(data stored in ACNUC7421 zone)

HOGENOMDNA: VIBCM_1

ID   VIBCM_1; SV 1; empty ; DNA; empty ; PRO; 2892523 BP.
XX
AC   NC_012578;
XX
PR   Project: 59355;
XX
DE   Vibrio cholerae M66-2 chromosome I, complete genome.
XX
OS   Vibrio cholerae M66-2
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RP   1-2892523
RX   PUBMED; 19115014.
RA   Feng,L., Reeves,P.R., Lan,R., Ren,Y., Gao,C., Zhou,Z., Ren,Y., Cheng,J.,
RA   Wang,W., Wang,J., Qian,W., Li,D. and Wang,L.;
RT   "A recalibrated molecular clock and independent origins for the cholera
RT   pandemic clones";
RL   PLoS ONE 3 (12), E4053 (2008)
XX
RN   [2]
RP   1-2892523
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (20-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2892523
RA   Wang,L., Feng,L., Reeves,P., Lan,R., Ren,Y., Gao,C., Zhou,Z., Ren,Y. and
RA   Wang,W.;
RT   "Direct Submission";
RL   Submitted (21-NOV-2008) TEDA School of Biological Sciences and
RL   Biotechnology, Nankai University, Hongda Street, TEDA, Tianjin, Tianjin
RL   300457, The People's Republic of China
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001233.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2892523
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:579112"
FT                   /collection_date="1937"
FT                   /country="Indonesia: Makassar"
FT                   /serotype="O1"
FT                   /strain="M66-2"
FT                   /organism="Vibrio cholerae M66-2"
FT                   /chromosome="I"
FT   gene            complement(235..402)
FT                   /db_xref="GeneID:7774083"
FT                   /locus_tag="VCM66_0001"
FT   CDS_pept        complement(235..402)
FT                   /locus_tag="VCM66_0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227080238"
FT                   /db_xref="GeneID:7774083"
FT                   /translation="MAQTRHQSLLNNDLFHAERLNAALFFGLWINLTVVKKLIDAFSIK
FT                   SHVDNYTIIR"
FT                   /protein_id="YP_002808789.1"
FT   gene            complement(372..806)
FT                   /db_xref="GeneID:7771300"
FT                   /locus_tag="VCM66_0002"