ccatggtgca    104880
     cgtgaatcgg ctgtccgttg agcgagtacg gatgcgttct cgtttcgagg atgttccagc    104940
     gggaaaggat ggcgagaccc gaaccgaatg cacctgaata gaagaacttg gaatgagggt    105000
     agcgcgagga gagggcgtgc ttgagaaagc gccagtccct ggattcgtac caaatttctt    105060
     gcaagcacac aaagtcgtaa aggggcatgt cggaagatgc aagccgagaa gcgatagctt    105120
     tgatacgcgc tatccgaagc ttcgagatgt acttgaggcc ccagacgttg agtgtaagga    105180
     tgcttagctg gtggtcatcg gagggtggat ccgagccgac aggttcagag gcgggtggaa    105240
     agatgggtgg caacgcctgc acctcggagg ttgaatgtgg tgacaatgga agcctcggca    105300
     tctctgcgag tttgtaaacc aggcgctgat acgctagccg agagcgttgt gagtgatgga    105360
     aagtaaagag tggctacgga caagcgttgc aagtgattga tcgtgagtcg tgggtgtgag    105420
     tgttggtctc tgcgcaccag gctctcagaa aaacctccac ctaagttagc tcaaggtgca    105480
     gcaaacaaca cgaaaacatt cgtgattcgt gattcgagat tcgcaccgca tccacgattc    105540
     acgattgtca caatcaccaa tcacgaaacg tgaatggcca cagtcacagt ttgctgctgc    105600
     tggaagtgaa cgaaatcgtg aatgcattgg cggttccgat cgaggaatac aatcacgaat    105660
     cacgaatgga ttttgagttg aaattgcagg gttcctgcaa cgtcgatgtc aacttaacag    105720
     ctatgcagag cgctacggct tacggctcat ggctcatggc tcatggctca gtcgctcacg    105780
     tggctcagtc actggcgctg gctgtgcccg tgtgcgggat tcacgaatca atcgtgattc    105840
     ttgaagcgca gctcgtcttg actttcgtcc atcctcctcc tatcggcgag cgtaacagga    105900
     ctcaactcgt actcaccctt gatcggatat ctgagcctct gaggcaaatt cggccgtttc    105960
     gattgctgtc agcaagcata cttccaagca agcatacttc aaagacctcg tcgcatttca    106020
     ggcgcgcgtt tcctgcaagt tctacgctta agcatcatag gcggctctgc gagcaaccct    106080
     cctcttacgc ttcacaatag acttagcaaa gacaggctcg ctgcatagct gtccaccatg    106140
     atcaaggtag gcgtacaaag acgaccctca gcttctaact cgactttgta actgacgatt    106200
     ggatttgttc acgaccgcca ccagatctgg agcatgaaga aggaggagga atcggcaaag    106260
     aagaagaagc caaaaacgtc gccagcacag ctacgcgtgc agaaaggtag gtcacagcag    106320
     caaagagcct ctacagagac gactttatca aatactcacc gtcgcgaacg acgatcatct    106380
     tcgacttgcg ctcgcttgct tccagatctg accgaactcg aattgccaaa gacgatgaag    106440
     accgacttcc ctgacccagc agatgtgctc aacttttctc tcacaatcga gccagatgag    106500
     ggtaagcaaa caaactcggg atgcagatct cactatcgct cggaaagctg actaacgcat    106560
     gtcaaacatt tggcggtggt cggataggca tgtacaagag cggatcgttc aaattcactt    106620
     tcgccatcaa cagcaattat ccacacgatc ctcctaaggt caagtgcaca caaaaggtgg    106680
     gtcttttacc ggattttgtg gtgccttcca ctgcagaccg agtgctcacc gctctgttga    106740
     tcgcgtttac atacttgcac agatctatca ccctaacgtc gacctggatg gcaacgtgtg    106800
     tctcaatatc cttcgtgagg actggaaacc tgtccttaat ctcaactcgg tcatggttgg    106860
     tctgcagtac ttgttcctcg agccgaatgc cgatgatcca ctcaacaaag gtacgtgaat    106920
     ctttctgcgg cgggacagaa ctcaatcgaa gcgacatcat actgaacatt tgacgcattc    106980
     aattctgatt tcgtgttcac caacgtagag gccgcagaag accttcgcaa ggatcgatct    107040
     gttttcgcga gcaatgtacg aagaagtctt gccggcggag ctatcagtaa gtttcttgag    107100
     tatcaattgc ctacgaccat ttcggagtat atcgctgact cttgaccgat cgatctacct    107160
     tgcccatgtc actcagaggg aacaacatat gacaaggcta ctgtcaagtg ataagggtca    107220
     acgaacagcg tgtctacatg caaagacagc gtacgcgtcc gagagcgtcg cgcgaatgta    107280
     cttctattct ccacactgca tatcacaaac attggtagct ctccagcgtc acactgaggc    107340
     gaatctgttt gtcatcacgc atatgaggtt ctggttagga acaggtctta tgctcgagag    107400
     tggaggatca cagaatcgtg aatgagtcgc ctgtttcttt tttacgctga acactcgtga    107460
     ctttggctcg cttgagattg gaccctgcat gctgagcaga catgccgcga actaagtgac    107520
     ttggtgcttt cgcacgtccc cacgtctcgt cttgataagg tacgtgttag cttctcgccg    107580
     aatcaacgtt gacacgagtc gtgagtcttg ctcttgggat cgcatctgcg caagacgctc    107640
     acctagtaga tctactgact gttttgtact gagatctaaa gctgtagctg aggcaatcac    107700
     tgtcgcactg cgcttgtctc gaaaggacag cctgtcgagc tgtgacgatt gtgatccagc    107760
     tcgcaccgca tttcgcacac aaacgcacgc tgcgctatca gcctgggaca ttggccttgc    107820
     tcgtaaacag gatggcctgg cgctgttcag gcggcacgaa tgccgagctg attgccaaca    107880
     tgcgcaatgc atcgctcatc acctcatctc gcgtctacga agctatgctc aaagtgaacc    107940
     gagccaacta tgtgccttcc caactaagcg cgtaccaaga ctctccgcaa acgatcggct    108000
     ttggcgccac catatctgcc ccacacatgc atgcacatgc agccgaagcc ctgctgcctt    108060
     tcctccactc ccaagcaaac gtcctcgacg tcggctctgg atctggctac atgctggcca    108120
     tcttccacca cctcgtcgac aacgggaaag tgatcggcat cgaccatatt ccgggactcg    108180
     tggatcaggc caatgcgaat ctagagcacg atggtctcgg tgcagaactc aagaatggaa    108240
     agattgtgaa tgtttgcgcg gatggcagaa acggcgtcga ggcacaagca ccgttcgatg    108300
     cgatccatgt cggagctgct gcccctggca tcccacagtc gttgctgcat cagttgaaag    108360
     ctcccggaag gatgtttatc ccagtagcag agcaggacgg atcgggcgaa cagaacatct    108420
     atcaagtcga caagtccgag acaggcgaga tcacaaagac caaaatctgt ggcgtgctct    108480
     atgtgcccct tacggatgct gccaagcagt ggagagcgta acatccaaga tgatgtgcag    108540
     ccacggataa cgatgttcac ctccaactag gaatacacgc acgcacgcac gccatcaatc    108600
     atttggtacc ttgtccagaa tctagcattg cacgcgtcgg aacacggaac cgtgaacgag    108660
     caaggctcga gggcgatatc tttgtgttgt gtcgtgcatg gcgttgtcgg ctagtgaacg    108720
     aggtgcacca atggcgctca tttctgctat tgctgctatt gctactgctg ctgctgctgc    108780
     tgcttctccc aatcttcctc gtcctgatcc ttagcaggca tgctatcatc ctcgcccttt    108840
     ttcaaagttt cgttgatcgc cttcttcaac aagccataag ccttttccaa atcgtcattg    108900
     acaatgaccc aatcgtgcgc tcccttttcc ctggcataag ccatctcggt ggcagccata    108960
     gagagcctct tgttgactga ctctggtgtc tcggtgcctc gacctatcaa cctctgcttg    109020
     agagtcgaaa acgaaggtgg agagataaag atgtagatcg ggttcaacga agcgtggttg    109080
     gccttgatga gcttgacgcc ttgagcgtcg atgtcgagga tagcgcgacg cgcggctgtg    109140
     cttccatctg cacctttgac gccttcggtg gatacgtcag ccaccgcctt ggcggtagtg    109200
     ccgtatcggt tgccgccaaa cttggcgtgt tcgagaaacg cgccctgttg aacaaggtct    109260
     tggaattctt gctgtgagac gtagtggtac gactggccgc ggacctcgcc tggtcgaggg    109320
     tctcttgttg tatctgcagt caagcaacag gcaagctctg gtcagcatca aagtacaaat    109380
     gcccaagttg tgcgcaaaac caggatcact tacgagatac ggaaaaacca aagtcattgg    109440
     ggaactcttg aaacaacttt ttcagaagtg tactcttgcc cacacccgaa ggacccgaca    109500
     gcacgatcgg acgtttgtcg cttggaatcg gaggcgtcga cgcccagttg gacgacggca    109560
     tgctggcggt agatgcaaaa ggaaatctct tgacagcagc caagaaagag gaggatggca    109620
     agcaggttcc agaggcagaa agaaaaggag tgatgcaacg aatcattcga atcttgaagg    109680
     cttccttgat ctgaatcaat cttggatgtg tgtccaggtg ggctgtgtgc tgagcttgat    109740
     gtctgagtca gatggcgagc gacgagccgg attcgttatt catcaatcaa tcaatcaatc    109800
     aatcacgaac cacgaaccac gaaccacgat tactgcttgc ttgcttgctt atagtcttct    109860
     taatcacgaa ggccgctccg agacgggaac gctgctgcat tcacgactct gtcacgtgtg    109920
     acttttctct gcgtgtcggc gaaaccctga caaagtccaa aaggcgaaca acaaaagttg    109980
     cggttagcag caaaaatcgt gaagaactta gtcttctcca tgttacctgc gaaagtcaag    110040
     attctaaatc gggcccgatg gattcttgct tggaccctga gctgcgagaa aagctgtttg    110100
     tgcactcaac ccaaaaaagg ttggctactt tacacgccct tgacgtgatt cacaagcttg    110160
     gagaaggcag cgcgtctgtg gatgtgcagc gaggtgagaa caacacgcag cgctgcaagt    110220
     cgtgcgtctt ggttagcagc aacacccggt gtcgactctg ctttcaaaca cggtagctcg    110280
     caacacaatc atcatcattg cgacatcctg ttcatacata ctgctatgat tgtgcccgac    110340
     tcacaatcag cagacgttgc tgggccttcc agacaatcgg ccggatcaca cgatcgatgg    110400
     aatcggcatc ttaaccccaa ggtcaagccg gaacccgcct gcgaaaacag caacaacgtc    110460
     attgacctct gcgactcggg agacgagctt gctcgttccg tcaaacctgt accgtccaag    110520
     cctatactac gctccaaaac gcctgctgca aagggcggca gagtcaaaga ccaagttgac    110580
     gacgatgaca atggctatga tggtctcctc aagtccgacc atgacgacga gtttggcagc    110640
     acgtttgtga aacataagag caagaagcgc ggattgtcag aatcgccttc aatatcgaag    110700
     ctatacgcta tcgctcggat tgccactctc gccacggacg gtgtcgcttc ggtctcagaa    110760
     tgcgaagcaa agctagctgg cgtcagcgca ggcattctct ctcgaatcca aaagtcgctc    110820
     gctctcgcca aacacccggg cacaggtgag gcagaagcgc aacaggcgct ccgcctcgcc    110880
     acgcgtctga tgtcgtctca gaacctaaca caggcggacc tgctcgcttc gtccgatgcc    110940
     gaaaccaacc aatctcgtgc tggaatgtcg atcgtcgaga tcgtctctca aaccaacgca    111000
     agcccgcgca acgagagctg ggtcaatcaa gtcgccatag ctgtcaacct gttctttgat    111060
     gtaaaagcgt actcaacttc gtacgcaaat cgcaccaaat tgagctggac cttttacggt    111120
     cttgcagtca acacggtcgc cgccgcacac gcgttcgaaa tggttcacaa ccaggtgctc    111180
     acgtgggcat acgacaaggc ggcagccaaa cttgtatctg gtaagacggg aaagaacagc    111240
     tactgtcagg gcgtcgctgc cggactgatc gcactagcga agaaagaaaa aaaagaagag    111300
     atgagactgg ccattgagtc cgagcagaag cgactcaaac tcgcagaaga gcaagaacaa    111360
     gcgcagatca agaaggaaag gcagcgtttg aatcaatctg ctatcaagtg cgagtcagac    111420
     gtccccacat ggtcgcgtgt caagccagag gcgcacgagc aaagtatgca taccggctca    111480
     gcccgcggat ctcgaactgt caagctggaa gatgtcgtgg atgaacaaga taccaaacct    111540
     ttcagatacg gcatcaaacg atctgactcg gaggacgctg atgctggctt cggtcgatgg    111600
     accgagaatc gctcgaatcg cggtattagt gttggaggaa tcaagcgcga aaacggcgtc    111660
     gaatacgatg actcggacaa cgaagatacc aatgagcagt tctacgattt taacaaccac    111720
     attcctcccg gccatggctt tggggacgac gttgacgatg atatcaaacc ccatttcgac    111780
     gaagctctcg aacgcgatat catcgatctc accgacgacc tcgaagaaga tgtcaaacca    111840
     aaacttgaga ccgatttcac agacgtgaaa ccgaaacccg aacgcgatag cgaagatgtc    111900
     aagccagatt tcggcgccgg ttggcaatct ggcaaccagc tcatccgctt ccgtcaggac    111960
     gccgagaaag ttgccgacga ctacctcgcc tcacagcatt ctggcttgaa gctcaagaaa    112020
     cgcgcaaagt cgagcttcaa aaaagattca cacgcctttc aacagggcaa agaggacgcc    112080
     aagaagatcg atgtaaagag gaaacgcatt caaaattgaa cagcgtgtcg tttcagatat    112140
     acggtcttga tgtgtgttca ctagtcgcat tgaatcgatg aaactgagtg tgtgtatttt    112200
     gtgattgcga tctgaggcat aatttcatgg aacgttaaga gttcgttgtc tttttggagc    112260
     gttatttcag tgattaagcg ggacttgagt attgcgccga gagttccgag gcgtttggat    112320
     agtgtccagg ccaccgtcga gacgcgagtc gcagaagcga gcaacaaagg agaggggagt    112380
     atcggcttct tgctgagacg ctgcacagcg ccaagtccat ataaaggaaa ggacgttact    112440
     gtttcgggca cgctcgccct atcgacgtga cttgcagggg gtcttttagc acgcgtgact    112500
     ggatcgtctt caagtgcagc ttgtgccgag ttttcagcct ggtcacccca acagctatcc    112560
     ccacggtgac ggttggttgc cacggatacg gcgctgttca tctactcctc cactaccgcc    112620
     tcgcctccat gcattgccaa ccagactctc tgcatcttcc aagctcagag cccttggaac    112680
     acccgcaaac aacccggcgc ctgaggtcgg tggtttacga ccaaggttcg tctccctcaa    112740
     aagctcatgc tggtcgaagc catacacgtt cttggcttta ctgaagttct tcgcgatgag    112800
     tgcatccagc gaaggcctca tagcacccaa gggtgtataa accgtccctc cctgaagatg    112860
     agataaggca ctttgcacaa gcacttggtc cacactgctg tatccttgct gaaatcctcc    112920
     agtgcgcagg tagtcgtcca tgtacggcca gtgcgccact tcgttccaag catcattgcg    112980
     gaacagatac ctgagtgtaa ccaccgcttt ggcttgttga gctggctcat tcgggtacat    113040
     gtccttggca aatcgttgta aaacgttctt agcgctgtaa aatgctgttg tgggagcact    113100
     ctcgacgagc cccgccaagc taagcaacgt aaagaagaac agcaataggt tcaagttcat    113160
     cttgagcgca agatcgagaa gctgggaatt ccggtggagc gaatcaagaa cgaaaaacga    113220
     aggacgaagg acgaacgagg agaaatggat accagctaca gtggtttata tccttcccat    113280
     gcaagccatc accgtcagga cgcctcaagc acctagcgag attggaacag caagaaactt    113340
     caatacactg tctagctcac aatacaagct tgtgtagtga aagttttaat gtgacagcag    113400
     tgagatcagg acaggtgtcg ccataaaact cgaattagat gacaaagggt ggccatgcga    113460
     cgatcacgcc caccaaccct ttggtaatgc atacagagtc tgccagtagc tgatcagaac    113520
     catgtttgag actcacacta ttgagtcgaa tgatcacaag tatgaggtta aagtactgag    113580
     aagcacgaac ccacaaattg actgttagat gcacattatg aaatgaggtg ctgtcttccg    113640
     tgaaggaatc acccaccttg tagagccttg ggcggttgat gctgttcgaa tgagggaata    113700
     agcctcaata gggtggttcg agaaaaagtt ggaacctgcg ttgatgaata ggtcgttgct    113760
     ttgcggcgtg cagctgtacc attcacgatt gtgacggtaa cctttcgaaa aatgaagctt    113820
     cgaggaaaga cgcgaaagga gaaaggtgca catagtatgg caatcactct gcgactgctg    113880
     cctgttctct tggccatagc catcactggt atccactccc ttcttcagag ccttcatcgc    113940
     tgcttttcaa acgctttaaa cctgagtctg cgtctcattt tcgttcaaag cagcgcttgc    114000
     gataaccgcg atgacatcgg cagtcttaaa cgagcacaag agcgtttcgc cacgctacct    114060
     gtcattcgtg attgtacggg aaacgagctc gtagtattca cattcgtgat tcatgattgc    114120
     cgagtgacaa cgaatgtcgt actgcatcat tcgtaagcaa aattcacgat tacgtggcga    114180
     cgagcatact gcatcggcgt tcatttccat ccacggtggc tgtatctctg cagcgagcag    114240
     cacagctcat gcgcgataat ttagggtcaa ggtcagtggg ttacatctcg cttagacaaa    114300
     cgacagctga aaggtgccag aataaactca acggctactg aaactatagg gaacgacttg    114360
     aatactcacg acgagtgcgg gaacgcggtc taggaacaat cgtgaatttc acttcgtttc    114420
     tgatcatcag atctgggagt catccatcca ctcacgactt tgatcgaagt aatagggagc    114480
     tcaataagga cacgatctca ttgtaattgc aggagattga tcttgcttat cagtctatgc    114540
     tcagtgttca accatgggtt ggttcggcga caaatacgga caatggcttg ctaaaatttg    114600
     tgaggttggc gaagagggac aatcgatctt cacctatgac tatccagcga ccaaagagct    114660
     gatcgcgctt gatcgaccct gtctgcgatc aggattcatc gctgcagcct cattgtgaat    114720
     ctcatcgacg gtacggtaat aggcttggcg atgcgcacgc atgcgtgcaa tctcaccggc    114780
     ataccaggcg ttccattcga gtccggtcaa agggtatgct gccgatcgcc cggctttgtc    114840
     gagcaagcag aaaaagtatg cagatgcatc agcgagtgaa gccgcatgaa tatgcggtca    114900
     ccacatatca cttacttgtt cttcctatca gcgccatatc tcggaaaaac tggggaaaca    114960
     catctactgg tggattctgg agcgctatta cgatgcagcg ttatcgtttg aagcatcacc    115020
     aaatgttacg tattgttagt aggtagggct tctagacgaa tcgctcagat gttcagacgt    115080
     accagtgttt tgttgcaatg cctcagagac acgctccttg agctgctgga tcgcccgctc    115140
     gattggcatt ccttgcctcc aaacaatttc ttctttaggg agaagatagg ccttgacgtg    115200
     accagtgcaa gtgattgcga tgagtaggat cgctgtgcag atattggacg gagtcattgc    115260
     aagtcgggtc cgtgccaagt ctgggcacag acgatgacgc tgaagccgag tagatgaatg    115320
     ataggcaaaa gaaggtaaac aattgacgaa cttagcaata tatgcttgcc caactgtcgg    115380
     ctcagctgct tgatttcagt cagcagaagc gctacgagca agaccttgaa acgtgcgtcc    115440
     aagataagct ctaggaccag cctgtgagac gcgagacagg agtgacaagc gctgatgaga    115500
     gcggtgagca ttcacgacag cgagatgcta cacctttgcg gatgttaatt gtctaaactc    115560
     ggcctctaat gctttggaga tgcacgaaag gctatcgctg cctcttatcg atctgcgtgg    115620
     ccggttctgt ctgaaccaat ctgaagcttg ccgagtatag cacatgagca acaccgtggg    115680
     tgcttctgct cgtgaactaa tctcggagcc tttagcaacc cacaccggta tgcggactgg    115740
     acggtcacca ctgcgaggtc ggaatcgggg tcgtaacggc accaaagact ctagccacgc    115800
     aggagaacgg catcagaccg gaacgagcta cctcctacac ttcaataacc acgatagaat    115860
     caagcaggca tgcaacgtgg tcgggagaag acctagacca gcgcttgctg tgctaaactc    115920
     gcatggatag ccaagaaaga gcctaagctg ctcgtcggta cacgctggat gtgtgtcgat    115980
     gaagacagag aggatctgtg ggctacaatg aagtttgaaa gtaccacttg acacacttga    116040
     cacgttgaga cacgcagcac atgtgggcag actggacatc cgaatcggat ctgtcttcta    116100
     gtcagccaac tattacatcg cgttgtttcg cggcgtctcg atgccacagc ctcactcgcg    116160
     cccacttctt gcacacttta gtatcgcata agctgtcaat gcggatttat tcatctcatt    116220
     tctgcatgta aggaacgtcc aatgtcccat tcaaactcaa tagaaatgtc cctgcggaag    116280
     tttcagcgat gtatgaagcc agaaaggtgt gtatcataat ctggagttag tcatctgtag    116340
     gacatcaagg atgatctcga tgaatcggac ttgcaaccat cgcatccggg catcaccact    116400
     gagcttgtgg tactggtgct ctaagtctaa cgtggacaag gataaaccta agcaatcacg    116460
     aatgttcttg aatcactgtg gatgtcatga tgagcggatt cagctcctgg atccggcgcg    116520
     tgcagctctg gcttcgggcg tctgaatacg ctcgatttca gcggcatacc agcggttcca    116580
     ctcggcgcct gtcacgggtc tagccgtgct ttctgttgaa agataggtaa atgcagagag    116640
     gttcttactc agtcaaagct ttggattttg cccacatcaa tactcttcga atctacactt    116700
     acccagtctt ccgtcctgtt gcagggaacg gaaaaaccta tgcgcagcca tggcgtccgg    116760
     attgatcgcg tctacacgtg cacgaaattt ggatggaagg tctctgtcag aatatatctg    116820
     ggggttactt tgcaacgaaa gctatgacct actttcacca ttgcgtcgga gagcagaaaa    116880
     gatgttcaaa tgaaggtttc tgatcccttc ttcgattggc tgaccatatt gccagagctg    116940
     ctctcctgct tcgatctggt aactccagac agaagccaag aatgtcaaga gcagcatcgg    117000
     cagaagaagc gtcaacttgg gggaatacat gctgaagagt ggaatcgtgt tgctatggca    117060
     cagaggtgtg aggatcaggc tcgagaatca ggtaagaacg cgccttatat gctcgtcgtc    117120
     gcaaaggctc ccctatctga gactgggtag cagcttggcc gccaaccaag tcaagcgaat    117180
     cttgctcatc actggaggtg gtcttctcga ttctacaatg gggatcgcct gaaattggct    117240
     cagaatgcca agtcatccaa gaggcgcgca acgaaatgag ccccacacag tgaagcacga    117300
     aggggcatct gcagatgaag tcttggccaa caatcaccaa tgcagtgggg aaactaccgg    117360
     tccgttgtga acgaagcaag cgaaaattcg tgatttgttt cgagtctgag taataaccat    117420
     caaggcctca cttgcacatt gcatcttctg ttagagagac cccgttcagt agagcgttcg    117480
     catgtttctt tcggatgcag acgtttacgt caacagtgtt tatcttacta cgcacaatgc    117540
     tagccataag tatcatttca gctgtcaacg atttcttctc tacgtgatct tgggttgttc    117600
     agggattggt tcttttagat gtaatatgca cgatgactga tccacgggcg tgcttcaaaa    117660
     ctgagcgaag agtccattgt ctgtcgtgag cactttacct gttggcgggc gtgttggtgg    117720
     gtgaagccaa atcgcaacag tggaaagagt cctgatcgaa gggcttgaaa acgtgcggct    117780
     aaacaaccca cagagaaaaa tacaacggcg aacgacttgt cgttcggccc cactctcata    117840
     cggcatcgaa ccaaatacct ccggcagcca tgatgcacga atgtaacaag gcgatccgaa    117900
     ctagcggttg aagttccgta acgccaacca catgaccata cgatgtagtc atcattcaat    117960
     cacttttcag agtttgcctc tgcacgctct taggaggggt tggacgcgaa gcatagaatt    118020
     ggcgatcatc tcgccgaaag ttggagcgac atgtgaaagg gcggaattgg tcttcaacac    118080
     atggaatagt ttcctaccca cgccagcgaa agatgtcaac aagaaacgtg ccggacgaga    118140
     cccatcaaga actgcacttg tgacttgctc aaggcgttct aacagtggga gtatgatgag    118200
     gcagatggtc cgaggtcgca ccacaagaat aggatatttg gctttatcga ataggactta    118260
     ttgcactcca tcttacgaac gacgatgaga tgaatcgtca aagggcaagg ctgtaggcaa    118320
     ggcagggacc agcatttaat gacccagtaa cgcgccaaga aaagcgacgt tcgtcgccaa    118380
     acgtatctat gtgtaattct gacggagaag gccgattcga gggccctgtg tgatttttcc    118440
     gttagctcgt tcatcttctc caacatcatg atattctgag aatgtgtcga caccattgtc    118500
     agtcaaagtg ttaaccccga cgagatacga gacgagtcaa gacaaacagg cgttgcaagc    118560
     gatcaaccga ctgtcgtatc tatactctca ccacaagcgt gagcctctag ccatggcggc    118620
     catgcgagca gtaaagtcaa atttggatcg atctacgagt ggcaactttg cacagtacaa    118680
     agcctatgca gaataggatt taccagcagg acttcgaacg cgtttgtggt tctttggagg    118740
     aacttgcacc tgatcagcct tgacctggcg caagtcttgc tccacgtttt gcgacaatct    118800
     atggaagagg ctattctctt gcactctgag ctgctgctcg atctgatcag atgcagtgta    118860
     agcgaggttg aaggcttgac gaacttggtc gatgtccttg ctcatgagct tatcaactat    118920
     ttctgctggc attccgcgct ttaccggaac tatgggcaca gctgtgctgg tccaagatag    118980
     ttggaggagg agcacgagtt gagctagaag tgtcagtgct ccaagctggc cgatgacgcg    119040
     cgacatttgt gattggcttg gaaacagcga aagtgagaag aatagggttg cgatgggaaa    119100
     ggacaaaagc aaaaaggaag cgttctctgc tacgctttta acactttgct gctccaaggc    119160
     tgaatctgtt ctgggcgacg agcgagcact ggaccggtga cgatgcaccg gtggcagacg    119220
     taccacaaga tcgaggcttg ctatcgggtg gtgcggtagg cgtccgcaca cagagcgagt    119280
     atcgagcgcc atttcagcgt gggaaatctt tgctcgtggt caaaagacca tcttgtcgag    119340
     aagccgatgg aggtgctcct tttcagcgtg ggaaccgacc catcttcata cacggccgct    119400
     ctccgcaatc cgcactcaag actggcccag cgtctagcgg caagtgtcac gtactagtta    119460
     tggtgctcgc tccacttctc tgcgattgtc gatatgccac gattcagatg aaagcggctg    119520
     cgaatgtcgt ttcatggtga gcggtacttg ttgtgcttta tgtgcttgcc gcgaatgccg    119580
     tcgagctcat ctgtgctttc acaatcgtag cttccgaagt tcgagcgtgt ttgcgacacc    119640
     ggtgttgctg taaaagttga gtttgtcgga aatagaagag acctggtgct tggctgggta    119700
     cttcaagtgt ctgaagtggc agaacatgta cacgtagctt ctgggcaatt gtcagcaaga    119760
     cttgattgag ggcgttggcg gtctggacac gcgtgcggaa gcggaaggca agtttgctca    119820
     cgaccatcaa agcaatatcc tttttcgttc agcctcgagc ggcgggcttg ttcacacgtt    119880
     ttccgtttac accttgcaca tgaatcaacg caatacacgg ttgcacttgc tggcgccatc    119940
     gggaaaagga tccaggttca agttgaagag aaatcgacgc acagcgcgct tgcaagcatc    120000
     atttacgcag ggagcatatt tcgtcaacca tcacggcgtt cgacgtcgaa atcggaaatg    120060
     aaagcaccac ccacagcgga atgcacatga ccattcgctc tgtactgctc gcctgaaacg    120120
     tacgctcttt agctaattcc taacagtcac gagtcacgct tatgaagcag cacacaatag    120180
     ggggctgtaa tacatcttac agcgggaata cgaagccaaa cgtgtaaaga tgcacgatgc    120240
     gtgatgggct gatcagagct tcattgaaca gaaagagcgc ctggtgcttt ttgctggctt    120300
     tgcaaacaac cgtggactgc gtaggaagct gggttttggc aggcatgcta cgctgcccgt    120360
     tgtcgcaagt ttagtgatcc gctggatgca aaaacgccga gagcaagatg tgcatataat    120420
     gatcacgatt attctccggt cctcaccaac ccactctccc gttttttcga ccgttgagac    120480
     acccgaccaa cacttgtaaa gtatcagtct tgtcttgctt gtacacaagt tagccatctg    120540
     tcaacgatgc gtctgttccg gtcaccgatc atcctgccgc tgctggttct tgtcgttttc    120600
     acagcaactt gcgttctggc tgtgccggcg ggtgacaacg gaagcagcag cagcagcagc    120660
     agcagcacca agggaaggct agccaagctg ctaggacgtt tcaagaagaa taaaccgccc    120720
     tcgctcctcg accacctgaa cgcctacatg ccggcgcacg agtacgctga gctgaagccg    120780
     acgtgggatc gcgcagtgga gcagggctgg attcgacccg atactggtac gttgtataga    120840
     aaaaggtcga acgcatttgc gcgcaaggca gaacgactga tgactgacga gtattttggc    120900
     gggttgtttg caactatccg gcacaggtga ggcgatccga tacgacggca ttcgtagtcg    120960
     tcaagaaaac gaaacgatca acttgatctt gcacaaaatc gacccgtaca ttgaggagct    121020
     cgcaagaaat ctaccgcact gattctatcg cgtgaccacg tatgcgttgt atggctctac    121080
     acttactgcc atccacgctc gcacgtgtct ctcaaacccc ctaaactgac gtgtcggcgc    121140
     caacccaaac gctcgttgct cgcttcccag tgcctcttca acatgcacct ctgcctctct    121200
     tctcgcccac ccctatcgct gcacttcttt gctcacgtta agtcaagcgc caaatccgtc    121260
     cttttcgtct tgccatgata cttgatttgc ctcttcttcg cgtctccgtc tgaacactat    121320
     cgctccgtgc actctcacga aaatccaaaa catgtctatc acacgtaaag tcagctgtga    121380
     ggctctcgag ctcaaatcag tgcgacacac gttttcggcg agcagagaca catatcagac    121440
     aacggataga accgagtaag gacggcaaag ttgtcttgtg attgcctcga atcgaacgtc    121500
     gctctcgata agatcaggat tcgatcatgc tatcgtcttg gtcgaccaga ggatgaagcg    121560
     tagcatcaga tcgcacgcca gcttgattgg cagcgagtcc agccaattcg ttggctagtc    121620
     tgggcaaatc tgaatcctcg aaaaacccaa gcacggtagc cgcctctttc tggtaatcct    121680
     gcaaaagcag agtgataaag tggtcaggag cgtcatggaa gcgtgcttct agcagagatc    121740
     gaagccgctt tccttgctcc tggcgctcca ctgggtgtgg atcggtatcg tcgctaacgg    121800
     catcgtccaa cttggcaaga tcaccaatgt caatccacgc gtgtctgccc gagccgtcct    121860
     gatcacccaa cacctcgcgc aacacagcgt acaacccagt gcactttaga tcttccaaga    121920
     gcgtctgatc cgagacattg ttggtctcgc tcagactcac ccaatcgtcg cgaatcacgc    121980
     ttcgcctcca gatggccttg agacaagcat gtcgtctaga ttcgggcatg ttgctcgatg    122040
     ctcgaatcag cactttgatc gccgtggaga agtcttccag ctgcgattcc ggggtgtcct    122100
     tgagcgtaag caggtcgatc agatcttccg cgccgaggta cgtgttggaa agcacaagtt    122160
     gctgaattag ttgcatatag tgctgtcgat acgccgcgta ttcggcgaga cgcgaagcaa    122220
     ccgtgtcgac aatttcgttt gcaagtttat ctgcagctgg cgttccagcg gtaggcaagt    122280
     ccacgggaaa cccgccagca acactgtttt cccacagagc cacaagcgaa tcctgaacag    122340
     cgatcaagtc caaatagtca tcgaaaaatt cgatctgctt ctgaacgccc accgtccgca    122400
     aatcttgcac tttcaaagtc gacagatatc cgagtttggc caaactcaac atgagtttcc    122460
     tctgcgaaac gttgctctcg accagtccca gctgctccaa tttagtcgac gccgcagcga    122520
     accgttgcag cgcaagatcg tgcaaccacg ccaaacgctc tttgcccggt tggctgagga    122580
     acgacagcac gagcgcgtga tattcggatt tctgcgtgag cagcgttcgc tgttgatcat    122640
     gttcaacgta ccatgtgtag agttcgtagg cgaacgactc ttggtaacgc tccagataag    122700
     tttcagtgcg agcgtcactt ttgagcgcgg gatcgttgca cagctcgacc aaggttcgga    122760
     agtccatgta ctgctcggcg agcgtgaacg ctcgatccga gcggccgatt gtgacgagag    122820
     gacggatgaa cagaggtcga gctgtgcggt aggtggtggc gaacacggcg aattctcgct    122880
     cgaatgcacc gctgtcggtt gcactggctg cggcagcttg taggtactgc agtcgctcca    122940
     agtaacacgc cagcgcaatc tcagcgagcg agcacagttg cgtcttgagc tcggcttgaa    123000
     ctcggtgctc ccgcttcaac tcttcgctaa cagcaccaga aaactcggtg gatgcggcat    123060
     cgatgctcga acccaattcg cgcgttcggt cgggaatcaa attcaccgtc aatgcaaaga    123120
     gactctccag gagctgcacg gttgcacttt gagctgtcca ggcctcgaac gctatcgttg    123180
     ctgctgcctg cgctgccggc gctgccggtg ttgctgctgt tgctgccgtt gctgccggtg    123240
     ttgctgctgt tgctgccgtt gctgttactg ctgatgtact tacaccactg tccggctcga    123300
     gaatgccgta cagtgctcca ctctcctttc tgtacctgag cgcagctcgc aaagcagaca    123360
     tcacgaccct attgaactcg agcacatccg tggacctcgt acgcaacggt tgagccgaga    123420
     tgctcttggt ctgctttagc agcctctcca acacctcggt cgtcaaatcg gcatgatgcc    123480
     ggaagaattt gcgcaccaag tcgtctgcgc tcgtgcccag tccttgttcg gccatcacgg    123540
     tttcgatgga tctagcgagc ggactctgtg cagccgacgc gtgactgtgt gttgaagtgt    123600
     aaaactcgtt ctgatacacc cacaattcgc tgagtgctgc tgctagctcg gcatcggcgc    123660
     gcaactgtcg ctttgtcgtc tggggcaact tctcaaggtg accacatgca gcgacaaact    123720
     ggaccaagaa acgcagcttg ccaagacgat ccttgagtgc ggctcgaaga tccaccgagg    123780
     gcgcaacgct ctgtgagatg gggttgctaa aagtcaaaag ctcacgactg aggtcttcgc    123840
     acgccgtcat caacgttcct tgcagatgag acgcaagttg gaaagtgaga gggttgagag    123900
     gcgattcaga atagtagagc gcctgttcga gcttgctctt gagtcgttcg gtgtcggcgc    123960
     gttgacgatc agctgctgaa gtgtaggcag tgcaacgatt gcggatctca ttgacactcg    124020
     tttccaccaa cagcgagcca gaggtagccg agatgagcga aagcgctgca atagcatgat    124080
     ttccgaagtc gatcgagtcg catccagtgc cgatgaatcg gttcttgacg tcgtccttga    124140
     gtttgatgac ttcttcaaat gtctcacaac ctgactcgag ctgcttggcg accactgtgt    124200
     cggcaaagca gataaacgca gcaggtccgc cattgggcaa gctgagtgtc ggcatcgcat    124260
     acgggcgcgg gtccgcgaag ttcgagtagt tgagcgccag gatagaagca accacaaacg    124320
     acccggcgtc cttcacagca tcgacgatgg ccaatccata accaagcggc tcgtgttcgg    124380
     ctttggcttg ggagtagaga agcaccagct ggccgtctga ctgaacagct ccgtcgagaa    124440
     cgtcaaagga aaggctctga gcagcactat acctctcgtc gctgagctga agcacattgc    124500
     tcgcgatgac ttgttggaca tcctgttcgg caagcagacg ctcacctccc tgatcaagca    124560
     cctgccatct ctgcaacgtc ttgcggccaa tcgcgtacac ttcgcggcct tgcttgcccg    124620
     cctgaatggg ggctacggca atcgagacga cttgatcgtt ggacgatccc atcgccgatg    124680
     tcgagccaaa caaacggcta agcaaaccgc gttgttggga gaaaggtcga atctcggcct    124740
     ggagcatgcc ggctctgctg ccgaccgaga cgcgcagcat tcgagactga ctggtggcta    124800
     gcaccaacgt cgactcgtcg acacgctgca gctgaacgat ggtttcagag gtcgacgaaa    124860
     gcggcaccga gatgcgctgt gcacgatcct gacgcgtgag cgaagacgag atgccctccc    124920
     acaggcaagt ttggccatcg ggcgcgacaa ggagcaatgc cggctctctg ttagcgcccc    124980
     gagggatgaa gcagcagtgc gcgaggtcat tgattgccgt catgctagaa gacgaatatt    125040
     gcggcacggg aaacacaaag catgtcggtg agccagtgcc aatcccgcgg ctggagtagt    125100
     tccacacaaa gcactgtgtg cgtgaaacaa ggcaagcgta gcccgtctga acgtcgagat    125160
     gaccctggaa cgcgtcgatg taaagatccg catcgttaag cacctcgagg acctcgttgg    125220
     gcaatctcga ataagctgat acgtgtaccc agcggtcgcc caatagcacg gtgccttcct    125280
     cgagctgcgc ctttgcatcc ttgctcaaca gaggcgggcg tcgaccgaaa ccagccatcg    125340
     aagcagaata agccgattcg gcgacggagc gcatatctgc gtcgtcgttg atcagtgatc    125400
     cttcgcgatc gaatgcactg ctagggctga gaagagatac attggggcca gagatggcga    125460
     gcatggagga aggacgtgga cgcgcgcgtg ttgtgcgtgg tctcgcgttg gtgctcaaga    125520
     agagagagcc ggacgaaaca tcgccggatt cgttgatgtt gttgacgtcg ccacgtctaa    125580
     aagtcgatgg tgaaagaaaa gacggcggag agagagggtc ctgaccaccg aatacaggcg    125640
     taccagcacg agatggatga ttggctgaat gagacgcgcc gacaccagca cccaccagcg    125700
     gtgtcgacga ccttgcatcc cttacccgcg agggcgtggt aaacattatg gtacactaac    125760
     gttttgctcg gaacaaaagg tcagaaaaga aaggtgggga acgttcttgg tgatgaagac    125820
     ggcaatgaaa aggaaggtag atgagtttca gatggtcaaa gcgaaccttt tcccacattt    125880
     tacgaatcaa ctgaccttta cgatttcttc gcgtgccgca taaaacacac gctcgaatcg    125940
     ggcgatacag cgcgttgcag atcgggatcg tccaagctgc atcgatgtat gaaggggtta    126000
     cggttgatca tcgcatcttc ctgtcccgca accagcacac agtggataaa actaaggcct    126060
     agctgactgt cagacacgac ggcctagaga caaatatagc gatgttgatg catagagaac    126120
     gatacgatgc aaaaagacac atgacaaaga cctggagagc gtgcacaaag tgttcggaca    126180
     aagagttgct gatgggcaaa ggagacggct gagactgaca gggaggtggc agatagcaag    126240
     acgagttgac gtgcgtgtaa aattatgaca aagacgaatt gttggcagag ataaggagga    126300
     gttggagagt atcgagtctg aaaaggaaca agatgaacgg aaaatcagaa cgtaggggaa    126360
     ggcgagttga ccccggaatc ttcttcttcc tcgtccatcg cttcatggat cgagcgcatc    126420
     atatcgacct caactgcact tgatggatcc gagaaactcc aagggaaggg attcgctgcg    126480
     ccgctcattt cagagtcgtc tgatttcggg gcaacctcgg ttggatgtgc aggggacgcc    126540
     agcggccttc ctcccggacg ccaaattcgc aacgaatggt cgtcaccgca tgaagccaag    126600
     gtgagagaat ccttgggatg ccaggctaca tcgttgacag ttcctccgtt gtgaccttcg    126660
     agcgtctcga tcaggcggcc gctggcacga tgccaaatgt agatcttggc atcttcgctg    126720
     ccagacacga caaagttctc gtcgataccg ccaaagccgc atccgatgac atgttgatgg    126780
     atcttgtgcc cattgaagcg ccttaccaag cactgacggt tgatatccca catctgcaac    126840
     tcgctaggac gcacattgat gagcgcgtac tgcgagtcgc cactgaccgc tagactgacg    126900
     acttcttcgc gcaggtagat ggagcccagc tcttcgcgcg tgcgcagatt gataaaatga    126960
     atgcgatatc gctcggtgcc catggtccgc gatccacctc ccaggtcggc ggccagatcc    127020
     agatcggctc gatcgtgaat gataccggta gaggccgtcg actgggaaga agtatcgctg    127080
     agctgatcag atgccgtgga gatgctcaga gcggtggatg agctggtgtg gccgcgagtt    127140
     gtggacgacg agaggccagt ttgcgcgact tggcgtgcac tgagagcgac cagatgagcg    127200
     ccgtccggcg aagcagccac gctaaggacg cggaagggtg acgtggtttt cttgtgcaga    127260
     acgtagccct gcgtgtccca ccaaacgatc ttgccgtcca tgcctccagt gacaaagcca    127320
     gaaccgtctg cgagccaggt tgcggtagct actgtgtagc tgtgttcgcg aagcgtcagc    127380
     atgcttcccg tggcaagtct gcaaagtgtg acgtcgacgt ccgaggtgac gaggagctgc    127440
     tcatcgtctg gcgaccaaga aacagacgag atgttgtccg agagcggaac aaacttttgc    127500
     aacagcttgt aatcgtcctg aacgctccag atcaggatgg tcttgtcagc acctgctgtt    127560
     gcaagtttag tgccgtcgtg cgagaattgt agacaccaaa cttcgtcgcg gtggtccatg    127620
     atgatgatgg aattgtgaga tggaaagacg gatcggtcgg atctatggtc ggtcaagagc    127680
     gagaagtgag agccatgagg agaattgaaa aagggatcct gttgcttctg aaagctctgc    127740
     gcctgctcga gcagctgtgg caagcgccga ctgggaatca tgacaagcgg agagacggca    127800
     gactcgattt cgaccatgag caacctgcgc gaatcaccgt cggcaccatc ccagccagct    127860
     ctagcatgga gctgttcggg cgaggccgag atgacgagac tggagagtag atggagctgg    127920
     gatgtgtcat gactgagcgg ggtgagcttc tcgcgtagca cgttgagcgc ctttttggtc    127980
     tggcgagcct cgagcagttc gaggtaacgc tgcttttgca acatgaagcg aatcgagcga    128040
     aggctgacca gatccggtct tcgaagtaca gagtcgatga ggtcttggtt cgacgagtcg    128100
     aggacagccg gcagggatac cgaggaagag gcggtggagg atgacgcagg tgcgtcgagc    128160
     aacgagctgc cagcgctgct acctagtggg ttgcgcgagg cctggatgcg cctggcagcg    128220
     taggtgaggc catcgatgag aagtctctct gcatttctcc aatcaccgct gaggacggca    128280
     gtgcgaaaag ctgtaatgga aggatgctcg agtgtgatgc cagattcggc ttcgagcgtc    128340
     ttggctgccg aatcgaaccc catctcgcgc aaggattgga gggtaagctt gacgagctct    128400
     cttcgatcga tcgagcttcc gggaaagagc ggagaaaagg cgggagcgtc tgaatagtct    128460
     tccaacgccg agacggctgg tttaccattg cggtgaccat tgctactgcc gttgatagtg    128520
     tcgaatttga gggagtgatc gctgggtttg cggttggagg aatcgccatt ggaatgggcg    128580
     gaagaggtgt tcttggccat tttgtcagct gcacccgtca cgactgcgag attagtcgag    128640
     tgagagggca gtagatgggt gggaagagga cgagattccc gactcgagag gacacaagag    128700
     aatcaagcct agctcttttt ggagttggcg cctccgaggc aacgagaggt cgagcgtgta    128760
     gacgtggcgt cctgaatgtg tgctggcttt tcccgccgag agagggttga tgacttggta    128820
     acggggtggc tgatgcaaag cgatctgaga atgagtgcct cagcagagat gcctgcgcca    128880
     agttgctgga cgtcgacggt aattacggcc gagatgctgc agcgacggga ggtcaggaga    128940
     ggacctagaa agcgggacgc aggtgttgct ggcgctgtgg tgctgtggtg ctgtgagctc    129000
     ctcctcgatg ggcagtatgt acacccgtac cacaaatgga ctccccaatg aggttggggg    129060
     tgatggtgtg ccaaagctca agtatgggta ttgagcagtt ggacagtcgc tggctgaggc    129120
     gggacacaca caagcagtgc tggtgaccga aaaggttcaa acaggtaagc cctgcttcat    129180
     aaatgtgtcg acgaggatga tggtggaann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    129240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    129300
     nnnnnnnnct cccgatccac gatccacgat ccacgatcca cgatccacga tccacgatcc    129360
     acgatccacg atccacgatc cacgatccac gatccacgat ccacgatcca cgatccacga    129420
     tccacgatcc acgatccacg actctgattg acacaagtca cacagtctta agttgaaaag    129480
     attctaacac tctattgcca ccgacgcttg cacctaatcc ccttctccgc tcgacttatc    129540
     cttagagcgc atctcgtgat tgcaaacaca catcaactag catcacaatc acacatctct    129600
     ttctctgtcc agtagcggtc tgcaaaaagc cactgccacc cgtgaccctc gcaggatcag    129660
     tcatgtgaga gagaccctgc agtctgagtc acaagtggag gttgcgtctc cgcgaaccgt    129720
     gaattcgtga attcgtgaat gaaataaaaa atcgtttacc tttttatcta atcacgactc    129780
     gcgaatcacg agattcgtga ttttgggttg caaggcgtac gttcagcata atgagccctt    129840
     cgatgctaca tacgactgta tccccgcccg ttgctcatac catctgctca cagtctaagt    129900
     cggtgtacac gaacaaagac acaccacaca ccacaacacg tacatggtac acatcaatac    129960
     acaaacatat aaaaaaacaa caactacaag acttccggca tagacaaacg ccgagtggcg    130020
     tggaacatgt gctgaaagaa gaacgaacgc ctctcgtcgg ctctgccctt cacttctctc    130080
     cacgagtgac aaagttcttg gcaaagcgga gcatcgcgcg aaagtcgggc atctcgggtc    130140
     caccgcccac tgcggtatag ccgccattgc gactcggcgc acccatcctg ccttcgacgc    130200
     tgcgcagtgg aagccgctgg ttcgaagcgg catgcgtcac gagcacgtgg gccagccagt    130260
     acagcggcag cgcgtcgttt gacagcggtg tggcgcctga tgcggtgagc ggcgtaaaca    130320
     gggtttgttg cagctctttg ggccattcat gtttgccttc cgtagcggtt gccacgttgg    130380
     cccagtgtac gttgccatcg tcgatagaat ccattccatt cccgctcgtc gactttttgg    130440
     ccgatgcaaa ccggcacgtc ggatcttggt cccatgcctt ccgccagcgc gaaagtgctt    130500
     tcttaaacag cgtcacctgc gcttcgttgg ctggtaccga gttaccatcg ctctgtaggt    130560
     cgcccaacct catccactgg cttagagatg atggtttggc cactctcatc gctcgacctt    130620
     cgagcatctc tatgatgcca cgcagcagcg ccaataccat cgccagacgc gcaaaaggtc    130680
     catgcgagcc atacagcgat ggcgagtcca gcaactcttg aagaggagac gcattcgcct    130740
     cggacgaaag cagctcttgc agggcttcat ccaacgttag acacttgtgc gtcttgagcg    130800
     ccgtgctcca gctcgatgca gtaggtgctc gccaaacgtg atccggcatc ggcagcggca    130860
     gatgcgctag ctccttggtg gagagcagcg tcggtacagc tgcgtccaag tgcgcaaccg    130920
     tatccaccat gtagatgaca aacgcgcttc ttctgcgccc ttcgagctcg gcccatcgtc    130980
     gccatatttt ctccgagtcg tccttctcgg cgccataaga agggaagaaa ggatacgaga    131040
     agcacatttc caccgactca aacagcacct gttgcatcac atcctcggcc gtcaaagaca    131100
     tgcctcgttc agcatgctcg gcatcgcgat caaagaaccc cgcctgtcga gccatattca    131160
     ccaccgcgcc gtgcgagacg ccggcaacca tgcgtgtcgt agcatcgctg ctcaggaagt    131220
     tgttgctctg gaacagcatc agcgcctgta ccaccgagca cttgtccttg acgctcttgc    131280
     atcggctcgc aaacgcgcgc attagcatct cgctcttttc gcccatcacg atcggcttga    131340
     ccagctcttg cccatcctct tcgtcgatca agcggctcgg acccgtgttg tcgatgagac    131400
     gctgcagacc gttcgcagac tcggacgcgc catggctgtt gatgatgttg atcgccgact    131460
     tgggtatcac ctcttcgccc gcccaccatt tgcgacccgc ctcgtgccct ccaagcatgc    131520
     acatggcaaa agcaatgcag ccgggtgtgg tatcaatccg gaacgtaggc tcgtgaatca    131580
     cagggaagtg cttgagcaga ttctgctgtg catgcagtgc cagaacactg aggcgtgcga    131640
     tcggcggcag actccaatgc tgcaccgagt aacatggtcg aaacatgtct ggcggaatga    131700
     aaaagggatt ctttacgtcc gtcagcgcct tttccagcgg agtgggcagc acctcgagac    131760
     tggtcaagtc gagccccgcc gtttcgggtg cagtcacgtt tttcgagtta aagtagtcag    131820
     aggcattagt ggtgtccacc ttgcccgatc ccgccgttgt cgagaataca ctgagcagct    131880
     gctggatgct ggggctcatc agccagccta gcgcactcaa ttgcgcactg ggcatgctgt    131940
     tgctcgccgc agctgcagct gcagctgccg ctgcagcaaa gctgccggcg ctcgggttgg    132000
     aaaacatcga gtggtcccaa ttaggggtgg agaattgaga tgcaccgagc ggtgctgaac    132060
     tgagcggcaa gccatggcta ttcaaaaagg agatttcgtt tccgtggatc ccggctctca    132120
     actcctgtac gccaccctga agcctcaaaa ggaaagcttc gggtcctggc gagagagccc    132180
     ctccatcaaa atactgctgc gactcgttct tgacaaagcg actcggtgta tcgatgccgc    132240
     tgttgctgat ctgtatcggt gccgacgttg tgattgcacc tctgccccca cttgcagccg    132300
     cactcgtcga aggcacggcc gcaacagagg acacggacat cgatgacgtg gcctgctgct    132360
     cggcaactgt cgctgctgat gtcgtggcgg tactggttgt ggccgacttg gcatcgttgt    132420
     catccgcggc cgcggttctg tcggaaaggc tgaacctttc gtgcgacgaa ctctttgcga    132480
     gcttactcga cgcagcgatg ccgtccgact gaggcgaggt gctctgactg tgccccgaaa    132540
     tgttgatgcc ttgcaagctg ttgtgtcggc tcaccgagcg ggaaggtgga cgcatgccgg    132600
     tccattggcc gcccagatcc agtgaagcca gccctccgcc tggcgtggtg ggcaactgcg    132660
     atcgcggact cgaaacgagc ggcgtgtcac gtgcattgga gaaggcggag agatatggcg    132720
     acatagacga attgagcgca gtgttggaga agggcgagag cggtccgagc gttgacacag    132780
     agaagcgcac aggttccttg ggtgttgtgg gtcccgaagc ctcttgaccc tgcgacatgc    132840
     tggtggcagc ggtggcatgg gaagtcgagt gacttgacga cgaggttcca gtatcagccg    132900
     aggacgtcga ggtgccaaag gaaaacgctg ggctattgga gctattggag ccatatacgg    132960
     cacctgcgcc tccagagata cccggagcga cggagcgaaa gtagctggcg tcagatccca    133020
     aatgtgatcc ggtgcgcgag cgatcgccga ggtggcccat gggcgaagtg acggagaagc    133080
     caagcgacgc gagcatgctg gcagtggcac gcgctactga gccaggagtg gttgcagcag    133140
     catggccggg cgagggcagc ttggcagtat ccagaccttc ccatatggca gcgtcggtag    133200
     gattcgcaaa cgccgaggct tgccgggctg tatacggatc gtagccggcc gcctgtctac    133260
     tcaagctaaa gcgggatccg gaattgctgc tgtggcgtgt aagggattga ccaccgtagc    133320
     gtgggctgcc gtgctcgctt ctggactggc tcgactcggg gctggagggt tggtggagct    133380
     gaggatggag cgcagctact gccgagtgaa cgggaagcgg gaagggagtc gaagcgtacg    133440
     ggttaactgc tcccctcccc atatgaaaat ccggagggtc catggagttg gcatattggt    133500
     atgccgccac cgagctgatg gcagccacgg tggttgctgc cgcagcggcc tgagcctgcg    133560
     aatcggcggc gatggcagga tcaatcatgg cggaagcatc ttcgggttgt tcttgagcgg    133620
     tagcgtgatg gtgacctgct gctgctgccg cggcagcagc ggcggcagct gcgacagcga    133680
     tggcatcatg tgtgagttgg tccgactgag gagcaggcgg aggtggtgtg gggccgttga    133740
     tactctcgga gcagaatacg ctcaaatttg gggcaccatc tgcagcagcc gtatcggggt    133800
     taccattggc accattggtg gcggcggcag cggccgcctt ggcggctttg gtggagcctt    133860
     ttggcctacc tggtttggca gcggtggagg atcgtcgggg cttggagacc ttgggtgggg    133920
     cttctccctc tgcgggtttt tcggtttcga cagagccgtc gaggtgcaat acgacacggc    133980
     attgtcgctt atggcgagag aggacgtcgc ttcgcgagaa accctttccg caatcgcaga    134040
     cgaaaggacg gatgtcggca tgccttctct cgtgacgtct gagatactca agtcgagagt    134100
     agctggtgga gcaggtgggg caaataaaag gaggaccgct aggcacgggg ccaccggcga    134160
     catcagtgga aacatcagcg gcagcggcag cggcgtcatc gtcgttgtcg tgcttgcggt    134220
     cttcgttgga agcattggat gcagtcgagt tgcgcttctg gatcttgcgt gccggccctg    134280
     atggaatggg tgagtgtggg cgagagcgaa cccgaccgtt ctctggctcc gcggccgcac    134340
     caaagtagtc gctttgcatg gcgtaagact tgtgagtcat acgactcggt gaagaggaca    134400
     gcgcgcccag cagagaagag acgggcgagt tgcaggccaa ctatggggct tgtcagccgg    134460
     agccgagctt gggtggaaga cgagaagagg ccgattcgtc ggtcaaagat gtgatgtaag    134520
     ttcaaagaga cgctgatggg tggctttcaa caacaacaac aaaaagctgt gacagcgaca    134580
     gctgtgagac gaatgtattg ctgcaagagc gacgccagtg ccttagacga ggccaaatgg    134640
     tcgctcgtcc aagctaaaat gtcatttgac ccttgagatc caaatgaggc gagggcgtat    134700
     tcgaagctat gcgaacgcag agggatggga cgaagatgaa gatgctgtgg tggatgtgat    134760
     tgacgatcgg gtgcacagaa agcgaaagaa tgaatgccgg atgggtaggc aaatgtggtc    134820
     gggggcgagg gtctgcaagt gacacaaaga tgtggtgaga gggaatgtcg aacggagagc    134880
     ttctgagggt accagtttgt ggaggtgaga agacaggcag ccagcagcga gcaacgagca    134940
     gcgagcggcg agcagcgaac aacagacagt cacaggccgt aaggcagctc caaaaaaaaa    135000
     aaaagggcag gctgcagagc gcgagcggga aaagctctga gcatcaagga tgtcggcctc    135060
     acacgctcaa ctgctcaccg tgctccatgc tctgtgctcc acggctcgtc agccttgcgg    135120
     agccaggtgg aggcattgga ccagtcaaac cacaaacaaa aaaaaaatta gcagaaaaag    135180
     gaggaaattt ggcagaacac gaaacgcgag agaaatccaa tcgtgaatca ccaagccaaa    135240
     agcgtgaatc acgaatcgtg aatcatatat ttaattatga tcacaaccgt gagcagtact    135300
     cgtgagtgat tcacaattca cgatttgcgc tcagccagag acgacggcgt ctggcgcggc    135360
     tcatcagcga ttcacgattt gttgcctcaa agccgatcgt gactaactta gcacagacaa    135420
     cagcatcggt agatcgctac ggcacacgct tgaatggcag cgcacaatcc aacaaagtcg    135480
     tcaacaagcc gttggcatgg ctcgagcggg tggacagcga ccccaccgaa gcaagcaagc    135540
     cagtcaatca gtaagccatt cgtgacttgc aagccaaatc cacaccggtc tgtgatttcg    135600
     gcctgcactt gtccattcaa gccaagccac tcacgacctg cgtttcgtaa gcaacgcgct    135660
     acccgattcg tccatataga atcacagtcg tgaatgattc tgaatttgaa atccatctgg    135720
     tattcagtga ttgttctgtg tttcgtgcga atttgcaacg gctgtaagcg tcgatggcgg    135780
     tctcagaaag agggccttct gcctgccaat tgaacactga cgaggactct caatcacgaa    135840
     tcgtgaatgt ctgaccaaga cgctcgccaa cgctttgcgc aggccatctg tcttctactc    135900
     ccgctcataa ttcaagacga ctcaaattgc gacagatcgg caggtcatgc ggacccttct    135960
     ttcgacgtag cgctccgtgc tatggccttg gcctggttcg ttggctgcca gaggaacagt    136020
     gaatcagtga atgtggcgca ggagcagcag cagcttgtcc tggtcagtgt gattattttc    136080
     cacgacagat tgtatcgcac gaaataaaga tttgcaaagc cgactcccga gtcgttgctg    136140
     cagctgtgta gggtccacca caaccaacac catgacgctc gagttcagca ctctcgttcc    136200
     tccatcatct tgcatcacac acaccttgct gcctcgcttg ccatggcatc cacttcaaca    136260
     gcctcccagc catgggacgt cttacggcgg aacacgcgca atctcgaatc agccatcgat    136320
     gcacgcctta ccacctattc gcaactcgcc tctaaaatcg cacgcgctgc ggatcacaca    136380
     acgctcgaca tgacgggtgc cggatcctcg tctgcatctg aaacccggga gcacagcgag    136440
     catgtcgagt tggaaactga gctggaatcg ctgatcaacg agctctcgaa ttcggtcgat    136500
     gctctgacag ccaaacttga cgatcctgcg atcccaccga ccacgccaca actgcacgcg    136560
     gttcagcgac atcgagaatt gctcttcgac tttacgcgcg actttcgtcg gtcccaaacc    136620
     aacgttcgac acgccatcga tcgtagagat ctactgggta acgttcaggg agatatcgac    136680
     gcgtataaag cggctcatgc atccgatgca gatgctctgc ttgccgagag agcaagaatc    136740
     gacaactcac acggcatgat cgatcgtacc ctagagtatg tagcgctccc ttggtcaaat    136800
     ccttccccct ccgacactca cttacattgc cctctttcac atcacctcac acagacaagc    136860
     atacgcaaca cgtgccgact tcgcagatca acgctccacc ctccaagcca tttccactcg    136920
     aatgtcttcc tccgcagccc aagttcccgg cctcaactcc atcatcacgc tcatcggtag    136980
     aagaaaaaca agggatagcg tcatcatggg ctgcttgatc ggtactctca ccgtgctgct    137040
     tctcaagttc gcccttggct gacctgcgca ggcttgactt gtctctcttc catcctcaca    137100
     tgccaacaaa accgtagact cccgcctgaa tcaaatatct cactcgcaga gtggctcttt    137160
     caatgtcaat tgagccgcaa aagaaagaca gtgcacaatg gagagcaaac cattggtatg    137220
     agaagcaaaa cgtacatttt gggcaagtcg aaatcgaatc tgccatcttg catcgcaaga    137280
     tggaggaagc atccgcccgt tcacttcaat agagaagctc gcgtatgagt cacaactcct    137340
     cgtcctcttc tttgatctgc gacggcttca gcatacccgg tacggtggcc gccttctcgc    137400
     gctctgcggc tgcttttcgc tgcgcctcag cctccctgtc ctcagcaaac aggtccgcgt    137460
     tgtccgaggc acctgtgtta ccgccaaaca tttcgcgcga cgtgatcagg aagtcacgca    137520
     gatgcagttt gtacgcaatc aggtcgctcg agtgcataca gagaccgttg acaaacgact    137580
     cgacgtactc agcctgcata tgcgggaagg cagtgcgcag caggttggtc gtgtactgtc    137640
     ggatgaagag ccggttgttc atgttaggat ccggctgcgt cgatggatcc cacagcggtg    137700
     ccgtaacccg gtctgtctcg atgagctcaa agatacgtgc cagcaaaatg cactgcgtct    137760
     tgaagccgct cttgtggtcc gagtcggtaa gcacaaaaaa gatgtcctgg ataatgttca    137820
     gcaggtactg ctggtagaag ccgttggcca cttcgagcgg cgatccagaa atgttggtga    137880
     gaagttcgag acagatgttg agacccgtgt cagcaatgtc acgcatggta tgcttgatgg    137940
     cccagatgat gctgtccatg gttaacttga acttgggtgg gggcagctcg agcaacgcgg    138000
     ggaagcagta caggttgatg gcacgcagca gcttgaagaa gccaacacgg tgctcaggaa    138060
     actcggcgaa atcctggttg atcatgttga gcgtgggctc aaacacagca tcgaggatgg    138120
     gtgcaatctt gtccgtcaac aagccttgca ggcgcgacgt gatggtggcc atgacgttga    138180
     gcacctcggc gtctcgtgca gcaggtacgt tgtggttgta gtcgccgagg atggcatcga    138240
     gcaaggatgg gatcagattc gtgttgaccg attcgaggtc ctcggcacgc ttgacgtatg    138300
     tctcgacaag gcgcagaatc tcctttttga tggtgcgcag gccacgtacc atgggtgtct    138360
     tggtagcgat caggccttca gcttcgacct tggcgctgat gatgccactg acgctgcggt    138420
     agagtgcaag catgtcgagg tagatgcggc caatttgggg taggaagaag gtgcctatgg    138480
     agacgcaggc agagacgttg gtcttgagca cattggacag aatcttgatg ttctcgggac    138540
     tgctgagcac atcgacgttg ttgtgcgcct gctgcataag gttgtcccat gcgctgttgg    138600
     gcagctccat tagcttggcg ataagacgct cctgcgtggg acggttgggc tgtgccgcga    138660
     tcatgtagcc gaccgcctcg tagaaggtgt gtacctgcaa cggcgagagg tccagcgtga    138720
     tgcggtgcaa gttgcgcaag atctcgtcga taaagggctc ctgctcgccc gcctgttgga    138780
     tgacaaagtg gcgacgacac ttttgtgcga tcttgatgta agtatcgcat gccatgtcct    138840
     ggacaccttc atggctctcg tgcataaact caaagttctt gttgaccaca gtcttgagga    138900
     acttccagtg tgccttgagg aagcgcggat actggccgac aatgtacatg atgttggaag    138960
     cgacgacagc cttgttgtcc ttgcctcgct tcatctcgca gagcccgagg aggtccttga    139020
     tgacggtaac gaggaagcgc ttctcggtct cttcgttcat ggcgcccgag atggaaccga    139080
     tggcccagca gagcgtgttg aggttggccc acgaccattc ggagccatcg acctgcttag    139140
     caagcttttc agtcatgatg ttttcggtat cgagcacgtc aagatgggtg aggtagacga    139200
     gcacctcgcg catgctcttg tacagtacaa tggtgtcgct ctccttcata aactcgcgga    139260
     cgatctcgcc ctcgtcgttt tcgacgatga gcacctcctc gggcttgacc atgcgctcga    139320
     tcatgacgag cctcaagttg gagaggatgt ctgcgtagat gtttttgcgc agattggccg    139380
     agcttgcgtt ggagacgccg ttgccgagat tcagaccgag aagcgggttc atctcggcga    139440
     tgggctgcga ctgctgttcc tcgtagagct cgctgacgag cttggaccag tattcgagac    139500
     agatcttgaa gacttcacgc tcgggcacct gcgatacctt gatgagatac atgtgggcgt    139560
     tgagaagaac gtccttgttc tctgggtttt cgactaatct gaggtgggca gtcaggaagt    139620
     tgcagaggaa aagcgcgaga ttgagcacaa gctcctgttc cgagtcggcg ctggtctcgt    139680
     aggcggctgc aatgttggtg gcgggcggga tcatgcggtt gaccgaagtc atgaccatgt    139740
     taaagagaac gacaaacttg gggtcgtact ctgcgccgac attgaggttg gcgatctcgg    139800
     agagacactt gagcgtgacg ttgcggaact cggcgacttc aaggaagcgg ccaatgagat    139860
     tgtcgatgac gttggtctca aagatgtagc caagtgggat ccagttgagg aagcgcagca    139920
     tggtctcgag ggtggccttg atgaggctag gcttctgcgc cttttcgagc acctcggagc    139980
     agagctggaa gacttcgccg aattcgccgc acatctggtt cttgagcgat ttggtcttgg    140040
     agatggtcat ctgttctgcc gagtagtcaa aaatttcttc agagagcagg cgaaggatgg    140100
     ccatgttgtt ttcgcagatg gagagggagc ccttggaaga ggagacgatc tcggggataa    140160
     acgagggcca gttgtggggc cactcctgtt tgagaatctg gataagggta gtgttgagct    140220
     tgccgagata agtgcgttct cgcttgaggt tggcctcgtc ggacgaatgc tggatgatca    140280
     tctcgacgat aaagttgcgg atgccctgct gctggtcctc ggggagcacc ttccaccgtg    140340
     tcgagatgag cttatcgaga atctgcaagg aaatgtattt ggtctgcggc gaagagctct    140400
     gctgaagaat gacgggcaca cgctgccagg catcagggtg ttcttgaaac tgagcaagcg    140460
     tctgctgcgc catcctctgc tgctgaccgg caccagtgta catggcggct acgacattgt    140520
     ccaagagacc gatgtcaagg tccttgtcaa agtccaagat tccctccatg gtgaagtgtg    140580
     ccgaggcgag cgatccagaa tcaagaaggc acggagatac aagcggcaaa ggggccgcag    140640
     cgtcgaatgg acagacgtgg gcaacagagc aaagacgatg cacgcgcgtc aagtggagga    140700
     tggtcgaaag gtgggcagca agagcgatgt cacgcgcaac cgagcacgat caggatggtg    140760
     tcaaacttgc ttctgtcgct tcgtcggccc aattgcaatg gtagcaggaa gtggtccggc    140820
     gaaatcgggt gtagcgtcca agtacaggct ataacgcccg aaccgaaccg aaatgggtct    140880
     gcttcaacga gggagagaaa atatactcga tgaatatatc gcgcggctac aagagagcaa    140940
     gctttatggc gcgctatgcg gaaaagttga tggacgacgg tgtgaaagga gaaggtggtg    141000
     tagtgaaaga tgaagaaaag agcaatggtg gaggctcagt gccaagatga acatcagacc    141060
     gacggacgcg ccatggaccg agcgaaagga acaccaaaca gacacgcaca cagcctctct    141120
     gattcacgat tctttcatgt ctgtctctgt ctctgttctc cttctcagtc tctgcctgcc    141180
     attttcgatc cgtgagctgc acaacaaaca attattgttc agcattttct ggcgctttcc    141240
     aaccagccaa ccagcaagca agcacgcgct ccagctcagt tctgtctggc attcgttcga    141300
     tttacgttgt tcccgattcg tgattcacga tttgttgatt ttttcacctt tttcgtgatt    141360
     tccactccga ccaaatctac acctcatcga tctcacattc ttcgacagtt gtccgtggct    141420
     gtgggcaatg ggcagtgggc gctgaataac cccgagtgat atatcttggt ccgttctgct    141480
     ttgccttgat agccgaccga catccagctt ggccgcgtta catgtttgaa agcgcggcga    141540
     ccttcacgct tgggatctag attcacgatt cacgaatcac gataacgatt agtcaacgtc    141600
     ggctcggttt gatccgtgac cgaacatgcg ctgagcgaaa ctcacgactc gtgactcgtg    141660
     actggttcat cacggtgatg caacggtgat gcaacgagca ggcttcctcc tcacaaacag    141720
     ggcgcattga ctggtcgccg agctcagaga tgaacaatac agactcgtga ttccagcaag    141780
     atcgttcgag cttcatgtgt gcatgtcttc gtgcgaatac aaagccgggc ccaagaacgg    141840
     ggtagaaccc acaaagacaa caagcgccat gttagaccgg acaacatcca cagaaaatga    141900
     caatcgtgaa tcacgactcg tgaatcgtga atgacccacc tcccgtgtct tttatgtttt    141960
     tcgagcggac gaatcagcga aggcgtacgg tgagaacgtg cgcacgtgtt ggcagtagcc    142020
     tctccgcaac gtacatcgaa tggtacccac actctgactc acaaatcagt tttacttatt    142080
     caggtggact tgcgccaggt cgtctgcagt accaactgcg tattgcttac atcttttccc    142140
     cctccctttt tttcctttta attggggact gctgatgact gtcgccaccc agtgttcgat    142200
     atgacaatgc tgaagatcca gcaggaacga agagtgcgca aagagtggat cgagtagaca    142260
     aggaaagaag ctgccaaagg agagcaggga aaaaagcacg gcagaaggca tcctgtttgt    142320
     ccagatggct gctctccagc ctgcttgaac tcgtacattc gtgattcgtg atttgccaaa    142380
     gtaagcaagc cgtgtcggcc gacggagcgg agctgcttgg ctacgtgcag cgaaatttga    142440
     gccgcgcccg tgcgttgcgc tagcgtgtag gttggtgtga gttggtctgt tgttcacgtc    142500
     tgcttttgtc gtagctacgc ttgctgatca gcatgccacc accatccgac atcgctcatc    142560
     gctcatcgct ggcatcgtgc ggtccaagga accactcgat ctcttattct ctctcttttt    142620
     cagcaaggcg ccgccgtttc cagccttgaa aagagcaagt catcggttgc tccgagatcc    142680
     atccatcggt acagccgcct gcttccaagg gactggactc gaaacctcgc tctccatcta    142740
     gccagccatg gacctcgtat aacggcgcat cgctgccaca agtagattga aacgagaaag    142800
     ctttgccact gatccgagtc gctcttgctt gtattcgccc gcgacaagtg cctcgctgcc    142860
     gctgctcgtg gcagttacca actctgttgc acatctcttc cgagctcttc cgagctcttc    142920
     cgacgttcaa gtatcgctga ccactcatcg gctgcaccat agcccaagat gaagtttggc    142980
     aagtacatcc tcggtcagca gatctctggc tggggcgcct actacctcga ttacaagttt    143040
     cttaagaaga tcatcaactc gctcgaaaag ggccggctgg gcgatgcggc cctgtttgcg    143100
     acgggcgtgc gtccagaaga gagcgtcaac agccagtcca ccgtctcacc gcaaccacag    143160
     attcttccgc gtgtcgaagg ctcggacgag cttcagatcc acaaagctgc cttcttcttc    143220
     aagctagaac gagaactaga aaagatcaac aatttctatc ttcaaaagga agccgaactc    143280
     aagtcccgtt tgcagacgct catcgacaag aagcgcatcc tttttgagtc tcgcaactct    143340
     tccaagctct ccaaggattc gccttcctat gtcgctctct acgaaggctt ccgctactat    143400
     gaaaaggatc tcagcaagct ccagcaattc atcgagatca atgccactgg cttccgtaag    143460
     attttgaaaa aatgggacaa acgctccaag tctcagacca aggagctcta cctcgctcgc    143520
     caagtcgaag tgcaaccttg cttcaacctc aagttcatcg ccgaactcag tgacattgcc    143580
     gccgccaact tgctcgagct tgagaatctc tcccacggac gctcactcag cgacaccctc    143640
     ggcaccaatg gcgctagcct ctctgcagac aatcgccttg actttgctgc cgctcagagt    143700
     caggacttcg atgcgcttgc cgatctcgaa gccaacctcg cagaggcaat caaggtgggc    143760
     cgtgtcgcac cggccaccga gatgatccgc atcgcagcac aaaacgaaga cttgaccagc    143820
     gtctcacgta tcgtttggcg tgctctcctc gaggctcccc acgatgccat gcgtgcagcg    143880
     ctagcgcatc atctggccga ctacaaattc gttgacgaca tcagcttgcg cacctgtctg    143940
     cacgaatctg ctatggctgg caagctcttc ctcgtccaat cctgcatcga gaacggcgtt    144000
     gacgtggctc agcaggatat ctacggccgc actgcgctct cctacgctgc catggcgggg    144060
     catacagacg tctgtcaata cttactctcg ctgccctcaa tctcggctgc cacatacgac    144120
     ctcgatggtt tctctccgct cattctcgcc gtcatgaatg gccgcaccga cgccgtccgc    144180
     atccttttgg aacatggcgc cagtgtcgag ccacgcgaca caatcgacct catccctctc    144240
     tgtctcgcca gctctggcgg ccatgccgac attgtccatc ttcttttgca aaagggtgca    144300
     aagatcgttg ccaacgccga aggtctgtat ccccaggctc ttgccgcccg cgctggccac    144360
     gcccagtgcg ttcgcctgct cgtcgcatcg ggtggcaacc ccgacgcgcc tgaaaaggga    144420
     acacaatgga ctcccacctt ctttgccgcc gaaaacggcc acgtcgactg ccttcaggtt    144480
     ctgctcgagg ctggttgcaa cgtcaacatt gtcgacgaga aggaccgcac ggctgccttc    144540
     tacgccgcgt ggaacggcaa aattgcttgc ttgcttcttc tcctccaagc agcacagcaa    144600
     agtcaggctc cacctcgaga gcgtcggctt tccaggacgt cggtcgccaa gacttcctca    144660
     tccgccgatg ctgcacacga tctagacctc gagatcgatg gcatccccga cctctcgctt    144720
     ccgccgccta tcattccctt ccgcacctac ggtcacaatt accttgacaa gcgtgcgctc    144780
     gtctctgttt cacttacaaa caactcggtc aagctctata agcatcaaga tccgaatcgt    144840
     cccgaacaat tctcgacatc gtcactcaaa cttgtcatga cgtcgcgccc ggacgcttct    144900
     accactgcaa tcccgcacaa tgtagtgctg ccgctcgcag acgaacgcga agtattttcc    144960
     ttccaggtcg acaggcttga gagcttttcc atcgaatggg aactcatgcc gacctttggt    145020
     tccaaagtga ttggcaaggc ggtcgcatta ccgagctcat ttgaaggtat gacggatcgc    145080
     aagcgcttcg ttcttccact tcaggacgtc tacctcaagg ttgtaggaga ggtatcgttt    145140
     gagcttgatt tcgtcaagcc gttcgacagc gtacagctcg agatcggtgg tcgcgtcgag    145200
     acgtactgga agagcatgct gcccggtgtg gcggctgcct ccaccgtagg acctacaagg    145260
     atgacgccca atagcggtgt cagtgggatc ggtggctcgc tcagcagtaa atcagcagca    145320
     gcgggtccga cgcaagctgt tgcggacaag agcgccacgg caagctccaa cggagcggtc    145380
     ggaactccat cggtcggatc ttctggcgcg gcatctgcaa ctgcagctgc agcgcaaccc    145440
     acgctggtca caggatcttc gcttgcgggc gaatacttgc gcgtggtggt acaggtgacc    145500
     aaggatgcga aagccgtggt atggcctgca caattcatcc ctctgcctgg tctgcaggtc    145560
     tatgttggca gtgttacatc cgaagaattc ctgtcggtcg ccacgcagac aggtcgctcg    145620
     ttggactgga ctccagcaca agcagcgcag gcatcatggg tagactggca gcgcgcactt    145680
     gaaagatcgg tagtgacgct ggaaacgctc ctgtcgcttc tgcctgtctc ggtcggaatc    145740
     gatatcgacg tcatgtaccc ctccacggcc gaggtgcgtt ctaacccagg gatgcccaag    145800
     atggaagtca accaatttgt cgataccatt ctgcacacgg tgtatgcagc aggcacgagc    145860
     aaccgcgagc agagtcgcaa gatcctcttc tcgtctcggt cgccaaccgt gtgcacggcg    145920
     ctcaactgga agcagcccaa ctatgcggta ttctttgcct ctttctgcgg catagatggc    145980
     atggcaagtc tcgaacgagg tcaactgctg ccctcgacac ggcacgaaac ggatccacgt    146040
     cgcgagagca tttcggaagc ggtccgattc gcaaagtcaa acaatctgct gggtatcatg    146100
     gtggatgtgg cgctgctgaa tcacgtaccg catctggtgg agagcgtcaa ggcaagcggt    146160
     ctgctgctga tcacgatcgg caaattcaag cggcagcagt cgctaccgca gttggaagag    146220
     gtggcagagc tggttgacga tgtcgatgga gaggtggatc aaggcattgt tgtctgtaag    146280
     agttagaaga gggcctgcga tcatgtcaag tggttgtcgt tactgagatt ttgcgtgtat    146340
     tgtgatttgt gtggtgaatg gtgggacgga gcacagacga tgcgaggctg cgacatgagt    146400
     gccaagatgg ggatcaatgg tgagaccgat agcaagaaaa tgggataagg tatatagtac    146460
     aaagtgtgcg ctggagagaa actaggatgg ctcgacgtgg cgtgtgatga attgcgtgtt    146520
     atcgtgcgcg cgcgttgtgt gaagagggga tgtcttcttg ggacatgctg cgatcgaggg    146580
     ttcgaaatgc ggttcgtctc gatgcaacca aggcctgagc tgaaatagtc ttgtctatcg    146640
     tctacgctta gcctttccgt tgttcttact tttgtgggcg tcaaacaggc tgttgccacc    146700
     ggagttcttg aagggtttca gacctctact cttgcggtat gtttctcttc tagaatctcg    146760
     gtggcccgaa gtggagatct tgttctgctg cgtagctcca tcctcttgtt tctctacgga    146820
     accgatgtcg atcatctctt cttctgcgtg cttagaatcg ccttggacag gaagcttgtc    146880
     cttgttcagt ccagcagcta gacgagcgga gagcgcgttg acgcgcgcag cttcggcaac    146940
     agcatagtca gattttgggt tggaccgctt ctgattgcgc gccttgagct tgctcgaaga    147000
     gcggagcgat tttgccatgg tcgaacaagg gtgtggcgct ggatgttgcg aggtggatga    147060
     aaggaacaag gagcgtcagg ctgtactgaa ggctgagtga gcttagagac ggctaggcgg    147120
     agctgcaatt ggctcagaaa tgtgtgtgag gaaggcaagg aaagggagga gaagagagat    147180
     ggccttcagg taaggacgtc gacgaccaag gtggtgtatc ggactcaaga cgaggttctc    147240
     ttggaattgc acgacggcct tggcttgcaa gccagaaaat gggcaatcag gacccttttt    147300
     gagttgtgag tctccaggaa ttttttcctc gaatcgtgaa tcgtgaagcg gctgcacaaa    147360
     gtgaagtttc gaagcacatt tctcggatag cggcgacagc ccgatttgaa tacgagatcg    147420
     gggcccagat ggcttttgaa caactcgtgc aaaggtgagg gttgtacttg agttgcatgg    147480
     ttcggttcgt ctttcttcgg cgttcagtgc cacgcagtca cagtcacgag ttgccagctc    147540
     gaaggaatct tgaatccgat gctcggtgga gaccgatgtc gaaagagccg ttctcactga    147600
     gtcggtggct ccccctttaa acaaccgtct cgtgatcgga tgcgacttcg tgcggtttca    147660
     acctatgcgc tagaatgaca ctttgcaatc acgccacagt cttggtgaag tcgactagaa    147720
     agtatgacac aggcgtgaga aggggatgct gccagcaaag tcgcaacgtc gctgacccgt    147780
     gcctgcagaa ggttggggga tccgacgttt caaaaatgtt gagtggacct gcgaaggtat    147840
     tgagtggcaa tcacgaatag cgcgtgcgca agcgtgtgtg catgcgcttg cgaatctgcg    147900
     aacctcatct caaatcctgg acatgagagt aacgagtgtg ggtcgtgccc gtgtctgtct    147960
     gaaagaagca ggaacgacaa gacatgaatc ttggtgcttg gctgtccgcg aaagggtcca    148020
     aatctcaacc cagcgcactc tccgctctcc gctctcgttc cgatttgtga gtgttgaact    148080
     ggatctttcg ctcacaactg actcttgctc actcgtgact cacactgtac gtgccgcatg    148140
     gccccaggct tgtggcatta ccagactttg aaatgaaaag taatctcgag gcaactgtgc    148200
     gtggtcaccc cacaatttcc tgctcaacgg cagaaggtgc cgaaaacaaa aactccaatc    148260
     gtgaaatcac agagaatcac gtatttcgaa tctaaataaa gttaatttga cttgtgactg    148320
     gctgccaacc gctgttcttc caagtaaacc gagcaaggtg gtggttaaag gcgacaggca    148380
     ccatcatggc ggttaccgcc gtcacctgcg ttcgtcggct tcaccagggg ctgccctttt    148440
     gtcctgtctg accgttgact gcaaatctcg gatcgaccgc ctcgcaagct cccgaacgtt    148500
     gcgagcttca agggctcgac gagtaaaagc aacagatcgt agctctctca ccacattgtc    148560
     acacgtgcac cggccctatt cagtcacagc ggctcgtctc gaagaagcga taccaagggc    148620
     gtagcatacc tgtcgggtct tcgaagcgct tgcaccacga gcagcttgtc gcctttttcc    148680
     tgctcgcgct cgcccattct tcacatcacg cctcgagtca acaccaccag cacatggaca    148740
     gcgcttccga gtcaaagctt ctgatccaac aaaaaggcat ccaccgagaa gcgtcaaccg    148800
     gactgccgtt gcagctgcac agtcacaaac ctagaaacac gaaagcaacc ctctcttgcc    148860
     ggcacgttgc agtatagacg tctcatatcg caactacagc cgccgctcac atcgcacccg    148920
     gcagagacga atccacctct gagacgccac ccttctgctg ggctctgctt gcgcaggcgc    148980
     acaactcagc acacgcccga cacggatcgc ttaccgtgac gaacagccaa aacaagatga    149040
     gggagactaa actgcacatc cccatgacca ccgccacggg cgaaacaatt ggcatcgtcg    149100
     gaatcctcgc acagatcgca ctgccgccac acaacccgca agaacacgaa ccgcatcccg    149160
     tctacacgtc acgttccacc accgcaccca tcgaaccttt ctctcgtcat atccaacagg    149220
     gcaacctcaa tcggcccgac atctccaacg acccttccgc ttccgctcat cttgtgcacc    149280
     gctcgtctca ctttgtcgag gacgatcacg ccacaatgca gaggttacgg cacaaggatc    149340
     agacgttcaa acgtcgaggc tacccgatct atcccatcga caagcgcgat acgcgcggtc    149400
     tcaagatcgc gctcatcttg catggtgtgc tggcgcacaa ggatcagatc taccacaaac    149460
     agctcgcgcg ggcgttgcca gtcgactcgt tccgcttcga ttttcgcgcc aacggtgaga    149520
     ctcccggcac gtggtcgatg ggcaacttgg cggatgatgt cgaggacctt gtagctgtgg    149580
     ttgactatct caggacaaag ttggagtata cggtggagat catcattgga cacagtcgag    149640
     gcgggctaga tggctttgct tggtttgcga aacactgtcc tgatgctttg ccgccttcgt    149700
     tgcgcgttcc gtttttcgtg gcacttagtg cgcgcttcaa catggccaac attcacgagc    149760
     gcgatcctgt atacctgtcc gcgtttgcga aggaaggctt cttccgttgg caggcacgcg    149820
     tagcaggtca ggataaagag ctgcacgtct acccagagca ggtagagcag tttgctgctt    149880
     ggccaacacg cgagatcgcg cttgcctttc cctacaacac ggatgtcctc ttgatccatg    149940
     gcacagcgga taaatccgtc cccgcgtccg acgtgacctc gtacggcaac atcttgagtg    150000
     gcatccatcg acggcctggc agctgttcgg tcaagttgat cgaccatgct gaccatttat    150060
     tccgaggctt ttatcctcag gttgtcgagg ccatcgtcga atggttggcc gagaggtccg    150120
     agttgacaaa aatgggcttg ggtgcagcag caattaggga taaagaaacg ttgggtctcg    150180
     ccagatttaa tccgagtcat tttgggcagg gtcgcgccgc gggcagtcag ctttgggata    150240
     ataatctggc tggcaccgtg ggtggtgcag tgaggggagg tgggctgggt gcacctttgt    150300
     tggataacac tggaatcagc ggtgcgcaac ggccagcgct gggcgcgtca atctcgcctt    150360
     ttcagaggta cgttgcggcg agtgtgggtg gcgtgccgag tcagccaaaa caggagcgta    150420
     tgccgcaggc ggacgactcg agggcggcaa aggaggatat gtcggatacg gcaaacagta    150480
     tccttaccgc cgatcagcgg tcaccgactc cgacaacacc ggtagagcgg ccaccagcag    150540
     agtcaccttt ccagtcacag catgccgcat cgatcgcacc caagatgtcg caggatacgc    150600
     tgggaaccgg tcatgtcgcg acttcttcgc acgcaccggc atccacaacc gcatccacag    150660
     atgaggccaa tccaaaccac gcaagcatcg ccgtctcgtc acaaagagcc aagtcgcgct    150720
     tgtagcttca acaacatcgt cgacaaggtg cttttgcgct catgttgtta ttccttcacg    150780
     ttcattctat gggcttttgt tatctagacc aatttgttgt attctacggg ttctcacttg    150840
     cgcattgcct ttttttgcat ccagatttgc ttatcactat gcacatgtta tccggagctg    150900
     atgtggcgac tgcttggaga caaactcaga aagcgtcatt ggaagaatcg tcgctgatga    150960
     tgatgctcga tatcggttcg acggctcatt gtgccatgga ttcagctaaa cgtgtgctga    151020
     acggcttgac tgcggcgttc agaagctctg cgtcatggtc gtcgcagtcg gaatcttcgg    151080
     agtcgatgat tacaggttcc gcgagcgcac gttgacttgg agttgatctt gaagtcgtgg    151140
     tgcgatgtgg tgcaggtgtg agaagctttc gaggcgattt gttcggtcgt ctctgctcct    151200
     cgctaccatt cgaggtggaa cgtggtggtg ttgcggcccg gctgtgcccc gctccaccgc    151260
     tagcaaggcg atcggagacc acggctccga gaaattcaat gcttgaatcc gcctcttcgc    151320
     catcggcatc ggaggagcgc atgagcgcgg atgtggcatc aggcagagag atgtgtctac    151380
     tttgaccccg acccctgcat ggtgctggtg ctgcaaagcc cgcgctcgtc tgatcggtag    151440
     tggcgatggg tacgggaacg gattcggtcc gcctcaaact tctctgcatc ccacttggca    151500
     ctctgagctg tctcggcgtg tggggcgctt ccaccgcgcc gcttgtcgac tcttgcacta    151560
     gactcgatcg tttcgaggag gtgtcacttg actgagggcc cttcggcgtc gcttttacct    151620
     gatttctcaa cgacggtttg acgctcgact cgatgaatgg cgacaacgtc gtctgattcg    151680
     ccttgcttct agcctcggtc gcagctttct tcctgagctc ctttgcttgt gccgcagcag    151740
     ctttcttttc cacctcatct agaaattcgt ggagcggacc agctccactt gtactcaact    151800
     ccagcagcgg ttctgcaatc cacatgagca gcggcgaccc cggatcgggc ctcttaccgg    151860
     ccattcctga tttgggcctt gttcgcgtgt cttcttgctg gtctcctaat cggtctgtgt    151920
     cagactcgtt gccttgcatt cgctcagatg ccagtcttgt atccaaagcg tcgtcaatgc    151980
     ctagctgtgc tagttcggcg aactcctcca tggggaccag cacgcgaaag tcgcggaatg    152040
     gatcgagagc ggcgtgtctg cgctgcattt tgatggcgag gattttgaca gatgatctaa    152100
     acgctggcag cgatgacaga gaagtttcca agtggtctac agtttccgcg gtccctgcac    152160
     agggcctggt ggcaatggca gccttagcga agaaatcagt tatacgtgtt gcgttggggc    152220
     tatcgtgtag cgctcggctc ttctgttgcg tcgtagagac tgaaactctt cttgccacag    152280
     aagcaacgtc gatgaatatg aactgttgac gcaccctcca actcataact tgctcttctg    152340
     tccaagcagt aatctcgagc gactcctgtc gcagtctacg cactaccacg cccggcccca    152400
     aaatcgtacg aaacttggac agaatagctt ccttggacca cttaaagtag atttgggtca    152460
     atcgcgcaag cctcttcaaa tcaggctcgg ccatcccacc cttgaaataa aaaaaactag    152520
     gatcaaactg cttgttgctc tgagacgtca gcggataaag atagtacgcc agcactttgc    152580
     gagattcggg cgtggacaga aagttgttgg gaatggttga tgcgagcttg ggtctttttg    152640
     aggggaggaa ccctatcttg ttggtgcgca gttcttcgcg cacgttttcc cgccaagtct    152700
     tgaggaatcg ttcgaacttg gggcaagtat gcgaggcgga ttcttgactg gtgtaggatg    152760
     ctttgaaagc tctgttcaag ctgtaaccga acccggagcg ggcaagggca acagcgatct    152820
     taattccgca ctgaagtaag ccagtcgtgt cgtagtcgcc gccagacatg agaccaatta    152880
     atatgagagc gtcacggtca aggcccatgt aatagcggtt ggaaagctcg agcgtattgt    152940
     acagcgttat gagatgattg ccgtcctgtc cggaaagctg aggccgtgaa gcagcgctgg    153000
     ctgtagtaat gtcttgagtt gaagccgcag cctggtcaaa catgtcgcca cttgtggacg    153060
     tggtcctact gaaagccatg gtgcctgaga gattcttgcc ccagttgcga atcacgacat    153120
     gtgcaccaaa gagcagtgcg tcagaatcgt ccgtcaacac agcatcgatg aggttcactt    153180
     ggttgagata agccagctcg gcttcggcct cgcctggtgc gcgatgccac tggtatccaa    153240
     atgcttcaat gaggtatgag aaaggctcct caatcacttg ttgtctgccg ctgaccagct    153300
     tacctcgctt ccaggtcggt ctcttgggtc catcaaaaac gaagacgggt agtacaggca    153360
     aactaagcag cttagcaagt cggtagaaca aaagcctgag atgcggattg gcaccgccag    153420
     agctctgaag cgcatgaaac agccatagcg aggcgtcgat acccagccga agtccccgaa    153480
     gttcgttgcg attttggaca aagctggtga ggaggtacga gtgtagtgtt gttgtttcgg    153540
     ctgcgggagc cagctcggcc cagagaccag gaattcccat tacaccgttg aggtgtcctc    153600
     aagtaaaagt ccagaactat gagaggcaga aaagcacggt cgtgccccgg atgcgcggag    153660
     gaagccggtg gagttgctga aacggttcgg tggttggtgt cagcacgcaa cgtgcaacgt    153720
     gcaacgtgca actcgtgact cacggctcgt gaccgttgtt gttgttttgt caaggcgcct    153780
     gctgacttcc taaaaatagg aaatcaaaag ggggtcacga aaatgtatcc tgttcgtgat    153840
     tgttcttgtt ttttgggacc ctgaacacga gcgggtgaag cagccgggtg tacaaatgcc    153900
     gaggcccacc atacaccttc gtagttctcg tgtcttcttg tgctaccgga acaacaacga    153960
     gctcccagcg taatccctct ggaaaagaaa cgcaacgttg tttcaaatct ctcttggatc    154020
     atcagtgtca tcatctggca gtcaatctga gcgccaatag cgaagagatg tccaccatca    154080
     atcagagcat cgatggactc acctcgaagc acgacctgct gctacctctg caaggctaca    154140
     ttcgaccacg tcgcgttcac ctcgcctcat tcactgcaga gacccgaaaa ggctctgttc    154200
     ttgcctacct tggcatccct tttgcccagc caccgaccgg tacacgtcgt tggcaagtgc    154260
     cccaagggcc attgccgagc tggtccaaga cgagaaactc gaaatggcag tcagatccgt    154320
     atcaagactt tgctgccatg gaaggcatgc atcgtggacg caagaacgcc aagacagcaa    154380
     taccacgaag cgaggactgc ctttatttga acgtgtgggt gccagaatcc aaagacaatg    154440
     accatgcaaa gagaccggtt ctggtctgga tttacggtgg tgcattctct gtcggcaatt    154500
     gctctagacc gcttcacgac ggtgcgaggc tggctcacga gagcggctgc attgtcgtat    154560
     ctttgacata tcgagtcggc gctctgggct tccttgggtc ccattccatg acagaagagg    154620
     cggcaggcga gtggccgctc gtgatgctcg agtcactgca gaaccgacct gctcgtggtc    154680
     agggtgctca cgtaggtgct ggtaactggg gcttgtggga cctcgtcagc ggcttgcttt    154740
     gggttcaaaa ctccatatct gtactcggcg gtgaccgaaa caatgttact gtattcggcg    154800
     aaagcgcagg cagcatcgct atccactatc tccttctatc acctcgtact cccgaaggcc    154860
     tcttccacaa ggccattctt cagagcggcg ttgtggctac actgttgccg cgtacaactc    154920
     aggcagtaca agccacattc gactcgctcg tgcggtcgct ttgtccttac catctcgagg    154980
     gcgatgacaa ggctcagctc gagtacctgc gaactcgagt aagcgcggat gatatctctg    155040
     catgcctgcg acctctagtg ggcaaacgcc caaggtccga gtatacaccg acgctatcag    155100
     atatgaaacg cctgccaagg gcgcgcgaga atctgaacgg tggtgacgcg tttagtgtga    155160
     cggatcagtg gggtcccgtg tgggacggcg cctttgtcga tccagacttt gtcgagcgag    155220
     cgctcggtcc actgccacca aagagtcaaa tgcgtaatgg tcgaagtggt gtgattgtgg    155280
     gcatgtgtgc agatgaaggc accatgttta actttttgat cgcgaccaga cagtcgctgg    155340
     ctgctcatca agatcttttc catccacaac tatcgtccga tcttggacgg ctgtatggat    155400
     ttgacatccg ggagctggtc gcaagcaagc tcagtggtcg cgaaaaagtt ctgcgagacc    155460
     agcaggcttt ctacacatgc gctacttata caggcgatgc ccaattcaca gcgccaatct    155520
     tggactatat ggcggctcaa agcggccatg cagctgatag aacggcagaa gaggactgcg    155580
     tagatacgta tggtttcctt ctggcatatc ggccatcgtg gggcatgttg gaagcgctga    155640
     cggtggtgcc cgagatgacc gaagagtggg cagcttttca cacgctcgat gttcccttcg    155700
     tatttgggct gaccggtcat cctggtttag acggccacgt ctacgtgtct gacgtgtccg    155760
     actatggcgt agatccggaa caagataatg gcaaggacgc agcagctatg ccgttggtac    155820
     atagtcgatc gacgtcgagg ggaatgaccg aggaggaaaa gcaactcagc ctgtacatga    155880
     tgcgaacgtg gactgcggtg gccaagttaa tagaatgcga tggcggtgga gagctcaagc    155940
     ttcctgatgg atcgacttgg cttggcttgg gctctagcac ggaagaagcc agcaaagtcg    156000
     gcatagatcg aattcgcctg ctggcaatcg gcgaggcacc ccaggcacca gcaaaggcag    156060
     caacggccaa tgtgggaggt tcgattcgca tatggcagac gcaactctcg caacatgcct    156120
     ttgcacagca gcatggcatc gccactttgc caagcttgca ggatcgagtg cgcttctgga    156180
     tgcacgagcc tatcactggc accggctcag cctcacaatc acacgccgac gctgcgcagt    156240
     cggacaaact tcgattgtgc cgatccatgc aaaactacta tggcttcctc tcaacgcctc    156300
     ctgtctttct gccatggaag ccatcgcaat cgtgaagcac gccgacattc acgattgtga    156360
     ttcacgattg ctacgacaag cgtgagtgac ttgtgacttg tgacttggtc ttccttattc    156420
     ctttttgtgg agacttgctc ccgatctcac agacgtcaac gtcaataact ttagtccgcg    156480
     gagtcacgaa gtgagacttt tcccgctttt gtgcgcgcat tttgctgctg acaacaacgt    156540
     gcaaagtgga ggatatttgg cgtcctttct ggcacacgtc atgtccatta gactggcccc    156600
     tctgcaacga gcttctgcca tggcttgagc gcgatcggcc ggtgactata cctcgatcta    156660
     cgcatgctaa tcttgatgac aagaggaaag aggagcagtg caatgattga gatgcttgtc    156720
     agatgacatg tggggtttgc agagtgcata ggctgtattg cgaaatgttc ccactgattc    156780
     cgccgtggat tacaaatccg cgccgtttct gacaaccgca aagctgccca tagcgctcca    156840
     cacgccccgt cctctccatt ttcgccggct ctctgctcat actgatgact gtgtacgagc    156900
     ctgcacgctg gtgtccattt gatacttgtc ttatcctgcc aatgtgctca gttgtccaaa    156960
     actacagaga tctgtcctcg ctttacgcgc gtccattcgt gattgtgaca cgcgatgcca    157020
     taactatata gtcgattgcg ttcgcaacgc tctgttcttc gtccaccatg ttgttcatgc    157080
     ctgttttggt tcaccagcag tagtgacaat gaggatcgta tcttctcaac tcttgacggc    157140
     actaacggcc ttgctcggtg cagcaagcat tcaagcagcc ccagctcttg acaacgatca    157200
     gcttgtctac caatctgcca ctccgtctgg tctcggagcc ctgacgttgg ggttctcttc    157260
     gaagctcttc tctaccttca gtagcctcat cacgcatatc tcgcagcccg tcgctgcttt    157320
     tgaagaccaa ggcaagacca tctggcaggt catcaacgat tccgaagagt tttcacagct    157380
     tgctcacatc ctcaattact cgtccgatgc taccaaagac attctgaaga aaaaggagga    157440
     cctaaccctc tttgcacctc ttgactggca ccacgatcgt gaaagagacg atgaagacaa    157500
     ggaggccttc caagacacat ctttcggtcc ggcttcaatt catcagtggg acgccatcca    157560
     gaaacagatt gccgactacg agcgagacta cagcatcgat gctcgtcgac acgataaagg    157620
     tgacaacaaa gacgaggaga agaagcgccg tcgcgagtgt atccgtaatc tcatcgatgc    157680
     cacggctctg taccacttgg ttcgatccga caccattctt gacgcgagga ccattggcga    157740
     caactcgagc gtcgccacct ggctcaactc tggcaaagcc catgccaaca atgacggtac    157800
     gaactggcgt gtgcgcacgg gtaagagcct tctgcctctt ccctcgattt atctcaactt    157860
     ttactcgcgc gtggtcaaac ccaacatccg tgccaagaat ggtttgattc atggtatcaa    157920
     gtatccgctt gtcctgccgc ccgatgtgct ccagagtctc ttctacggtc aaaccacctt    157980
     ctccaccacc acctcggctc ttcaaaaggc tcacattgac aagttcttca cgtaccgtcc    158040
     cgaacacgcg catcgccacc atgccgatca cgacaaggct gctggtttga tcgacacctg    158100
     gtaccacgag cgcagcgcca gcaagcactt tgacggtgtt cctgctgaga ccatctttgt    158160
     gcccaccaac ttggcatggt ctcgtctgcc gtttatcttc cgcgcctacc ttttctcgcc    158220
     ctggggcaca gaactgctgc agaagatctt tatgctgcac tcgctgccct cggacattgt    158280
     gtatgccgac tttgtgcacc acgtctcgca ctcgggcgaa cctgcttctg acgctgtcca    158340
     cagtgtggtg ggacacgcca acaagacctc gtacacattt gatacggttc taccgaagat    158400
     caacggcacc aagggcgagc acgagacggt agatgtcgat gtttacaggt actacttgct    158460
     gcctggcggc aggggtccgc tgcagacgag gatggtggcg caaaacgttt ctgtcatcct    158520
     acaagacggc ccggctcgga atggagtgtg gcatgcaatc gaccgattcc tgaagccaaa    158580
     gggtcatccg gagcaaggtg tctgggccga ggtcgccact gcagcagaag aggctggatt    158640
     cggcagtctt gatttgctct cggaagctca ggctaatctg tggtgagctc ggatctgttc    158700
     cattctttgc tggtccacag ctagtcgatc gagtctactg tagtttgcat gcaaatggtt    158760
     ttcaacattg cgattcagac gtgagactgc tcatcttgaa cgatacctcc ggttggtaca    158820
     atcacgaatg caatgagctt ttcatttgtg aatgctgatg ttgacatagg tgggccatgc    158880
     ggactgacac tttccatgat catcgagcaa gagtcacaac cacgctgctt cgcctgacag    158940
     ctgtcaaaag gcactgctcc atgctgatcc ggccgaaagc tttccggcga atgaactgac    159000
     cttgttcgtt ctgctggata ggctgggcgg aaatccaagt cacgcaatgt tatgagcaca    159060
     cttcgccatt catgattaac tggagactcg agttgctcgg cgtgggggat ccaatcaagt    159120
     caaagcggaa cagaacccaa agccatcgtt tattggtcaa cgatgtaaag ttaagatcgg    159180
     tacattgcac ggccttttcc tatttcgctc tttcagagaa gaatttcgcg cacacgtgcg    159240
     attgtccgtc gatccgatcc gagccaggct atctttctgc gagcaagaag caatcgggct    159300
     ttcaatgatg cctgaaacat tgccaagagt gaacctagcc ctgtatggtg tcgagcagta    159360
     agattactag ctaggccgtc caatgggaag acggttgagg atcgtgagcg atcaagttgc    159420
     agcaagctca atccgattga gtgtccatcg tcccacttta tcactgcgca tgatttatta    159480
     ttgatcgact tgccgtgctc ctaaccaggc taagttagcg tttctgtact cgcattcgtg    159540
     atcggaagag caacaatgtg acgccaaaag ctgacacctt actgttgtcg gaagaccact    159600
     gtatgccttt ggacgattct atactgatcg gatagtagag ggaggtcgaa tctgaaggac    159660
     ggggtaaagt gaacaggatt ttcgatccaa ccagctggag gaagcaggct acgcgtggtg    159720
     gtcgagtcga gtcatctctt ctcgcgtata tgcaggcttg catgcaacct ggcagctcgc    159780
     caaccgtgga tggaacgact aacgctcgcc tcaactggca cgtgagatta attcgagcct    159840
     tgacgcagag ctatcttgca cacccacccg tgccgcttcc acacaaacta cctgtacact    159900
     cgtgataaag ctggcatcac cgacaatgac tgacttatat agagatgcaa agccgagcta    159960
     ggggcaaggt caaggcggga tcgcaacctt cgatcgtgtc tttgaggaag acgaaggctt    160020
     gtgtggctgc atgcatgctt cattgcaggg aaccatgtgc aggatgactc gactttccga    160080
     agaaggtttt ttttaaatat ttttttggta tttgcttcgg ctgctttcag cttagctggt    160140
     tctggcacaa aatcgacgct aagagcgacg acaaagactt gcttgcacga tggtgacgac    160200
     ggctgtgtca tttctggact gagcagtcac gcatacacga tattactttg tctgcctctg    160260
     caaaacaatc aagggatcat cgctttgcga tatacgatac aacaccgttg gaaaaaccgt    160320
     tgctcttttt tccctccctt tgctgacgac gtggaagtga aaagttacaa ccattttcca    160380
     gtcgcattct tcatgtctgg ccgccactac agttgtgcct cgatggtgat cacaactaca    160440
     agtcacggcg ataatgcttg cgtgccggcg tatcaacttc actgtgccgg ttctcgttcc    160500
     cataacgaag acacgtcaac aagaatcgac gccatccgag cagctgagga taccgacatg    160560
     tacctgcatt tgagtagcat agttacttga tactcacgct ttgccggcgc tctcgtctcc    160620
     gtcgatccac aaaacgtgaa taggtgaaag ttgctctcct tgtcgacgtg tccattccaa    160680
     gctcgcttct ctcccacgaa cagtggatac cattgtcaag gcccctcatc attcctcggg    160740
     ggttccgtga agatacccgc aacccaagcg ccagcctgac aaccacggcg tgcggcatct    160800
     ctggtcactt tagcacagca ggttgtggcg cacccttccg tggatcgtga ttcgtgattg    160860
     aatcgtgaat gtttaatcca ggttgtgcag ggaaatttac taaaccgacg ccaaacagct    160920
     ttggccgctc ttttcaccgg agcatgcacg agggcttgcg atcctcgaaa agattagtga    160980
     ttgttgccgc tgcttggatc gcctcgcttc tgccactggt tggcattcac ctcactgtgg    161040
     ggaccaacaa gaggacagct tcaattctgc gcccactccc ctgatcctgg aactccatat    161100
     cccttttgtt gtgggcaaag agacatgaag cagagcgagc atgcttgatc cagaaaaacc    161160
     ctagtttctc aatcagcaat cagcaatacg caatatgcaa tatacacacc gttggctctg    161220
     agtttcagtg caaaagcgga gtgaaagatg atgagggcgt ctgtgggaaa aaagcgccca    161280
     agcaaagctt gttccaagtg tgagttcgac cgagctggac tcggttcacc aatcgtgagt    161340
     gttggtgtac cgcatcacgc gcccctcccg ctcctcgcca aatttgaatc gcaccctcaa    161400
     ttttcgaggc agtccaccag tctttccaaa gcggaaccta tcttgtattt agggcgaaaa    161460
     gacagtgtcc tcctccctat tcaaaagctc tttggacact gctcgtatgc ttggtcattc    161520
     gtttttcttc ccatcctcac tcttgacact gctctcgtac ctcttttggt tcgcctcacc    161580
     ttcccgtcgc tcgtcattcc cgtcgactct ctctactgct gcccccagct gccttcagct    161640
     gcctgtcccc ttatattcaa gcctgtttcc cacatcacca aaggccatcc tcccatcttc    161700
     gcgatactct ccaaccaact ccatctcaat tgtccatttt tccctcagga acaatcttct    161760
     gtttacggac tcgccgtaat actctaactt tgcctacaac tatcgccctg tgcgatctcg    161820
     acgatttcct acagctgctt tatcaccact gaccacgtag ctggcccacc atgttcttct    161880
     aaacggtctc cccgtctaga ctcgctcgat tctttctcgt tacaaaacga agaaaggaca    161940
     gactccctaa cctctccgtt acagcctctc cccccttcca ccacttccac attgttaccc    162000
     aatctccctt ccgggttgat ttctacgttg tcttctttta acaacatctc caacgtcaat    162060
     ctgacagctc ctaccaagct gtcctctact tcgccatcat ggttttcccc actccccagt    162120
     gcatgcctcg cctcggccaa caacaatctt caagccaaca accagtcttc caacagtcac    162180
     tcgaacagtg tcaaaacacc ctttttgaaa agtgtctacc acccgaccaa cgatagtgcc    162240
     tctgcttcaa gcatctctct tttgaatttc gacaccactt cacacagcac ccctgttgct    162300
     gctgttgctg ctgccaccaa accaatctct ctgcgagctc acctcgaagc cgccatctca    162360
     aacccttcat ctacgtctgc gcaagccaac ttgctgaagc agcttcagtc taccctggct    162420
     gccatccgtc ccttgtccaa atctcaagcc gtcgctgcta catctaactc tagctccagc    162480
     tcggcccatc cgaccacgcc tgctgcccag cctacgtttg ctagagtacc tagcatcact    162540
     cctgctgctg ttgcttctgc tttagctgct gccgctggac gtcgtcacac tctgccttct    162600
     aaccccgttg ctgcttctga agccactaac accaacgtgt ctatggctca gactcaacgt    162660
     ctagaacaga tccaaaacta tcgacagctc atcgcccagc tcaacgccac gatgcctgct    162720
     tctgctgata gcacagtccc gatgctgcct ttcggggcgt cttttgcgga ctctgccaag    162780
     accgtaggaa ccggtctcaa cgccgcttcc ttcggtctca accccatgtc tgctgatgac    162840
     ccttcgtgga tcggacacgg attccaggcc caggccgctg tcgacttcct ctcttcccca    162900
     gagtggactg acccgtcgcc tgcgctgacc gactcgatgt ctttcgagat cgactcttgc    162960
     ggccccagcc cgctgctgcc tctggatggc tacgaggatg atctcggagt gcccggtatc    163020
     gccggcgctc ccctcttccc tcctcaggat ggatacgcct cgtccaacgt gagcccgctt    163080
     gagcccgctc acaacgactt tggctcctcc accgttggtg attttggtgc ccctgaaatg    163140
     ggctctgact ttaccctgtt tcctgagacc aggcctgcca agcttcccat tgagatggcg    163200
     ttcagcaagc tgaacaaacc cgcggctggc tctggcacct caaatgaaga tcccgctatg    163260
     acgcttctac gagccctgag cagtgctgcg ctctccgcct cgtcgagtac cgccagtgtt    163320
     gctgtttcca acaacagcag cacctcggtc gctgcgtctt cgactccagt actcactgct    163380
     tcgccactag catttacttc aatgggcgct ccccaggctc tcgctccttc gagcaccgag    163440
     gcgacccctc ctgctctgca acgaacgagt ttgtcgctgt catcgtcttc tgccccggtg    163500
     gccactagtg aatcccgagg cacaaagcga cgcatggaat cgacggacct tctgcctctg    163560
     gatgctccca tccaaaagcg tacctactac acagtctctg ccacttcccg acgtgacact    163620
     gctcgcgccg ccgaagtgga cgagtttgcc gaggaggagg ctgccattcg acgcgagaag    163680
     gaccctcgtg ttgccaagcg tctttcgaac acgctggccg ctcgacgatc tcgacaccgt    163740
     aaggcggaag agcttcgtct gctcaacgag aagatcgaag ctctcacctc tgaggttgag    163800
     tcgtggaagc gacgttgcga acaggccgag aaggagagga acgacgcgct ggcactgctg    163860
     tcttagtttg acagcagcga tctcgctttg cctgtcttgt ccttgtactt gtatcgttat    163920
     tccttcggcg gctctcatgc ctttgcctcc caaaaggttt cgcaccctct cagtgttgac    163980
     ccagaacgtt ttccgtagta tccgtcgtcg tattatctat gctccacgtc gcctatttat    164040
     gctcctactt cgccatgtct cgtttgcctg caacccaaaa atctattaaa aaataaatgt    164100
     caatacgaat gaatccagat cttgttcgag cctcgactgt tatcctgcgc ttgaagtgaa    164160
     gtggcgattg tgaaggaaaa cgtgaacact tgttttccca tggcggtcat gaacgagatg    164220
     tgacacgtga ccgtaaatat agcaattcga tgttacaccg gcactggaaa ttagttgcac    164280
     gactaaccct cacgcctgtc cgttggcacg tgacaacgaa gaaacatgct aggtgtgaag    164340
     gactggaaat tagtcagctt gagaggtgac tgggaagaga gaagtcggtg gaaatcgtaa    164400
     aggttgacga gcccattttt ctccgtgctt atacggtaca gtcggtcctc cacacgatag    164460
     tgggcggaag gttaggtgct tgcgtttgct cttccatcgt caacgacaaa cgcattcgaa    164520
     cgctcgacat acctttggca gttgacgtaa aaatgtcggc ggttttcaga cagagtcttg    164580
     ggttgcttgt aagtgcggtc gccgccgcaa ttggttctga atgatatgcg ggacgcttca    164640
     ctgaccacct tgctttgacg ttgtatttgt gctgctacag cgatcagcgc cagcacgtgg    164700
     gtcgttgctc tgcaacccga cgcgtgcatg cttcactcca acctatacat ccctcacacg    164760
     gcttctatcc acggaggcgc gcgccaagat cgactcggcg gtgaaatcca acccgctggt    164820
     catcttcatg aagggaacac ccgacatgcc catgtgtggc ttcagccgcg ccgtcatcca    164880
     agtgatgcag gttcaaggcg taaaacccga gctgctcaaa actttcaact gtctcgaaga    164940
     ccaggaactg cgtgaaggca tcaaagagta ctcggactgg cccaccatcc cacaagttta    165000
     cgtcgatggc gaattcgtcg gcggctgcga catcgtgatc aacatgcacc agagcggaga    165060
     gttggaagat ctcttagaga agaacggcct tttactgcct ctgaatgagg aggctgcaaa    165120
     agcgcaggct tgaaacaagc aagatacgcc cgcagttctc atgacactca cttagggtta    165180
     ctgtctcgat ggtcactgat ttcgctcaaa tgccagataa caaacttgtt gcagtgcaga    165240
     gcagataggg tcggatatga aagagtcaga ctaagcggtc acactgcata tgagcgcgat    165300
     gtacgacgct tccagcgcca aaccgtgacc ttgaatatgc agaaatgtca tgatagcgtc    165360
     gccacacaca cacacacaca cacaccacgg tgtcgactag gtttgcttta accacaccac    165420
     tattgttcaa acaagcacgc atcgtgtcgg gatgagctcc atgcagtgag acgcattgaa    165480
     cgtgatgctg gctgatctac atctcgatgc cagcctgagc caaggcgacg gtcatctcgg    165540
     catccaagta gctggctaca gcaacgttct cgggcaaacc ctttctcctt ctcgtcttga    165600
     ccacaaagtc cttggccaat ccgagcatgg gagccggttc caacgggcgc agttttacac    165660
     tgctatctat cggattgccc ggtacgatac tccagtggct gaagaacatc atcgcgaacg    165720
     cttggccctg ggttgcaatg cgcaggtcgg tttcaaagcc attggcgtcg attactggaa    165780
     tgtacgcttg caccgtatac agcgtcgagc caggtttcgg agtatctttg acaacgtggc    165840
     cacgacgttt ggcaagcaac gtatacacgg cggcgacacc agtggccgta gtttgtacct    165900
     ccacttcgta gatcggctcc atgagtctcg gcgtcgccat caacagcgcc gcgtagcagg    165960
     cacggcgcgc agtggggatg atttggcctc caccacggtg aatcggctcg tgcgctagtg    166020
     ttgcatcgag aatgcggaat ttcacgttgc gcatcggctc gtccgccaac ggtccttctc    166080
     gacatcccca ttggaatccc tgggtgatac tctccttcac cgcatacagc aacttcttgt    166140
     ccacctccga aggcaaggtg tcgtcgacaa gaacgttcgc tccccgttca tccggtccaa    166200
     aagcccacac acttcgactc gccagcagat cccacccgta cttctcttgc agcaccttgc    166260
     ccaactgctt gggaggcatc ttgatatcca acaacccaga ttcaatgtct tcagcaaccc    166320
     ctttttccaa aggttcgcag atgatcgtca gcttgttctt cttgtttggc gtcgatgcgt    166380
     agcatttcac agaagacgtc tctaccaccg tttcgcagaa gcgcgccact ggatctgaaa    166440
     cgcgaatctc gatctcggaa aagagcactc gcagatcgtg cagcacacag tcgaggtaca    166500
     gttcaccagt acccatgatg acgtgttccc ccgactcttc cactttcgtc accgccagtg    166560
     gataactctt gttgatgcga cggaggcctt cgagcatctt tggtagttct gaggggttta    166620
     aaggttcgac cgagactttg agcacggatt gcgtcatgtg ttcaatcggg gcaaagatgg    166680
     aaacgtcttc ggtggcgagc gacgcatcga caatcgtgcc agttttggaa agagacgcat    166740
     cgatacccga gagcaaaacc caattgccag cgggaacacc gtctgtcggc acaacatagc    166800
     gcgtctcata gacgccgacg gtttggattg tggcgagtac catatcttcc tcgtcgtctt    166860
     gcgagaatgc ttctccaagc actttgactc gcatccctgg acgtgctgtg cccgccatga    166920
     cacgtccgaa cgcgcgaaac tcttgcgcgt cgatggtttg atagagtttg gatacatgga    166980
     ttacgagtga cgcgtcagca tcgcaggctg ccatagcttc gtagatcgct cccgctcgag    167040
     gacctgtata gcacttttcg agctttttga ccgctgcatc tttgggagaa ggaatgttgt    167100
     cgaccaccag atcgaccagt ccttgcgatg gaccaaagaa ttggttgagc acgatcttga    167160
     gcaaaggtcg cacatccacc ttgaacactg ctggtttcag acgaattcgc agctcggcta    167220
     atgtcctctt gagcgtgtga gtgtcggaag acagcacagc cgagtagatc ttgtacagcg    167280
     gctccaagat aaaatgcaca aacgacctct tgctctctgc atctggcgcc ttcctcgaaa    167340
     agttgcgcga ttccgcattg tagtagatgt ttccccacag tctttgggca aaagcgtcca    167400
     cgtcgatgct ggcgccatac gtctctgcgt aaagtttggc aaagctgcgc agcgtgaagc    167460
     aatagcccat ctgcgttgag gcaaaggcaa cattgccccg ttcgggtccc agacgaagcg    167520
     caggattggc gtcaaaggaa gcgatgcagt tgttgacctc ttggatggca tgccgaatct    167580
     tgtagtatgc ttcgttgggg ggaagtcgga gttccagcac gagacggtcg agcttgttca    167640
     gcacaaggac aataggaagc tgttggagga tgcaatgtcg gatgatctgg accgtgttgc    167700
     acatgacgcc ttcgattaca tcgacaacga gcacgactcc atccgcaaga cgacaggctg    167760
     cagccacttc gtcctggaag ttggtatgcc ccggcgtgtc aatgagattc aacaggtacg    167820
     atttgcgctt tgtgccttcc agtaccaacg acagcggcgc actcttgatt gagatgcctc    167880
     tgtcacgttc gagcaaatgc gcatctgtat agcgcagatg cgtatccatg tctacttcga    167940
     tcttgtgtgt ttcatacacc aacgtgtcta gcaggcttgt ctttccatgg tgcaaatgtc    168000
     ctaccacagc aacattcctc accatgtctg ggaaacccat gagactcgac aggaagcctc    168060
     tgtcgaagcg agtttctggc agaccctgct cttgcactgc aaagcgccga accttgatcg    168120
     gttcaacgat gggaaccgat agtggctgtg cgtcttcctc ctgtaccatg gtctcgacat    168180
     cttcgccgta aacttcggat gccgaagggt agtactgctt gtcctcgtgc aataccactg    168240
     cgtttgacgc agcttcatcg acgcgtatca atgcatgttg aggcactatg ttgccgtctt    168300
     catccagctc catattggcg agacgctcgt catcgtcttc gccatcatca tatccttcaa    168360
     gcggggcagg ttgctcgaga gatggaggtg gatcttgtcc atatccctgt gagtggtcgt    168420
     cgtctgaacc aagctctgag tccgaaagtg ggccgatgta gttgccgaac tcgtcgtagt    168480
     cgtccatgat gggcaatggc ggctagcaca gccggatcta cgattttggt ggtcgagatg    168540
     gatgcaggcg tgcaagaaac ccggaaactg agccagttac gcttcaaagc tacttgcctg    168600
     tcgtttgctt cctgctctgg agtacgggtc gcaaagaatg ttgtcggatg acagaaggcg    168660
     atccgattgt agtcgtttga gaagaagggg acaaagttag cagttacaaa atctcccgac    168720
     tgccgaaaac atgaaaaagg gcgagtcgtg aaggaaacat aaaattaaac agagctagaa    168780
     aatcgtgatt ccaccaagtc tgagtcctga gttgcagaac ggtgcgtggt gacgtctaag    168840
     agtgcggatc agccgattcg tgattggaga gctcttcgct acacagaccc ttttcgtagc    168900
     aatcgagatg cagattcctc cactgtacta ttcagcgaga gtagtgcata cagttacagt    168960
     cacgtaccac cagccatctg cgcttacagc ttcacaccat caccagagaa aaaagtgggc    169020
     tcgatcacct gctcggacaa gcccaagcta cgtcttccag cgatccttcc aaaacgacgt    169080
     ccttcgttgc ctctaacaga tatttacaca gggtctcgag ccgctggccg tgtcagggac    169140
     tttgcgaatc cgacctactg ctcgacctac cctaccgttt taaatttctt tgctgatatg    169200
     gaaacattgt gatccggctc tgctcttctg gtactcgtct tctctgctgt ttggattgcc    169260
     tcgaggatgc cgtcaatatc gccgcaacac accgcagagc ctagcagcag cacgcagtcc    169320
     acattgcact cgacgcctgc tgtaagccag gtccgcatac aaacgcctga agcacctgcc    169380
     agcctcgacg agctgctcaa atcgcctcat aatcctgcct tgcagattcg tcagcctagc    169440
     tcgacgcttc gaggcgccac cccggatgac cagcgaagac ggaatggttt ccacctttgg    169500
     cgcaccgagt cggaagacgc ccgtaacgcg cggctgcgcc aagcgatcca agcagcagag    169560
     gcacaggcta acgcgccacc gagtctcaag catcgacttg gcaacgctct cgggaaagct    169620
     tccgattgga ttcagtcacg cggctttctg agcttgtaca ggctcaaccc gatccaatta    169680
     ggcgatggca cggaagcgat actgtcggac gcctttgcgg ttcgctcacc aaaactctct    169740
     cggctcggcc taatcgttct tacaatcagt ctggcaggcg ctcagctcgc atggacgctc    169800
     gaacttgcgt acggaacacc gtatcttctt tcgctcggtc taagccagca aagcaccagc    169860
     ttggtctggc tcgccggccc actcagcggt ctcatcgctc agccggtcgt cggctcgctt    169920
     tcggatcatt ccacatcatc ttttcgtcgc cgaaaataca tgatcatctc ggctttgctg    169980
     ctgactgttt cgaccattac tcttgcctac tcagtcccta tctctacttc cctcgtcgat    170040
     ctcttcggag gcggacttgc cgactgggat cctcgccgcc acgatttggt ccattccacc    170100
     acgcagatta tctcggtcat ggccttttgg atcctcgact ttgctctcaa tgggcttcag    170160
     gctgcttcgc gagcgcttat cctcgatacc gcgccttccg aacagcagac tattgcgaat    170220
     gcgtggcagg gcaggatgac ccatgcgggc aacgtggtgg ggtatctgtg cggatgggtc    170280
     gaccttgcca gttggaaatc gctgcgctgg ctcgggggag gtcagtttcg gcgattcgcc    170340
     atgatctcgt tgctcgccat gatctcgtgc gttagcgtca ccatctcgtg catctccgag    170400
     tcgccgacag acgatcggtt ttcgcaatcg acgcatcaac gacaatccat gtgcacctcg    170460
     gcatggagca ccgcccaggc gacgttggat gatgtatggc atgccatccg caggttgcct    170520
     agatcggtac ggagggtatg cctggtacag ctgtttgcgt tcatgggttg gttcccgttc    170580
     ctcttctaca gcactacata tatcctgcag atcgcgcagt acgagcggaa tctcgagcac    170640
     agacgtacac atgacgacct catccttgta cagccgtttg atgctggtca gggtggacag    170700
     gctggccgtc cgagctcgga ccgggatgca gagcgtggat cgtttgccat gctcatgttt    170760
     gctctcattt cgctcgtttc tgcagcgctg ttgccatatc tcgctttggc cggtgaaaaa    170820
     cgtgatcaac cttgtctcaa aaatgctgat tcaaacaacg gccaagagac ccccacccca    170880
     ccgttgcaga tcaacatacc tgcggatcgc gcatcactgt ggagcgaacc acggcacacg    170940
     gcggatcgcg agcattctga gcgcatctcg cgtgttcagc gcgtaacccg cggtctagtt    171000
     caaggtctga cgctacgaac attctggagc gtcgcctcga tcgtctttgc tgctttgatg    171060
     ctcgtcggga cagcttgggc gtctacggta cggcaagcta cggtggtgat cgcgcttgtc    171120
     ggcgtgccgt ggagcgttgc tgcgtgggca ccatttgcgc tggtcggcga gttcgtgagg    171180
     gaggccgagg atggcgcatc tccgtttgaa ttcgaacaag atcattggtc gccagctcgg    171240
     atgagggcta gggcagcggc gaccgaagag gggcggccaa gaaagcacag ccagccaagt    171300
     gctcacgaat cggttagcag ggtggaccaa gctgatgtcg gggctggggg aggattcaag    171360
     tacattgatc aggtatcacc tacaaggatg ggtaggggtg gagaacaagg tgcgagggag    171420
     agaatccgag cgtcgctggt ggattgtgca cctctaccac gcacttcgac ggcgagcagt    171480
     gaggatgtcg aatcgctcca tgtagcaccg cattgcggtg atggtggcgg atggcgctct    171540
     tcgtcctact cgtcgcatgc gcccactcca cagaacgcaa ccggcggagc ggggactatt    171600
     ctgggcattc acaacctcgc catcgtcgct ccacagttcg tcgtcgccat catcgcctcg    171660
     ctcatcttca gcgccgtaca ctcgagtctc agcgccacac atctcgtctt gaactctccg    171720
     gcgctggcct ccttggctga cagggatcat cgagtagcgc aaggtggcgt ggtgaatcca    171780
     gcgaaaggaa cagtttgggt tttaaggttc ggaggaagca tggctctcat cgcggctgtt    171840
     gtggcgagat tcgtaccgtt gacgcttagc gagagacaga gacgctaccc tgcccagcag    171900
     ccgatacagc accacgcagc aggccagcat gacgattacc gcgacgtcct ataatcgtga    171960
     atgcacttcg aatttcgtgc cacctctttt tcgtgaccaa gatcaaggtc ggttgcaacc    172020
     aagacgaggc tcgtctgtgt ttgcgacagg aacactcagg tctgcaatga cgtcgagaag    172080
     tcgtgaccca caaaggagag atgaggtggt caagtgcgtt aggaagattt attggggtgg    172140
     gggagaggta caaatacagg atgaatgcaa tagaatgcga tggggacgat agatggaaag    172200
     agtacagtga gatgcgatga tgcgatgatt gaataaaagt ataaatgagt tggcaagagc    172260
     acagatgcga gagcgaagga ggagaggaat tactgttcat cctcgaattg agcaagaacg    172320
     acttcctcct gccaacattc atcgtcacca tgcagctcac cgttgcagca gtcgtttttg    172380
     caaacaaaca caaatgctgt gctccagact agcccggtcc tcgcatcaaa tgtcaagtca    172440
     ccggtcgtcg ctttctgccc gttgccctca gcagagccag gcaagcgtcg accgagagct    172500
     tgctcgatcg ccgcctttcg tttcgcctct tcatcttgcg tttcggacaa cgagacttcg    172560
     agtgcatcgg gagcgaccga tccgtcggca gcttggatct gatccgcgcg aagcaagttg    172620
     atcaagttgg gcatgagttg tgcttcaaat acccgctctg cgccgcattg ctggcaagga    172680
     ggaactgctc gtgcgctgaa cgagcgttct ccaggagcag cagagccggc ggtgaattga    172740
     cccttggtga cagcaacacc ttgtcccgct tttggttgat attccttggg ccacagcaga    172800
     tcgtagatct tgcctttggc gtggaaagca attggctggc caccgaactc gtatcgaaca    172860
     gcctgtctcg gttcaacaga aacccgcttt agaaaacgtt caaaagtatc gtcgatgccg    172920
     tcgagcagca tcttttcata gccttccttg gcgaacccct tgaggtcagc gtcgtcggcg    172980
     gcagagtcag tggtggtgag ggcgccggat gcggatgcgg atttgagcat cgctgcttct    173040
     tgcttggaga gcttcttgga gagcgaggac gagcaaggct cggggacggt attcaggtag    173100
     agcggtggat atcgcgtcga cgattccacc catgtagatt cagccgtggg ggctgaggca    173160
     gcaagatcgg atttcagcgc aagttcttcg gctagcctct cgctctcgga ttcttcatcc    173220
     ccctcgtcgg actcatcccc cgattcatcg tcagagtctt gcgcctcgtc ggcgacgtgc    173280
     gttgctgatg caggagcagc agcggcggcg gtggcgaaag ggttatctga gctaccgccg    173340
     aagagcaaac ctcctaatcc ggcattggca ccgccagcag gagccgagaa tgggttgatc    173400
     ttggcgcgct cttcctgttc ctgcttggct ttggcagctg ccgcttcgcg ctccttcttg    173460
     gcctgttcgc gagcaagacg cttggctttt tgcttttcaa gcttcgcagc ccagcgacgg    173520
     ttgaatttga gcgtgcgaat cacgcgtaat ctgttgtaat tggcaaaaca aggtcggaac    173580
     aaaacatgag aaaggtcaac gatggtgcta cagaagacgt ttgtaaagag gagagccatc    173640
     ttgatatcat gtctcatgtc gataaaatac atgggggcat cattgttaaa aagctcgttt    173700
     gtcaaagttg taaatctttt cagaacccac ggggcgtcaa gtgaagaaat tgatactaat    173760
     cctgtgcccc ctatgtagcg tcgatggcca cgatattaat ggtgttgtag agtgaaactt    173820
     acgaagaggc gtcgttccgc tgacacgctg gtctagcgca accccagacc aaaaggcatc    173880
     ggtcataggg agattcgacg agaggtgcaa agatctgcac gaggagctgc atctgctgct    173940
     cacatgaatt gcactgtgca atcttgtcag atgggcaagc cttcatagga agccatgcgg    174000
     cgcgaccacc gatgcgcgag acgagcgggt tagcctcgtc atcgccttcg agcggtccat    174060
     ctgcgaggcc gagctgaaca tcagaggcgt cgaactcgga gccagagtca gaatcgtaac    174120
     cgtcgtctga ggccggctgt ggcatctaaa gcaatgtaag acgcacaaaa gaagaagaaa    174180
     aatcgatctg gtgtcagatg gtttgtccgt ttgccgcaaa ctccaatgca tggaaaagaa    174240
     aagagctcag gattaggtag cctagggtta acagcacaga aatcccccag gcgtctctca    174300
     ccgaagtggt cgacgtgcct cccgtttaat agggactcta agactcgtca tctagttttt    174360
     gtcatcattt tgcaaaagag ggagggaggt agtgggccta agaggcgagt aaagtgattg    174420
     catatatcaa ggatacgtac gatgatgtta cttgtgtatg atcgagtgtt ctgataccga    174480
     cttggagtct cagaacgggt atatggggat ggggatcgat gaggaaggga aggaaggatt    174540
     ttcagtcaag aagaaacaaa tttttggctg caaacgacac tcagactcac gacttgccaa    174600
     acacaaagaa aaagagaaaa cacgaaacac cagaaaaaat cccaaagaaa gctgcggaca    174660
     actcacgact cgctgtgact cttcttttcc ttttttgctt ttctttctgc aagaaatcag    174720
     gcggaatctt acattcttag gatagtcgtg agtcgtgagt gacggggggt cgcggacagc    174780
     aaatcgtgaa tcgtgaatcg atcaccgtgg agctgagtgg cacaaggcac gaggtacaaa    174840
     tcgtgaaggt gggtacagtc gtgagtcgtg agtcagtcgt gaatcctgta gatgctacat    174900
     ctcgtgtcta cacctccgct tgagtcgcta cttccccaca tcgaacttga gtgcgagaga    174960
     tctgtggtgt gagctgcgag agtcatcaaa caggacattc atccctggct cattcgtgat    175020
     tgtgtcaata cagtcgtgag tttacaaatc atacgcagag gaccgtacaa atgacgagga    175080
     agaaaagaag aaaggctcac cgcacagaca cgagatccaa tcacaagtcg caatcgtcaa    175140
     ttgtgaattt tgcagctgcg tagaaccacg aactgactga atcgtaaata tgccaatcac    175200
     gaattatatc aggcacaact ccgcccactc acgactcgtt tcagctctca cacgcagaaa    175260
     gcggtgattc gtgattcgtg attcacgatt gacgctgact gcctgttcag ctcgaattct    175320
     ccacatcgtc agcgcgacga cgcacggaat cgtcgacgct ctttttccca tcgatccagc    175380
     atcatctcca agctcgcacg tcgtagcttg actgccatac tcgaacgaaa ccgacctggt    175440
     cccgcaccgc actcgtccag acctctgctc gtgttcgatc taccccagac ttctcggaca    175500
     ctgtatcgta cctagcgtca cgaatctctt atcattagga cagcaaacac cacctttttc    175560
     agcttcaacc cccttctcga aacgtattca agatgtcggg agaaggtgcg tgggctcacc    175620
     gtcgtaaatg ctgctgtcag gtggctcaga agggaatcgt actgacattt gtgctcttat    175680
     ctcgctttgc ccgttccttc tttgtaacgc cgctccccat gttcgacgat ctgtcacacg    175740
     gcaaccctat cgcacacctc ctcctcttca catccgacac gacgctaaac catggtggtg    175800
     gccacaatct acaggatggc ttttcctgct ctcggtcctg ctttcggcgg tccttctctt    175860
     cactatggtt ttcttcgtgc gtactcaata tcatgcaatc cagggtgcgg atccagtttg    175920
     accatgccca tcgctgactc ctttctcact ggtctcaatt tttatcctcc gggcaacatc    175980
     tgccacatcc atacctacta tcattgatat gccacccaac gacgcaacag atcatcatgt    176040
     tctccgatct cgaatgcgac tacatcaacc ctattgatct ttgcaataag ctcaatcagg    176100
     tacgtttttc cccctcaccc ttctcgcttc caccttccct ttcgagtctc gctgacatgc    176160
     tctcgctctc ttttccctgt ccgctacgtc tttgacagtt cattctcccc gaaatggcag    176220
     cacacgcagt gctcaccctg ttcttcctac tcagcgggca atggcttgcc ttcctactca    176280
     atgctcctct cgtcgcattc aacgtcaaca aagtcatgaa caaaaaccat accttggacg    176340
     ccacagagat cttccgcacc ttgtctcaac ataagaaggt ctgctttatc aaactcggct    176400
     tctacctcgt cagcttcttc tactacttgt acaggatgat ccttgcgctc atcgccgaca    176460
     ccgaataagc gcacctgaaa cacgggcaac ctaggcgaca cgaacgaggt cagtgccgga    176520
     gacgaagctt ggagagatcc atacaagtgg catcccaggt aggggcgagg agagtaggaa    176580
     actgcagttt catcaccagg caccaaggcc tttatatggt gtttccttgt agtattgtca    176640
     aaaaaaaaca acccagatct tgaatcacgc ttcatctttg gtttgcgcct tgcttggcat    176700
     cctactgcct gtcgtttcaa gctgcatttt ttttggctat ctggataagc ctgtcgcatc    176760
     acgccacgtg acctaggagc tggaagccat gttcaatggc aagatgctgc atagaatcac    176820
     tcaacaacga cgacaaccac atcgcccaaa gaaacgctga tgtccggact cttgagctct    176880
     gctttgacct tgaatccttg acccacaact gctcctagct ccggaaccgt cagatcgatt    176940
     ttcatcttca tggcttctaa cacggctgct ttctgcgcca ctttcaccaa atcacccacg    177000
     ctaacccagc actttccaaa cgttggcagc gagatttgag ctgaccgcca gcgcttgtag    177060
     attggcatgg aactcgttgc tcgagtagtc ctcgttttcc agcgccaaag atttgtgttg    177120
     ctcattctcc tgcatctcta cttgccattc tgcgaacatc ttcctttccc tttccttcgc    177180
     tttcgacaat acccccgctt ttgttgttct aaattcaacg cttccttctg tatcaatgtc    177240
     aggaacgcgg attgctgggc aacatggtac ccgcttcgaa gtatttgaat gacaaattgc    177300
     actctatctg ctccatcttt tcagactgaa tcgtgtcgaa attttcaagc aaccacgacc    177360
     tggtaccgaa cgtggtccaa cagggtaatg tccgacgcag gagcgcgcat cttcccggac    177420
     aactgacgga acaggtggcg aaacagcttc gtccgtggcc ccagcgggtg gggttgaatt    177480
     ttcgggatcg catctgcttg cgtgcgtgca gagcaagcag aatcggtatg cccataaaaa    177540
     cccccacccc aacagccagg tgtttacacc ccgttaccgc gaactgagcg tcttggatcg    177600
     accaatggcc gttcgcagag gcggaatact atcgttatta tcaggcaagt aaagtgcgcg    177660
     cgaccgaacc gtttccatat gcttgtggag ggagaccttc accgacggat cgccaaatgt    177720
     gactggtagc gtgaatccac gcgtggcgat cttgaccatt tcagcgctca gaatctgctt    177780
     ctccagtcga tcaattgtta caagtcgctt atccagaaag gattcatctg gatggtgaga    177840
     cttcccaagc tgggatacgc aagagagctc aggattggct tcgtgtctga actgctggtc    177900
     aacaacgagt atagcaagga aagcagcgcg aaaagctaga cgagaagcaa ctttgagcaa    177960
     aacggtgacg acatcaagat tcgtgaattt ggacacgccc acaacgatgg caagtgcaaa    178020
     cggttttcga tctgcattca tagcgatctt actggtgccg agcggaggca aggagcgaaa    178080
     ggaaagcagg cgacgcgagc taacagcatg tcactcttgc aatctcttgg accctgcata    178140
     gaacacgcaa ggtgcaactt gacgccaaag tgtccgctcc tagctgaaac tcttcagagc    178200
     tttggcggtg gttggcgcaa gcgagtgacg ctgctcttac accacaacac acagacagga    178260
     tctcgggcgc gttcaagcgc tgcaaagaca gggagaaatg attgccgatg gatggctatc    178320
     gagctgagcc ttgtcttttg aatgcattca agcatatcta gcatgtagac aggatagaga    178380
     gacagtccga ggagcagatc gggatattca cgattgtggt ttccaacgtt gtatgttcca    178440
     tgaagatgag gatgagcgag ggacaagaaa tgaatgaatt caagcagatt cgtgattcat    178500
     gaatcgtgaa tcacgaatgt caacaacgct tttgtgaaac ttgaatccga aagtagcctg    178560
     gcttatataa tattaagtaa cgtgtaatag taacttatgg cgaatcgtga cgaatcgtga    178620
     atggtaccaa tcgtgaatta aaatgcaatc acgagttgtg aatcgtgatt cactggaaat    178680
     gcaccgacgt ttttttcaac gcgctgtcga atgtcgagtt gagataagtt aggttgagcg    178740
     gcgcgcgcga ctcacgagtg tgactggtgg ttgcagctct tagctgtgcg tggcaagcaa    178800
     cagaaggttc tcatgtgttt ttttgggcaa agtctgccgt cagatcgcgc cctgcttggc    178860
     ggcacgctaa acgtgagatt gagtgacaaa gtgccgcacg cgcttcaatt cagccaaaat    178920
     gggccacacg gcacaccacg accacgtcgt gtcgtcgtcg ctccgaaatt cacacgagac    178980
     tcacaactgt gactgaccag gcacagtcaa gccaagcgac caacaaacag tcactacgaa    179040
     agagtcgttc gctgcctttg aacggctttg tgggcgtgtg tgtgtctctc tgtctgtctg    179100
     tctgtttaag tagcgaaatc gtaattgccc actggccaac ttcccgagtg tctagccgtc    179160
     ttggtcagtt aggctggctg cctgtctctc tatctgtctt gctgcgtgct tgttgcctgt    179220
     cgctggcgtc caagtcgcgc tcgttcattc ctgtcgagat tgtcaatacc aaccgtatcg    179280
     acatcgtcac catcgtcacc accattcccc acctcacttt ggttgttcac aagcacttcg    179340
     caactcgctc tcagcaactt ggctgctctt ctaccggttc aaacggccat caccaccttc    179400
     agccaacgcg caaatcttcc atcaattgac acgcgacgcc tagtacagcc gagatacaca    179460
     gtcacacacc ggcgcttgtc ttcaacacca ttcacacccc aagccgatac ataacagagc    179520
     catcaatcgc gcgctctcct ctgctgcacc agcctgcgat cagtaccgtc atacatccac    179580
     gttcgctcgc ctaaacgcca tccagcttcc actgtcatct gctttgaccg ctaacaacat    179640
     tcgtcttcgc tggtgacgta cactctccgc aattcgtgcc ctcagcttcg ttgcagcagg    179700
     cagccattct cgtacagctt agtgcgcagt atctcgttcg ctcttgcgtg tccctgcatc    179760
     acaccaactt cgtgcacgcg ccctcatcga tccattccct cggttccact tttaccgaac    179820
     cagccagcaa cattgccgcg ttccttttct cggatcactc cttccctcat ctccttgccc    179880
     ctcccaacct tttggctggg atcgtacagg cgccatcatg aagggactca agaaagctat    179940
     ggtatgtatc agttgtaaca acgtgaagcg ccgcccgcat gcgtcagtgc gcgattccaa    180000
     gttcgattct acttgctgac cttaccgtat atcatcgtta cataaccacc gtcgtaaacg    180060
     tcctattacc tcgactctcc cagaaccttt cgcgttccaa gtcgaacgac tctaacggca    180120
     accgcagcgg atcggcaggc ggaggaaccg taccagcacc ccctcccaaa ggtggctccg    180180
     tacccgccaa ccctgcctat caaggctcac tcaaatccac caaaaatggc cccagctctg    180240
     catccagctc ttttagctct ctctccagct ctgcaacttc ggcagctccc tcacatgccc    180300
     cttacaacgt cccagtttac cctactggcc aaggtacgcc ccaaactcgt ttgcttcccc    180360
     acggtgtgaa taatctggct gacaagacgc cgcctgctcc tcctgtcgtc gtcgtcgacg    180420
     tctcttcaga gatgcccgcc gatcccatcc cacactcggt cgcaaccgcg tcccagcctt    180480
     cttcttccat cactcctttc catcatacag gctctccagg ttcccctcct cctccaggcg    180540
     ccgctatggc ttccctcagc agcaccggca tcgccgcttc cgagctcgct acccctccca    180600
     aggctgcctc gctcacccga ttgcgtcaga gcccctccaa ctcgggcccc aaggatacca    180660
     ttcccatcac ttccaaaaca ccgccgcgca agcagaggag ctcgcgcttc catgtcacag    180720
     aaaaggtcga gctcgagaag cttccacact ttaacggtat gtgcccctca ccacgctttt    180780
     ttgaccctca cattgcgata caacaactga ccccctcttt atttggctcc aacaacagag    180840
     gtggtccccg cggatcgacc cgagctcttc gtccgaaagc ttcgtcagtg ttcgctcgtg    180900
     ttcgacttca acgacgccag ccaggagctc gagggcaagc agatcaaagc cgctacacta    180960
     cacgagatgc ttgactacat taccaccaat cgcaaagtca tcaccgacga aatctatccg    181020
     gaagttgtcg ccatgttctc tgccaacctt ttccgctcca ttccaccaca ggtcaacccg    181080
     gtcggtgacg cctttgaccc agaagaggac gaaccggtgc ttgaacttgc ctggccccat    181140
     cttcaaatcg tctacgagtt ctttctccgc ttcgtcgaga gccccgactt caacaccaac    181200
     attgcaaaga aattcatcga ccaccacttt gtcttgcaac tactcgagct ctttgacagc    181260
     gaggatccac gcgagcgcga tttcctcaag acaacattgc atcgcatcta cggcaaattt    181320
     ctcaacctcc gagcctttat cagacggtcc atcaacaacg tctttttcca attcatctac    181380
     gaaaccgagc gtcacaacgg catcgcagag ctgctcgaga ttcttggttc catcatcaac    181440
     ggctttgcgc tgccgctcaa ggaggagcac aagacctttc tgacgcgcgt gctcatcccg    181500
     ttgcacaagg tcaagagtct cgcgctctat cacccgcagc tcgcctactg tgtcgtgcaa    181560
     ttcttagaga aggacagctc gttgaccgag gaggtgttgc tcggcttgtt gaggtactgg    181620
     ccaaaggtta actcgcccaa ggaggtcatg ttcctcaatg aggtcgaaga gattttggac    181680
     gtgatcgagc cgtccgagtt tgtcaaggtc gaagtgcctc tcttccagca gctccagcga    181740
     tgcatcaaca gtcagcactt ccaggtcgcc gagcgcgctc tgtacttttg gaacaacgag    181800
     tacattgtca acctcatcgg tgacaacgtc caggtcatct tgccaatcgt cttttcttcg    181860
     ctctaccaaa actcgaaagc acattggaat cgcactatcc atggtctcgt ctacaatgcg    181920
     ctcaagctct ttatggagat caacccagcg cttttcgaga tgtgcacaaa cgagtacaag    181980
     cagcagcgcc agatggagaa gcagaagctc atcgaccgcg aggaggcatg gaagaggctc    182040
     cgcgacaccg ccatcaagaa cagcaaggcg attggcgttg aaatgcccgc ctcgctcaaa    182100
     gaggagcaag cggcgccagc gggaagcgtc aacccatacg acctcgatgc ctttgactcg    182160
     gcggctgatt taacagcagg cgccgatagc ctgtttgagc aaatgggtca aggcatcaat    182220
     ggcgaagttt cgacgaccga ctttgacgat gtcgaagccc accgcgttgc acaagaaacc    182280
     tcgcaagcgc agcaacctga tcttaccagg gaagacagcg ttgacgatat ggtacgttga    182340
     cctttgatcc acatcagcag tcgactcgca cttggcgaga aagcaaaaga aatattcgca    182400
     tccgctagca gcccactcgc tatcgtaccg tgtaccactg cttcacggag cctgactaga    182460
     aatgcgaaat tcatctttat ctttgcatcg ctgtttcgtc atctctggca gaaagatttt    182520
     ccagaaacgg ctcgacagca ggtcaacaag caagagtcgc ctcatgtccg acgcaagagc    182580
     gtaataccca tggacccgac cgtactggcc gagctggccg gtcacaagag cctagatggg    182640
     tgagtatttg ttgattttcg ctgttcattt tgcgggcaca agttgacgag atgtgcggtt    182700
     tcttctcact tgtcgttgca gatcggatct ttctcagctg tcgaatgatg catagacagc    182760
     tccctcttgc gcatacacat gctagacgta atttgttgtg ggttaatgca gtgggacctg    182820
     gtcttcgtca tggcaactgc tgatgaaccc ccgagtgcac ttgaaccaac ccgctctcgt    182880
     cggtgtcatt cttgtcgcat atcttgggaa gcatctctag cgcacaacat cttgtcccct    182940
     tttggtgttc gttttgtttc ccatcgtgat ttccactttc cttctctacg gtgtgttttc    183000
     aggcatgtgg ttttttagaa ggctctttcg ttggctcggt gtgtgtggtt gtgtcaagtg    183060
     ggttgatgag gtgggtcggt caaagggtga atgctggcgg tggcggtgga ttcggggtcg    183120
     gagttgaagt tcatttcgat gtggtaaggg tgtacgtatt ggtgtctgtt taggatgagc    183180
     tgatctgtct tcctgaccac gtcgtattcg gtatcacttg ttcaagcggt gttttcgcaa    183240
     acatgcatcg accaactagc ctctacgtga cgctgatctg cctgcttgga acggtgatga    183300
     gcgttcgagc ggcgacgcag agggtcgggg attcgtgcag ttacaagcag aactgccagg    183360
     attgggcgga aggtgttggg ccggactggg ccaaaggagc gataacgtgt gctgtgccgc    183420
     aggatggtaa acccgaaaaa tgcggcagtg gcgataagaa gggcagagac gaattctcag    183480
     ggtaagccag caagctcaaa ccatgcttac aacaccaagc acttgctcaa ctgatacgcg    183540
     atatcttgat attctcaacc accaatagcg tctgtaaagc agtaggcacc ctgtcagcta    183600
     cagaatacgg ttgcgcctgc ggcgtccaca aggcagactg ccccgaaact agccccttct    183660
     cccgaatctt ctggccccag gactggctcg aaaccgcctg gtcccaagta caccactaac    183720
     cgcttccccc ctcccgtcgc tcgtccagcc ttcttggcat tcgccataat ccttcgagtt    183780
     gcgcgtccat accaccacac cgactgttct ccatcccaaa tcacatctac acccagccaa    183840
     atcaagtggt ttgtccacac aaaagtcaat tgtgatttcc caggtgtgca tgtagacaag    183900
     gatgtcttgg ctacaaaatc aaagctgcac gctgcattgg gatggtgtga gatcctcctt    183960
     ccccagctta agcgttatat tgagatcgat gagaggacag accaagacgc acgccacatg    184020
     aacctcgcca atgtgaagcg atagggctca acccgaacga ggtagattgg gcgttgacga    184080
     agaagccagt ggcattggcc ggatcgccgg agttgcattc gcgccgccga ggaacccgcg    184140
     gtgcaacgtg atcctcttga gcggctgtgg cgcttgtgcc gctgtcgccg ataccctgct    184200
     atccgccgtc gagttcgacg acgcatgtgc agctcgtccg tttccactcg tcgctcgact    184260
     ggcgttcctc gccgacgcgc ccgaaccccg actccgtgtg gcgcgtgtgt caggatcttg    184320
     gtacgtatat tgaccgagac tcgcagcagc cgccagagca ctcttgcgag gagctgcacg    184380
     ctcttttcgt aagccagcgg tcgccgacga tttcggcgtg tttgctgttg gctctgcttc    184440
     tgcattgcgc gctagcgtcg accgccgtcc tgttccgccc gttgctgcag tgcgaccaac    184500
     atcaggcgcg cgccgttcgg tttgcaagaa tctttgacag atctcgatat aaagagaccc    184560
     gtacttttgc acccaacgag cgccgtcagt gcctctcaaa cagctgctca gcgcatcgat    184620
     gctgcatgcc gccaagaccg aaatctcttg caacttgtcg tcgcggatca accagccgcg    184680
     cgactgtttt tcctgacgag cgagtcgatc atcgagcttc ttgagctcgc ggtagcagcc    184740
     ttgattcacg tccgatgatc gaggatcgat ctcaaagtcg tctgcactgt cgtcgcttcc    184800
     agccgcattc gagaccacgc ggcggctgcc gttagctgcc tggttgtcag cagccaatgg    184860
     agcatcgtcg tccgtgtcag catccagatc aaaattgtcc gtgaacatct cttccgggat    184920
     ccaattgtcg tcgtcaaggc taccatccgt cgtccctgcc tgcggctcca ctcgtgatgg    184980
     cggcgtcaag ctgacatttg aaatgtcgtg cgcgtcctcg tcgaattcag cgaaatcctc    185040
     atctcgaagc tgcctctgct gctttcgagt gttctgtcct cgaccgttgt tcaacgatga    185100
     tgatgccgcc gacacctttg ccgcgacttg catcttgatc gccttttggc cgttcaatac    185160
     cttgtcggcc gccgagccca ccatcaagta cgacgtgtta aatcccgccc gattcatgac    185220
     atctttcaac ttgaacacgc cttccgagca aagatgctca aacagccggt ggatttcgac    185280
     cttggcgatc tcactacctg cgccgtgcat ctcgagtttg tcgtgcccag cctcgcggat    185340
     ctttttggta cgatggccgt agaacacttc ggcacagtgc ggtaacgtcc atcggcctcc    185400
     tttgtccgcg atcgctttga ccagcttgat cgccttgaca gcgagttcgg taacgtcttg    185460
     gatgtaaatc gcaccggact gacggcagca gttatcgcac gtgctgcgac actgttccga    185520
     ggtgaacccg gattcgccaa agtaacgcag gacctggacg cggcgacatt cgatttcgtt    185580
     ttcgcagaag cgttgcatct cgcgcaagga atcgatgcta cggtctattg cctcttgcga    185640
     cttttcctcg ctgagcatca tgttctccat cctgcgcacg tcagtccagg aatagtacag    185700
     gatgcagacc gagtcaagcc catcgcgtcc agctcggccc gtttcctgat agtagccctc    185760
     caacgacttg ggaagcgaat ggtggatcac aaagcggacg tcaggcttgt cgatacccat    185820
     accaaacgca atcgtggcta caatcacctt gtactcgccg ttcttccatc tttgctgcac    185880
     ctttgaacgg tcgtccttgc ccagtttagc gtggtagtgg tgagctgtga tgccgtgctt    185940
     tttgagatcg tcggcgaccg tctcgcagga ctcgcggctg aaacagtaaa cgataccaca    186000
     ttcgtccttg tgcgaggtga ggatgaaact agcgatctcg tcgatcaact tgctcttggg    186060
     ctttttgcgc acctgatact cgagattcgg gcgattgaag ctcgacgaga gctgcaatac    186120
     gttgcgcatc ttaagacagg acttgacatc cttgatgaca cgcgcattgg ctgtagcagt    186180
     gagtgccatg atgggtacct gcggatactt gtctcgcagc gcacccagct cggtgtaatg    186240
     cggacgaaag tcgtgtcccc attgactgac gcaatgtgct tcgtcgacga cgatgcgcgc    186300
     caaccgcttc tgcgagtaaa ggaggtcgag gagttccatc gcctggttag attggcgaat    186360
     gaattctggc gttacataga gcagcctcaa agagcccacg cgatccctgg ccgtgttgaa    186420
     tgcgtctcga cggtcgttcg cgctcatgtc gccagtaagc ttgacggcgg gtacgtcctt    186480
     cctgacgagg tccagcacct ggtcttctat gagtgagaga agcggtgaga tgacaatgct    186540
     gacgcccgtg gctttatctg tgtcgatgca agcgggcagc tgatagcaga gcgactttcc    186600
     gccaccggtt ggcataagga cgaagacgtc gcgtccgctg agcgtgccat tgatcgcctc    186660
     tagctgattg cgtcgaaagc gcttcagttt gaagaatttc ttgagcacgt agcctacttg    186720
     ggtggtccaa ggataatggg gcatgctgcg cagctgatcc ttggacatag gctcttgcat    186780
     cgaggggccg caaagcttga atttctcctc gaccggcatg gcctcaacat cgtcttcgtc    186840
     atcatcgctg agttcatata tctgtgcgtt gacaataggt tgatcacgtc tgtccgcact    186900
     gaggctgcct tgcagaaagc cgtcttgatc atcgacgttg acggcacttg ttgccacgga    186960
     gggagcctca tcggcttggg tacggtgctg aattgagttg tctacaattt ctggcaaatc    187020
     tgtgctgttc tcgttcgcag aaacgatgtc atcgctagca tgtagaatgt ggcttggatc    187080
     tcgcagtacg cggagaggag ccgttgagtt ggatttagat gctgtcgagg aaggtgtttg    187140
     ctcgcgcgat gtcgttacag gtgaggcaag aggcttcctc gcagctgaca ccatgttgtc    187200
     gcccaagatc tgaaacgagc tcgaggttgt gcggaccgcc gaatcagaat aaggatttgc    187260
     tggcaaactt ctgactggag tcgaccttct cgaggtattc tcggcagtgt gaccaggcgt    187320
     agttgccgag gtaagcgacg gagcgggcac agctccaaat tctttcgcac cgagcgccca    187380
     agcgatgtga gccagcttct tttgcatctc gtgcacacgc tcgaaggctt cgtgcttttg    187440
     gtaccaagcc tcggggccgt gccatcccag ctctagtgtt tgcaattgtg ccaaacggcc    187500
     gcgcaaaatt tgttccttgg ccgcaaaatc gatccgaagc tcgtcttcgc tgtacttgtc    187560
     atattgtgag tcatactgag gaggcgcggt ctgagatgag ccaagcggtg gatatttacg    187620
     aggtgtctgc gatatcgagc cactcgaggt aggctgtggc agacgcgatc ctgatggcag    187680
     gccgccgctg acgtttgaga tggaagcggc cgatggacca gacctcgatc tcttttgagc    187740
     agtggatgcg tcctggtcat cggtaataga ccgcttgggt gacggtcgat cacgtgcacc    187800
     tacgtgtttg acatcgtcta ggtgtgtatg ctcgtcatcg tcgagataga tgatcccaga    187860
     cctgcgatct tccgctttgc acgcgcgata tggggtattt ggggttagtg cggattgcgg    187920
     cataactgaa agaaggcaat cctgggcaat gtgcgtgtcc gacacctttg gggcgagctg    187980
     acacgagtcg atgttcttga tgcgagagcg acgttggcaa cacagcgagt acttcgatgt    188040
     acaacgtctg gtgagaacaa tgagaacaat gcggatgaga ttgggcttcg agccactggc    188100
     gaggcaacga atgggccagt gtttgctcag cggagtcgct ggaggtaatg acgattctgc    188160
     gggcgaaaag gatggcgaaa agagggtagt gatttgctca gggccgactg gagggcttca    188220
     acagcaagtc atccggagtg ctctcttttc ggtgtgcaag tacgatagca gatgggattg    188280
     ctgatgctga gaaaatgaca gaacgagagg cgctgccgac gttgatagaa ttgcgcggag    188340
     ttgatattat tgcggcaaga gcagatagat aacacgatca tgtgaatgct gagtcagtat    188400
     cgcgggtgtc ggccgatgcc gagagtcgat cgacaaaatc aacagacgat agatgtaggc    188460
     tgcgatgaag gggcgagccg aacgtgttga aaagagtgct gctgatcggc tgtgattgtg    188520
     gatcgaaaaa ggttcttttg ccacgtatgc gatgtggata acgcttctga gcgatttggt    188580
     gatccttgtg atgaggagag aagccgtcgg cgattggaac cgaagcttac tgcgcagttc    188640
     caacggtcct acgaggagag ttgcagccac cgcggcgtgc tgcctgaatt ggaaaaagtg    188700
     ttaattgcgg tttctcaatc gtgaatcacg ttcccaagac gcgttccgcg tcggagcact    188760
     tttacatttc ttcctagaga gcaccgaggt ttcgctcagc agttttcttc acggttgatt    188820
     cgtgatagta ttcgtgaatt tgttcgcgac ctgtgcttgg aatgtcaggt ggtgtgtgga    188880
     ggtcgctggg ccagtcacgt gatgcatcaa gaaagtgtct ccgctgcaaa gtgcattttt    188940
     ttatggtttg gctcaaccaa gaaaggtaaa aagtggtgga tgctattcgt cattcatggt    189000
     aagaaagaca ctttcgacag tctcatcctc atccattcca gcctctcctc ttgcctgcag    189060
     ttgcgcacac tcgacgacaa cgcgacagta tcagatggac acacagacgt caacgtccag    189120
     caggagaggt agcctatttt cgaccagaag acgaagctca gcactacgaa tcacgtcagg    189180
     cagcagggcg gagtacagag tggatggagt cacccgtcgc cgctttgatt cgaagcggca    189240
     acctaggtca gcgccaggaa gattcgttca cgcctgatct acagcattca cgctacatgt    189300
     cgggtgaatc tgacaatgaa tcggcttatc ctacaccttc ggacccaacc accgccgctc    189360
     aaccagtacc tcacgagaca tggcccatta gcagcaacag caagatgatt gacggcattc    189420
     cggtccgcgc cgacgaggaa gtgcgcaaga tccactacat tgactcttcc gctgaccatg    189480
     cgttcttgac cccagccacg aaactggaag ctccgacggc agtggctacg acgaccacaa    189540
     tgccctcatc gtcggtcggg aatgtagccg acgtgtctca tttgcaagtc gcacccacca    189600
     accaggcagc ttcagcagca ccaacaggag cctcgcctat ctcctctgct acattgccgc    189660
     cctgctcaag tgcagcgcag aacaccggca cagctcaagg tctgacgggg aacgcagctg    189720
     ctgtgtcgtc aatgcctgcc accgatgcgg ctgtctgtgc agcggacgct ctgcccttgc    189780
     gaccggtaaa catggcaacc tcttctgctg cgtccacacc tgcttccaca ccaggcgcaa    189840
     ctccacaaac gtatgcacgc aagagaggca ggccacgcaa gcaccccctc cccgatccga    189900
     acgcaccacc caaatcgaag cgcaaactaa gtccagtcag atctgctgcc gctgctgcta    189960
     agaagaaagc cacggcggct gccgccgctc gctctgccgc ctcgagtgct ggatcgctcc    190020
     tctctgtccc cgatctcggt cgtctcatcc cacagggttc aacgtcggac aatgcacaaa    190080
     attttatcca gaacaatctt cgcttgtttg ccgatctctt tgtggcgctc cagaagcagg    190140
     cagccaccga cagtccagca cgcaacgaat ccctcgtcct tctcaccggt gcaacacagg    190200
     aaaacatgca acacgctctc gacgcaggtc agaacgaggt ttcgaatagc gaaagcacca    190260
     gaacatctgt gatagatgaa cgtccgcccg aagacatggc gacctcggcg cgtgaaccga    190320
     cagctgctcc atctactctg tacgccgata ctggcgccgg tatggcgaat gtgggagcaa    190380
     cgtcgtcaac ctcagcagct ccttctaacc ctatctcggg acccagcgat gccattcgcg    190440
     acgaaatcaa gaaaaagatg gccgacgtta ccaagggtcg cgaagccatc caagccgaga    190500
     ttcttcagat gcgcgtcgac gcaagcttct tcgagaatgc acaaaagacg gtcgacgaac    190560
     gcatcgttgt gctccgagat cgaattgcta agcacacagc gctgctacaa cgagagcgtg    190620
     aagcaacgcg ccaggcgagg gaagccactc gcagagccaa aaaggatcgt aaggcaaggg    190680
     agaagagttt gcgcgatagc gagagggagg agcgtcggct tgctcagacg tttgcacagc    190740
     ttgaacgaga gatcgctgcc gaagaagagg agcggcggcg actggaagag gtcgattcga    190800
     gcgacgaaga ggaggacgag cggcccgagg agcaacgcgc ttcagtctca ggaagccagt    190860
     tgccagcaac ggaaacagct tcgctcagtg cgagtcccac cgaagcgaca actgtctctg    190920
     ccaccggtac gccttccatt ggtaatgagg cagccatcac accagaccgt gccatcggct    190980
     tcagcgacga agagctcgcc aaagtgctgg gtatctcgac cagtgagctt gcaggcttca    191040
     gtcagacgct cgagctgact gctggtttgc caacttcgcc aacgcgtaca ccgctcagca    191100
     gcagtgcggc tcaaccagac gcgacacctt cgacatttgc atccatgctt ccatccgtca    191160
     cagaggcttc tgattcgaat gctgacagct ttgacgtcgc cgcgtttctc gagatcgctg    191220
     gctcgtttgg cagtgccagt gacgctatca caagcgagtt atctgcaacg caacagcaag    191280
     gataatgcaa gtctcatgaa aggctacatg tccaagccgc aatccggctt ccacgccgtg    191340
     aaagtccagc aactcgaaaa attccatgaa caactaatct cacatcacat caaatgcatc    191400
     gtgcatcacc atcttgtact tttacacatc agatactcgg ttcaacctac atcttgacca    191460
     atcgtcatga cttgcttcac ttcatgcctt ttgattcgac gcctgtgagt gtgagtggag    191520
     atgtaaagga gctgtgtgcc gcgtacagga gcatcgactg tcatgcccgc tcttccgcct    191580
     caaactctcg cgaagattct gtacgacttc gtcctagaag atgagtttca cgccttgaat    191640
     tgagatagcg agacgttttc atcgacaatt gaatagtata gtttacaaag atgctgatgt    191700
     cggagtcaac tagaaatcgg tggctcgccc gccgtatgtc cactccttct cgtacttcaa    191760
     cgggtcattc ttgggaccac caacttcgcc cgtggtaggg ttcgtctctc cttcgaattc    191820
     agctttgggc tttcgtcgag catccgggtg catttcgccc ttttctggat ccgagcttga    191880
     gagaaaaggt gatgcatctt aaggtacaca gccattatca gatgttgaat ccgtcaatat    191940
     ctgttgaaag gagaggctca gatgatatgg ttgacttact ctgcttttgc ttgaccaagt    192000
     tttcgaactc cttttgctcc tgtggtggca aaggtggggg gccgggtcgg ttgaagccgc    192060
     ctgagcgcac gagaggggtg gtgtagagcg ctcgacgtga tgcgctttgc gccgcactgt    192120
     ttgacagaga aaatttaatg gcagatctgg tgattaatat catcgtgctg atctgtgccc    192180
     ggaggagtct agagtctacc gtctctgggg tgaaggtgat gagcaagtgg caagaaagaa    192240
     agtgtgctgc acgaagttgt tgtatgcaag ctatagggtt cgggtggagt cgtgagtgtg    192300
     gaggtggcgc gtcacacact gaattccccg acgttggagc tgcttacgtg atgccagctc    192360
     gggcgaaacg acctttttag agaacaaacc tcagacgccc aagtaggacc tacccaccag    192420
     cgaaacatcc atggcattca agattgttca acagctagac acctggtaca actcagcttc    192480
     aacgtcacaa caatcgctga gacgctctgt agcggagaca ccagtcaaat tcgccagaaa    192540
     cataatccga tacaccctag atacatacga gctgaaacga agaaatgaaa acaaaccaca    192600
     aaaccgagct gcatcacgat gtgatgggaa tattgatgaa acacgaatcg tgaatatgaa    192660
     tgtaagtcat gagtatgaaa ccaagcatga acgtgcaacg tgcaagtgag ggtcacttgt    192720
     tacattttag aaatcgtgaa tgatgcaagc ttattgcctg gtaggaacac gagcagcggg    192780
     gttctgggct agagcaccca cggcatcgcc ctggatgtcc tgaggagcga acgagtcgcg    192840
     ctcctgatac ttggcctcct tgatgtcgtc ctgcgaacat cgatccgact cctcgtccga    192900
     ctgcagcaga ctcgtgtcga tcgccttggg gttgaacgag aacgagccct tggggatgaa    192960
     ggtggcggcg attatgacta tggagaggac ggtgaagtga acaccaccaa cgtacttgag    193020
     gcagtcgcgc gcacggttga tggcagcaac accagaaaga ccacgcagtt gacggtcgat    193080
     ccatcgacca aggaaggtcg agatgagcga gtacatgaca atgtaggtaa catagaggaa    193140
     agccattacg gaaccgagag ccgagacgtc cttgtccttg gcctccatcc tggcgagcgt    193200
     cgactggatg taagcagcga gcgacacgtc accagcagcc caaccgtacg agacggggat    193260
     gaagacggcg gcgagcttcc aggcggatcc gacattacca cgggtgtagg ggaagaaagg    193320
     catcacccag acgaggttga gcaacagagc atccagacgc aaccagggca tgggggtggg    193380
     gatggcctgg gtgaagatca tgaccgagag ggcaccgagc agttcaccaa agttggaacc    193440
     gccgacgatg atctgcgaat aggacgaaac accaatgatg gcacgggcgt agatgggagc    193500
     aagaccgttc tcgaggtatc ggtgaccgta aagggcaaag gcatatccgg gaacgagcca    193560
     gatgaatcgg cggtcggtga agatgaggta acctccgtac cagaaggcct tgatgaaggc    193620
     gcgaacaccg tcgaccatcg acatgacgat accacgggtc tcaacctcga cgcgggcaag    193680
     gcgagactcc tcctcattgc gctggctctc accgagcgag gagatccaga tccatacggc    193740
     ggcggcgagg gtgaagagga cgggagagag gaaagcagag tagttgtagc caaacttgcc    193800
     gatgagcgag gtcgaggtga aggcaccagt ggtaccggca acctcgtaca tgacgtggac    193860
     gaaagcgtcc atctttcgca gacggtcgac atcaccacca acaatgtcac gaggaatcac    193920
     acggcggatc agctcgacag tgccgtaaga gatacccgag atgacgtaga tagggaagag    193980
     accattcggg ctccagctac cgtacttggt cttgttgtta gcggtcttgt acttgagcac    194040
     accgcccgtg gcagcgtcgg caatgagagg aacagtagcg atgataccaa aagtaagaac    194100
     ggcagtagcg agtaccgtac gagtagggaa acgcttgatc aagggagcga caatgatgga    194160
     gccgatgcac tgggcggcgt agttggtacc ggtcaagatg gcgatcttct cgaaacgacg    194220
     agcaccaaaa cgctcattag cctgggtgat aaagcttcct gcaaacagtt ctagcgctac    194280
     cttataacac ataatgccac aggtataaat gccgatgttg cgacgttgtt cgggcgtgaa    194340
     ggcgccccat agttgcagtc ccatgatgga aagatatccg cgagggggtc gattgggagt    194400
     cgggacgaag aagaggcgca gactttttgg tgggatagga gaacagtagt gtgttgatag    194460
     gtgggtgaaa agtggactga gaagaattga acctggttgt ggtcttatac ggctcaggat    194520
     gattgggtag caccttgcga tattgccacc cttgtgcaat aaagagagag agaccttaga    194580
     actctagctt tctcagcaat cctgtgcctg catcttcgca gcagccagct cctgctgaga    194640
     agcttggtga atagaacaaa ccagcaaagc tcacacagta ggtctgtgga gaagacggag    194700
     aaagtgaaaa aggcccgtat agtttcgaag accgagttgg acaaggccac gttccattcc    194760
     tgctgcagca catttcaggc agcgttgccg catctgcagc tgggaagctc tccgacgtag    194820
     ggagaaagcg tactgtatag aatcggcttc agaatggcca caacagcagt cacaagttca    194880
     aagcccgtcc ctctgcgagc ggaggagaga agggaggtcg agcctgccag tacgaaccaa    194940
     cacgcctgag ataattcgcc cgtttttttt gtcctttgac atgaggtgtc cagtaccgct    195000
     tccagactga tcaaaacgcg tccatttgtg attcaccact ggaaaacttg ccttgacgaa    195060
     aattgactca caaggaagcc ttcagagcac tacattattg cacactttgc gaacgacggc    195120
     agacccggga gcggcggctg gacggcttgg cgcttagcta tggagcccag attggttcaa    195180
     ccaaggagcc acgagcaagt gcaatcgtga tttcgtccag gaaagacact ttttaatact    195240
     tgctgtattc gtgctcacac aaatcacgaa tcgtgaatgg catctcgatt ggaactcgtc    195300
     tttaagaacg tgcgctcatt taacgagaga gcgaactagc tcataagctg tacacggtct    195360
     ggaacggcgg ggaaaggaga aggggcgcct gggtccattt ttttgggttt gtaggaagcg    195420
     aagcgaagct agtgacgacc atcacgaaaa atgcaatgaa tccatccaca gatcatggat    195480
     tcacgatttg gtccttcacc aggaagcgga gcaacttaac cgaatcgtga atcagattct    195540
     gtctcttcca aaacaactct cctttgcccc acagactgat ccatcatcga caaaagcttg    195600
     acagatcaga cgactttgcg gatcgaacca cgctgccgcc caagctccgt tgccctgatc    195660
     gcacgtgtga ttccgggaca cgaaatgcac actgcctgct ttcacacgct gtatttttgt    195720
     atgtcattta ttcggcttgt ggtatctggc cagcttatca ggtcccatag tcacactgct    195780
     gcaagcttga acctagtcga taggtttcct cgttcattgc caagacagaa cgtcgtcaga    195840
     gcgatatcca atgtcggcga acgtgccatt tgttttccag caacctttgc ggcaggcgtg    195900
     cttcggtttg agtaatgacg aatagatgat gtccacggct aactcattaa taaaggcgag    195960
     cgaatgctat cgatttgtcg ccactcaagt aagttgtgcg cacaaacagc cttgccgtcg    196020
     gtcaagtttg gcgagacctc agctctgcag tctgtgccag agcgcaggaa agggcgtggg    196080
     gacggaaggg taaccaccga ccgggggtcc gatctgacag gtcttggcaa ggtggcggga    196140
     cgagaacgtg cgcatcccta aatcttgatg ctctgctgaa aacaaaggaa tgtcagctag    196200
     gccgcgcagt actttcgaat gaagtgtagt gtatctacag caggctatca gcagcacagc    196260
     tatccgtcag tggctcgtac cttcctagcc tctgtgttca gagatctgga atcaacagac    196320
     acagccaatc acgaatttca atttcaattg caacttgaca gaagcgcctt gcgatttgaa    196380
     cagaaatcta cctagttagt caaagacaaa tttgtatcgt gcaaccacgg gaagccgctt    196440
     cgacgacggt gttcacgcta aacgaatgaa gtggtgtcaa gcaattcatg ggtcgtctgt    196500
     ccacgttggc ttcttggcgc agctcgttca cgtcgcgtgg gctgctcgat gctagcgggc    196560
     aagaaaactt gtgcttgcca agactttggt tgcagctctt ggcatgctcc ggatgcatat    196620
     tcaccatttt caattttcaa gatcaagttt tactgtatcg tgtgggtaaa gcgttcaaga    196680
     tcatctaact tatctcaaat gctttcatcg cattccagcc tgatgggcta ctaggtctct    196740
     gcttgacatt tatcacccat cgtggacctc tgacactcta cggatcgctg cactttcacc    196800
     aagatgagcc tgtctatctc tcgatctttg aatttagtct agtgccttgt gattgcctga    196860
     aggtttgcgg tgcctcaagc gtaacgacag cgactgttaa cattcacgat tgagagccca    196920
     gtttttgaag aggtgaggaa agagatgaat tcataccaga cccaaaaggg agtccagaaa    196980
     tttgcgccgg aaaatgactg tgggttgtcg aaaataggca catttcttcg tggaggggaa    197040
     tgccacaaga aaaagaggca aaagaactgc agcacctagg atttctgcgt agtcccccac    197100
     cgcagtacta attaggcgat acgtagctta gacttcgtag atcggacggg atgcggtgct    197160
     ttcaacgttc tatggccgca gatgtaaagt tatggtgagt agcatgatat caagcgttta    197220
     gtgaccgtcg ctttgcaaaa ttgcgaaagc tctcttcttt ttctgcaagt tttgtgccag    197280
     catttacgcg ccagtcacaa gtccaactca cgattgaaaa gagaaaaaac aaaaccaatc    197340
     gtgattatat cataaatata cacgatatag ttatacttaa cttatatata gatacatctg    197400
     agcaagactc tcctcgttgc aactatgcgg gtatagtgga cggcaatcgc gaaacggcag    197460
     aaagcaacgt cagaaagggc gatacgctac ggtcacaaag gcattgtccg caagcgtttg    197520
     accagcttga cttgttcagt cgctgccgtc gcctgctcga gaatggacta agggagtcga    197580
     ccgtgggttg gggcgcgatt ccaaatgcag taagtatggc gaattagcat cgaagcatca    197640
     atcaatacga tcaaaggcct tgtcagaaca atacttacaa cttgtagacc cgtaatgtcg    197700
     acaaccgatt gcttgagtgt gcctgccacc tcggccttcc tcttgagatc gatgttgacc    197760
     ggtttgctct gctctcgtag ctgttgggcg tgctccttct cggcgttgcg acgctgctcc    197820
     tccttcttgg cctccaatgc tcgaatgacg gcagctcgct tttccattgc ttccgctcta    197880
     cgcgctggaa gcgccttgcg gaatccaatc acctctgtcg tcaaggtatt ggcttggtca    197940
     ttgagcacct gcagccgtct tgagagatcc tcgtcgaagg gttcgacccc tttgctatgc    198000
     cgcgcaaact cgcttggtga catgccattg tatagaaggt ttcgctcgat cttggccttg    198060
     gccgctcctg tcaactaaag agggataatg tcggatgagg agaaagcatg tccacgaact    198120
     tcagaacttc tctgtacaca ttttctgttg ttttgcagag cgagactcac ccttttaaac    198180
     gtcttgttca ccaaggctct gagcgccttg tcgcgctcca gttcgcttcc aaactccatc    198240
     tgtgccactt tgtgggcatg ctgatcgata gcacgaagta catgatctag atccgccgga    198300
     cggtctaggt tcaagcgtgg gaaatggccc gacattttgt cgaagaggtc gccgctgctg    198360
     ctgtgattgt agaagggtcg gaatgaaggc gagaatcgga tgagccgaag acggattggt    198420
     gacaggcgtc aaaagggccc gaaggcgtca gaacagcgag acaatccgaa tcaagtatgg    198480
     caaagctcct ggtgatgcac gaagatagat agagatacgc gccggatcgt tagacggtgg    198540
     tggttacatg tacacttgtg gagaatccga acttgtgagt ctgtgagtgt cgaaatcaac    198600
     actttgtgac tcaaacgact cttcgcccag gagcgcgtgt tcggaattgc cgccggcgct    198660
     ctctctgcac cttgttctcg tttttccaac tcgcaacaac acgcgtcttg gctggttcac    198720
     accacgacaa gcgtaaaaac agtctcgaga gtcacgagtg cgaatttaca gtataacagc    198780
     agattctgct ccacgcatat ccgcgatcat acttgatacg tgatcattac gatttgtgag    198840
     ttagaccctt gactcgcctt cgcctctagc agcttcgttt acaaaatttc cgaccaggca    198900
     agtcatctgc ttcagcgtta atctctgcta cggcttggcc tgcaatcgcg cttgaacaac    198960
     gccgcctcat caccatcgta atccgtcaag agttgcgcga aatgcaaggt gatcgatcct    199020
     gtcaccgcac agtttttctg caggcatgac cgacgaaaag gccgtcgttc cgacccaaaa    199080
     gcatcgccca actttcacac aacttcctac tatacttgtt cggctggtca atgaccgctt    199140
     cgatgaagat cagtatgatc aggctgtcga gctgctcgaa cagctgcgag tagaaggtgt    199200
     aaggcctcca aaaagcttga tccagaagct cgtcggcctc agtctatgct cgctcgctcc    199260
     gcgacaggtc gcttccacat caagatggac tcttgatcat cagctgcaca acatcgccgc    199320
     tcgactcctg acacagcaca agggcaccaa gagcgaccgc gatgcgatga agacaacctc    199380
     ttccacgcct gaacgaccct cagggtctgc cgtgctcaga gctagctctc ttctcatcca    199440
     gtactcccgc tgcaacgctt tgatctctgt cgacaacacc agaccgcaat cagaagctga    199500
     gcgcaatgct tccttgctcg ctcttcatgt tcttgaatct ctgccatcgc agagaagacc    199560
     gctggaaagt cgcaagtcca accgctcagc ctcgacacaa cgagctcgtc tggactcgga    199620
     acgactcgac gacagcgatc atgacggatc gtttgaggtc agctcgatcg agcaatgggt    199680
     atacgatcat cttcagcaag cagaggacgt gtgggacttg ctgagcggtc gaaggttctc    199740
     gaatgactcc gagagcgagg aggtctctct tggacgagtc agcgagttct ggatgaacga    199800
     ctctgagcgc aaacgatatg cgaagcaatt gcacgctttc gccacggctc atcagcgtct    199860
     cgaggaccgg ctcagagacc accgatggaa gaagctcaac ggtggcaccg atagtaactc    199920
     atccgattca gatagcgatg aggtctcgga cgaagatatc ttgggcctca aggccaaacg    199980
     ctcggtccag cccaacagca aacgcaaggc cacatgtcag caaaagaagc cagataagcg    200040
     tgaacgcacg agaaagggcg caagactacc gtacaacgat acaggaacat cacacacaaa    200100
     cgtcaagatg accgaaggtg gctggcgtac gctctctgtt ctcctcgagc tgtggcatcg    200160
     agcatcgcca caagcggtcg gcgcaagtgc agattctatg tcacgtccca tagacgagcc    200220
     gcctctccta tggcaatttc cgcacagcca tgtgacgagc caagatgatc gtcacccaac    200280
     atccaagatc gccgccggta aagacacaac tgacgagatt ggccgggctt tggacgtcgc    200340
     attttccttt ccaagtgtcc tccccgccta tgtatcttgt tctagcggaa ccgaggcgtc    200400
     tgtaaacttg ttcgacacgg cgaaatccgt cacagcctgc ggtgacgctc gtctattttc    200460
     gtcggtgtca gcagcagagc taatgcatcg acacgaagtc ggcaatcaga aggtagagcg    200520
     tcttatggcg gtgcgtgccg aagctgcggc gtggttactt tcgtccatgt acgaattggt    200580
     caaactcaac tatataagcc acgtcgcctt gcttgaaggc atgtcagacc ggatggaagc    200640
     attgcaggcg caagagattc aatttatcat gcttcctctg ctcgcaaagg aagcgtatct    200700
     tgtggctgct gtcctgattc gcaacttgac cgacacaact cggacacgtc cagacaagat    200760
     caaagcgctt gaccacagcc atttcctatt tgacggtcaa ggcatcatca ctatggatgc    200820
     ggcattggca tacgcgatcc cgcgccatga gtcagccatc acgcttctgc aagcctgctt    200880
     aatgcgatac caggacggta acgcgaaagc tgtcttgcag ttcttgtcgc tcaacaggct    200940
     cgagctagac gatgctgccg attcggacct gcaactgacg ctgccgaacc gagcggaaag    201000
     cggaaagcaa gctgtggtac gaaagcagag ccgacgacat ctcaagacta agcccagtac    201060
     acgcaagacg ggcaagatga tgacggaaat gcaggcttcc gaggctgcaa gcaccgagtt    201120
     gacggaagat atgatgaaaa acggcatgct ggcgtttgcg tttgtgcgga cgctgcaaat    201180
     gggagcgagg aaccgcatca accagatcaa gtttctcata gcacgagcaa tgagtgtatt    201240
     gcacgctggc aatcagactt cacaagcgag cccagatgca ggcgcgtcca ctaacgatcg    201300
     caatccaaga cccgcccagg actcggagtc aaagacgaac aagttgggcg aggtggaaag    201360
     cgcatctcag caacggaact tggaggtctt tctcacgcaa ctttgcaagg cgctcgagca    201420
     tgatgttggc gactttcaga gctgtgtcgc ggccatgaag acgcatgtga atcaggacag    201480
     cgcggatcga cgtttcaagg acctagctgg ccagttggtg tctggcacca gtgatagaga    201540
     cgctcctgtc tcgctaccgt cgttggaagc gttggtggat cgatgccaga agtattacga    201600
     cgacacgcag catttggctc acactacgcg catgctgctc gactctgtga aatggagctg    201660
     acaatcgtga atgctgtgca cgtggtcatg tcgccacggg gaatatgacg agcaagacgt    201720
     aagtgcaaaa tggctcaagg gcgagcaaaa tggaaatggg caaaagatgt acggtaggct    201780
     gccgcaaatt ggccgatgaa gggcgggaat tctccacccg aggagactcg tgactggctc    201840
     acgcgactgt cgcttttggc gtaacttaac cgctgctatc tgctgtgtgc caacacgcca    201900
     cataatcata atgctgatat tcgaacaagt tataaacacg agctatgatg aagcatacaa    201960
     ccaagaggta gcgtaaagaa agtattacat gcgaccagag taagggtagg cttgcgggag    202020
     cgtggcgcat cattagagcg tgctacttgt ttgggggagg ggcagcagag atcaattgat    202080
     gcgaccgagt tttcgttgca ccgatccgac aagcttagcc caagctctca agccctggta    202140
     tcttgcagcg ggggccaaat cgccaaaagt ctgtctccac aattgcctat tgtacgctct    202200
     atgtcttgcg gcgttagcct tgagccaagc cgagtagaat gtggcgagcg aatccgagtc    202260
     gaggtcgagc tcgctctcct gtgctgcttg tttgacatgc tcgcgtgatt tggggagggt    202320
     tgcaaccgct ttgctcgagc cggttcttga tctgaattcg gacaaggctt gaatgaaacg    202380
     cgcattgttg tcctgccaaa atcgctggtt gaagttgtct gctctcgcca tgcgaagttt    202440
     gtgagctagc tccgcttcct ccaacttgga aagcagtcgc tcaaagtacg gcgacggtga    202500
     tcgcgcagag cgtgcagaac gtgcagagga ccaggaagat tcgcccgaag tggtaaactc    202560
     ttgcagtgag tacggatgtg aaatggctaa tgtttgacca gctgatgtcg aggtggaagc    202620
     ggaagaggag gaggcttgtt cgaaagcaga accgtaacga atgggacgaa ggttgctgat    202680
     cggatcaggt ggtccaacca tgtctgctcc cggtcgggag gcgaatctcg ccgatcgtcg    202740
     caaaggcgtg ctggtggtgg aagaggacgg aagtgatgtg gacgcagagc gagatgaaga    202800
     cggtgtggcg aacaaggtcg cagtacgaag agccgggata gctgggagag ctctaacgag    202860
     aaggggtgtg ttggccatgg tgacagatga tacgattgtc ttcgaggtgg atgagacgct    202920
     agggatgatc atggctacgt gcaggctgac ggaacgagtg aatgatgatg atgatcggtg    202980
     gcttcgacag ctatttgttg agcagcgttg aaatctgaag gatcaagtgt ggaagaaagg    203040
     tggcgaacgg ctaggaaaga agacgttggg cgtgtttagg gacaaagtga cccaattgtg    203100
     aatcagagag agcaagagag accctttgat gagggttgca ccaatcgtga atcgtggttg    203160
     ctttggtgga aaaacttatg aaaaagtcgc cgtcttcaac gccacagcgt acgccagccg    203220
     actcacagac tcacgactcg tgagtggaaa attttgaatt ctgaacagac caaaaaaggc    203280
     gcgtctgtgc taagttaacc ttagttaagt gacctagtgt cactctggaa tttcgcagtc    203340
     agcaaatcat gaatcatgaa tcacgaatca cgaatgcggg gagaaaggca tgttggcttt    203400
     gcatctgatt cacgattcac gattgagcgt tgcgcgttgc gtgttgcgtg ttgcccgttt    203460
     cccgttgcca agatcgagat gttaagttgg cacatctagc ggatcggaac cgagcgagaa    203520
     tcacgaatca cgaattaatg attgttgatg gacgcgaaga aatcctggac tcgacgtaat    203580
     tgaagaaaca agacagccaa ctcagcttgc gtcctgacca tcattacctt cataccatca    203640
     agcagtgtct ggcatacaca gcagcatcgt gtagactgcc tcactctagc tccgcatcca    203700
     aagcgtgatc gtaacattct tgatcgaatc ttcgatttgt gtggtctgct ttgcgcgtct    203760
     gcgtttctgg gcgtctgctt ctgtgcttgc gcttgcgctt tcgctttttt tcaatctggc    203820
     ttggagcgtc ggcattgtgc tttggtacat tcacgcagca gctttgttgg catcgacagc    203880
     tgtctcgcat caagcctctt gacctcgaaa cgatacgcag ctcacgctag agcaacacac    203940
     acccaagatg gcgggcgcac agcgaggttc gcgcgttgtt ttcgtcggca acatcccgta    204000
     cgacatgtct gaggagcagc tcaccgacgt ctttcgcgag gtgggtaagg tcgtcggttt    204060
     ccgacttgtc aacgatcgag agacgggcaa attcaagggg tatggctttt gcgagtttga    204120
     agaccccgag acggcggcgt cggcagtacg aaacctgaac gaagtcgagg ttggaggccg    204180
     acctctgcgc atttcgtttg ccgatatcga tccgctgatg gaagggcgtt cgacgcaaca    204240
     cggtcaattt gatcaggatg atctgcgcag aagagctgcg gcagccggac gagcaggtag    204300
     accaggcaca ttcggtcatg gcgggacagc gagaggaggc ggaatggcag gtggaggcgg    204360
     atggcaacaa cgtggtcctg cggatagcgg gttcggacaa aggcagtttg gtggcccgcc    204420
     tggagggcag gcgtacggtg gaccagttgg agctcagatg ggcggtggtg cgcctggtgg    204480
     ctatgctggt gcaggagctg catcgatggg cgtaggaggt gggccataca cattgcctgc    204540
     taaccttcct gctggcgtgc cgctacctgc aggtgtcggc tcgacagatg ctatcacaca    204600
     gacactggcg acgctgccgc caaaccaact gctcgacatt atgagccaga tgaagtcgct    204660
     agtggctact tcgcccgatc aagcgcgcgc tctgctcact ggtcatccgc agctggcata    204720
     tgccctgttt caagcgatgc tcatgatgaa tgtcgttgat cccgacattc ttcaacgcat    204780
     tcttgccgcc tctggtgcgg tgcccggtgc tgtggccgcg gcggcggcca gtgtaccgcc    204840
     tcacatgcag acgcactcag gcgctagcaa cggctctgca acaccgcctc aacgctacgg    204900
     cactgcggca gctgcgacaa ggtacgctgc accagcgcgc ccaccgccga cgtcgtacgc    204960
     gcaaccaggc tatggcggtg cacccagcgc acctgcagcc aacgacgcag tagcagcact    205020
     ggcagggcag aacttgcccg aagaacagaa ggcacttctt atgcaggtct tgcagctcac    205080
     accggaccag atcaacgctt tgcctccgga tcaaaaagcg agcattctgc agctcaaggc    205140
     tcaattcggt caagcgtgat ctgtggacat gctggggacc aatgttatgt cctatgaaag    205200
     gatgggccga ggatgctcgt ctgactgctg gccgacgctt tgctgtaata ctaaaatcac    205260
     caaaacgagg tgcaatccgg gagagagttt caacgtgtct catagggtca ttgtagcaga    205320
     attgacgagc cggatcgatt cacgattgag tgtgatgggt gtttttgggc acgcacggtc    205380
     gccgcaagcg aacccggata gggctttgta gaagttgtca tgagcaatga gcatgtgggg    205440
     acaggcaagg atgacaagtg gagaccagtg cgggtcgatc tgattccgat tcaagatgct    205500
     cgcaccggat ggaatcaaga atgcggttct gagacaggtg tggcatgtgg ttcaaagaca    205560
     ccgattgtcg atgcacagcg cttgtgttgt gtgttgtgtg gagccgacca aacacgatgg    205620
     taggtttgga cgctgtgctg tagatgctga caagcactct gacgtgtggt tgcggattgt    205680
     ttgcactctt gaagtcgtga gtcttggttg ccggcaagtc atgagtggcg cgtctctgct    205740
     tggattttgg ctaccaaaat caaactctga accagtcaag agttgactga acgcggaatc    205800
     aaacgactcg tgaatcgtga agggtgaagg atcggcatcg ccacgcgcat tgaagttgcg    205860
     tattgcacct cgtacctatg taactgcaca ctcacgactc gtcactcacg actggcagct    205920
     gcacgcggca cgcgcaggct caaggattgt taggttgtgg aaatgatgag tcgattcgtg    205980
     attcacgatt catgtttcac caaaatcgtg aatcacggga atcgtgaatg acggaggtgt    206040
     acagtcacga gtcgtgtcaa ggtatgcatg aaggaatgag ctatcgacca agccgctttc    206100
     actttgccga gtcgatcacg cctggcgttg ctgatcaggg ggctgggctc caaaagggat    206160
     gagtgctaga tgggccgaca ccatcacgct ttgctctgcg ccggttgggc gctacccgaa    206220
     ggcatccagc acgaaggcaa cgtacaagcg agctcgtcgt ggttggcaag catatgtgtc    206280
     tgtgtgtgtt tgtgtgtgtg gagaaagaga ctaccaatct tgaatcacga atcacgaatc    206340
     acgaatcacg aatcacgaat cgtgaatcga gaatctgcag cgaggtgaaa catgctgcag    206400
     ccattcgtga tccacacgcc aagcgcttcc gatcgtctgg cgtcacaagg catgatcccg    206460
     atgcacactc gaggaccctg tcacagtgac aatcgtgaat tgtggttcta agattaactt    206520
     gacttaggtc aagtacttat cgtcgtgcct cgatcggcgc gttaacccta gtcggttccg    206580
     gtacgcttgc tcgcctggca gctcttgatc cacattcaca atttcaccca tgtcaaatga    206640
     tgagcaacaa acccattcac aatatcgtct gcccgaagac aagggtgggt cgatgccgtc    206700
     agagctcgat ccaaacttgt cgatagaccg acactcattt gtgattagtc tgagtcgtcg    206760
     acggtctgag ttgcgctgct cgcgtctctc ggctatcgtg ctgtattctg tgttcgtggt    206820
     tcgtgatggt gtgactctgc aagctgtggt gctgtgatgc tgtggctgtg actgtgtgac    206880
     tgaatcagat tcaagcgcct cggcccactt tctgatttcc ttttctgaac aagcacagaa    206940
     aacagcgctt ctcgtgtcct gcagctgctc accctgtcac tttgtatcac gtacaacaca    207000
     cctttaggct ccgaatacgc aaatcattcg cgataattga aagcttgccg atccttccta    207060
     gcctcgactc gcctcgactc gcctcgactc gcctcgcctc cgctctgctt tcaacgcatt    207120
     cgtgcttcgt gatttggatg ggtcatctca ctcgctacag tcacgggtcg tgagttcgag    207180
     taagttacca taaagtaaag aaactatctg ttcagggggt tttatttttt tatttccatg    207240
     aatttttcgg gttcgctttc gccattttac tcacgactgt gactctttct ccacttgttg    207300
     ctgtaactgt tgctgttact cttgctgctg ctgttgctgc tgctgctgtt gctgctgctt    207360
     gtcaccatca gagccgactc caagtcgcat aattcacgat tgctaagcac ttgggcttcc    207420
     tcttgactcc atcatcatcg atcatcgaga tgccgctgcg cttcctcgag cttgatctct    207480
     ttcattagcg ctttgtcgac ttcgccaaga cgcttaccac cctcttggac ccgcgtcaac    207540
     tcttctcttc ttagaacctc ccggacatga tcatcgccgt ctctgctctt gcttcttcct    207600
     aatcagtaaa ctggctcgct gctgttctcg ctagtcccag caccaacggc tacagcgtca    207660
     gcacgcgtcg cctttgctct cccttgattc cacgcaccat ccatctgatt ggcatgacgc    207720
     caacaccttt gctttcaagc acaacccttc gagcctctca tttgactcgt cccttgtcat    207780
     ccatttcgca cgtctataca cccgtcattc ttctttttct tcttctcatc cgactgaatg    207840
     agatagcctc tgtctccaac agctctcaac agcaacacta aagccagtcg cactgtcttt    207900
     tcagaccgcc caccttgcgc ttgccgtcat gaccccaccc aacatacaat cctcaccgcc    207960
     gccgcttccc tacaagcccc aaatcagacg tcctagcaca gccaaatcca ctcgaaccct    208020
     ctccaattct tccattccta cgctagcaac cgcccgtctt gccactcagc cttctccatc    208080
     gtcctccagt gcgactctta ttcaacactc acctttacaa cctcgtagac cgccgcgctc    208140
     cgccatatgc ccttcctctt cacgtcctcc cttgcctcat tccgccctgg acccctcgca    208200
     ggatcaccat cgtagcgatt cgggcagatc caccggatcc tcgcgctcca ccgccactac    208260
     agatagcttt ttcttgccac agcatccgca cccattcaac cgccgtctca aagatctgcc    208320
     gtctctccct ccatcgtcat ctttcgtcga ttcccccacg ccgcacagac cacacgatgc    208380
     tcccgcatcc gcatccgcat ccgcatccgc tcttgatctc aacctcacca ttgcttcctc    208440
     agtcgccccg gccttggtgc cgcccgcacg gctctttcgc agccagagct ccatcagcac    208500
     cacccccacc agtcctgaag atggcagtgg ctcgcccctg ggcggctcag ttacagccga    208560
     tcatgcacct ctcgatgacg ccaacgccaa gctccaagcc caacacgcag acagcctcga    208620
     cgatttctgg caagccgact actcctacgc tcgaccctcg accgagatgc gcaaaacaac    208680
     tttgccacct ctgctgcgat ccaatgcacc cattccgccc tcaaggtcgc agtcgctcga    208740
     tccccttgcc gagccactgg acgccaacag cgttgacagc ccttctcagc acaaccaatc    208800
     ttccccagta ggatcggctg tccctctact tgctgccaac ctgcaaaagc ttaattcgca    208860
     aaacgacctt cgacgaaaca gcgtttcagt cacaggcaaa cttgcttcgc ccaacccttc    208920
     ctccctcagc ggtaactcac tcccaccaga tgcagcgacg acgctcgcct cgcaaaggct    208980
     tgcatatctc cttaccaaca gccagcaatg cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    209040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn    209100
     nnnnnnnnnn ngctgtagac cacaggccac aacccaacaa atcaagctcg agcctgtctg    209160
     cctcttcggc gcacgaccac gacaggatca cgctttcaac cgcatccaag cgatcttcgg    209220
     cctcgtccag cagctccttt cgcatgacct tgtctagaca ggccaaaacg ttgcgcaatt    209280
     cgttcatgtg gacaccgccg accactgaca atacaatagc agccaaaaag gagcctagca    209340
     taaccagctc cttgtttctc agtccggaca gcttgtcgac tccgatctca caggcttcga    209400
     gcccaacccc ggccgtcaga agtccacaat tgcaaagcag cgtactcacg tctacacagc    209460
     tctcttcgca taaccaaggc atcctcgcac cgcagcaaca tcactgtgct tttccgccga    209520
     tctcatcagc caagacttcc gtgccgacga ccgtggcggc ctccacacca tcttctttca    209580
     gctctacaga cgtccttcca aagagaacag cgtccaagaa tgccaatacc gatgcatcgt    209640
     tgaccttttc agcgtcggca aacaccgatc tccccaaccc caaccccaag ccgaagaagc    209700
     ccgccaccga ttacggcaaa acagccgatc gatctcgatc acgcctctcg tcgcgtatta    209760
     cactgcaaaa tgcaaactgg tccatgaaaa tctccaacat gaagaccaag aagccgaccg    209820
     atgcctctgc tttcacgtct acaacatcac atgtgggtgc agacgcgagc tctcgcacta    209880
     cgaatagacg ttccaagagc caagcgtccc tctcttcggc gctcactgct gcatccgcga    209940
     acactattca tgcagaggtg cgcgataccg cggagcgagt cccccggttg gaatcctcga    210000
     aggcaccagc atcgctgctt attgatacaa cgccggtctc gacaagcgaa tcatccggcg    210060
     tagatccccg actctctccg tcctttgccg caacatttgc atttctcaac agcgaaattg    210120
     actccacgga tcactcgcca cttttggtgt cgacaatgtt gccgtcgcag gagaatgctc    210180
     aaaacgctat tcgcatcgct gatcgagcgt ctctacccgc ctctgtgatc ccagcgattc    210240
     agtctagccc ggaacacaag gtctcccaaa cgtcggtgac cgacctctac gatactacca    210300
     tcgctacgcc cagctcgcaa cctgaacctt cgcgtccaag cgatgcagaa gatgcacgcg    210360
     ctcagtccgc tctctttgac cgacttgccg attctcccga ggccgtacac aagacgcttg    210420
     ttttaccgga tccattacat cctcctgcct cgacgtcctt cgaccgcgtc tctgccgctt    210480
     cacagagcac atttcagagg catagccaca agaagcacat gtccctcgga tccaccacct    210540
     tgatctcgaa atcagcgcgc aaagcagcct ccgacctaga caaacgtgcg tgcgtggctt    210600
     cgtctggact tccattgact aatgtcaacg ccgcttcccg gtggagcttc gccagtgcct    210660
     tgcccctgtt cacgccaatg agcgaagatg gcaccttttt cgacgccctc acctcacctc    210720
     tggacgagca accctccaat gtcaaggcga gtccatcgcc gccggacaac tcagtgctgc    210780
     catcctttgc aactgcaacc gaatttttcc ccttgacaaa gacagagccc gtcagccccg    210840
     tgcacgatca accgttcact ccctgcacca aaaccaccgt tgctgcacaa atggcggcta    210900
     cggcacaagc tatgccgcca ccgaaccgat catcgcttgg gcgtcgtctg tcgggcgtag    210960
     tcgaaccttc gaaagtgcgc tcttcagacc actgtgcgtt ggcatctccg tcacaaagca    211020
     ctcatgccga aacaatgcgc cgagatgctc ttccagctag acctgagacc agtctgggat    211080
     tttatcttcg caacccactg cgcaaggagc gaaaggcgtc tcaaaaggcc gcacagtcgc    211140
     tgacgcctac agttagtcgc actgagactt ccagcacggc aagccacaaa tcaccgactt    211200
     ccgccatccg cagaatgtcg acgggcttcc ggctcgatcg atcattaccg gtcaagaaag    211260
     aactcactcg agccgagacg tcactcggta tggccgcttc tgaggtcaag tcagcacgcc    211320
     tctttagcag cagagttctg gctccgacaa agagctcatt ggcgagaagc gtgcagcgat    211380
     ctccgccctc gacgggtagc gctaccgcga aatcttcgcc tgcctcctca ttagccactc    211440
     ccatcaccaa agcgctctcg cgttcgcctc agcggcccac aaacccaccg tcatcgtacc    211500
     gcggctcgcc ggctgcatcc tcccgtcctt cagtgagtgc ggttggctct gccttcaagt    211560
     ctaccccttc atcaaaggca ccgctctctt cgacgagcag gggtcgtaca tcttcgtctc    211620
     aagacgtcgc cacgtcgatg gcaaccggtc aggatgccct tccggcagct ccatccaatc    211680
     caaccaacgt tcgtcgccga cgcacgctta gcaagccgct gctgaatccg atccgcacct    211740
     ctttcagtga aacgcgaaac tattccagac cgtccacagc gatcggcttc cgaggtggca    211800
     tgaccgccgc agaccgcaag atgagccagc ccacgcttga catggtagat gaccgtgaat    211860
     tcctcgaagc gctcgaacag gtacgagccg tacagcgcga gcgcatccag gctgaagcgc    211920
     aaaaggtcga gaacaagagt cgccttgctc gtctaggaat ggcgtctggc aaccacctca    211980
     agactaagaa cccagaatcc gctcttgaca aggacaacaa cgacactagc acttcgccca    212040
     acagccttaa cagaagcgtc aacgagccgg tgacagccgc tgctcctacg agcatcgtac    212100
     ccgctagacc acgattgcgt cacaagcggt cagccagcgc cgacgctcaa ctggcccacg    212160
     ttcagacaac aacgtctgtg gcagcggaag agtccgatcg cgacattgat cagcggcaga    212220
     aggatattgt caaggcgtat gccgacaagc aacccctagt tggaccacct acgtcgggtc    212280
     tcgaatgggg cgtgggaaaa gccagtggca agcttcacga cggcgccttt gtcaatgacg    212340
     acgactggaa gaaagaggtc aaagcattgt tcctcatccg tgagctggtg cagactgaga    212400
     gaagctattc acggcatctc agcagcctcc ttggcgtaat ccgaaagatg ccggtggctc    212460
     ctggcagcaa tagccccagt tgtcctagca tgaaacgcaa gtcgaccagc aatctgtttg    212520
     cagcctattc atcggctgtt gctagcaaaa cctcgccgaa tgctagcccc ccaagtcaca    212580
     tggcgctgat gcggacatat ttgccgcagt tgatcgcgtt gagcaacgca cttgttcagc    212640
     gcgtcgagga gaaccccact agtgccggcg tgggtggcgc ttttgatatg ttagcagctc    212700
     agctcgagtc gacctttgtc ggatggtccg gggtcgcatc tcaggcactg gccgaactgc    212760
     gatcgaccga gatggccaag tcaaaatcgc cgttcaagat tgggttggtg ccgctgatgc    212820
     ctcgtgaatc gactgaggtg ggcgcgtcga cggctgatgc agtcagcagc gcaagtggca    212880
     gctcaacgcc tggatcgagc ttcaggaatg cggcgctacg catgacttcg ttcacgcgtc    212940
     cgacctcgcc tgttgtttct cgtcgtgatt cgaacgcacc agcagatggc aatgctaccg    213000
     ttacgaccaa gagatcgacc aagcgtcgca gtacgatcac cagcaccagc ttccatccgc    213060
     cgccacgtgt cgttgtcgcc gcggctacgg tgctctcgtc aagcccggag caggacaagg    213120
     aaggcgacag ttccgctttc gcaacaacga ccaccgcagc gcaacgtttc ggacacttgc    213180
     gcagtcaatc gacactcgtc actccgctac ccacccctac gtcgagcact gcccctgatc    213240
     catggtcggc accgccacca tcgggtggca agagcttgac accgatggac attgccatca    213300
     tgccgacgca gcgtctacct cgttacgggc tcatgttgcg tgatctgctg cgcaacactc    213360
     ctccggaatc tctgtcacat gttcgtgtgc aacgggcgat tgggctgata caaaaagtcg    213420
     caggcttgtg cgatgctgtc gccccagttg gcgtaaccgg tgggcgcggg acgagtggga    213480
     acagctcggg ggcggtaccc tctgcacgcg cgagaagcgt gatgggtgtg gcgtctacag    213540
     actttgcggt gaatgcgggg tcgagcatca ctgatcagta gctcattgtc atgcatacca    213600
     tgtcttgctt tgatcagcca catgcacgat cgacattttc tttgggattc ttggttgcct    213660
     agcaatcacg attcgtcacc aatccccaat caccaatgac gagcgcatta cgacacattc    213720
     actgtatttg tacgtttcct tattgctgaa acactggttt ttatcgcacg ccttgtcgtg    213780
     tttttcttgg ctcgtagtga ttgtgacgat ggcaggcaag ggtcgatgga ggtacagccg    213840
     aaacgcgaaa ttgagaggag agaacgaggt tgagaggtta cgccgactgt tgctgctgat    213900
     ggcggttgac gctggaaaag atgtctttca ggtgggcttg tgcgtcctgg ccttgtttta    213960
     cgaggtactg ttggacgggt gtgtaggagg tatatgtagg aaaggttggg tgaatttcag    214020
     atgcggagag gtaggttgtg ggggctgtgg ggagacgtac ctgttgtttc ttcttgaagg    214080
     cgtccaaatc tgctgagttg gcctggtgct tggctgtgag gtcggcgagg atgactggac    214140
     gtgattcttg gatgaacctt gatccagaca ttggggatga tggatgcaag agagtcagct    214200
     gggttttcag ggtctagttg ggtcaaggag cgcagcttca agacttacat cttgcctaca    214260
     ctgctgtaga agcttgcatt ggaatcttgg atcgcctgca attcggtcag agtcaaggtg    214320
     agcaacttgg actcgcgctc tcgcgcgctg atctgcgctc gcaacgccgc cagttgctgg    214380
     ttggtctggt acacctgcag ctggatcttc tcaagcactt tcgaaagcgt ctcgtccgga    214440
     atcgacgaca tgatcccagt atctcgatgc gcgcgcatgc gttaccggcg caggatcaaa    214500
     tcactgaatg cgatacgtgc cgtgcgtgtg catgtggtgg tgatggtcac aacggaaatc    214560
     gattgaccaa gattcacgct ttcaccacat tcgtgattca cacattcacc gttcgtgatt    214620
     tgtgattgtg agtgagtgtg tggagcgcgc actctttccg gttttcaagt tggaatcacg    214680
     aattgcacac atctttacga atcacgaatg tgcgtggtca attacgaatc gtccgtgatc    214740
     cattttcatc tcgacctctt ggttcactct ggtatgctct gttcacatca cctcatcgca    214800
     agaaaaagtg ttgttgcatt caaaattgcg cctctttgtc tcgctcattg acttgttggc    214860
     agctgctttt gcaccagaag tgcgtccgca accgactttt tgaacggtgt actgatctcg    214920
     ccctgctcag caaagtaggc caataccagc tccctggcca cggtaaacga tgcatctacc    214980
     ggcttgacct cgtgcttgag ctcgtcgcga gctgtgtcct gaccgaacac ctctcctcca    215040
     tactcgaaaa ccaacccact ccttgcgggc ttttggttac cgctcggaac aatcacacaa    215100
     tccaaaggac tgcctttggg caccgagcct ttcgggaaag cgtccttgac gtgctggatt    215160
     tcttgctgga actgcgtctc gtgcgatgcg tcgatttgcg actgtctgat ggctttcttg    215220
     agtcggtttt gcagagcgcg gatgaagccg tcgcgcagat ggttaaaatc ggtattgcga    215280
     acggggacga ttcggatgac tgctggtgtg ccttggtcga ggaggtgttt catgtgttgt    215340
     tcgatggttt ctgctgacga gtcaaagtga agcgcacttt catccatgta gagcgcagcg    215400
     acgtagacgc gaacgcggag gaacgagacg gtgcgaacgc ccaggccgac caatcgcaga    215460
     cgaggctgcg gctcatccga cgccaacgag gccggcgtgc gcatatacaa tggaaagctg    215520
     agattcgtat ccgcatctac aaccacttgc ttggacacgt caccgctcaa cgacgtaagc    215580
     ctcgagccgg tgccgctggc tgcaacagca tctagccgga tgctgtcggt agacgaaacg    215640
     ctgtaaatcg atatgatacc agctaacgct gctgctgcgc ttagcgactt ccacttcctc    215700
     tgtgctgtat gcgacgactc gggcgtagag agagccacga cgcaagggtg gtacgattgc    215760
     tggaagaacg ctgctgcagc tcgaggttgc gaggaagccg aacaaacttg aaaggaagga    215820
     taggatcgtg tgaacgtcga gatgccacgt gcggctgctg tacaagacgc tgcagaacgt    215880
     ctcgctccag ccgcggtgat cagcgtcgga gttagcatgc tgtgtaacgt ggaggttgtg    215940
     cgagatgtcg acaagtggtg gcgaggaagc atttacgaat cgtgaatcat gaatggacga    216000
     tgagctcagc ccccagtctg tgctctgctc cgcaagtccg gctgaacgtg caacacgaac    216060
     cgtgaattca cgattccgtg attcgtgatt cacgattcat gattcgtgaa tatcgcccgt    216120
     gccaatagtg gtagcggcgt aacagccagc tcttcacgct tttcgcccac gtccatgctc    216180
     cactcacgac tcgtgacttt acagatgaac gtcttcgtgc ttcagggtcc aggtgtgttt    216240
     ttttttcttt tctttttctt tttggcaccc gagttgattc acgattcacg atcttggctt    216300
     ggcctacgga gtggaatcgt gaattacgga tcacgaacgg tttaggagat ttatttggca    216360
     tgaggcgaac tgcgcgtgct ctatgtctgt caagtggtgt agtgtgtctc acagctggct    216420
     gcttaaccgg aaacacaacg cgcgcgcttt tgtcgatccg tgatgcacat gcagagagac    216480
     gcaaagacac acaaacaaca cacatgctca ggctgtgttc cctcaatcgt gaatgcagat    216540
     cttagactga cttgtccgaa gctttggcac atggtcaact cgattcgaaa gatcgtccat    216600
     tgtctttatt ccaccaccat cgtctgcaca gccctgtcgt cgtggatcgc atctcctgtt    216660
     gcgatcagct ccagcttcgt tctacctctc aagcacgctt ttcgatcttg tggtgatctg    216720
     caaggccaca tccgctcgga atctgctacc acgctctact cgatcgtttc ggccgccggt    216780
     tgaactgcat tctcgatcgt ccagcatcga cacaatgccc gccacaacgt ccaagctgac    216840
     acccgattcc gagctccagc tcgccttcga tccgagcttg ataccgcaag cgagcaagga    216900
     ccttctaccc gaagacatca tcgtccgacc gctcgccagc gacgactaca accgcggaca    216960
     ccttcgcgtt ctcgccgacc tcacgcaggc ccctgacatc ggcctcaccg cgtggtccaa    217020
     gcagttcgcc ctccaactcg cgtctcccaa cacatactac cctatcgtct tcgtccacac    217080
     acacaccgac cagatcgtcg catgcggtac catgtttgtc gagttcaaat tcttgcgagg    217140
     cggcggctct tgtgctcaca ttgaggatat cgtcgttcac aaggacggtc aggccaaagg    217200
     cctgggtaag agaatcatcg aaattctcac gcacatcgcc aagcagagag cttgctacaa    217260
     ggtgattctc gattgcagcg aaaagaatat tgccttctat gaaaagtgcg gctatcataa    217320
     agcgggcgat cagatggctg tgtactttgt atagatgcat gtcgaattgg ctcaatcgac    217380
     acgattttta gttcccatag tacgcagtgc ccatgtgcgt gattctggct cgctacgacg    217440
     cccgcacggc gatcagcgga acacgcctct cgacacacgt ggagtcatcc ggggtctgct    217500
     gcaatgcaca cctgttggtc ccggccgtgt cgttcgagtt gttctaactc cacgattgcg    217560
     tacatcactc cgtcttggtt acctgaactc tctacgcact caaccattgc ttggtccgcg    217620
     tacataccca tcagttcact caggtggagt acgcaatacc ctcgttgtct ttgcggacta    217680
     tgtccaattg cccgagcact cccgcattgc tccgacgatg ccattctggt gggcctccgt    217740
     tcggattatg gacgctagca caaggaaaat aaggaggatt gagtacatcc tctcctgtat    217800
     tctcaagcag cctcgtgaga gatggtaaag gttagataga acgctcaaca tattcgtgat    217860
     tgtcgttgcg tattcgaaat ggggacagga atcacaaatc gggtcgatgg tcgatggtcg    217920
     ctggtcgatg atcgatggaa caagtaaaga ccgtggatgt gtgagagctg agtggaaaag    217980
     caaatgcact gagaaacgta gagatccaaa agaatactcg atgcaaccac actcagacgt    218040
     cccaacatct ggctcatacc ttcgtcgttc acaggtccgt ggtttcatca aaagcgacga    218100
     gaaccacgaa ctgctactcc ttccatcggc ccacttcgac ctcacaaacc gcttcgaatc    218160
     caaccaaact gtgcgagccc cttgtgtcga gatatggcag agcgatccac gcctcgtagg    218220
     ccgctcgcct atgcttgctg cgcctctcta ccgtctcttg gtcaccatgt ttgcgcgtac    218280
     cagccgacgc aggcggttcg ccggactgaa tcagcgtcgg caccaaaact tgaaggtggt    218340
     gcgtcgagat acgatattgt cttgtcagct ccgcggttcg ttcgacgaaa ggttccaatg    218400
     gccaggtggc ccacatgggc tcttgaaacg caaactcgag cccgttcctc tgcgatgctt    218460
     cgtccaacag tgcgcgtagt gagtcgcatg cgttggtgag cttgttgagc acttttgtga    218520
     gtcgatcgac aactgttgtt agaccatcgt gtgcagattc tatgcgatcc actgcgtcag    218580
     ctagtctcgt ttccctccat ccgcccggac ccaccatcgg atcccatgct tgcttcgcat    218640
     ctaatgctag tgctctcttc ttatcttgaa cgcttgagtt atatgctcct gcagctcctt    218700
     tcgcctgtcg cgttgcacca gattcgggct cgccgatcct gttcgcagca tacacctctt    218760
     cccagccatc cacagcttct ttggcccact tgagtccgtc aaatgtcgca atctcttccc    218820
     acatccttgc tgctgcaaca aacgtcacca gcaacgtacg acactgtcga tggtatgtag    218880
     tctcaaagtc cctgctcaac aatcctgtcg aatcgtacat cgaaaacgac gagctgccac    218940
     cagcgcttgc gccaggagtc ggaggcgacg tcaaccgact cgatgggaga ggagacgagc    219000
     gcgaggagag cgatatgctt cgtttgcctc cgctaccgcc accagtattc ccagtaccta    219060
     gcgctgaagc cttggatgat tttggtgtcg agggcgcttg tcgattcgag ttgctggacg    219120
     agggtgaaga cggtggtgtt gaacttgctt tgttcgcttt agcgagcaga gcggcgttct    219180
     ggctgttgcg accaaacggc gacagcgctg cggccgacgc acggttgtta gctggcgacg    219240
     gcatggcaaa acggctatct cagcttgatc agcctgctta tgtgcgacaa agacgagtga    219300
     tattggtctg gatggtcgcc ctatcagccg tgagcgagca cccgtcaagt ggagtgaatc    219360
     acgaatgcac caaattttga gccaaacgtc ggaagacgga atccataaag ttacatggaa    219420
     agttaagtgg cacgaagata caccatgcac gtgatacaag atgaaattgc tacgctgtta    219480
     caccgaaaat gggaacgtcc cccgcatttc ttcacgctgc aaaatcaccc aagcacgaag    219540
     tctgaaagtg cagacccggt tgaactacga accacgaacc ggatgcgagc gacacagaat    219600
     gacgaatctt aacgctattc acgattcatc caggcaccat caccatctcc actttgcgca    219660
     accagatact tggtagcatg gcgagctcgc atagatccgt gcctgggaga tccagagcag    219720
     cagcagcacc atcgccatct tcgtcgggta agcaggccga tgagcctacc tttctcgatc    219780
     caaccgacga tgccacgttt caatctctga aaaagcttct atcggcgccc gcttcgagta    219840
     cacagcatct cagcctactt tcggagagca cgctgttcgg aagtatcaca ttttacctga    219900
     gcaaactcga gctcgaccat gtggccgagt ttgccggcgt catcagctcg agcggctgcc    219960
     tctggacgcc accacctccc gcagccaagc cgccgacagc aacgccgcgc agcgcatcaa    220020
     accaggtgac ttggacaaca gagcctggat cgtcctcgag cgactcggaa aaggcggaca    220080
     ttgccaagac gaccaccact gcgtcatcca acagtgcccg atcgagtgcg tcgagctcct    220140
     tgagcggctt cttgatctcg cgctccacca gcgtctctca agctgtggct gctgcgctca    220200
     ccaagagagc ggatctcatt gttcggtcca agaagaattc gaccggatgg gcttcgcgtt    220260
     cagctctgtc acagtacctc ggtgctgtca tccaaggcat cgacgataca gagcgagatg    220320
     cgaccccaga atcctaccga gcagcgagag ggttgccgat ccctcgcctc gccatcattg    220380
     gaggcctact caacgctctc tccatcctca aggaccaacg cgcgcgcaca cgcaacatgt    220440
     cgatcctcga cgagatggct gcgctgcgcg ccaaccctgt actcgggctc agtgttcggc    220500
     agcaactcag caccattcaa gatgaatgga tcgtgacgct cgccgagatc ctggaccacc    220560
     tgcatggaca gcccggctcg tctgcttcgg ccactgcctt ccaggctggc tctggctcca    220620
     gtgcaagtcg tgagcgcgag gacgatgtcg acgagtggga ggccgagttc cgaaagcgca    220680
     ctgcgtccgt ttcaggacct gctagcatca ctttgcttgc ctcaaagcaa accctacgtg    220740
     ctgccttgag cgacgttcgc gacgtacctc tatacatggc cgctcagctt gcaccgctgg    220800
     tgcctgaccg caagatccac gcgcttgatc ctgttcagct gacatcagtc actagcgatg    220860
     ccatcctctc gctcttcgaa gggcctcaag gctcgtgttt tctcgccacg cttgctcaag    220920
     atgttcacac gcagaaaagc tgtggtgaag atgggataaa gatcctagtc gacgcaaacg    220980
     gtgccactgc caacgccctt caaggcatcc tcgactcgac tcttttcccg ctgctaggtc    221040
     cgctgtcgaa gctcatgtct cgcgctcttg ccaaggcagt gacgtcgctg acacccgaag    221100
     agctctcggc gctactgctt ggaaccgccg atgcagcact cgagcctcga ttcggcgaga    221160
     cagaattctt ccccttcctc gttcgcatgt ctcgcctctc ttctcgtctc gaggcatcat    221220
     ggctagcgag tgcactcgcc ggcgccaatg aagacgacat tgtcgaatcg agccgacagc    221280
     tcaccaagca gctgtggacg acgttcaaaa cgctgctttt cagctatacc atgctgtttg    221340
     actcgatgat ggatgcgctc gtcgacatgt gccccagtcc gacgcttact atcccagccg    221400
     ccgcggccgt ggccgagacg gatgcactcg tcgattcgtc gttgacaagt cgcagatggc    221460
     cgtatgcatc gacgtcgaat ttacctcctc cgtatctgat cattgtccag cacgtactcg    221520
     cgatctactc gcacctgtat tggatcacaa gcaccttcgg ttcggatggg ttcgacatct    221580
     accgtaaagt gttttactct gcgttggatg tgatcggtcg cgatggcgag gcgtgtattc    221640
     aattgctgga gctaatcgcg cctgaccaag tggatgtggt cggcgaattg gacggtctcg    221700
     agacaaactc agccaaacga agcgccacca cgtactttct caacgttgcc gagcagctgg    221760
     ttggcgtgct accggacgag gtggtggaag agctcattct acccatctgt cgaccatacc    221820
     tcgaaaacac gcgcttcacc gatacattcg aatccgctca ctcggtagtg ctggcgctat    221880
     actcgaacca caagcgatgc atcctcaacc tggcgccgtt ctacgtcgag ttgttgatcg    221940
     ccagctatcc gaaaaggttg acatcaatgc agttcgagta cgctatgtcc accgtggttg    222000
     ctgcaatcag cgacaggagt gattcggtgg cttggtgggt gattaccaag ttggccgatg    222060
     agatcgatcg agaacgtctg gctgggagcg cagcagagcg gactgcagag gatacgatcc    222120
     gcgctggtgg atatatcgaa tcgagccaag ctaccaggca ggatgtcgaa gaagctacag    222180
     cgaactccgc ctctgagcac cctactgtac ccaccgtggc tagcgaaaac gttgctgctc    222240
     ccactcagca gaccaacgca gatacatatg accgactcac ccacctgcaa atgtgtctca    222300
     tcggctgcgt acccagcgtc aacctcgtgc tgctccgttc agcgctcgca aaggtggaag    222360
     cgtacattat gcagtgcaag caacaagaac ggtccctttc acaagccaac gccacacttg    222420
     accaaaatga aagcaccagt agcagattgg ctctgtgcca aaagacgttt gacgccattc    222480
     aggcgctcaa tgcggcgacg agggaggaag ggctgcgatg gtggcttgac catcgcacca    222540
     agtttggtgt gtaacccaag gtcacgtacg tcgggggctc accgtccaca ctgcctaggg    222600
     aatgcaaccc ggcacctcaa gggaaaatgt aaagtatagt ggatttgtac agtttaccac    222660
     tttacatacg cgcacccatt tcgtttaaga tgactggtcg agagtgtgtg ttgacggtga    222720
     cgtgtggctg agcaactcac gaggtctgac tctgactcat tagcgactgc tgcgctggct    222780
     tgaaagttta gttcaaactc ctggtccttg tctttgcacg tcccctccac agcttctggt    222840
     ccacggcaat agataagtga gcttacggac gtgggacgtg ggagcgggtt tggcccacag    222900
     gtccacggtc ggttcaccgt tcacggttcg ttcgaaatga cgaaaagtgg agcggcggcg    222960
     aatttgtatc acgaatcacg attcgtaata tttccggctt tctattttgt cacttctgga    223020
     cgccgtggga tgtaccaaca tgtgtcgttt gacatcatcg ttctccgatc ttggccatgt    223080
     acggtgaagc attgtacact gattggccaa ccgagacgcc aaggcgatgc aggaaagccg    223140
     aaagatagtg gaggataaag tcatttccgc tttcacaact tattcgtgat tgcatcagcc    223200
     acgagctcat tagccaccag tccacacaca gtcacgagtt caccttgctt cgactcgttt    223260
     cctcagttgc gctccgctta gaccattaga tacacagctc ttcattatgg ttgcaccact    223320
     tgggtctcgt tggtgtgaaa aacaaacgta catctgctgc gcggaggtca catccaacgg    223380
     agcattgtac gcgaacacaa gcatttgcac acgccacagc tcgcactcaa aactcacatg    223440
     gcggcgtggt tatgtccgcg catcgatgcg agtcgcaata taggtgttaa ccgaagaatc    223500
     gccgcaggtc cctccgattc gctagccttg tgactgttgt gtgcccttgt gccgttgctg    223560
     gcaggtccat ggtgaccgtt tgccgatcca taagtttcac acctccacca gattgcaagg    223620
     gccttaatga gcagcacggt gcagtggacg tatatatacc tgcggttttc atccttgttt    223680
     gatcggaaaa catcaacttg gatccagcaa caggccaaaa ctcacaatgt cgagtacaga    223740
     tgcgctcttc gaaggatggg taggacacga caagtcgtgt atcggcaaca tgaagtggga    223800
     aacctacact cccaagcaat ggcgcgaaac ggacatcgag atcaagattg agtgttgcgg    223860
     cgtgtgcgct tcggacctgc acactgcgcg gtcaggatgg ggaccgacgc gctatccttg    223920
     cgttgtcggc catgagattg tcggcactgt cgcacgcgtg ggaaagcagg tttccggctt    223980
     taacatcggc gaccgtgtcg gtgtgggtgc tcagtcggac tcgtgcaaga gttgcgaggc    224040
     ctgcaagaac ggcgacgagc cttggtgcga aaagggcatc gtaggcacgt acaacggcga    224100
     ttactcgagc accgacggtt caggcttctc gatgggtggg tacgcaaaat actcgcgtgt    224160
     gccggctcac tttgcggtcc acatcccgga ctccttacct tccacagtgg ctgccccact    224220
     catgtgcggc ggcgtcacgg tctacaaccc actcaagacc aacggatgcg ggaatgaagg    224280
     cgtcaaacga gtcggtgtcg taggtatcgg cggtctcggc cactttgccc tcatcttcgc    224340
     taaagctctc ggagccgaaa agatcgtcgc catctcgcac acgcattcca aagaagatct    224400
     cgcgcgcaag ctcggcgcta ctaatttcat cgcttcaggc gacgaggacc cctggtctgc    224460
     ccataagcgc tcgttggacc tgctcatctt gactaacaac aacgctgata tgcccatcac    224520
     cgactacctc accctggtcc ggcctcatgg aaaagtcgtc gctgtgggcg tgcccgagga    224580
     gccatgcatg cccacgcctc tgcccgcttt ggcttttagc ggcgtcttct tgggcggctc    224640
     gcttatcggt gggcccgcca tcatcaagga gatgcttgaa ttggccgcca agcaaaactt    224700
     gaagcccatg attgagcaac gtgacatgaa ggacgccaac caggtggtca aagatatgga    224760
     tgccggcaag cctcgattcc gatatgtgat ggtgaacaaa gactacgagc ctgtcaaagc    224820
     ttgagcacat actgccatcg gtcagttttc taaactagca cggtctgctt cagatagatc    224880
     tcacctttca tcttcacaga aagtcagcgt ttgctaaccg ttcccacagc aaagagcggc    224940
     aggcaaccgc aaatgatgag ccaataactg ccaaaagttt gttgtcgagt ggagagcata    225000
     gtccgtgata aaagaaaatc gatggtagca attcgtgaca agccgtctat ttaatgttgc    225060
     ccaatcgctg tgtgccggca aagatcttgg tatccagagt ggtagcttta tcgccgatcc    225120
     tctgcaatct cgcattctgg ctgtccactt cttgtcccat agcctttccg agctgattga    225180
     gcctggaact gagcataccg atctcgtcca gattctggtc gagttcatcc tctaattcgt    225240
     catcggactc tgtggcttca aactggtacc ttccacgttg cgcgaccttg tttcgctgag    225300
     cggcttcttc ggccttcttg ccggagccga agcggtcctg accgaaacga ccaaagctag    225360
     ccttgccagt tcctggtccg ttcatgctgg cgtcgagtct cgactgggca tccgtcacgt    225420
     cacgacggac ggcttcgcgc tcttccctct cgtcaatgtg acgagcgatg atgcgtgcct    225480
     cttccgcatc gcgcttggcc ttcttgttga actgcatatt gggacggaag atggaccggt    225540
     tgagtgctac gatctctttg gcgttgtcct cggctcgtga cgcgtgtgct ttggcgagat    225600
     cgagcgagcg ctcggtgttg ccgatctttt ccgattgatc cgacagcttg aacatggtgt    225660
     tggttgccgt ctcttccgcc tcgcgcgcga tgcgcagtgc attgcgcgtc gacgagatcg    225720
     actcttgctt ggtaaagcgc atctgctgct tgatcgcctc cacctcgtca tcctcttgat    225780
     ctcgctgctc ttcccgttgc tctaccccgt cataccccgt attggctgtc gatccaacgc    225840
     ctacaccaga gcctcgaccg tactcagctt ccaaatctcc ctcagctcca acaccgcctc    225900
     tttggttttg cacgttccgc gacagattcc ccgacttact gccgcctcca cccgcatact    225960
     gatcgtagcc cgaaccgaaa ccagcgctcg gtgctcgcgc attggcaaaa cgctcttggt    226020
     agccagtggt tccaccagga gtaccgccgt aatgctgctg cccgtatccg ccagctccat    226080
     agccagcatt accgcgatca aagccgccac ctccaccgcc accagcagcg ccgtgtctgc    226140
     cagcaacgtt agattgcgga gctggcgccg agtcgaccgc tggaatcttg ctgctgtttt    226200
     tctttccgaa taggcccatc ttgatcactt gacagagcga gagcgaatgt gatgcgtgtc    226260
     tatgagatag ctgaaggaca aagaaagctt cacgcttgca ttgcgtctat agggtccccc    226320
     catgcaacgt acagcgcatg cgcttggcgt gtgcacagcc agctcactcg tgactcttca    226380
     aaaaccacga atcacggggc ggtgtcgaag caacgtaaca ctatttaaaa aatctcgtgt    226440
     cttgctacac actcacgact cgccactccc gtgcctctca tcattcacga ttcacgattc    226500
     aggcttgtga ttcgtgattg aagtcgctcc acttcagtat ctgtggctgc gtcacaggca    226560
     acttgaactc aatggctcga catggcattc caaccaaatc gaataggcca aagtgtccct    226620
     cggtcaagcg caaccgatga cgataaggaa cgtggttgca ttcgaagagg cgcgggtatc    226680
     atgcacataa acgctaactg aacgacgacg atgtgaaacg agacgagaga aaagtaacga    226740
     tacgaatgca aagagcgtga cagggctaga cagatatcta cgaccaacag atagcagatt    226800
     agggtggaaa ttagtgactc gtaaatcacg acctgccatc tggcttgacg atactcttgg    226860
     cgattttttc caagtaataa agatgtgggc gtggccggtc gatctcgtcc atagtgattg    226920
     cgtgatccga tgcgtgagaa cgggttcgac tgcgcaagcg agatccggca ttgtggatca    226980
     agaacgcatc cacttcgacg gcatgtcgtt tctcagcttg aacgcaggca tcccacaact    227040
     cgcgatcgat gcctgagctc ggagcaaaag cgcccctcgc cagtgctcgg cggatagcct    227100
     gaatattctt gcggtcgatg ctgcgttcgt tggcgtcgcg atcaggagca ggtgaacttg    227160
     agcgatccct ctcaccgaga cgcgaccgtg gattcgagga acgaccgaaa gcttccgttg    227220
     acttggtcct gcgagcacgc accgtgttat cgccatcgac agcagacctc attgcccaag    227280
     aggcatcgtg cgagtcgtca ccgtcctcaa acggctcgtc gaatcccgca aagacgtctt    227340
     cctcctcatc accagacttg tggacccatc gcatttggac aggatcgaag agcatgtcgc    227400
     caaccacgcg agcaccagaa gcaatcttgc tcaagagcgt actgctctcc ggcgacagag    227460
     gcgaagagta gccggcagcg tgcgtcagtg cagagctggt ggagctaccc gtcagctgcg    227520
     agatgagagc ggggcgagtg ctgctctgga tgacctggtc aaagtcccta agaacgcctt    227580
     cgttgccctc ccagcggagc gcctgggcat tccatcgcat tcctttcacc agtctgggtg    227640
     cgggcagagt gcctgcgcca agagatcgga ttagagctgg tttgctccgc tttccgcgtt    227700
     gaacaccgcg cttagactga ttcccgtgcg gtggcacagg cggggcagat gcaggcgttg    227760
     cagcgacgcg attcttgctg agcttatctg aagaggcagc tggacgaaaa ctttggacga    227820
     tggaaaccgt cgcattgggc agatcatcga taccatcgag ctcggcaccg ttgccgtagg    227880
     tgacagagcg cttgaggagg cgtgcgactg gttgactctc gcccgaggag ctgcgacgct    227940
     caagattcga tctagctttc gagcgtgtat tgaccgagat gcgtgttacc ggctgataaa    228000
     tgtgccgaga gccgaatgag acgggagtgc tgggtcgagc gggggcgcta atgtccctct    228060
     gtaggcgggc caattggtcc gccgcttcgg cggccctggc acgcgatgcg gccgtcgagt    228120
     cggtgagtct agagctgccc tttctcctca agcgcgaagc tgaagatgcg gtgctgttgc    228180
     cactgttgtg gcgctgacgc atggccggag cagatatggt ggcagggggt ggatcaactg    228240
     aacaaggcat gttaacgggc ggagaagtcc tcatggatgg cagcgacctt ttacgtgtaa    228300
     gttgactacc acgattttgc aatcgattgg acgaagaggg ggttgcattg gaagcagcgg    228360
     caccggacat gtgcgcttga aggtcacttg ctgatctttt gaatcggaga cgatcgcgac    228420
     tagccccgcg gatgtcagag ctagttgtaa aaggctggac tggaaggatg tcttcgtgtt    228480
     gggaagcagt acgtgcagga tgtcggcgat cgtcgcacgg gattgataag atctcaacgc    228540
     ctaaccgtga cgttgagcga gctttgtata gttttgaggt gacattgcga gctgcgatac    228600
     ggctggtgga gagatcaaag tcatcgtcga taataagacc ggctgcgatc gcagcatcag    228660
     agtctgcagt ttgagagtga tccggttcta agttgccatg ttggccggag cgcttcagat    228720
     cgagcagtgc ctcggcctct gcttgaatgt cggaaggtgt aagagtggat gcacttgaag    228780
     gctttgcaaa gatgctgcct tcgaggtcga gaccatcaag catgtcttca tgctcgtcat    228840
     ctgcatcgct ttcgcccgaa aggctcttgg ccgagggggg gtgttctgga ttggaaggtg    228900
     gatgcagcga tgaggatgag gtgtgcgtgg tgctggtgag aggagcagcg ctgaaagctg    228960
     attcatcatc ccaagtgtct ctgctgactt ggctgagcga ggtgttggag cgggcccggg    229020
     acagcgacga acagaggctg aggttgttca tgtcgggctc caggtcaaag tccatcttga    229080
     cattggcgtc ggtctctgag aggggtaatt cgagatcgga ccgattgcgc ccagagcttt    229140
     gcgaagagac agtggatctg cgaagagagc cgcttttgct gtgcgggctg tctggatctg    229200
     tgaggtcggt ggaaagaccc atcatgctac gagagcttgt actggccgac gtgctgagac    229260
     tggcggtgga gcatgcagga gggccttgtg ctttgaagac atcatcaaag tgagagaggc    229320
     gctcgagatc cagagctgga ggcctcagtt gctcgtcgag actgtcgtgg gctgcgaaaa    229380
     catgcgcgga ggatgccgag gcggaagctt tgcccgcttc aagcatgagc ttcaatgctg    229440
     agctagcagc agtagatagc ttgatggtgt cggcttgttc atccgaacca tcttcgagat    229500
     catcttcggg aaagtcttga tcccaatttg gctccgcata cagctcggtg tgtgagacat    229560
     cgcgaacatc ctgtaaggac gtgtgatcag tacgcagctc ggtgttatcc aagtcaaagt    229620
     cgctgtctga ccagtcttcg acttgtgaca tggcgataaa agagtgtggc ctagagcagc    229680
     accaatgttg cgtggtcctt ggtacgatga caaaggtggc tctaagccca cattattagc    229740
     gaggtgaggg atgacctgcg tgatggtgct gttgctgttg ctgttgctga aatgtcaaaa    229800
     cgagtgtgcg caaaaagtga cgtaagagag aatataaaaa aaagatgcca gaaagcgtgc    229860
     gctagcaaag atcaagagtg tgatgaggat ggtgggagat caatggacgg aagacgatga    229920
     tgccgcgagc aaaggcaccg atgtctcatg tagacagttg aggccaacgt tgtgctaaac    229980
     tcgcagtaac ttgacgctaa atcgtgaatc ctcccctcgc gctctcacct cttcaccttg    230040
     tagcccttct atttgtgatt tgtgattcgt gattcttggt tgtttcagcg cacagctgcc    230100
     agaaagcgaa ctccagagac gccacccacg actcacggac tttggtattt gcacggccgc    230160
     tttctggtgt ggctttgtgc ttggacacgc gtcaggtcta aacgtgataa cttaaaatca    230220
     agatgaaagc tttgagaatc acgaatattc agagcatgaa gatcaacact ctcacgattc    230280
     atgactcgtg actctgactt tgtatttgat ttcgcgctcc ttctcactca acatttcctt    230340
     atcggacagc cgccgaaacg agggttcaag tagagctatc cgctatgccc gtgtgaagtt    230400
     gacagctctc attgaagcac gtttcaatca tctcctccat cgagaacaaa ggccttgatc    230460
     ggcatctcct cctcgtcgca tcgtcgccga cgatcgagtt gggcgaccga ttctaaaaat    230520
     ggcttcaata ggatcgagtc ggcctcagct caagtccaag tttagcgaat cctacacagc    230580
     tctgctgcaa ggtaagcagc catggcttga aagcaacggc tttcccgtgt cagcttcttc    230640
     gtcttcattc gacgcccagg ccgccgctcg accagctgcc tcacgctcga agtcggcagg    230700
     caaatccaac tctggtccac gtacgcgcta ctttgccgat ctactttgcc ttccagtaga    230760
     gacccgcttt gtcgctcagc agcttgaagc aatccctcca gagaccctac tcgatgatga    230820
     tccgcacgcc agaggcgctc acatcgccga caacatcggg tctctctgga gggaagccat    230880
     tcgtgtatgg cgcgagagcg aagaagacga ggtgcgcaga agaaatgctg tcgataccct    230940
     ggtagcgtta tcctttccta tcctcaacaa gcgctttgcc aactactcgt ttgacatcat    231000
     caccatcttt gctggtggca tggacgacgc cgatgagacg tttactctgc ttgtcgactc    231060
     aatcgatgac actctacgcg gcggagacct ggccagggta cgtattccat cttcagctcg    231120
     cgacgaagac gacgagcgag agcacgatct agctcgagca aaggcaagag agtggatcga    231180
     ctcagaggta cagcatcgcg cgctacaact cggactcttg tggctctcct gtgtggcgca    231240
     gacatcgctc gcggcctact ttctccgtcg cgacctcttt gtcaccgctt ccacgtttat    231300
     ttcaacgcca gttggctctc gatttgcctt cgagggtgca gtgtttctag gccttctcgc    231360
     caccattggt caaggtgcag ccggtggagt gtcgcccaac gtcagcacct cgaatccgta    231420
     cgcacgtcgc tttcgtgatt gggtggacga agactgcatg gctaagatcc tggtcgcagc    231480
     ttccactgcc atggatcaga acatcgagct atatcgacaa gtcgtcgacg actcacctcc    231540
     gactttgaca ggcagtatcg ccggactcgc tagcttgcga tgggtgtcaa gccttgctga    231600
     gctcgtctct tcgcccacga gtcctacgtt tgccgctgct cccggccgtc gtccctcaac    231660
     agcatccaca atgatcggtg actttacaca tctgccttcg cccagctgtg tcatcctgtt    231720
     gccgctcttt ctgctctcaa gatccaacca ggcattcact tcgctcattc tcgacgtcgc    231780
     cgactcgcaa cccgttcaga acgaaacaca agcgcgagcg cgcggtgagt cgttctgcca    231840
     cctggcttcg ctttcatcct accttgctac ccatgcttcc gtctcgtctc gctctgcatc    231900
     gtattctcgc atcgctctac tctctctcct cgtctttctc tacgatccac gtggcagccg    231960
     taacatgctt gccgagtctg agcacttgac tgatacgctc agacgcattc gcctctgtcg    232020
     tcaacgcgag cctgcacttg cactgccacg caccaagcgc actcgactcg tcaccgcagt    232080
     actcgacacc gccacctgct cattgcgcta caacctcagc aagcgcattg atgttgcttc    232140
     ttacctcatc agtctgaaac tcgtccagcg cgtcgtgatc ctgtgctctg atgagcgcat    232200
     ccagctcgag tacgactggc aagattgttg gagcgcaatg ctggcgcttg cgacgtttct    232260
     cgcctcgcga tactctgaga ttcgttcgag caaagatctt tcggaactga tcaaagcgtt    232320
     gatcacaagt ttgagcacga tcttacttcg atcggatcat ttcctggcgt caacaaacga    232380
     gatccaccag tttatctacg agattgtacg ctgctccatg tcgctacgga agaacgtact    232440
     gcttctcgat ccatccctga agggtacgag ctccgcatcg tcgagtgatt caaacctcaa    232500
     cggcagtgct tcgataccaa tctctcccaa attgcacagc caagtgccag catggaagaa    232560
     tctcgagcgg gtcattcaag ctgtcgaatc caaaatcgcc gaatgggtcg agcaaaaacc    232620
     cagttcgaga aagaacaaaa cgcctgacat caacacgatt atcaagctca tcgccagcat    232680
     cgatcgcgaa cacctgcttg caggtgcaac caccgaagac acacatccca acagcagcag    232740
     caacggtaga gctgctgtcg ctttgggcgg agccgcacac cacgaactcg aatggctcga    232800
     tcgcatccag gaccagtgtc tgcccgaatt cgttcgacat gtttgctcgg atatcttgcg    232860
     catcctaccc atctattagt cgcacctatt cacacagagt ccgagggtgt ttgtggtcca    232920
     acttttcgca aaccactgca gagatcgctt gaatcgagtg cattgacaat gaaagggaat    232980
     cgccaagatg caggataaaa acaggcgcaa gtccgtgtaa tcattgaaac ttttggatga    233040
     caacagcgtt gaggagacca gcctgttcga gagtctgcga ctcgtcagtg agcggcttgg    233100
     gcgggaaaga tgagttgagc acatagcttc gagtcgacat tcccgggttc gcactgtagc    233160
     gaagcataga acaaggtggt tagcgcacag caattggcaa agatccaaag gcagactgct    233220
     tacacttacg cattgatgta gcttctcaag tcagcgattg tgtgctgcgt gttgaaacga    233280
     gcggtcatcc tctgaccatc gcccaatcgc acctgtagct gcgtggtcgg cttgtcggtg    233340
     tccaccttga aatcgcccgt ggaagccgtg gcggcacttg ccgaggatga agccgcagca    233400
     gcggtaggct gcgacctgga tgacgaagcg gatgacgaag cgaatgaagc aggagcgggc    233460
     gacccgagtc gattgcccga gccggcgaaa ggcttcattg gcggaggttt gtactcttcg    233520
     tcggtgcgtc ggtggacgtg aacgtgcact tgctggccaa aacggatgtt gaggaggtcc    233580
     aagggagcgt gtcccgagtt aattgccgca agcgtctgag catgtgcggg atcgtcgtag    233640
     cgcatcagct caccgtcttc taccgagaac ccatccttcc agaaggtgag atttcgaatt    233700
     gccacctccc catcttcctc ctcgtcgttc gcttcgttgg cgccagcacc acccaacctg    233760
     ctaccgaatc caccgggcat cgaaggagtc gaaagggacg atgattcggc ttctgcagcg    233820
     tcgttgatgg tcctgccgcg gcccgtgaat gcgaaggagg ccgaagacgg aggtttgctt    233880
     cccgaagctt tggccctacc cgcagcaagt tcctcgggat ggcgcttgcc ctcttcggca    233940
     gcacgtttca ggatctcttg caccagatct ccccctggct gattcctgcg acgccgtgct    234000
     tcgggattct cgacgctgag cgcgctcctc tcaccaccgg cgtagtaatt catctcatca    234060
     tcgtctcctt catcgtcgtc gccatcgtca ctagaagccc tctttccact ggctggacta    234120
     ctgttcaaag tctgtaaatc acggaaggtc gcgataccgc cactggccct cgaacgagaa    234180
     gattggctcg atgccaagga ggtggatccg aagccagaga gactggaggg gtctacgggc    234240
     tgacctgaca gcgtacgtgg ccccgtatag ttttgctcaa cgctaggaga agagctcgct    234300
     tctgcggtgt cttccactcc tgctccagct tccgactgtg aaggttccga ttcgtagaag    234360
     ctcgacatgg cggtctgcag gtcgccgccc gaggcttcga gaaagaagcg ggcgcggtcg    234420
     gccgaagcgc cagtgatcgc tgcaaattgc tgaatgctct cgtccatctc ggatacaagg    234480
     tatttctcta gaacagcgaa agtagtagaa aggaggaaag gaggaaagga ggaaaggcgg    234540
     tagaagaagg agccgaaggt gaagctgaga acgacacgta atcgtgaatc gtgaatcgtg    234600
     aatggccaac aagtggagga actgcgctgc aaaacgtgct gcttccagcg cgcatgggcc    234660
     ggcagttgaa cacaaagatc tgggttggcg aagaaaagag gcgatcacac aaaacgattt    234720
     tcggactaaa tttgactcgg acgagaagag gttttggaac gtcttgagac gaggcgaatg    234780
     cgaagagtcg cagcacagag cagaggagat tcgcgattgg aaatgcgctc tcaatcaaac    234840
     ggtcccgaat aaccacactc acgactcgtg aatcttactt tcaagataac ttattgcaac    234900
     atcatcgtga tttcactctt caacctctct atccgcatta tcttccgaga agtccaacag    234960
     cacaggggct tagacagtag cagtagtacg tttgcgcgcg catctgctac agcctcagga    235020
     tcctatcacc acgagacgaa tcgtagcggt tgaggtttca cttcatcatt accgacatgg    235080
     cgtcgaaaag caacgaacaa gttgtcaccg agaccttctc ggaacgatct ccctttgctg    235140
     atggtatgac agcagccggt gctagtgccg gtgccggtct tttcgtcagc gctatccaga    235200
     acagtgttca gagtcacaac aagggtgctc tcggtgtctt tactcgtaca ggaagcacca    235260
     ttgctctttt cagtaagtat ctccacctac ttcgacgagg gacggacctg tgcagggaag    235320
     aggcacatgc atattgcggc tgtgctcgtt gtacatggtt gacgcgactg cagtcccttc    235380
     ttagctataa tgttccactg actaacgctg ttctttacct tgttactttg catcgttaac    235440
     gaccctgttc tctctcagct gcaatgggag gcatcttctc gtacaccgac tcgacggtcg    235500
     ccaattttag acagaaggat gatgctgtca acggagcgat cggtggttgc gctgccggtt    235560
     ttgtgctcgg tgctgccgct cgctccgttc ctatgatgtt tggtggttgc gcttctctcg    235620
     ctgcattgat cggtactttt gatgcggcag gtaagtcgct ccagggcacc tacgcgcgcg    235680
     catcgccata tgacttttca catgatcacg acgcagctcc gggcgcgcaa ggttggaggg    235740
     aagctcgaga tgcccgtcgt cagaacttct tcaaggtaag tagcagcaga gcacggatcg    235800
     aacaaattca gcgacatctg actcacccat cctcccttgg caaacactcc tgcattctgg    235860
     caacaaacag caaaagaagg acgacgtcga gtctgatgca tagatacgct gaatgcttcg    235920
     ctcaatccat ttatctctat catttcccaa catttttcag attaccaacc tgtatcaaaa    235980
     cgtccatacc cgacacaggc aacaacagag caggcgggtg agactcgaat gagcgttgta    236040
     cattgcagaa atctgaagcg ccttggatgg tctacgacaa cgaggcgccg acaaagtcgg    236100
     aagtcagaac gcccttttcg gttctgagca gacgaggttt cttgtctgcc tccggatcca    236160
     ctgcgtcggg gagagcaccg acccaagcgc actgcttgtc ctcggtcgta gtgtatcctg    236220
     gctgaatggt ttcaaagatc ttcttcttgg ggttgagcac agcttcaggc tctcgaccct    236280
     cgaaaccctc gacccaaacc ttgtcgcctg gctggcttcc ctcggggggg taaacaggct    236340
     cgacacctcc gtccttgcca tccttgtgtg tggcgcaaag aagcataccg tacgacttga    236400
     taccgcgcat cgatgcgggc ttgaggttgc agacgccgat gaccatacgg ttctgcatct    236460
     tttcgatggg gacaaagttg accagaccgc tgaggatggt gcgcggtccg tcggcttcgc    236520
     caaagtcgac cttctcgaga tagagcgcgt cggcatctgg gtgcctctcg atcgagacga    236580
     tcttgcctac tcgaagatca acttgagaag ggagaggtcc agtggtgtca gcggcagcgg    236640
     cagccgcgcc gccctttttg cctccaccac ctccagctcc agccttggcc tccttaggtg    236700
     ccttttcctt cttctccttc ttctccttca cgggctgctg ctctgagacc tccttcttgg    236760
     agaagcctgc agtagcagca acagcctcct tgctggcttt cttggccttc ttgaggtctt    236820
     cgggcttggc acgctcgatg gtgggcatgc cctcgtaggt cggctcaaag gaggcaaagc    236880
     caagttgagc ggcgttggcg gctttggcca cagacgacaa attggaaagg tgcgagatgt    236940
     agcgagcgac cgaggggttt ttatgctgtt cggctggctc gagctttgaa acagcagggt    237000
     agatgcaagc aaaaagcgca aggtcggcca cggttggctc gttagaagcg acgtaggtga    237060
     cactgtcaag ctgctcattg agcgacttga gaccctcggc agagacaagc tgcttttcat    237120
     cggacttgtc gagtttctcg agccattctg tcgtagccga cttggcctta tcgtcagcac    237180
     caaagatctg ggctgatttg cccgtgagat cggcaagttt gttggcaagg tccgtcaacg    237240
     gcaaagctgc gtcaccctgt agttgctgga tggcactctg tggtggtgcc gggacatatg    237300
     aggaaggtgg tgtcgggagt tgcatggata gaggcgcaag tacatgcgtc catcgagtgg    237360
     cacagtggtt aggtcgataa gagggccagg acgccagagc gagggggatc tgttggatca    237420
     gtcatttgag caagctggac gaaaagcgta aaaagtcggc cagagcagac acgattcaga    237480
     tacttacagc attgtttgca tactgcgcat aagtagcggt gatgagctgt ctcgctctct    237540
     gtccagacat gatgatagat tggtggtggt gtggagaaga aagcaccaag gaattcatga    237600
     tttgagcgtt ggtatcacag tcactaattc acgaattcac gatttcagga agaagtcgtg    237660
     agttggtggg ttttaaacaa agaaactcgg agaatggtat aggtctaaca tctcactcag    237720
     ctgaccctgg aacatcgtgc atcgtgcatg gaaccgtgaa cgtcgtgtgt gggacatcgc    237780
     ccgtcacgcg tggcgcgtgg ccaagaagtg tgactgtaag gttctggtct gctcacagcc    237840
     tgcagttcat cgcgaagtgg gtcaaggggt ccaagcaaag ccacgagctg gtggatcatt    237900
     cacgattcac gattattcat gttcacgatt attcgtgctt caacccagtt tgacaggcag    237960
     aaggaagctt caaagcttgc ttcttttgaa aatcagctca tcacgcatgc gtgctgggac    238020
     aagtgagatt cacaatgcgt agtgtgtaca ggacagatac tctgcagacc acgaatgatg    238080
     atgttggtgt tgagctgatc tgctaggaag aaagcacagc gcggacaacc ttggtatcca    238140
     accttttcat tcgccaaagc ctctccgtat tctcgggccg ctgttctctg ctcttgtcca    238200
     ctccactgcc agcacatcct cgcacaagcc aagtgaaagg ttggcgacaa tgtccactgc    238260
     cgcctctacc agctcgcaag ccaagcagct gcggcctgtg atcctcgtca ctggtgccaa    238320
     cgctggtgtc ggctttggta tctgccagag gctgctggtt cagctctcat ctcctacgcc    238380
     gagtgacacg cttccaaatc atccgcaact gtactctgac ccgacaatcc agcccacgcc    238440
     gacgccgttt tccgcagcag acggatgcac catcatcctc gcatgccgta accccatcaa    238500
     agctcacaag gcgaggcaac agctccaaca gctgctcaag tggatcgaga accttccaga    238560
     acacgaagat accccgaccg gccctccaga gagctgggct ttcgcctttg atgccgactc    238620
     gaaggatgac aagctgaccg accctgagac ggagcaagac atccgtgaca caccgcacga    238680
     agatgctgat cctgctttgg tcgcccatgc acaggagaac aacgtgagga ggagaaggaa    238740
     acagaggaaa gcgcttgcca atggagatga caccagccaa gacccaagcg cgcatttgga    238800
     gtcggaagcc gacaaggtgg acgatggcga ctcgcttggc tcgcctgacc tcaacgctag    238860
     cctggagcag cgaaacaagc gcgccaatgc atggtatcgc cgtcgcttct gtcaaggtac    238920
     tcgcatagag tttgtaccgc tcgacctcgg cagcatgggc agtgctctgg aatgcgcgcg    238980
     catggtgcga gagagatact cgcacgtcac gcacgtggtg ctcaacgctg gttcgtcagc    239040
     atggaccggt atgaactggt tccatgcggt gtggatgatc atgacgcagt ttcgatacgc    239100
     tgttacctgg ccggcataca agatgcagcg tgcaggtgat aagagcgacg atgactttgg    239160
     ctgggtgtgg caatgcaatg tcggcgcgca ctggatactg gtgcgagcct tgctgccgtc    239220
     gctgcgtgca acgccttact cggtgccctc acgcatcatc tggactagct cggtcgaagc    239280
     tttctccaag tactacgaag ccagcgacta ccagtgcctg gatgtagcca agtcgccgct    239340
     tccttatgaa tcggtcaagt atcagtgcga gctcgccgcc tttggactgg acgatgccct    239400
     ccagactcgg cgtatgcgca ctcagcctgg cacgcccatg gaagagcgtt caacgatgtt    239460
     gggtatgtcg agcacaggaa gcgaaagcat gcaccgctcc gcctcatcag cgagtggcac    239520
     tgctccgcat ggcttcctcg ggctcccacc tgcttcgcgt ccagtgcctg ggcaacccga    239580
     gccccggagc ttcctggcac atccaggagt ggtggcgtct actatgatgt ctcaattcgt    239640
     tgcatcgtgg gtaacgatat tcgtggtggc aagcttctac attgcacgat gggtgggctc    239700
     gccgcaccat cccatcgacc cgttcaaggg agctatttcg gtcagttacg cctgcctggc    239760
     accggatccc gaccccaaga agcgatatgg cagccggtcc gacttttggg gacgcgagta    239820
     tgtgggcatc gagaagatcg aatattaccg ctcgcagctg gggggagctg gaccaggcgt    239880
     aggcgcgcgg ttggcactgg cagggattga tcctgacacg gtacaaggcg acgtttcgga    239940
     tgcggggcga gtgctggcca tggcacgcga gtacgttggc ttgtgcgaaa ggatagcacg    240000
     ccaggtgtgg cgaagcgcaa gaaggggcga tctgcctccc tggagctcgc tcgccggtga    240060
     cgaatttgtt gtgcaagagc acatgcatca gctttcaatc gaagacgacc atgggcagca    240120
     gaatcttgat gccgaagatg cgcggccgcc ggcgccgtcg aacgatgctg gtcccgccat    240180
     cacactcaag acgacgaccg tgccgagtag tggcccctcg acggatgata aagaatggga    240240
     gaaagtgcaa tgaacatcga caggtcttac ctcttcgttt gggagttcgc acgcagacgt    240300
     cgggcagcgc ataaacaagg tcgctaagat tcattttcgc ctgtcgtaga atagactgcg    240360
     ttatggtagt agtctttcgc gtgtacggtt ctggcattcg cattgatgtc aagctatttg    240420
     cttgcagtac gcaggtcggc aaggacttgt tgtactgtcc gtaggtaatg atatcgcgac    240480
     agcacggcac tcgagactgt cttctttcac ggcgtcaact cttggacgtg tcatggaatc    240540
     gtgaatgttc gcaagaagat tatccaaacc cagatgaaaa ggggatcgaa aattgtggat    240600
     acaaaattca accaaagggc atgtgtgcga cgatctagaa tatctctgag caacacaagc    240660
     atgaaacggt caaatccgct tgttcagcac caactcacga ctaattcacg atttgtgtca    240720
     ttgatttaga ttcttcagcg agtgcatgtg gacctgcacc tggttccagt cgctccagca    240780
     gaagactctc tgatccacga aaagaccccg tggaaatttt agatggtctt agatgcgctc    240840
     taggcgcgat tggcgaggat ttaacttgac tttatttgtc acggttggct gtgccccagg    240900
     cctcgcacaa ccaccagacg gatagcccaa acttcaggat tcacgattag cagtttgaaa    240960
     ttggaataat ctcgaatttt gaaagattcg tgattcatgt cgacgatctt gaaaaccgcg    241020
     acaggtccaa gccgaccaag tccaagcaca agggcacagt tggagcagca gcggccactc    241080
     cctttctgca cttgttccaa gtggctctta cgcctcgatt catttcaata ttaatacttt    241140
     ctcgacggct gtgagctgtg cggaacactc tgtatgtgtc tcgcttatgc gcttcgaaca    241200
     atcagcctgt agtttccttt ggctcagtct agactcgaac aataagttac ctcacgactc    241260
     ttgcacttgt gcacgccccg tcaatccggt ctttcttatt cccgcatctc accgtccatt    241320
     cgctctccct tccgtcgttc aaaggcaacc aaccacctct cgtgaccctc tttctctgct    241380
     tgcctgtaca ccagaccacg agactactgt cgacagagcc tgcttgtgaa gtcgttccgc    241440
     gtcgctattc gctgtgcagt aaaaaagcta ctcaattgag cgcccaagta tacacgagtt    241500
     attattcaac gcacactgta caagtactcc tcacacctgt atacgcgcgc tcatcaggcg    241560
     ttgcgatagc tcctctccgt cttttcctga ttgttccagc cgcgagtaaa ctattgcgtt    241620
     tgaccaccgc cattcattgc gcgcttgtgt tctcagcagt gcaccgcgta cactcatcga    241680
     gatagagaga agcaaaccca aaggcaaggc ctacgcttct gtcccgacca caaatcatcc    241740
     ctcgtgcatc catttcgccg atctttcgac tctattccac ctaggagacg ctttctttga    241800
     catccacgat tgcattcagt gccatctcga tctcgccttt gtcagcttcc taattgatac    241860
     gcctttcagc cgtcatccaa ccctcgtttt cttcgatcac cccttcgtcc accgtaccct    241920
     tcacttccac cacatcgccc tttccgtgct cgcgacgaac ggtttcaccg ctccagatcc    241980
     agcgcgagct gtatctgtgt ccttccttcc ttcgctttct cgacagcatt ggtgacagtg    242040
     ctcgcgtctt cgaccgcaag gcgagacgaa atcgcttatc aactatcact gacatccagc    242100
     taacaagacg agattgcgat ctgtcattcc ggctggcgtc catcaagcat ttttaggccc    242160
     ctcaaattgt ccgcctcgca ttgccatctt ccttgtatac cgtctaccta cctctcaccc    242220
     attgcagtcc tcacagatcg ttcttgatcg ctatgcagca gaccacagca gctgtggctg    242280
     tgcctcagct tataggtcga cgtcaatccg gcaacttgcc accagacatg cctttgagcg    242340
     ctgatcctcg gctcggtgct actcacgcct acatttcgct ttcgaacgat ccgtttccgt    242400
     cccagacctc agacattgct cataactacc attacacctc tagtcgagcc tcgttcgacc    242460
     agcagctccc ttttgacggt gcaagtagtt ccaatgtccc ctcgtggttc tacactggct    242520
     cacacgcgcc cgctcaccca accgcagcag agaaccgtct gccttaccat tttgatgcat    242580
     atgcaccaca cgcatcgtca gcagcatcca gtaacatgtc tgctccatcc gatgcgccct    242640
     tgaccacaaa cactcagcat caggcctcta actcggtact cccgaccgcg cgctttgcta    242700
     ccaaatcagc tggcctgagc tcgacaaatg ctgcgccttt cggtgccgag ctttcggtta    242760
     atgctcattc ttcctcggct tcgggcgcat cgcattcggt tccatcttcc ctagccagca    242820
     gacgtatcag cgacgagagt gcgcatctgg ccgccgcagg cacttcgatg tccgaagcca    242880
     gctcttcgct tgtaaatccg ccagtacgcg ctaccactca ttccgcttcc gagtctaccg    242940
     gtttcaatgg ctcaatttcg ccctcgtcat ccgcacgcat gtctggcagt cctgaaaaca    243000
     tggacgtctg tcgaccctac catgtctacg cttctacatc caccgtgcct ccacttagcg    243060
     gcatggtcat gggtgcacct gtcacagcct cgatgatgga atctatcgac tcgtggctcg    243120
     ctccgggacc gcccgcatcg ctaggcgcag ggccctcctc tgcaaacgtt gacagccttg    243180
     ccacagccat gggctcggca aaagcgcgcg tggcggtcac gcccaaattc tcttccgcag    243240
     acgcctccac agcagacgat gcaccatcct cttcacacat gcttggcggg tcggtcattc    243300
     accctagttc attcaccagc aacagctcct caacatctgg cgctgcgccc tttaagacga    243360
     gtatcgagag gcgcgagcgt aacaaggcat cccagcgcga gtctcgcaag cgcaagcagg    243420
     accgcctcga gactcttgaa ggcgaaaatg ctgcgctacg aaaggcgttg gctgatatga    243480
     agaggttcag tcacgccctt tccaacggtg ccggcattcg tggcgaggac ggtggtgaag    243540
     tcgcgcccgc ccagctcgcc aaattcacag gagctttcca tctggacttg atcgaatctc    243600
     acctggaaga cgagtcgaca gaggcagagt ggaaaggctt agttggacga cgttggccgt    243660
     ctgggactgc acaaacgggt gatcggcaag gggatgtttc cgccctcgcc acttcaacag    243720
     ccagttcgga cgaggacaac atccgtgacg aatctcaaga catggccaat gacgctgcgc    243780
     aaggctctgc gtcgatgaaa ggcgagagcg acaatgcgcc acagtccgct tcgcagcagg    243840
     ttaagaaggc catgtgggag atctctctca accagaagcg tcagaaggcg gcacagagct    243900
     tcccctcgat ggttgctgtg cccgaactcg tgctgtacaa ggtgtgccgt ctgtacttca    243960
     gcacactcct gccgttcacc accaagctca agtctggtat cgtcaacctg cgcgccgccc    244020
     gtgaagcacc aggcttcttc ggaggcttgg acgatctacc tcgcttccct ggcgatccat    244080
     cgttcggcgt ttcggagcta tatctgccca agaatctgat gcccaccgag atgcaattgc    244140
     gcattggctt tcacccggtc gagattgctg ttatgccata tccgaagatg cgagatcgtt    244200
     tgctcacagt tctcagcgct ttccaagcca tcaacgagct ggcgcaggaa gaggaggctg    244260
     ccgctgctgc gcaaattagc gaggatgtca gcggctcgaa ctcgcaaact ggcaacgcaa    244320
     gcattgacca gcacgtcaag ccgagcgatg ccagcaatgt ggagctgacg aacgaagaca    244380
     ttcgtcagcg caccgcgttg gtcgccgata tgtcggcctg gaagcccagg gacggcaccg    244440
     gtgctgttgt ggtgccggac aagagtcgcg tctattctta tgggttcctg gagaagccac    244500
     gaggctcgtc gcgcttgcgc aagccagctc agcgctggct cgacgaattt ttctacgagg    244560
     tggtgcagac gctgcgagtg tggtcgccgg caggtgatgt gtttgatggc gagtgctttg    244620
     aatttaaaga aagcttcttt cgcaagtatc cttatatggt ggacagcgac atccttcgag    244680
     ccaccaaccg atggaggcgt gctcggggcg aagatcccat ccgcctctaa gtcgataacc    244740
     ccgttcggtt tcgttccctt tcattcccac tgtatcgtat ttctagcatt cttctccagt    244800
     ctcgtgatct ctttcatcct gtggccgacg cccgtgcact ctggccgacc tatcgatcca    244860
     gtcgattcac aggtccaagt tactgcgcga cacgtcgttg tccagttgcc tcttctcggg    244920
     ctctattgca ctgtccatat tgcttttccc ttctccggct tcagcgtggc ctctctgtca    244980
     cttgtacttg ttctcgataa taacgtttgc tcccgcccgc tgtgcgcgtt ttgttgtaaa    245040
     tggctaggac ctgtcagaga tgatgaacca gtcaatcgaa cttttgttta cgacctgact    245100
     gtgtgagact tgctcgtctg aatgctgtga gcgttttctt gacctggcag gttctttgac    245160
     attcgtgatt cacgattgtt ttgctacata gcatcgatgg atctccattt cgttcccgat    245220
     aaaagagtgg aacaattcac gattgatttt atgactcctg tgacagcgat gagactgacg    245280
     catgctgttg aggcgaattc gccacgcaga ttcacgattt gcagattagc actaagctag    245340
     agatgagcag caacaatcac gagtcgtgag tgacgtgagc ctgcgtgtag cttttgagac    245400
     caacaccaac acctgcactt ttccagctac ttcggatgtc cgcattcacg attcaagatt    245460
     cgtgattgta atcacgaatt atctttgatt aacttgcagt acgtcgtgag tgagttgaag    245520
     cgaattcacg attttgtcgt tggaattcag gggtctaaga gcagtcacaa gcaccaagtg    245580
     tgacgctctc cgtgttgcgt gttgtgttgg ctaagttgat tcgtgattca cgaatgcgtt    245640
     tgtttttatg gtccgaattc aacgcaagca caaagccaca caagacactc acgacttaca    245700
     gactctcctg cgtgtgaact gcctggaact ttggggactc attgcacatt cttcctacag    245760
     cacatgcagt catacacagg cctgctccac tacgcccgcc ccatccagtg agtgagcttg    245820
     acagtaccag ctgcatcaca aaagcgtccc tatcatctac cccatcttgc cttacgacca    245880
     tcatatcatt ctggccctct cgagtgcatc aatcaacacc aaaccgagca aggtcaaagc    245940
     aagcatattt ggtggtcact tgaacgcaat catcatgtcg atctcaccgg tggacatcac    246000
     aagcctcaaa cagaggtacg agaaggctgg tcaatcacat ctctttgcct tttgggatac    246060
     cttggctgct gagcaacaag ctgagctcgc tcaacagctc gacgaactcg acgtatcgcg    246120
     cgtcaaccag gtctttcaca ccgccatcaa ggcagacgaa gaggcgaggg ccggcaagtc    246180
     gcatcaggta caaccaccgc cgccttcgtc cgtcgagaac accattcaag gcgaagcaga    246240
     ccccgccaaa gttgagcagt tccgcaatgt tggcctcaac gcaattgccc aaggtcaagt    246300
     cggagttctc ttgatggctg gtggccaggg cacacgtctc ggctcgagtg ctcccaaagg    246360
     ttgctacgac attggtcttc cgtcccacaa gagcttattc cagatccaag ctgagcgcat    246420
     cctctctctc cagaagcttg ccgccaagca cgccaacagt tcctcctcct ccagcagctc    246480
     gtccagcagt ggcgtcatca tcccttggta cattatgacc tctggaccca cgcgcaaaga    246540
     cacggaagca tttttcgacc aacacaagta ctttggtctc gaaaagcaaa acattatttt    246600
     cttcgagcaa ggtactcttc catgtctctc gctagagggc aagatccttc ttgagacacc    246660
     tagcaaggtc gccactgctc cagacggcaa cggcggcttg taccgcgccc ttcgaacgcc    246720
     gtataacaaa ggtcatcccg aaaccgtcat ttccgatctc gaaaaacgcg gcatcaagta    246780
     cctccacgcg tacggtgtgg acaactgtct tgtcaaagtt ggcgaccctg ttttcctcgg    246840
     cgtctgtttg cagcaggatg ttcaggttgg cgtcaaagtc gtcaagaagg agaaccctaa    246900
     agagtcggtt ggcgttgttg cacttcgcga cggcaagttt ggagtggtcg aatactcgga    246960
     gattccagag gcattgagcg aagcgcgcga tgccaacggt gagctctcgt tccgagccgc    247020
     caacattgtc aaccacttct acacgactaa gttcctcgca gatgatgtac ctgcctttga    247080
     acccgagatg gccttccaca tcgcgcgcaa gaagattccc accatcgatt tgactacagg    247140
     ccaaccggtc aagccctcta cacccaacgg catgaagctc gagctgttcg tctttgacgt    247200
     cttccccttc tgcggcgaca agcttgccgt ccacgaagtt gcaagacaag aagagttcag    247260
     cccgcttaag aacgcaaaag gaaccggtgt tgacgaccag gacacttcgc gccgagatct    247320
     tcttgcccaa cagagccgat ggctccgcgc tgcaggtgcc aagatcgcgg atgacgtcga    247380
     aatcgagctc agcccgctcc tcacatacag tggcgaggga ctcgacaagt ttgctggtca    247440
     gactctgtcg caatctggca acattgagcc ttgatttcga cccacaccat gccgcttgca    247500
     agatatcact gtcaaatcta cgcatccgcg atctacgaac aatctactcg ccctgcctca    247560
     gtgtgaacaa gaccagagac ctgtttcaga gccatccttc atcaacgtga gccgagcact    247620
     gagcaccgag cactgagcat tccgtgctcg cgtgcgaccc gctgtctgcc gcgtaccgcc    247680
     gcctagttcg gacagctctg tccacgcaac ccagtaatca aagggtccca aaccgtgccg    247740
     agagagcccg gcctttttgc attgaaattt tggagtgtgt aaagggttgt atacaaaaca    247800
     ccaaggcata cgaatttcgc agccttgaat gacggatgat gatgaggaat gctggatcaa    247860
     cccaccatct gagctgaaag cgcatacgaa gtgcagagag atagagggaa tagcggatga    247920
     aacgacctag cttgctgatt gagaaacttt ctcaagatgg gagaaaggga aaaaagcata    247980
     caacaaagga ccgggatgtg tcgacgagaa aagcgtagat attttggtga gaaagggtaa    248040
     catcaacaag caagcaagga gaaacgccat cccaaaaaag ggacccctct gcaactcgaa    248100
     gcgagtcgat caacaaatgg gttggtgtgg tgtcatgctg cggaaaacat gaaatcgaga    248160
     caaggagcaa acgaacgcaa cgacacgctt agttggcgtg cagaagctgg aggaactcct    248220
     tagcgacggg ctgcttggcc tccttcttga atcccgactt cttggcggcc tgggcgcgga    248280
     tctcggatcg gatcgcagcc tgggcgtaag ggttaaggcg gaacagaaca gcacggttct    248340
     tgagcgggtt cttgcgctgg gtgaaggggc gagtggtctt agcggggccc ttagcacgaa    248400
     ccaccgactg gatctcgtcc gagttgatga tgcgcgtgac gtcagtgtta gcaatcttgg    248460
     ccttaggcag cgtgaaacca gtcttggcgg cgaacacctc gtcgaggcgg ccgaaggcgg    248520
     actgcgtgaa gatgacaaag cggccaaggt gtccaccagg ggcgagctgg agcaggttca    248580
     ggcgctcaac cgagcagagc tcaacaccgg gcacgttgcg gaacgccttg acgataccgg    248640
     cgtccttgtt gtagatgaca aggggaccgc ggcgctgcgt gtggcggcgg ttgcgcagct    248700
     tgccaacacc agcacggatc ttgcgcgagt tcgacacctt aacaacgtcg ttgtaggcgt    248760
     tgaccgactt gagcagggcg atggcctcct tggtcttggt caggctctcg gcggcatcgg    248820
     caacgacgag ggggatctcc tcgagctcct cgacacggtg accgcgggcg aggacgagcg    248880
     aggggacggc ggtggcagcc agagcagagg cggtagcgta acgcttctgg ttctggttgg    248940
     tcttgatgaa ccatcggcgc cacagcttgg tgggggcgaa catgtgacca ccacggacca    249000
     tgttaccgaa ggcggcctga ccggatcggt gggtaccacc accgccgaca cgggggatac    249060
     gagcgacggc acgaccggta ccccaggact cggcagaggt ctggtgacca gccttagtgg    249120
     agacggcata gggctgacgc ttgttcttgg caacgttggc tggagtggac gaattagaaa    249180
     agtgagacat cggcgtacgg ggtcagtgac acgctcttgc tgtcgaaata gagacgcagt    249240
     ccttcccatc ccattctttg ttgtcctgct ctgctgcatg ttgtatctat gccgactttg    249300
     ataccgtcca gcgtctgata tgttccattg ctgtagatcg agttctcatc cggctttccc    249360
     tttcaaatcc aacttcaagt ccttgctaca tggtcataca agttcaatgt cgagatactc    249420
     actgtgaacg agctgaacaa cgtcaggtcg gataggggca gtgaagactg cggggagggg    249480
     gagcgagccc gaggccgcgc catcgaggcc cctcacgttg acagctgttg agaagacgaa    249540
     caaaatgcaa gtgaaacggt cgcggtcaat gtgatggtcc atgaatggac gacattctac    249600
     agcagcagcg cgacaccagt tacatcatca tctttttttg tggtcaatcg tgtaggaagt    249660
     cgtcaggaat cacaagggtc ggtcggaagg tgcgagacca gccatgttgt gaaagtccat    249720
     cggcacagct tagatagtca tttcctggtg attgctgatt gctggtgcta agatgctgag    249780
     catcgagttt gctgtaatgt aacgatttgg ggtttccgtt gacctagctc gacgtattgt    249840
     accatacgtg tcccgagttc cagcaatgtt ttctaagagg cgacgcatct tttctcgatc    249900
     acgaccatcc tgctctgccg agtgtggcgg ggtgcccgaa ctgatgaaaa agtgaacagt    249960
     gtttgcggaa tgaagcattc ttcgttgacg gttggtttgg catggtcctt gctagtggtt    250020
     gatttgctat gctcctcttc acaacgatgc tgactgacga ggaatgatgc tgactgatgt    250080
     gtacgctggt gtctctgcat gtgtgatatg tcggtgctgc tgctgatggg ctgaatgaga    250140
     tacctactgg gtctagcagc catttttgat atcttgaaga gaatggttgg tggatgattc    250200
     caaggaggat gacgacgtcg agctctcgga gtaggccaaa cttggaatcc agattctgat    250260
     gttgcgacag agcgttggcg aggcaagtgg ttgcgtagct tgggtgtgtc tgtggctaca    250320
     gtttggccat tccactcact atagagactt gctctgctgg cctgaatctt cacctcgaag    250380
     ccctaagctt tcgttagctt ggaaatttcc aagactgatc tcctctgcct ttcagctgtg    250440
     agagttattt tcaatcttac tacatctatc gattagcaat cgtttaaatt catcctttca    250500
     gtctgtattc tttttgatta atattgcacg tgacgtggtg aatgcctcgg ccgcttctca    250560
     cctggcgcta attctgtttt tttttagtat agcagccaag tcttagcgat gagctgtcga    250620
     acgactggac ttggaactcg taaatcagcg agtgactgac tgagaacatc aggactgtac    250680
     gtcagtaaat taatgatcag tatcagttcc agagtttgac tgcacgcgcg agaaagagcg    250740
     aaggtgtaca ccctgagaag tcaccacatt caagcgccag gagcctggag accgcgttcg    250800
     tcgtcatcac ttgccctttg cttcctccat cttcttcgta ccctcaagat atcgcctatt    250860
     tacactttga cgacaagatg actttccaga ccctgtggta cagccacccc cgaaagtttg    250920
     gcaagggctc ccgccagtgg taagtgtcac catgatgcag aatggacgca gaatggataa    250980
     caacgcagac gactgctatc aatccggggc aatccgacaa tcgacacagc ttgataatgc    251040
     atatggcagt ttcgtacaac gacaatcaga tgcatgcgca accaacatac cacggtaaag    251100
     acgcgctctg ttgagggcac gaccatcgtc tttgagatgc ccagcaactc tcatcactag    251160
     catctactag cctcgacatt gcatcaccag tcatgaacat tcgtcagagg ctgaagtcgt    251220
     caggtttcag agactatcta cccagctttc cgcagatgag cgaaacgcct tcgaggactt    251280
     gggtggcagc tgctcatgcc cgcctcaaca tggacaaact cgggactctc atagtgtaac    251340
     agcagaactg agtctcagca agaataaccc atcacctgtt ggagcacttc atctccagcc    251400
     tctgatcgtt cccaagtctt gcttggtcta gtactcggca aagctcacag atccaacact    251460
     ttttgtggac gggtttagac gaattggacc gagcagatcg ttcagtattt cctcgattca    251520
     catcccgctg ctaggactgg gagaagaaca tagtacggtt aatcagctac gcagtttggg    251580
     atggaaacaa gtggacaaca agctcttacg actccggcta gtattgatca tcactgttgc    251640
     atctcagcac accacgaaga gacgtgccac gcttcaaccg tccgcagctg tcaggcctcg    251700
     atttgggagg ctcgacgttc gcgacatcat tgtcttaact gcttcgcctg acatcgtttc    251760
     cagcacacac ttgggttgat caagtcctgc tagaatcatc gccatctagt tacgaagagc    251820
     tgcccactga cgttttgatt tcgtgacgct ccatctcgat gtatttccta ctacagccgt    251880
     gtttgcggta accagggtgg tatcatccga aagtacggcc tcgacatctg ccgtcagtgc    251940
     ttccgtgagc gcgctgacca gatcggcttc cacaagtacc gttaaagtgg caccggacgt    252000
     ctacgccaag caaaactact acacatctct acacacacgc acacccatct cgttgtcttt    252060
     caccatgcat tcaaaagtct cttttcgaga cctccgcttc ccttgctcgc atctcgagcg    252120
     atcccttgcg ggtccgccag cgttgcggtc aagtggttga ttccgtatgc gacacacggc    252180
     agcactgtaa cttttccccg tacccgctca tgtcacatac tttgtcgcca tctgctgcca    252240
     tagcaaacaa aagctttctc ggtccaagaa tgcgttttga gtgtgacgtt cagcagacga    252300
     gcagatgaac ggctgttgtg gcgttaggac tctgccatgt gagcttcgca aagatggtcg    252360
     ggaacaaatt atgtccgaac aacgcgccgc tgcgactgct tgcccagttt cgtgctggcg    252420
     gtagaaacac cgatttccag agtgtacaaa gacatttgag gatttgttga gtgtgatcat    252480
     cgagatctca agtcaggaac aatcggaagg gttggcattt cagatgttgt cccgatctgt    252540
     gctcagaaag atccgtgcga gaaaaatgcg gcggtcattg cggaattgga acgcggagga    252600
     aatctaactc gaacaaaccc gatgtttcaa ttataaggct gctgattgga cctgggatgg    252660
     gcagacatgc gagcctgatg cacgttggat caatgcacgg cagagcaagc ttgtactttc    252720
     tctcgacgtt gcggcagatg taatgttagc ttttcacgat ggcgaagtct tgcataagtt    252780
     ctgcaagcct cacatgggcg agtttgactg ccgagacgac attgtcagcc tttcgaaggg    252840
     aagaggagca ggcgaaacgg atgaaagaga cacagtagga tacagtacag tgcagtagca    252900
     gttcagcttc atcaggctgt ttggagacaa tcaagaatgg cggttcactt gcgcatgggt    252960
     agcaacattg tcttttgctg gctgccagat tgaatatcaa ttagtgagat ctcagcatct    253020
     ccttgctgat taggtcaagc tgacagccag cctcaaaagg tgcgagatgt gatctggagg    253080
     tgtaactaac tgcctttcac ggaccttgcc ggccgatcgg gttggtgaat aagcaagttt    253140
     ttgctcttgc tctccttctc gtcgactctc ccagctcgct tccaattacg tggttctatg    253200
     agccgttgtc aatatctccc ctagtctgcc atcttccaca gattgcaaat cgagacggtg    253260
     tagcaagctg ctctttgccg ccagccagaa acgaaaacaa ctctgttcaa gcggtcaggc    253320
     ggttcgaaaa cgcgttgatg ttgaaaaacg aagcttctgg agggcagtcg aatttatgag    253380
     gatttacagt gaaggcagag gcactaggag acactctgtt caagcgcatg cggtctttga    253440
     aggcttttga attcaactca caaagaggtt gcacagtttc aattcgaatt tttgaaagcg    253500
     cgttgaaacg ctgctgcatg ctgcgcgcta caggctgaag ttgtgtgtca catcttcgaa    253560
     aagcgagcaa gttgattgga ccaagttcgt cgcgagggtc aaggcagctt cgctcgggct    253620
     gcgattgccg ttgctggccg gtcaaagctt tgctccaagg gcgtgaatca gcgcgaaaat    253680
     cggaattttc acctgcttgg ctgcctcgcc tgcccaaacc acccccgctt gcccgatggt    253740
     cactgcttgc tgctgcttgc gattttcact tgtcccacgc tttcccttgg tttgcaaaag    253800
     gcgcactgct ggctggcgag ctgatttcta tctttgctat cggccctttt cgcgtgtaat    253860
     ctgtgttgtg cctctgtgcg ctagagaagc tgttttcccc ctccttcgtt cgtccgccct    253920
     ggccgtttca actcgttgat actgctatct agcccccctc ccacctcttt aactccaact    253980
     tcttccttca ccatcacctt tcacatccaa cctctttctt ccagagtgag agcagggtag    254040
     ctggtatacc aaccacaatc atgcttcctc tccgagcatt gcgatcttcc tccctccggg    254100
     cggccgccaa ggctcccctc gcccgcggtt atgccaccac cgtcgccgag gaggctgccg    254160
     aaatctctcc ctctctcttc gacaagaagg tcgagatgtc cgtcgtcgag aagggcaagg    254220
     gctactacgt caactacaag cgcatcgagg acaaccttaa ggtcgttcgt cagcggtaag    254280
     tgttacctcc ctttcatgct ttcgttactt gcacagcaaa accatcagaa cagcagccgc    254340
     ctgtgacgta ccaacaacat gcctttttag gaccgagcgg acgattcagc aagctagtgt    254400
     ccgaagcgca ggcacaatat gcgaacggac cgcactttct gctgcgtctc ttttcacgtt    254460
     tcaggcttag aacgtggagt ttcgcttttg gagatgcgca gaatagcttg ttcattgcct    254520
     gcgcaaggtg tactgagctt gcgactgcaa gtccgatctg tcctgaattg caaaagcctg    254580
     atcgtcagac tggctttggc acaaagttgc ccgctgcttc agcctaagct cgttcgaatc    254640
     tttcagaaga gcgtgtcaac atatattttg cgaacacgtg tactaatact tctttacgcc    254700
     tcttttctga ttctcctcat ctgcagtctc aaccgacctc tctcgctcgc cgagaagatc    254760
     gtctatggtc acttggacaa cccccatgag caggagatct cgcgtggtaa ctcgtacctc    254820
     aagcttcgcc ctgatcgtgt tgcttgccag gatgccaccg cccagatggc tctgctccag    254880
     ttcatgtcgg ctggtctccc caccgtcgct gtccccacca ctgttcactg tgaccatctt    254940
     atcgaggctc aggtcggcgg tgccaaggac ttggcccgtg ctatcgagat taacaaggag    255000
     gtctacgact tccttgccac tgccaccgcc aagtatggta ttggcttctg gaggcccggt    255060
     tccggtatta tccaccagat catcctcgag aactacgcct tccccggtgg tctcatgatt    255120
     ggtactgact cgcacacccc caacgctggt ggtctcggca tgatcgcctg tggtgtcggt    255180
     ggtgctgacg ctgtcgacgt catggctgac attccctggg agctcaaggc ccccaaggtt    255240
     atcggtgtcg agctcaaggg caagatgtcg ggctggacaa ctcccaagga tgtcatcctc    255300
     aaggtggccg gtgagcttac cgtcaagggt ggtaccggtg ccatcatcga gtacaagggt    255360
     cccggtgtcg agtcgctctc gtgcactggt atggccacca tctgcaacat gggtgccgag    255420
     attggtgcca ctacctccgt cttcccctac aacgagcgca tgggcgacta cctgcgggcc    255480
     accaaccgat ccgagatcgc cgacctcgcc aagggcttcc accgcaacct cctcccagac    2555