(data stored in ACNUC7421 zone)

HOGENOMDNA: VIBCM_2

ID   VIBCM_2; SV 1; empty ; DNA; empty ; PRO; 1046382 BP.
XX
AC   NC_012580;
XX
PR   Project: 59355;
XX
DE   Vibrio cholerae M66-2 chromosome II, complete genome.
XX
OS   Vibrio cholerae M66-2
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RP   1-1046382
RX   PUBMED; 19115014.
RA   Feng,L., Reeves,P.R., Lan,R., Ren,Y., Gao,C., Zhou,Z., Ren,Y., Cheng,J.,
RA   Wang,W., Wang,J., Qian,W., Li,D. and Wang,L.;
RT   "A recalibrated molecular clock and independent origins for the cholera
RT   pandemic clones";
RL   PLoS ONE 3 (12), E4053 (2008)
XX
RN   [2]
RP   1-1046382
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (20-APR-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-1046382
RA   Wang,L., Feng,L., Reeves,P., Lan,R., Ren,Y., Gao,C., Zhou,Z., Ren,Y. and
RA   Wang,W.;
RT   "Direct Submission";
RL   Submitted (21-NOV-2008) TEDA School of Biological Sciences and
RL   Biotechnology, Nankai University, Hongda Street, TEDA, Tianjin, Tianjin
RL   300457, The People's Republic of China
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001234.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..1046382
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:579112"
FT                   /collection_date="1937"
FT                   /country="Indonesia: Makassar"
FT                   /serotype="O1"
FT                   /strain="M66-2"
FT                   /organism="Vibrio cholerae M66-2"
FT                   /chromosome="II"
FT   gene            complement(112..246)
FT                   /db_xref="GeneID:7781299"
FT                   /locus_tag="VCM66_A0001"
FT   CDS_pept        complement(112..246)
FT                   /locus_tag="VCM66_A0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811635"
FT                   /db_xref="GeneID:7781299"
FT                   /translation="MNPAHHFNQNGIHRNLVARFNRSAYGSLLFIHHHFKTWLYIVNK"
FT                   /protein_id="YP_002811645.1"
FT   gene            1134..3110
FT                   /db_xref="GeneID:7781300"
FT                   /locus_tag="VCM66_A0002"
FT   CDS_pept        1134..3110
FT                   /locus_tag="VCM66_A0002"
FT                   /gene_family="HOG000218516" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811636"
FT                   /db_xref="GeneID:7781300"
FT                   /translation="MSSEEKRLIKLPRTHKDGHLFEVSEAAIDWIEQYQHFKGVTKSIV
FT                   ELLNLISLRGLRSRDGLVSTTELIDATDGQLTRAAIQQRLRAAVAVGLFKQIPVRFEEG
FT                   LAGKTMLHRFINPNQLISVLGSTSLVTESVKQNEKQKRSKALAQTQVNQRLLHEHGLNT
FT                   PPAMKDEADQFVVSPTNWAGIIDQALAPPRTRKSYQKSMVSISGTRAVIETRSSKNIMT
FT                   VDDLMTLFALFTLTVQYHDHHQDDYHFNAKQAPNKTPLYITDILSLRGKKDSGPARDSI
FT                   RDSIDRIEFTDFQLHELTGRWLSENMPEGFKSDRFRFLARTITASEEAPVEGSDGEIRI
FT                   KPNLYILVWEPSFFEELLTRDYFFLFPPEILKQHTLVFQLYSYFRSRMSRRHTDVMMLS
FT                   ELNQKLARNIEWRRFSMDLIRELRRLSEGKGSEDLFVVNLWGYHLTVKSIEEKGKVVDY
FT                   QVDIKCDVEEVLRYSRAKTTNAGKRNMAPTLPNPLRNELVSKQKLAELSSIIDGEFEPI
FT                   QRKAPSPRGRLGRRVKLRKHLVEINADEITITLSRYTSPEALERSITALAAMTGHAPSS
FT                   IKEECVELIDKLDWLRVENDVIQYPTLSKLLELYNSQNESKHLSIEKLIAGLAVRRKVC
FT                   KLVQDGHIDETVYRALDEMAAGA"
FT                   /protein_id="YP_002811646.1"
FT   misc_feature    2001..2675
FT                   /note="Protein of unknown function (DUF3346); Region:
FT                   DUF3346; pfam11826"
FT                   /db_xref="CDD:152262"
FT                   /locus_tag="VCM66_A0002"
FT   gene            complement(3330..3944)
FT                   /db_xref="GeneID:7781301"
FT                   /locus_tag="VCM66_A0003"
FT   CDS_pept        complement(3330..3944)
FT                   /locus_tag="VCM66_A0003"
FT                   /gene_family="HOG000218264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811637"
FT                   /db_xref="GeneID:7781301"
FT                   /translation="MIFPFPYQEYMANIAFVNHTTRMKAWHQPYGLLQIVDLMGSTLFL
FT                   MIETYGMNELQHWLHTIHHWYQHNDCAAVAELQPLIFGAPQALWQPALNSTQSKAIACW
FT                   LDACLRQFEFYRETDTEKALQYLNLAYGRFQLCAAQPECDLELKSWCLLRMQQLMVLSL
FT                   EHLNHQVGGESQSHALIDAHVRFMAFHAWNDDQGTRDPMRG"
FT                   /protein_id="YP_002811647.1"
FT   gene            4154..4351
FT                   /db_xref="GeneID:7781302"
FT                   /locus_tag="VCM66_A0004"
FT   CDS_pept        4154..4351
FT                   /locus_tag="VCM66_A0004"
FT                   /gene_family="HOG000218263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811638"
FT                   /db_xref="GeneID:7781302"
FT                   /translation="MSINSIDHDDMTNIANKWDSIEEIESQRPTKNLKSAEARRRIETL
FT                   REIRESGLTIEEAKELGLLH"
FT                   /protein_id="YP_002811648.1"
FT   gene            4445..4723
FT                   /db_xref="GeneID:7781303"
FT                   /locus_tag="VCM66_A0005"
FT   CDS_pept        4445..4723
FT                   /locus_tag="VCM66_A0005"
FT                   /gene_family="HOG000218262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811639"
FT                   /db_xref="GeneID:7781303"
FT                   /translation="MTLNFPHSYVIFRPTILLTVGLLMSFNLALLTAAEKNRVELDKQA
FT                   SYLVWRLKQAKAGPEEITKQMAKIASESEKQWFQQSIEKYKRVMGVA"
FT                   /protein_id="YP_002811649.1"
FT   misc_feature    4523..4705
FT                   /note="Protein of unknown function (DUF3283); Region:
FT                   DUF3283; pfam11686"
FT                   /db_xref="CDD:152122"
FT                   /locus_tag="VCM66_A0005"
FT   gene            4811..5530
FT                   /db_xref="GeneID:7781304"
FT                   /locus_tag="VCM66_A0006"
FT   CDS_pept        4811..5530
FT                   /locus_tag="VCM66_A0006"
FT                   /gene_family="HOG000228371" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811640"
FT                   /db_xref="GeneID:7781304"
FT                   /translation="MGRSFEVRKASMAKTQGAKIKVYSKYGKEIYVCAKNGGTDPDMNL
FT                   SLRHLITKAKKDQVPAHVIEKALDKASGGAGEDYQPARYEGFGPGGASVIVDCLTDNGN
FT                   RTYQDVRQCFVKTGAKIGTPGVVAHMFDHQAVFQFQGDDEEAILEALMMADAEVTDIEH
FT                   EDGVITVFAPNTEFFKVKTALNEAFPDLTLDVEEITFVPQNRTVVSGEDAEKFQKFLDM
FT                   LDDCDDVQQVYHNADIE"
FT                   /protein_id="YP_002811650.1"
FT   misc_feature    4811..5521
FT                   /note="Domain of unknown function DUF28; Region: DUF28;
FT                   cl00361"
FT                   /db_xref="CDD:174146"
FT                   /locus_tag="VCM66_A0006"
FT   gene            5573..6520
FT                   /db_xref="GeneID:7781305"
FT                   /locus_tag="VCM66_A0007"
FT   CDS_pept        5573..6520
FT                   /locus_tag="VCM66_A0007"
FT                   /gene_family="HOG000219608" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative 3-hydroxyisobutyrate dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811641"
FT                   /db_xref="GeneID:7781305"
FT                   /translation="MGYQHPTFSAKSFGYKNKNHKENKMRVSFIGLGVMGYPMAGHLQK
FT                   AGFDVTVFNRTQAKAVAWAKQFGGQYAETVAECVKNADVVLTCVGNDDDVRSMTTAATG
FT                   AIPAMKPGAVLIDHTTTSALLAEELSAAAQQAGLHFMDAPVSGGQAGAENGVLTIMCGG
FT                   DEALFAKMQPIFAAYGRSSVLMGAAGQGQRAKMVNQICIAGVLNGLSEGLMLAEQAGLD
FT                   IPNLVACLKNGAAGSWQMENRALTMSQEKFDFGFAIDWMIKDLGFCLDEAAQLGLRLPM
FT                   TENTMTAYQRLSAQGLGRMDTSVLIQAIKEAAKK"
FT                   /protein_id="YP_002811651.1"
FT   misc_feature    5645..6502
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="VCM66_A0007"
FT   misc_feature    <5648..>5842
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176935"
FT                   /locus_tag="VCM66_A0007"
FT   misc_feature    order(5669..5677,5732..5737,5834..5839)
FT                   /note="NAD(P) binding pocket; other site"
FT                   /db_xref="CDD:133449"
FT                   /locus_tag="VCM66_A0007"
FT   gene            complement(6624..8285)
FT                   /db_xref="GeneID:7781306"
FT                   /locus_tag="VCM66_A0008"
FT   CDS_pept        complement(6624..8285)
FT                   /locus_tag="VCM66_A0008"
FT                   /gene_family="HOG000148080" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811642"
FT                   /db_xref="GeneID:7781306"
FT                   /translation="MSLTIRQRLYILSLVPLLTIALSMMYVTFNETSKLSQEQMRNTRE
FT                   AMMEMKQTELKSYLQIADTALNALKSRQAPLEEALAILREIEFANSGYLFGYDSKGTRL
FT                   LLGKATNGLGDNFMNMQDTQGNYLIQDLLKNAKLNQFTTYYFPKPGEQTPLPKLSYSVY
FT                   LPQWDLTIGTGFYTDDVDAEIAEMEARAEEQLEQGLYTLAGITLLIVILVSVMAIMINR
FT                   SIMRPLELFDNSISSFASGDADLTARMEKFSVPEFHKLSHNFNRFVESLQNIIKRVNQV
FT                   GQQVVEETNAMSQRATQVDHLASNQREETEQVATAMTEMTTTAQEISNNANNAAQSAKD
FT                   AEDNATDVHNIVNAAARSVQALAEEVADASSVIAKLEGDVNNITSSLAVIQDIAEQTNL
FT                   LALNAAIEAARAGEQGRGFAVVADEVRKLASRTQESTQQIHTMIQQLKAGSDAAVKAME
FT                   SSQQRSITTVREANAAAEALQKIQASIGTIMDMNALIATATEEQSIVGQEISQRIVVIS
FT                   DQSSESADLANQNRQGSQTLNGRAHELYELVARFKV"
FT                   /protein_id="YP_002811652.1"
FT   misc_feature    complement(<7608..8279)
FT                   /note="Signal transduction histidine kinase [Signal
FT                   transduction mechanisms]; Region: COG4564"
FT                   /db_xref="CDD:34202"
FT                   /locus_tag="VCM66_A0008"
FT   misc_feature    complement(7896..8156)
FT                   /note="Cache domain; Region: Cache_2; pfam08269"
FT                   /db_xref="CDD:149365"
FT                   /locus_tag="VCM66_A0008"
FT   misc_feature    complement(7467..7682)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cl01054"
FT                   /db_xref="CDD:154171"
FT                   /locus_tag="VCM66_A0008"
FT   misc_feature    complement(6627..7229)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="VCM66_A0008"
FT   gene            8484..8921
FT                   /db_xref="GeneID:7781307"
FT                   /locus_tag="VCM66_A0010"
FT   CDS_pept        8484..8921
FT                   /locus_tag="VCM66_A0010"
FT                   /gene_family="HOG000293716" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:227811643"
FT                   /db_xref="GeneID:7781307"
FT                   /translation="MSDGRCLSISKESVLYSAPFQFDRATIMNLKTDIQQLNNRIDTCR
FT                   CKLDAAKSRADSEMVSKFTDELEALTKRLNSVKGKQDYDLNKMRKTIADMPFSRELTKL
FT                   EQADLGKLKKSVKGLVIVHPTTKIGKALRVEVMTGFAPKPF"
FT                   /protein_id="YP_002811653.1"
FT   misc_feature    8565..8918
FT                   /note="Protein of unknown function (DUF2810); Region:
FT                   DUF2810; cl08159"
FT                   /db_xref="CDD:174965"
FT                   /locus_tag="VCM66_A0010"
FT   gene            complement(8987..11737)
FT                   /db_xref="GeneID:7781308"
FT                   /locus_tag="VCM66_A0011"