(data stored in ACNUC8465 zone)

HOGENOMDNA: VIVUL2_1

ID   VIVUL2_1; SV 1; empty ; DNA; empty ; PRO; 3194232 BP.
XX
AC   NC_014965;
XX
PR   Project: 62243;
XX
DE   Vibrio vulnificus MO6-24/O chromosome chromosome I, complete sequence.
XX
OS   Vibrio vulnificus MO6-24/O
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RP   1-3194232
RA   Park,J.H., Cho,Y.-J., Lee,J.K., Chun,J., Kim,K.-S., Lee,K.-H., Park,S.-J.,
RA   Seok,Y.-J. and Choi,S.H.;
RT   "Complete Genome Sequence of Vibrio vulnificus M06-24/O";
RL   Unpublished
XX
RN   [2]
RP   1-3194232
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (25-JAN-2011) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3194232
RA   Park,J.H., Cho,Y.-J., Lee,J.K., Chun,J., Kim,K.-S., Lee,K.-H., Park,S.-J.,
RA   Seok,Y.-J. and Choi,S.H.;
RT   "Direct Submission";
RL   Submitted (03-DEC-2010) Center for Food Safety and Toxicology, Department
RL   of Food Science and Biotechnology, Seoul National University, 599
RL   Gwanak-ro, Gwanak-gu, Seoul 151-921, South Korea
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002469.
CC   Source DNA and bacteria are available from the National Research
CC   Laboratory of Molecular Microbiology and Toxicology, Center for
CC   Food Safety and Toxicology, Department of Food Science and
CC   Biotechnology, Seoul National University, Seoul 151-921, S. Korea.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3194232
FT                   /strain="MO6-24/O"
FT                   /mol_type="genomic DNA"
FT                   /organism="Vibrio vulnificus MO6-24/O"
FT                   /chromosome="I"
FT                   /db_xref="taxon:914127"
FT   gene            117..2015
FT                   /db_xref="GeneID:10167771"
FT                   /locus_tag="VVM_00001"
FT   CDS_pept        117..2015
FT                   /locus_tag="VVM_00001"
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154847"
FT                   /db_xref="GeneID:10167771"
FT                   /translation="MLYHETFDVIVVGGGHAGTEAALASARTGQKTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEVDAMGGLMAQAIDHAGIQFRTLNASKGPAVRATRAQADRALY
FT                   KAYVRDFLENAPNLTLFQQAVDDLIVEQDQVRGVITQMGLKFHAKAVVLTVGTFLGGKI
FT                   HIGLQSSSGGRAGDPPSIALADRLRELPFRVDRLKTGTPPRIDARSVDFSVLEAQHGDN
FT                   PTPVFSFMGDRTHHPRQIPCFITHTNEQTHEVIRNNLDRSPMYAGIIEGIGPRYCPSIE
FT                   DKVMRFADKNSHQIFIEPEGLTTHELYPNGISTSLPFDVQVQIVRSMKGFENAHIVRPG
FT                   YAIEYDFFDPRDLKQTYETKFIQGLFFAGQINGTTGYEEAAAQGLMAGLNASLFSQEKE
FT                   GWSPRRDQAYMGVLIDDLSTMGTKEPYRMFTSRAEHRLLLREDNADLRLTEKARELGLV
FT                   DDARWARFNQKIDNMEQERQRLKSTWMNPASTGIEELNQLLKSPMNREASGEDLLRRPE
FT                   MTYEQLTSLAAFAPALDDLEAAEQVEIQVKYEGYIKRQQDEIEKSLRHEHTKLPVDLDY
FT                   SEVKGLSNEVVLKLNTAKPETLGIASRISGITPAAISILLVHLKKIGMLKVGEENA"
FT                   /protein_id="YP_004187226.1"
FT   gene            2012..2647
FT                   /db_xref="GeneID:10164697"
FT                   /locus_tag="VVM_00003"
FT   CDS_pept        2012..2647
FT                   /locus_tag="VVM_00003"
FT                   /gene_family="HOG000221012" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rRNA small subunit methyltransferase, glucose
FT                   inhibited division protein GidB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154848"
FT                   /db_xref="GeneID:10164697"
FT                   /translation="MSALRQKLDALIEQTDLQVNERQREQLLGYVELLNKWNKAYNLTS
FT                   VRDPQDMLVKHILDSIVVAPHLDGERFIDVGTGPGLPGIPLAIMHPEKTFFLLDSLGKR
FT                   IRFIKQVLHELKIENVTTVQSRVEEFQPEEKFDGVLSRAFASMTDMVEWCHHLPKTGQG
FT                   VFLALKGLHPKDEIDQLPEWCSVTEIISLTVPELEGDRHLVILSRKDN"
FT                   /protein_id="YP_004187227.1"
FT   gene            2658..3431
FT                   /db_xref="GeneID:10164698"
FT                   /locus_tag="VVM_00004"
FT   CDS_pept        2658..3431
FT                   /locus_tag="VVM_00004"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome (plasmid) partitioning protein
FT                   ParA/Sporulation initiation inhibitor protein Soj"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154849"
FT                   /db_xref="GeneID:10164698"
FT                   /translation="MGKIVAIANQKGGVGKTTTCVNLAASMAATKRKVLVIDLDPQGNA
FT                   TMASGVDKYMVDATAYDLLVEETPFDQVVCKTTTGKYDLIAANGDVTAAEIKLMEVFAR
FT                   EVRLKNALASVRDNYDFIFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMD
FT                   TISKLAAVVNDKLKIEGLLRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEA
FT                   PSHGKPAMYYDKHSAGSKAYLALAGEMLRREEIPV"
FT                   /protein_id="YP_004187228.1"
FT   gene            3456..4337
FT                   /db_xref="GeneID:10164699"
FT                   /locus_tag="VVM_00006"
FT   CDS_pept        3456..4337
FT                   /locus_tag="VVM_00006"
FT                   /gene_family="HOG000088074" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome (plasmid) partitioning protein
FT                   ParB/Stage 0 sporulation protein J"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154850"
FT                   /db_xref="GeneID:10164699"
FT                   /translation="MSKRGLGKGLDALLSTSSLAREKQHIATQSQALSAEGELTDIAVG
FT                   QLQPGVYQPRKDMSPQALEELTASIQSQGIIQPIVVRPVQDGHFEIIAGERRWRAAKLA
FT                   GLKRVPCLIKHVEDRAAIAMALIENIQREDLNVIEEAQALERLQDEFSLTHQQVADVIG
FT                   KSRTAVSNLLRLNGLELEVKQFVAQKLLDMGHARALLALEGEQQVEVAQQVASKALTVR
FT                   QTEQLVKKCLTPKVEEKNQPKDEETQQISQKLSETLGAKVSLVRNGNGKAKLTISIDEP
FT                   HKLEQLIAKLES"
FT                   /protein_id="YP_004187229.1"
FT   gene            4578..4916
FT                   /db_xref="GeneID:10164700"
FT                   /locus_tag="VVM_00008"
FT   CDS_pept        4578..4916
FT                   /locus_tag="VVM_00008"
FT                   /gene_family="HOG000253861" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP synthase protein I"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154851"
FT                   /db_xref="GeneID:10164700"
FT                   /translation="MIESGAVIFVAAGVALAVNAEWGFSSLIGGGIFVVANAVFSVCAF
FT                   LFVGARASKYVAISFYTGEALKILITVVLFSVAYMYMQVELVPLKLTYLLVLGINIFAP
FT                   ALFINNKK"
FT                   /protein_id="YP_004187230.1"
FT   gene            4925..5737
FT                   /db_xref="GeneID:10164701"
FT                   /locus_tag="VVM_00011"
FT   CDS_pept        4925..5737
FT                   /product="ATP synthase subunit A"
FT                   /gene_family="HOG000253872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00011"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154852"
FT                   /db_xref="GeneID:10164701"
FT                   /translation="MAAPGEALTPSGYITHHLTNLSTYKLGLVAEESSFWNVHIDSLFF
FT                   SWFTGLIFLGIFYAVARKTTAGVPGKLQCAVEMIVEFVATNVKDTFHGRNPLIAPLALT
FT                   IFCWVFLMNLMDLVPIDFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSI
FT                   KVKGLGGFARELALHPFNHWTMIPFNLLIEVVSLLAKPLSLGMRLFGNMFAGEVVFILC
FT                   AAMLPWYLQWMGSLPWAIFHILVILIQAFVFMMLTIVYMSMAHEDSDH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187231.1"
FT   gene            5790..6047
FT                   /db_xref="GeneID:10164702"
FT                   /locus_tag="VVM_00014"
FT   CDS_pept        5790..6047
FT                   /product="ATP synthase subunit C"
FT                   /gene_family="HOG000235244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00014"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154853"
FT                   /db_xref="GeneID:10164702"
FT                   /translation="METVLSFSAIAVAIIVGLCALGTAVGFAVLGGKFLEGAARQPEMA
FT                   PMLQVKMFIIAGLLDAVPMIGIVIALLFTFANPFVGQLAG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187232.1"
FT   gene            6125..6589
FT                   /db_xref="GeneID:10164703"
FT                   /locus_tag="VVM_00015"
FT   CDS_pept        6125..6589
FT                   /product="ATP synthase subunit B"
FT                   /gene_family="HOG000015378" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00015"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154854"
FT                   /db_xref="GeneID:10164703"
FT                   /translation="MNATLLGQAISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAA
FT                   ERAAKDLDLAQANASSQLKEAKRTATEIIEQANKRKAQILDEAREDAQTERQKILAQAE
FT                   AQLEAERNRARDELRKQVATLAVAGAEKILERSIDKDAHKDILDNITAKL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187233.1"
FT   gene            6604..7137
FT                   /db_xref="GeneID:10164704"
FT                   /locus_tag="VVM_00016"
FT   CDS_pept        6604..7137
FT                   /product="ATP synthase subunit delta"
FT                   /gene_family="HOG000075824" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00016"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154855"
FT                   /db_xref="GeneID:10164704"
FT                   /translation="MADFTTIARPYAKAAFDFAVEKGQLDQWGQMLSFAAEVAQNEQIS
FT                   ELLSGSMSADKLAELFIAICGEQVDEFGQNLLKVMAENGRLAALPDVCTLFFVLKKEHE
FT                   KEIDVEVISATELSDEQCANISQKLEQRLERKVKLNCSVDEALLGGVIIRAGDLVIDNS
FT                   ARGRLNRLSDALQS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187234.1"
FT   gene            7151..8692
FT                   /db_xref="GeneID:10164705"
FT                   /locus_tag="VVM_00017"
FT   CDS_pept        7151..8692
FT                   /product="ATP synthase subunit alpha"
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00017"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154856"
FT                   /db_xref="GeneID:10164705"
FT                   /translation="MQLNSTEISDLIKQRIESFNVVSEARNEGTIVSVSDGIIRIHGLA
FT                   DVMQGEMIELPGGRYALALNLERDSVGAVVMGPYADLKEGMKVTGTGRILEVPVGPELL
FT                   GRVVNTLGEPIDGKGPIEAKLTSPVEVIAPGVIDRQSVDQPVQTGYKSVDSMIPIGRGQ
FT                   RELIIGDRQTGKTAMAIDAIINQKNSGIFSIYVAIGQKASTIANVVRKLEEHGALKNTI
FT                   VVVASASESAALQYLAPYAGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPP
FT                   GREAFPGDVFYLHSRLLERAARVNAEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLQTELFNAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTALAA
FT                   YRELAAFAQFSSDLDEATKRQLNHGQKVTELMKQKQYAPMSVFDQALTIFAAERGYLSD
FT                   IELSKVLDFEAALLSYARGQYAELAAEIDKTGAYNDEIEAQLKKLTDDFKATQTW"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187235.1"
FT   gene            8736..9602
FT                   /db_xref="GeneID:10164706"
FT                   /locus_tag="VVM_00020"
FT   CDS_pept        8736..9602
FT                   /product="ATP synthase subunit gamma"
FT                   /gene_family="HOG000215912" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00020"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154857"
FT                   /db_xref="GeneID:10164706"
FT                   /translation="MAGAKEIRSKIGSVKSTQKITKAMEMVAASKMRRSQDAMEASRPY
FT                   AETMRKVIGHVANASLEYRHPYLDEREAKRVGYIIISTDRGLCGGLNINVFKKAVTDMQ
FT                   AWKEKGADVELAVIGSKATAFFKHGGAKVAAQVSGLGDSPSLEDLIGSVSVMLEKYDEG
FT                   ELDRLYLVFNKFVNTMVQQPTIDQLLPLPKSDSKDMQREHSWDYIYEPEPQALLDALLV
FT                   RYVESQVYQGVVENLACEQAARMVAMKAATDNATNLIDDLELVYNKARQAAITQELSEI
FT                   VGGAAAV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187236.1"
FT   gene            9638..11041
FT                   /db_xref="GeneID:10164707"
FT                   /locus_tag="VVM_00022"
FT   CDS_pept        9638..11041
FT                   /product="ATP synthase subunit beta"
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00022"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154858"
FT                   /db_xref="GeneID:10164707"
FT                   /translation="MATGKIVQIIGAVVDVEFPQSDVPSVYDALNVKDSKERLVLEVQQ
FT                   QLGGGVVRCIVMGSSDGLRRGVEVVNTGAPISVPVGTKTLGRIMNVLGDAIDERGEIGA
FT                   EELYSIHRPAPSYEEQSNATELLETGVKVIDLICPFAKGGKIGLFGGAGVGKTVNMMEL
FT                   INNIALQHSGLSVFAGVGERTREGNDFYHEMQEAGVVNIEKPEESKVAMVYGQMNEPPG
FT                   NRLRVALTGLTMAERFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAE
FT                   EMGVLQERITSTKQGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLNRNIAAMGLYP
FT                   AIDPLDSTSRQLDPLVVGQEHYDTARGVQQTLQRYKELKDIIAILGMDELSESDKQVVA
FT                   RARKIERFLTQPYHVAEVFTGDPGVYVPLKETLRGFKGLLAGEYDDIPEQAFMYCGTID
FT                   EAIENAKKL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187237.1"
FT   gene            11060..11482
FT                   /db_xref="GeneID:10164708"
FT                   /locus_tag="VVM_00026"
FT   CDS_pept        11060..11482
FT                   /product="ATP synthase subunit epsilon"
FT                   /gene_family="HOG000216025" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00026"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="GI:320154859"
FT                   /db_xref="GeneID:10164708"
FT                   /translation="MAAITFHLDVVSAEKKIFSGRVETFQVTGSEGELGIFHGHTPLLT
FT                   AIKPGMVRIVKLHGEEEFIYVSGGIVEVQPGTATVLADTAIRGEELDAAKAEEAKRRAK
FT                   ENILNQHGDMDFAQAASELAKAIAQLRVIELTKKRR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187238.1"
FT   gene            11683..12999
FT                   /db_xref="GeneID:10164709"
FT                   /locus_tag="VVM_00027"
FT   CDS_pept        11683..12999
FT                   /product="N-acetylglucosamine-1-phosphate
FT                   /gene_family="HOG000283476" [ FAMILY / ALN / TREE ]
FT                   uridyltransferase/Glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00027"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="GI:320154860"
FT                   /db_xref="GeneID:10164709"
FT                   /translation="MYSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVYGHGGDQMQ
FT                   AALAEEPVNWVLQAEQLGTGHAVDQASPQFEDDEKILVLYGDVPLISSETIESLLDAQP
FT                   KGGIALLTVVLDNPTGYGRIVRKNGPVVAIVEQKDANEEQKLIKEINTGVMVATGGDLK
FT                   RWLAGLNNDNAQGEYYLTDVIAAAHDEGNAVEAVHPVSPIEVEGVNDRAQLARLERAFQ
FT                   AAQAKKLLEQGVMLRDPARFDLRGELQCGLDVEIDVNVIIEGNVSLGDNVVIGAGCVLK
FT                   DCEIDDNTIVRPYSVIEGATVGEQCTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGEG
FT                   SKANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPLTIAD
FT                   GATIGAGTTLTKDVAEGELVITRAKERKVTGWQRPVKKK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187239.1"
FT   gene            complement(13060..13776)
FT                   /db_xref="GeneID:10164710"
FT                   /locus_tag="VVM_00031"
FT   CDS_pept        complement(13060..13776)
FT                   /locus_tag="VVM_00031"
FT                   /gene_family="HOG000267552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative amino acid ABC transporter permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154861"
FT                   /db_xref="GeneID:10164710"
FT                   /translation="MMLLPLTGCSDYQWGWYVLDPTTEQGLTNVKFLIAGFADTISVSL
FT                   LSMLFAMTLGLMVALPALSPRKSLQRLNRIYVEVIRAIPVLVLLLWVYYGLPTLLDVSL
FT                   DHYWAGIIALTIAESAFMAEVFRGGIQSIGRGQHEAAKSLGLNYWQKMRLVILPQAFRQ
FT                   MLPALGNQFVYILKMSSLVSVIGLSDLTRRANELVVNEYLPLEIYTFLVLEYLLLILMV
FT                   SQAVRWLEKRSAIPSH"
FT                   /protein_id="YP_004187240.1"
FT   gene            13908..14684
FT                   /db_xref="GeneID:10164711"
FT                   /locus_tag="VVM_00032"
FT   CDS_pept        13908..14684
FT                   /product="cyclohexadienyl dehydratase"
FT                   /gene_family="HOG000253885" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00032"
FT                   /EC_number="4.2.1.51"
FT                   /EC_number="4.2.1.91"
FT                   /db_xref="GI:320154862"
FT                   /db_xref="GeneID:10164711"
FT                   /translation="MKKTWLALGLGLLAASTLANAQSRLNEILDNGVLRVGTTGDWNPM
FT                   TMKDPANNSYRGFDIDVTTELAKDLGVKVEYVATDWKTLVNGITADKYDITGSASLSMS
FT                   RAKVAGYSQPYFYLAFVPVVQKKDLGKYSDWSDFDKADVKVAATLGTVQEKMVKAFFPS
FT                   AQHIVIEAPARDFQELLAKRADVSVTSNVEAATLVEKFQQLAIVPVKEPRKPTPIAMLL
FT                   PQDDQVWINYVNHWVELKKTQGFFKQTAEKWGLKGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187241.1"
FT   gene            complement(14753..15958)
FT                   /db_xref="GeneID:10164712"
FT                   /locus_tag="VVM_00035"
FT   CDS_pept        complement(14753..15958)
FT                   /locus_tag="VVM_00035"
FT                   /gene_family="HOG000143172" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multidrug resistance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154863"
FT                   /db_xref="GeneID:10164712"
FT                   /translation="MNISKLQLVYLAALSMLGFVATDMYLPAFKAMEIDFMTGPEQIAL
FT                   SLTVFLVGMAVGQLLWGLASDKFGHRNTLAAGLALFTLASLGLAFSDQVWQLLSLRFVQ
FT                   AIGVCAPAVIWQAMVIKRYSSSSQQIFATIMPLVALSPALAPQLGVVLADSFGWHSIFV
FT                   ALTVLGLVLVAATMAQPSVANEPKQSSVKSDIKHLLSSKTYLGNVMMFATASAAFFAYL
FT                   TGMPEIMAQLGYDAKDIGMSFVPQTIAFMVGGYLGKVGVRKFGDEKVLRQLIGLFSVAA
FT                   LLIFIASQWQLTSIWPILAPFCLIAVANGALYPIVVNRALASAKQSPATAAGLQNSLQI
FT                   TVSSLSSALVAALASQAQAVTGIAIVLCMGGLWIGYIVSNKELSQHFTTPDNARVVSDE
FT                   EI"
FT                   /protein_id="YP_004187242.1"
FT   gene            16110..17030
FT                   /db_xref="GeneID:10164713"
FT                   /locus_tag="VVM_00036"
FT   CDS_pept        16110..17030
FT                   /locus_tag="VVM_00036"
FT                   /gene_family="HOG000181313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154864"
FT                   /db_xref="GeneID:10164713"
FT                   /translation="MFSKPSLEMLDTVARLGSFTAAAEVLHKVPSAISYGVRQVEQELG
FT                   VLLFRRLPRKVELTPAGELFIAEARMLLRQMEEVKSQTRRAAQGWQSTLKLTLDNVVKL
FT                   DKLKPLVEDFYREFDFAELQINMEVFNGSWEAIAQGRADIVIGATSAIPVGGDFEVRDM
FT                   GRLDWAFVMSPAHPCVRQQVLTEAFVSQFPAICLDDTSSVLPKRHTGHYPQQRRLLLPN
FT                   WYSAIECLKNGVGVGYMPRHIAMPLINDGVLVEKVLPDDKPLSQCCLVWRKDDNHKLIQ
FT                   WMVDYLGNSHQLHQDWLLSETKRPV"
FT                   /protein_id="YP_004187243.1"
FT   gene            complement(17050..18579)
FT                   /db_xref="GeneID:10164714"
FT                   /locus_tag="VVM_00039"
FT   CDS_pept        complement(17050..18579)
FT                   /product="threonine dehydratase biosynthetic"
FT                   /gene_family="HOG000046975" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00039"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="GI:320154865"
FT                   /db_xref="GeneID:10164714"
FT                   /translation="MSLTQQTGADYLRQILRAPVYEVATVTPLQEMPRLSARIGNNVQI
FT                   KREDRQPVHSFKLRGAYNMVANLSQAQKDAGVIAASAGNHAQGMALSGTRLGIETTIVM
FT                   PRTTPDIKVDAVRGFGGKVVLHGSNFDEAKAEAERLSQEKGYTFVPPFDHPLVIAGQGT
FT                   IGMEMLQQNGHLDHIFVPVGGGGLAAGVAVLVKQLMPEIKVIAVEPEDSACLKAALDAG
FT                   EPVVLDQVSMFADGVAVKRIGDETFRLCQHYIDDHVTVSSDEICAAVKDIFEDTRAIAE
FT                   PSGALALAGLKKYAEKHKLKGHNLGTVLSGANTNFHGLRYVSERCELGEKREGLLAVTI
FT                   PERKGAFFEFCHLIGGRAVTEFNYRYNDDSLANIFVGVRLQNGQEELDGIIRDLREGGY
FT                   PVVDLSEDEMAKLHVRYMIGGKPSKPLKERLYSFEFPEYPGALLKFLSTLGTHWNISLF
FT                   NYRNHGADYGRVLCGFELDESDLSRFSAHLRELGYQCKDVTDNPSYRFFLS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187244.1"
FT   gene            complement(18583..20424)
FT                   /db_xref="GeneID:10164715"
FT                   /locus_tag="VVM_00040"
FT   CDS_pept        complement(18583..20424)
FT                   /product="dihydroxy-acid dehydratase"
FT                   /gene_family="HOG000173155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00040"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="GI:320154866"
FT                   /db_xref="GeneID:10164715"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGVKDEDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDLGQLVAREIEAAGGIAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASMRLNIPVIFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMIQGADPKVSDEQSEQIERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLL
FT                   ATHADRKQLFISAGQRIVELTKRYYEQDDESALPRNIATKAAFENAMALDIAMGGSTNT
FT                   VLHLLAAAQEGEVDFDMTDIDRMSRMVPHLCKVAPSTQKYHMEDVHRAGGVVGILGELN
FT                   RAGLLHNQSKTVLGLTWEEQLAQYDIMLTDSEEVKRFYRAGPAGIRTTQAFSQDCRWDT
FT                   LDDDRAQGCIRTKENAFSQDGGLAVLKGNIALDGCIVKTAGVDESILKFTGPAVVFESQ
FT                   EDAVEGILGGKVKAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKACALLTDGRFS
FT                   GGTSGLSIGHASPEAANGGAIGLVKQGDLIAIDIPNRTISLQVSEQEMAERRAEQDALG
FT                   WKPVSRQREVSFALKAYASMATSADKGAVRDKSKLEG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187245.1"
FT   gene            complement(20437..21375)
FT                   /db_xref="GeneID:10164716"
FT                   /locus_tag="VVM_00042"
FT   CDS_pept        complement(20437..21375)
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /gene_family="HOG000276706" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00042"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="GI:320154867"
FT                   /db_xref="GeneID:10164716"
FT                   /translation="MATKTADYIWFNGKMVPWAEANVHVLTHAMHYGTSVFEGVRCYNT
FT                   PKGPIVFRHQEHAQRLKDSAKIYRFPIPYSVEEIMEATRETLRQNKLDNAYIRPLAFVG
FT                   NVGLGVCPPTDTEMDLIIAAFPWGSYLGEEALENGVDAMVSSWNRAAPNTIPTAAKAGG
FT                   NYLSSLLVGGEARRHGYAEGIALSVDGYLSEGAGENIFVIKNGVITTPPATAAILPGIT
FT                   RDSIMTLAREMGYEVREANIAREALYLADEVFMTGTAAEVVPVRSVDQIQVGAGKRGPI
FT                   TKAVQEAYFGLFNGTTEDKWGWLDYVYPEKK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187246.1"
FT   gene            complement(21387..21671)
FT                   /db_xref="GeneID:10164717"
FT                   /locus_tag="VVM_00044"
FT   CDS_pept        complement(21387..21671)
FT                   /product="acetolactate synthase small subunit"
FT                   /gene_family="HOG000286146" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00044"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="GI:320154868"
FT                   /db_xref="GeneID:10164717"
FT                   /translation="MERYLLDIKADDKPVLLERVLRVIRHRGFVIKQVAATQNHESKVA
FT                   SVEIIVDSDRPISFLTNQIEKLWDIRSVEVMKIRNDELPNNNLQQHVSA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187247.1"
FT   gene            complement(21683..23329)
FT                   /db_xref="GeneID:10164718"
FT                   /locus_tag="VVM_00047"
FT   CDS_pept        complement(21683..23329)
FT                   /product="acetolactate synthase large subunit"
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00047"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="GI:320154869"
FT                   /db_xref="GeneID:10164718"
FT                   /translation="MTGAELVVAALKQQGIKTVFGYPGGAIMPIYDALYDGGVEHILCR
FT                   HEQGAAMAAIGMARATQDVAVCMATSGPGATNLVTGLADAFLDSVPLVAITGQVASSHI
FT                   GTDAFQEMDVIGMSLSCTKHSYLVTDINELAPTLAEAFEVAKTGRPGPVIVDIAKDVQL
FT                   AKAPVELLPPFTPPALPQVSQVDVARAQALLDQSTRPVLYVGGGVQLAKATHTVREFLR
FT                   LNPMPAVSTLKGLGTIERHDPHYLGMLGMHGTKAANLVVQEADLLLVVGARFDDRVTGK
FT                   LETFAPHAKVIHIDIDAAEINKLRHANAPLRGDINVILPQLELTRDISPWVHHCESLRS
FT                   GFKWRYDHPGELIYAPGLLKQLSDLMPDNTIVSTDVGQHQMWAAQHIQPREPQNFITSA
FT                   GLGTMGFGLPAAMGAAVARPDAQSVLISGDGSIMMNIQELGTLKRRQIPVKIVLLNNQR
FT                   LGMVRQWQSLFFDGRHSETILDDNPDFVMLAKAFDIPGKTITKKEEVEPALKEMLASKT
FT                   SYLLHVLIDEEENVWPLVPPGASNSDMLENT"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187248.1"
FT   gene            23799..25322
FT                   /db_xref="GeneID:10164719"
FT                   /locus_tag="VVM_00048"
FT   CDS_pept        23799..25322
FT                   /locus_tag="VVM_00048"
FT                   /gene_family="HOG000246698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Mg(2+) chelatase family protein/ComM-related
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154870"
FT                   /db_xref="GeneID:10164719"
FT                   /translation="MGLAIIHSRASVGVEAPSVSVEVHISNGLPGFTLVGLPETTVKES
FT                   KDRVRSAIVNSNFQFPAKRITVNLAPADLPKEGGRFDLPIALGILAASEQISVQFLQQH
FT                   EFVGELALSGELRAVKGVLPAALAAKGVSRSLVVPHANGDQAALVGKNMHKSACSLIEV
FT                   CAYLCGQQALALHQAPQREKPAQHHRDLQDIIGQQQGKRALEIAAAGNHNLLFLGPPGT
FT                   GKTMLASRLRDLLPEMSEEEAMETAAVASLTQSDINEHNWKQRPFRAPHHSSSMAALVG
FT                   GGTIPRPGEISLAHNGLLFLDEMPEFERKVLDSMREPLESGEIIISRAQGKTRFPARFQ
FT                   LVGALNPSPTGYYEGNQARANPQAILRYLGRLSGPLLDRFDMSLEIPALPKGTLAEGGE
FT                   RGEPTAVVKARVEQARERMQHRNGKVNALLGSREIEAFCPLSKQDAEFLETALHRLGLS
FT                   IRAYHRIIKVARTIADLEGAPQITRAHLAEALGYRAMDRLLKQLTLQAV"
FT                   /protein_id="YP_004187249.1"
FT   gene            complement(25361..26317)
FT                   /db_xref="GeneID:10164720"
FT                   /locus_tag="VVM_00051"
FT   CDS_pept        complement(25361..26317)
FT                   /locus_tag="VVM_00051"
FT                   /gene_family="HOG000252124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154871"
FT                   /db_xref="GeneID:10164720"
FT                   /translation="MKNRILITTALIFSHMAQAGLSDTAGFSGEISLLTGYGASQSHFN
FT                   TETDATISNYSSSASHEGAALFAPLGNIAYTFGQQLEQQFYLGTAREDIAVGTLAFELG
FT                   YQYQLSSGVVIDFSLLPTVMSGETWQDPYLLNQKRTVTDESGIAYRLQFHNLWGGNVNL
FT                   DTAYGTKELEKDTITDPSLKRDGESYYAKLDYRYRLKPTSFVQPAVVYLKHQADGKAAS
FT                   YDSLGAEVSWFNLFAKHRLVLTAGYKVQDYQAASQLFDKKREDQQLSLFLAYEYAQLFS
FT                   SPDWSFVALAGYNQTDSNIEFYEQSDYLLSVGVNYKF"
FT                   /protein_id="YP_004187250.1"
FT   gene            26544..27359
FT                   /db_xref="GeneID:10164721"
FT                   /locus_tag="VVM_00052"
FT   CDS_pept        26544..27359
FT                   /product="putative acyltransferase yihG"
FT                   /gene_family="HOG000284917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00052"
FT                   /EC_number="2.3.-.-"
FT                   /db_xref="GI:320154872"
FT                   /db_xref="GeneID:10164721"
FT                   /translation="MTICLIAIVKLVLPTQGLKAKATDAANKMMWLWATINAVILALFN
FT                   RIEWDIEGGEGLKKEGWYLMISNHLSWTDIVVLCCVFKDRIPMPKFFLKQQLLYVPFIG
FT                   MACWALDMPFMRRYSREYLIRHPEKRGQDLATTRRSCEKFRHTPTTVVNYVEGTRFTTE
FT                   KRKKSNAGYDYLLQPKSGGIAYTLAAMGEQFDHIIDVTLAYPQNTDKPFQDMLMGRMRK
FT                   VVVKIRLLPVDDQVKGDYFNDKPYKRQFQLWLGDVWQEKDQLLKEIHKG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187251.1"
FT   gene            complement(27413..28018)
FT                   /db_xref="GeneID:10164722"
FT                   /locus_tag="VVM_00055"
FT   CDS_pept        complement(27413..28018)
FT                   /locus_tag="VVM_00055"
FT                   /gene_family="HOG000265316" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic thiol:disulfide interchange protein
FT                   DsbA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154873"
FT                   /db_xref="GeneID:10164722"
FT                   /translation="MKKLFAFFSMLLLSLTANAATQFKEGEHYKVLDTQVSKKPMVSEF
FT                   FSFYCPHCNTFEPIIQQLKAQLPEGVKLQKNHVSFMGGAMGPSMSKAYATMIALKVEDK
FT                   MVPVMFNRIHNMRKAPKDDAELRQIFLDEGVDANKFDAAFNGFAVDSMVRRFDKQFKDS
FT                   GLSGVPAVIVNNKYLVQAQGIKTMDEYFELVNFLLKKQ"
FT                   /protein_id="YP_004187252.1"
FT   gene            complement(28051..29037)
FT                   /db_xref="GeneID:10164723"
FT                   /locus_tag="VVM_00056"
FT   CDS_pept        complement(28051..29037)
FT                   /locus_tag="VVM_00056"
FT                   /gene_family="HOG000265894" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YihE protein a ser/thr kinase implicated in LPS
FT                   synthesis and Cpx signaling"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154874"
FT                   /db_xref="GeneID:10164723"
FT                   /translation="MSLGAFNFDALTPDFMWYALESIGIRAESGLLPLNSYENRVYQFT
FT                   DEERRRFVVKFYRPERWTPAQIVEEHQFTQELVENDIPVAAPVNINGATLHHYQGYQFA
FT                   LFNSVGGRQFEVDNLDQLEWVGRFLGRIHQVGAKQRFQHRPSIGLDEYLYQPRALLQQC
FT                   NMIPMHLENSFFQDLDRLIAAIEAQWPKNTQSIRLHGDCHPGNILWRDGPMFVDLDDAR
FT                   NGPAVQDLWMLLNGDRQEKLMQLDILLESYGEFSDFSHQELKLIEPLRGLRMVHYMAWL
FT                   AKRWQDPAFPLAFPWFNEPKYWEGQVLAFKEQIAALEEPPLSLMPQW"
FT                   /protein_id="YP_004187253.1"
FT   gene            complement(29089..30576)
FT                   /db_xref="GeneID:10164724"
FT                   /locus_tag="VVM_00059"
FT   CDS_pept        complement(29089..30576)
FT                   /locus_tag="VVM_00059"
FT                   /gene_family="HOG000284963" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type cbb3 cytochrome oxidase biogenesis protein
FT                   CcoG"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154875"
FT                   /db_xref="GeneID:10164724"
FT                   /translation="MSKVSERKPREIAPLKPKKDQSMSQDKIDIKDVTPKTFNPKTHKG
FT                   KGDRFNPNNRIYVRESKGTFQKLRRYGGWFLLLLFTLTPWISYGDRQAILLDIGSQQFN
FT                   FFGTTLYPQDLTLLALLFMIAAFGLFFITTFLGRVWCGYLCPQTVWTFMYIWFEEKLEG
FT                   SANKRRKQDSGKLTPNLAMRKSAKHVAWFTIALATGFTFVGYFVPVRELVVDFFTFNAS
FT                   FWPVFWVMFFAICTYANAGWMRSIVCLHMCPYARFQSAMFDKDTFIVGYDSQRGEQRGP
FT                   RSRKADPKQLGLGDCIDCDLCVQVCPTGIDIRDGLQYECINCGACIDACNTTMDKMGYE
FT                   KGLINYTTEHRLSGKHTKVMRPKLIGYGLVLLVMLGLFFAQIAAVDPAGLSVIRDRNQL
FT                   FRVNSAGEVENTYTLKIINKTQQVQEYHLDVKGLSEVTWYGKQTIQVNPGEVLNLPLSL
FT                   GVDPEKLSSPISTIQFILDDKSNDFTIEVESRFIKKL"
FT                   /protein_id="YP_004187254.1"
FT   gene            complement(30786..31052)
FT                   /db_xref="GeneID:10164725"
FT                   /locus_tag="VVM_00061"
FT   CDS_pept        complement(30786..31052)
FT                   /locus_tag="VVM_00061"
FT                   /gene_family="HOG000284974" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein YihD"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154876"
FT                   /db_xref="GeneID:10164725"
FT                   /translation="MKCHRIEELLELLEPEWQKDQQMNLLQFIVKLAGEAGYHGKLEEL
FT                   TDDVLIYHLKMRNSAKDEMIPGLKKDQEDDFKTAILRARGIIK"
FT                   /protein_id="YP_004187255.1"
FT   gene            complement(31171..31338)
FT                   /db_xref="GeneID:10164726"
FT                   /locus_tag="VVM_00063"
FT   CDS_pept        complement(31171..31338)
FT                   /locus_tag="VVM_00063"
FT                   /gene_family="HOG000290276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154877"
FT                   /db_xref="GeneID:10164726"
FT                   /translation="MRPTTVRFSHTNRSAMRRRSGFAAAPTSKKTASGMTLVEKNALMP
FT                   QTPAKVVQAA"
FT                   /protein_id="YP_004187256.1"
FT   gene            31655..32464
FT                   /db_xref="GeneID:10164727"
FT                   /locus_tag="VVM_00064"
FT   CDS_pept        31655..32464
FT                   /locus_tag="VVM_00064"
FT                   /gene_family="HOG000294417" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154878"
FT                   /db_xref="GeneID:10164727"
FT                   /translation="MSFLKKTLASFGIGSAKVDSILQQEVLYPGQAANIKVHVYGGSSE
FT                   QEIDNIHLKLCCRYIAEVKEDRGSSSQGQQTRRVPQSHVLASWSLPYAFVIKPSEERVF
FT                   DVALDIPFNTPITIGDAKVWLETGLDIALAIDPTDKDILTVRPDPMMDGIFTALEEQGL
FT                   RIRQVECEEVKGFELPFVQEFEFVPTTGPFHGRWRELEVVAYRSPSELKLWFEIDRHRE
FT                   GGRGMLASLLGLGKLQRELVLPLNLSAKQAGETVLGYLEETTYHSLT"
FT                   /protein_id="YP_004187257.1"
FT   gene            32602..33246
FT                   /db_xref="GeneID:10164728"
FT                   /locus_tag="VVM_00067"
FT   CDS_pept        32602..33246
FT                   /locus_tag="VVM_00067"
FT                   /gene_family="HOG000039438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein hemolysin III-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154879"
FT                   /db_xref="GeneID:10164728"
FT                   /translation="MSVSQYSVREEVANAVTHGLGMIFGIVGLVMLLEKATEHHADGLT
FT                   IASMAIYGSSIIVLFLASTLYHAIPYPKAKRWLKTFDHSAIYLLIAGSYTPFLLVSLRT
FT                   PLAIGLMIVIWSIALLGIIMKVAFVYRFKRFSLVSYLLMGWLSLIVIYQLAISLDIGGL
FT                   TLLAAGGLIYSLGVIFYVAKKIPYNHAIWHCFVLAGCVCHFLAIYLYVNPV"
FT                   /protein_id="YP_004187258.1"
FT   gene            complement(33295..34740)
FT                   /db_xref="GeneID:10164729"
FT                   /locus_tag="VVM_00070"
FT   CDS_pept        complement(33295..34740)
FT                   /locus_tag="VVM_00070"
FT                   /gene_family="HOG000225541" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="potassium uptake protein TrkH"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154880"
FT                   /db_xref="GeneID:10164729"
FT                   /translation="MVNFRPVLFVIGLVLSKLALFMYVPTLVAFFTGTGGFLDFGQAVL
FT                   ITHFAAFVCLSIGRTAHFKLSVRDMFLITSLVWTIASAFAALPFMFINHISFTDAYFET
FT                   MSGITTTGSTVLSGLDNMAPSILLWRSILQWLGGIGFIVMAVAVLPMLNVGGMKLFQTE
FT                   SSDWSDKSSPRAKTVAKNIVVVYLVLTGLCLIGYLLTGMNLFDAINHSFTTLSTGGYST
FT                   SDGSMNHFSNGAHWVATLFMFLGGLPFLLFVSAMRKRRVDALIKDAQVRGFTYLFLGTS
FT                   LVISAWLVIRDGYTIADALRVAMFNIVSVVTTTGFGLEDFTAWGALPTTLFAFLMMAGA
FT                   CSGSTSGGIKIFRFQIAMTLLNKQIMKLIHPSGIFVQRYNQRPVNDDIVRSVVAFGLMF
FT                   FITIIAIAGGLSAMGLDPVTSISGSITAVANVGPGMGSIIGPTGNFAPLPDAAKWLLSF
FT                   GMLMGRLEILTLLVLFFPAFWRR"
FT                   /protein_id="YP_004187259.1"
FT   gene            complement(34750..36126)
FT                   /db_xref="GeneID:10164730"
FT                   /locus_tag="VVM_00073"
FT   CDS_pept        complement(34750..36126)
FT                   /locus_tag="VVM_00073"
FT                   /gene_family="HOG000227130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Trk system potassium uptake protein TrkA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154881"
FT                   /db_xref="GeneID:10164730"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDKDGDRLRELQDKYDL
FT                   RVVNGHASHPDVLHEAGAQDADMLVAVTNTDETNMAACQVAFTLFNTPNRIARIRSPQY
FT                   LAQKEALFKSGAIPVDHLIAPEELVTSYIERLIQYPGALQVVSFAEEKVSLVAVKAYYG
FT                   GPLVGNALSALREHMPHIDTRVAAIFRQGRPIRPQGTTIIEADDEVFFVAASNHIRSVM
FT                   SELQRLEKPYRRIMIVGGGNIGASLAKRLEQTYSVKLIERNLQRAEKLSEELENTIVFC
FT                   GDAADQELLTEENIDQVDVFIALTNEDETNIMSAMLAKRMGAKKVMVLIQRGAYVDLVQ
FT                   GGVIDVAISPQQATISALLTHVRRADIVNVSSLRRGAAEAIEAVAHGDESNSKVVGRAV
FT                   GDIKLPPGTTIGAIVRGEEVLIAHDRTVIEQDDHVVMFLVDKKYVPDVEALFQPSPFFL
FT                   "
FT                   /protein_id="YP_004187260.1"
FT   gene            complement(36183..37463)
FT                   /db_xref="GeneID:10164731"
FT                   /locus_tag="VVM_00075"
FT   CDS_pept        complement(36183..37463)
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /gene_family="HOG000037300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00075"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320154882"
FT                   /db_xref="GeneID:10164731"
FT                   /translation="MNVRAAAANVLYQVVDRGNSLSTALPEAQQSIRPRDHALLQEICY
FT                   GALRYLPRLESIAGKLMDKPLKGKQRVFHHLILVGLYQLGHMRIPAHAAVGETVEGAQA
FT                   LKGPRLRGLINAVLRNYQREQQALDEFSVSHNAGKYVHPSWLLKILQDAYPEQWQTIVE
FT                   ANNNKAPMWLRVNHAHHDRDEYLQLLKNANIDSTLHSEAMDAIKLAAPCDVHSLPGFEQ
FT                   GWVSVQDAAAQLSFNYLQPKDGELILDCCAAPGGKTAHILERVSAREVVALDCDEQRLK
FT                   RVTENLKRLNLQAKVICGDARNPEQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRA
FT                   EDITALAQLQSEIFDAMWAQLKPGGTLVYATCSITPMENVEQVKAFLARTPAAQLVGSE
FT                   RENPGRQILPGEEDMDGFYYAVLVKQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187261.1"
FT   gene            complement(37547..38494)
FT                   /db_xref="GeneID:10164732"
FT                   /locus_tag="VVM_00078"
FT   CDS_pept        complement(37547..38494)
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /gene_family="HOG000261177" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00078"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="GI:320154883"
FT                   /db_xref="GeneID:10164732"
FT                   /translation="MSKPLRIVFAGTPDFAAQHLAALLSSEHEVIAVYTQPDRPAGRGK
FT                   KLTASPVKTIALEHNIPVYQPENFKSDEAKQALADLNADIMVVVAYGLLLPQAVLDTPK
FT                   LGCINVHGSILPRWRGAAPIQRSIWAGDAETGVTIMQMDIGLDTGDMLKIATLPIDASD
FT                   TSATMYDKLAKLGPVALVECLADIAAGTAIAIKQDDERANYAKKLSKEEARINWQDDAE
FT                   HIERCVRAFNPWPMSHFEVAENSIKVWQSRVEASSHDAPAGTILKADKSGIYIATGHGC
FT                   LVLEQIQIPGKKAMPVQDVLNARAAWFEVGSVLS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187262.1"
FT   gene            complement(38526..39038)
FT                   /db_xref="GeneID:10164733"
FT                   /locus_tag="VVM_00079"
FT   CDS_pept        complement(38526..39038)
FT                   /product="peptide deformylase"
FT                   /gene_family="HOG000243509" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00079"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="GI:320154884"
FT                   /db_xref="GeneID:10164733"
FT                   /translation="MSVLQVLTFPDDRLRTVAKPVEKVTPEIQKIVDDMIETMYDEEGI
FT                   GLAATQVDIHQRIVVIDISESRNEPMVLINPEILEKHGEDGIEEGCLSVPGARALVPRA
FT                   AEVTVKALDRDGHEFTLEADDLLAICIQHELDHLQGKLFVDYLSPLKRKRIQDKLAKIK
FT                   RFNEKQR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187263.1"
FT   gene            39177..40274
FT                   /db_xref="GeneID:10164734"
FT                   /locus_tag="VVM_00081"
FT   CDS_pept        39177..40274
FT                   /locus_tag="VVM_00081"
FT                   /gene_family="HOG000270067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154885"
FT                   /db_xref="GeneID:10164734"
FT                   /translation="MNSVLQAASRALLPLLFSVSVAAQESPAPLNIKPDAPQTYVVVKG
FT                   DTLWDISALYLDSPWLWPRLWQINPDIDNPHLIYPGDKLSLVWKNGQPMLSLKPVVTLS
FT                   PKARITEKKAVPTVDEGLVLPYLQSDRLLSKEKLSSVARVMGTSDGRKYLAKDERIFIS
FT                   GQQTETHWAIYRQVQEFERADPDANMIALRVVAQGELKESAQDYSGIEVTSQRQEVLIN
FT                   DIALPQSENLVEELSTTFYPAPAPQDVDAKILGSIDGIDYSAPSQVVILDKGKVDNLRQ
FT                   GHIFELYKASNNVYRSSDSQFSYEKSGSSDEISLPKSRIGELMIIRPYEYFSLALITRS
FT                   TQPISRDILVVAPVQVDESVTAQTP"
FT                   /protein_id="YP_004187264.1"
FT   gene            40274..41377
FT                   /db_xref="GeneID:10164735"
FT                   /locus_tag="VVM_00084"
FT   CDS_pept        40274..41377
FT                   /locus_tag="VVM_00084"
FT                   /gene_family="HOG000003906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rossmann fold nucleotide-binding protein Smf
FT                   possibly involved in DNA uptake"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154886"
FT                   /db_xref="GeneID:10164735"
FT                   /translation="MSQDELHAWLALSFTPNIGVKKLTKLLSIDSPLNILRYSQEQLLS
FT                   LGLSSQQIITLRSSAQQDAEAALQWQQLSSQHHILTLHDGLYPPLLKETASPPCQLFVQ
FT                   GDPHCLTKPQIALVGSRHATMQGLQHARDFAAQLVQHGLVVTSGLALGIDGHAHDGALT
FT                   AGGETVAVLGSGFQHIYPARHKGLAERIGQQGALVSEFRPNTKAKAEHFPRRNRIISGL
FT                   SLGVLVVEAAEKSGSLITARYAAEQGREVFALPNSLHITNARGGNLLIKSGACLVTGVE
FT                   DVLSEVQTLLDWSTNQQADLFSSSNTEEQLPFPQLLANVGNEATPVDILANRTNIPVQE
FT                   VMMQLLELELSGHVVAVNGGYIRRGRG"
FT                   /protein_id="YP_004187265.1"
FT   gene            41380..41859
FT                   /db_xref="GeneID:10164736"
FT                   /locus_tag="VVM_00085"
FT   CDS_pept        41380..41859
FT                   /locus_tag="VVM_00085"
FT                   /gene_family="HOG000137865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154887"
FT                   /db_xref="GeneID:10164736"
FT                   /translation="MMMDILMYLFETYIHSDADLQVDQDELEDELLRAGFHQQDIYKAL
FT                   LWLEELAALQQSDAHSAISRCSAVSSTRVYSPKEMQRLDIECRGFLLFLEQINVLTTET
FT                   REMVIDRVMGLETNEFELEDLKWIILMVLFNVPGNENAYTLMEELLYTKEQGILH"
FT                   /protein_id="YP_004187266.1"
FT   gene            41883..42452
FT                   /db_xref="GeneID:10164737"
FT                   /locus_tag="VVM_00086"
FT   CDS_pept        41883..42452
FT                   /locus_tag="VVM_00086"
FT                   /gene_family="HOG000270078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C-terminal Zn-finger domain of DNA topoisomerase
FT                   I-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154888"
FT                   /db_xref="GeneID:10164737"
FT                   /translation="MSSKIDRTLFSAHEHALEHTPCPQCGGELVLKHGKHGAFLGCNQY
FT                   PRCDYVKPLHQNDGHIVKELGVACPECGNELVLRQGRYGMFVGCSHYPHCHHIEPINQP
FT                   EPEQNPKTLFACPECGKGHLVERKTRFGKTFYACDNYPKCKFAVNLPPVKGHCETCGFP
FT                   LLVEKKLAGGVKLQCASRKCQHTQSR"
FT                   /protein_id="YP_004187267.1"
FT   gene            complement(42517..43650)
FT                   /db_xref="GeneID:10164738"
FT                   /locus_tag="VVM_00088"
FT   CDS_pept        complement(42517..43650)
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   /gene_family="HOG000034026" [ FAMILY / ALN / TREE ]
FT                   subunit"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00088"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="GI:320154889"
FT                   /db_xref="GeneID:10164738"
FT                   /translation="MHVLVLGAGQLARMMSLAGAPLNIQISAYDVTTGDVVHPLTLHLL
FT                   GHGLEQAIEHVDVITAEFEHIPHDVLAICQASGKFLPSSEAIKAGGDRRLEKALLDHAG
FT                   VRNANYYVIETREDFNKAIEHVGIPMVLKSALGGYDGKGQWRLKDVAQIETLWQEMAAC
FT                   IAATPTQAIVAEEFVPFQREVSLIGARGKEGQIEVYPLAENIHVNGVLSLSTAIDSPDL
FT                   QEQAKHMFTAVAETLNYVGVLALEFFDVDGQLLVNEIAPRVHNSGHWTQQGAETCQFEN
FT                   HLRAVCGLPLGSTKLVRETSMINILGEDTLPASVMAMDGCHIHWYGKEKRAGRKMGHIN
FT                   VCGDYSGELQRRLCALANVLDEKAFPAVHEFAKKWQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187268.1"
FT   gene            complement(43654..44139)
FT                   /db_xref="GeneID:10164739"
FT                   /locus_tag="VVM_00089"
FT   CDS_pept        complement(43654..44139)
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   /gene_family="HOG000034140" [ FAMILY / ALN / TREE ]
FT                   catalytic subunit"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00089"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="GI:320154890"
FT                   /db_xref="GeneID:10164739"
FT                   /translation="MKVGIIMGSKSDWPTMKLAAEMLDRFGVEYETKVVSAHRTPHLLA
FT                   EYASTAKERGLKVIIAGAGGAAHLPGMAAAFTSLPVLGVPVQSRALSGLDSLYSIVQMP
FT                   KGIAVGTLAIGEAGAANAGLLAAQILGTHDENIMAKVEAFRSEQTESVLANPNPAED"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187269.1"
FT   gene            44320..44877
FT                   /db_xref="GeneID:10164740"
FT                   /locus_tag="VVM_00090"
FT   CDS_pept        44320..44877
FT                   /locus_tag="VVM_00090"
FT                   /gene_family="HOG000076163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YrdC/Sua5 family protein, required for
FT                   threonylcarbamoyladenosine (t(6)A) formation in tRNA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154891"
FT                   /db_xref="GeneID:10164740"
FT                   /translation="MSNLQQVVKALKQGQVVAYPTEGVFGLGCDPDNEVAIERLLTIKQ
FT                   RPSDKGLILIAADFQQLQPYLDLTSLSAEQLQRVFATWPGPYTWVMPASARASALVTGY
FT                   RQTVAVRVSDHPLVQKLCSEYGKPLTSTSANLSGQTECKTVEQVQDQLGSQISVILFGE
FT                   IGERHRPSEIRDARTEQLLRQG"
FT                   /protein_id="YP_004187270.1"
FT   gene            44906..45823
FT                   /db_xref="GeneID:10164741"
FT                   /locus_tag="VVM_00093"
FT   CDS_pept        44906..45823
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /gene_family="HOG000262768" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00093"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="GI:320154892"
FT                   /db_xref="GeneID:10164741"
FT                   /translation="MSTIDKEAVKLYLMQLQDQICQRLEQEDGKATFIEDAWYREPGDR
FT                   LGGGGRTRVMRDGNVFEQGGVNFSHVQGNAMPASATAHRPELAGRRFEAMGVSLVMHPH
FT                   NPYVPTSHANVRFFIAEKEGEAPIWWFGGGFDLTPFYPFEEDCQFWHNTAKEVCAPFGA
FT                   DVYAQHKAWCDDYFYLPHRGETRGIGGLFFDDLNQWEFDKCFDYIKAVGEGYCDAYLPI
FT                   VERRKVTEYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSMPPLARWE
FT                   YSYEPQADSPEASLYQHYLKPREW"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187271.1"
FT   gene            45959..46792
FT                   /db_xref="GeneID:10164742"
FT                   /locus_tag="VVM_00095"
FT   CDS_pept        45959..46792
FT                   /product="shikimate 5-dehydrogenase I alpha"
FT                   /gene_family="HOG000237876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00095"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="GI:320154893"
FT                   /db_xref="GeneID:10164742"
FT                   /translation="MTQQIDRYAVFGNPIEHSKSPFIHTLFARQTNQPLIYTAETAPKE
FT                   GFVEAVKAFFAEGGKGCNVTLPFKEEAYQFASRLTERAQLAGAVNTLKKLDDGDIIGDN
FT                   TDGAGLVQDLLQHQVVLAGARILVIGAGGAARGVLKPLLDQKPTSLTITNRTFSKAEKL
FT                   AVLFAAYGSVTAKEMNTVTEEYDVIINSTSASLSGELPALSSSIFAANSTSYDMMYGKG
FT                   DTTFNQWAKQHGAAHAYDGLGMLVGQAAESFMLWRGLRPGSKQILRELRKNLEGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187272.1"
FT   gene            46796..47059
FT                   /db_xref="GeneID:10164743"
FT                   /locus_tag="VVM_00097"
FT   CDS_pept        46796..47059
FT                   /locus_tag="VVM_00097"
FT                   /gene_family="HOG000270089" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154894"
FT                   /db_xref="GeneID:10164743"
FT                   /translation="MNQAILFPDMQSWDEASQSVNFAAQQSGALIECFVAKHKLEKLSG
FT                   LELDTEQAVIAAFIDYRFDLEEIAEELIEDEAFNEEGHIIID"
FT                   /protein_id="YP_004187273.1"
FT   gene            complement(47049..47615)
FT                   /db_xref="GeneID:10164744"
FT                   /locus_tag="VVM_00099"
FT   CDS_pept        complement(47049..47615)
FT                   /locus_tag="VVM_00099"
FT                   /gene_family="HOG000049430" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbonic anhydrase family 3"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154895"
FT                   /db_xref="GeneID:10164744"
FT                   /translation="MSSIRSYKGIHPQIGERVYIDSTSVIVGDIRIGDDSSIWPLVAAR
FT                   GDVNHIHIGARTNIQDGSVLHVTHKNAENPHGYPLLIGNDVTIGHKVMLHGCDIHDRVL
FT                   VGMGAIVLDDVVVESDVMIGAGSLVPPGKRLESGYLYVGSPIKQVRPLSEKERAFLLKS
FT                   ADNYVQNKNDYLTEVKDLHERQTNR"
FT                   /protein_id="YP_004187274.1"
FT   gene            48097..49632
FT                   /db_xref="GeneID:10164745"
FT                   /locus_tag="VVM_r00001"
FT   rRNA            48097..49632
FT                   /db_xref="GeneID:10164745"
FT                   /locus_tag="VVM_r00001"
FT                   /product="16S ribosomal RNA"
FT   gene            49695..49771
FT                   /db_xref="GeneID:10164746"
FT                   /locus_tag="VVM_t00001"
FT   tRNA            49695..49771
FT                   /note="anticodon GAT"
FT                   /db_xref="GeneID:10164746"
FT                   /locus_tag="VVM_t00001"
FT                   /product="tRNA-Ile"
FT   gene            49782..49857
FT                   /db_xref="GeneID:10164747"
FT                   /locus_tag="VVM_t00002"
FT   tRNA            49782..49857
FT                   /note="anticodon TGC"
FT                   /db_xref="GeneID:10164747"
FT                   /locus_tag="VVM_t00002"
FT                   /product="tRNA-Ala"
FT   gene            50138..53024
FT                   /db_xref="GeneID:10164748"
FT                   /locus_tag="VVM_r00002"
FT   rRNA            50138..53024
FT                   /db_xref="GeneID:10164748"
FT                   /locus_tag="VVM_r00002"
FT                   /product="23S ribosomal RNA"
FT   gene            53147..53266
FT                   /db_xref="GeneID:10164749"
FT                   /locus_tag="VVM_r00003"
FT   rRNA            53147..53266
FT                   /db_xref="GeneID:10164749"
FT                   /locus_tag="VVM_r00003"
FT                   /product="5S ribosomal RNA"
FT   gene            53295..53371
FT                   /db_xref="GeneID:10164750"
FT                   /locus_tag="VVM_t00003"
FT   tRNA            53295..53371
FT                   /note="anticodon GTC"
FT                   /db_xref="GeneID:10164750"
FT                   /locus_tag="VVM_t00003"
FT                   /product="tRNA-Asp"
FT   misc_feature    complement(53452..54009)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|27364599|ref|NP_760127.1| transposase"
FT   gene            complement(53452..53802)
FT                   /db_xref="GeneID:10164751"
FT                   /locus_tag="VVM_00104"
FT   CDS_pept        complement(53452..53802)
FT                   /locus_tag="VVM_00104"
FT                   /gene_family="HOG000151591" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154896"
FT                   /db_xref="GeneID:10164751"
FT                   /translation="MVEHLKQLSAVTEKGRHAVVIMDGAGWHTNDIAEPFDNVSIIKLP
FT                   PYSPELNPIEQVWSWLRQHSLANQSFADYEDIVSKVCRAWNSFFGMFGQSQTDVLEKLD
FT                   RPEQLIFQIGMT"
FT                   /protein_id="YP_004187275.1"
FT   gene            complement(53818..54009)
FT                   /db_xref="GeneID:10164752"
FT                   /locus_tag="VVM_00105"
FT   CDS_pept        complement(53818..54009)
FT                   /locus_tag="VVM_00105"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154897"
FT                   /db_xref="GeneID:10164752"
FT                   /translation="MGLDNVDVWFQDEARFGQQNTTTRLWAERGSRPRVVKQQQFEYAY
FT                   LFGSVCPARGIGEAMVVP"
FT                   /protein_id="YP_004187276.1"
FT   gene            complement(54035..54511)
FT                   /db_xref="GeneID:10164753"
FT                   /locus_tag="VVM_00106"
FT   CDS_pept        complement(54035..54511)
FT                   /locus_tag="VVM_00106"
FT                   /gene_family="HOG000224070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154898"
FT                   /db_xref="GeneID:10164753"
FT                   /translation="MDSLNNIDFKKLASQQKSIQMKMRLLALAHFKDGHSRTQIAKFLK
FT                   VSRTSVNKWVQTFLEEGLEGLQEKPRTGRPAFLNAEQREQLSQYIKARAMDSSGGRLTG
FT                   NDIHAYIVNEFGKHYHPDSIYYLLNHMGFSWITSRSKRPRQSQQIQDDLKKIQN"
FT                   /protein_id="YP_004187277.1"
FT   gene            complement(54595..55485)
FT                   /db_xref="GeneID:10164754"
FT                   /locus_tag="VVM_00107"
FT   CDS_pept        complement(54595..55485)
FT                   /locus_tag="VVM_00107"
FT                   /gene_family="HOG000269751" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HTH-type transcriptional regulator IlvY"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154899"
FT                   /db_xref="GeneID:10164754"
FT                   /translation="MNIKSLQLFIHLCDSKNFAKTAAAMHISPSALSRQIQKLEEETSQ
FT                   QLFTRDNRSVEITPAGKKLMPVALKMLNEWQQYQLQNRYSETELKGEIRLFCSVTASYS
FT                   HLPELLSEFRLQHPFIEFKISTGDPAQAMDKILNGEADIAISAKPDTVPAKVAFEPISE
FT                   IPLSVIAPQGVSSFTDEMNRDKPDWSSIPYIVPEAGTARERANTWFKKMKIKPNIYAQV
FT                   SGHEAIVSMVALGCGIGIAPDVVINNSPVKEKIQRLKVAPIKPFELGVCCIKSQLENPL
FT                   IQALWKVAESKYIVI"
FT                   /protein_id="YP_004187278.1"
FT   gene            55627..57111
FT                   /db_xref="GeneID:10164755"
FT                   /locus_tag="VVM_00108"
FT   CDS_pept        55627..57111
FT                   /product="ketol-acid reductoisomerase"
FT                   /gene_family="HOG000286135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00108"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="GI:320154900"
FT                   /db_xref="GeneID:10164755"
FT                   /translation="MANYFNTLNLREQLDQLGRCRFMDRSEFATEADYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRQAAIDEQRQSYKNAKENGFEVGSYETLIPQADLVVN
FT                   LTPDKQHTNVVETVMPLMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGWDIAKAWAAATGGHRAGCLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSIVCYEKMVAEGIDPGYAGKLLQYGWETITEALKFGGITHMMDRLSNPA
FT                   KIKAFELSEELKDLMRPLYNKHMDDIISGHFSSTMMADWANDDANLLGWRAETGETAFE
FT                   NYPSTDVEISEQEYFDNGILMVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANVATPLLREKFMPSVGTDVIGKGLGETSNQVDN
FT                   ATLIAVNETIRNHPVEYIGEELRGYMTDMKRIAVGG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187279.1"
FT   gene            complement(57306..57557)
FT                   /db_xref="GeneID:10164756"
FT                   /locus_tag="VVM_00110"
FT   CDS_pept        complement(57306..57557)
FT                   /locus_tag="VVM_00110"
FT                   /gene_family="HOG000265044" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154901"
FT                   /db_xref="GeneID:10164756"
FT                   /translation="MFDPKKIEQIAKQIHDSMPQPVKDLGADVDQKIRQVIQGQLNKLD
FT                   VVSREEFDVQTQVLLRTRQKLSEMEKKLSELEAKLADK"
FT                   /protein_id="YP_004187280.1"
FT   gene            complement(57703..60822)
FT                   /db_xref="GeneID:10164757"
FT                   /locus_tag="VVM_00113"
FT   CDS_pept        complement(57703..60822)
FT                   /locus_tag="VVM_00113"
FT                   /gene_family="HOG000158128" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RND multidrug efflux transporter; Acriflavin
FT                   resistance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154902"
FT                   /db_xref="GeneID:10164757"
FT                   /translation="MRFTDVFIKRPVLAVSISFLIALLGLQAVFKMQVREYPEMTNTVV
FT                   TVTTSYYGASADLIQGFITQPLEQAVAQADNIDYMTSQSVLGKSTITVNMKLNTDPNAA
FT                   LADILAKTNSVRSQLPKEAEDPTVTMSTGSTTAVLYIGFTSDELSSSQITDYLERVINP
FT                   QLFTINGVSKVDLYGGLKYALRVWLDPAKMGALRLTATDVMGVLNANNYQSATGQVTGE
FT                   FVLYNGSADTQVSNVQELENLVVKSGDGEVIRLGDIAKVTLEKSHDVYRASANGQEAVV
FT                   AAINAAPSANPINIAADVLELLPQLERNLPSNIKMNVMYDSTIAINESIHEVVKTIVEA
FT                   AVIVLVVITLFLGSFRAVIIPIVTIPLSLIGVAMVMQAMGFSWNLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHIKEGESPFRAAIIGTREIAVPVIAMTLTLGAVYAPIALMGGITGSL
FT                   FKEFALTLAGSVFVSGIIALTLSPMMCSKMLKAHEKPSKFEEKVHHVLDGMTNRYEKML
FT                   KAVMDHRPVVIGFALIVFGTLPVLFKFIPSELAPSEDKGVVMLMGTGPSNANLDYLQNT
FT                   MNDVNKILSDQPEVEFAQVFTGVPNSNQAFGLATLKPWSQREASQAEITKRVGGLVSNV
FT                   PGMAVTAFQMPELPGAGSGLPIQFVITTPNSFESLYTIASDILTEVTSSPLFVYSDLDL
FT                   KYDSATMKIKIDKDKAGAYGVTMQDIGITLGTMMADGYVNRIDLNGRSYEVIPQVERKW
FT                   RLNPESMKNYYVRAADGKAVPLGSLITIDVIAEPRSLPHFNQLNSATVGAVPSPGTAMG
FT                   DAINWFENIASSKLPTGYNHDYMGEARQFVTEGSALYATFGLALAIIFLVLAIQFESIR
FT                   DPIVIMVSVPLAICGALIALAWGLATMNIYSQVGLITLVGLITKHGILICEVAKEEQLH
FT                   NKRSRIDAVMEAAKVRLRPILMTTAAMIAGLIPLMYATGAGAAQRFSIGIVIVAGLAIG
FT                   TLFTLFVLPVIYSYLAEKHKPLPVFVEDKDLEKLARVDEAKAAQRQIAEQ"
FT                   /protein_id="YP_004187281.1"
FT   gene            complement(60834..61940)
FT                   /db_xref="GeneID:10164758"
FT                   /locus_tag="VVM_00115"
FT   CDS_pept        complement(60834..61940)
FT                   /locus_tag="VVM_00115"
FT                   /gene_family="HOG000274245" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Co/Zn/Cd efflux system membrane fusion
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154903"
FT                   /db_xref="GeneID:10164758"
FT                   /translation="MKKWTFFMLLIAILLFGSVIGFNLFKQKKIAEYLANRPEPEFPVT
FT                   VTEVKPVDWVPVIEAIGFIEPNQGVTIANETSGVIKQIRFESGTQVKEGQPLVLLDSDV
FT                   EKANLKSSEAKLPAAEAKYKRYQGLFKKGSISKEAYDEAGANYYSLKADIESLKASIAR
FT                   REIKAPFSGVIGIRNVYLGQYLQAGSDIVRLEDTSVMRLRFTVPQNDISRINLGQEVDI
FT                   FVDAYPQNPFKGSITAIEPAVNIQSGLIQIQADIPNSDGKLRSGMFARANIILPKLEDQ
FT                   VTLPQTAITFTLYGDNVYILTEEDGVQRVKQHVVKVGERTGNIAHILDGVKVGDQVVTS
FT                   GQVRLSNDAKVRVVESDAITPPAETPML"
FT                   /protein_id="YP_004187282.1"
FT   gene            complement(61958..62539)
FT                   /db_xref="GeneID:10164759"
FT                   /locus_tag="VVM_00116"
FT   CDS_pept        complement(61958..62539)
FT                   /locus_tag="VVM_00116"
FT                   /gene_family="HOG000285141" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator TetR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154904"
FT                   /db_xref="GeneID:10164759"
FT                   /translation="MSSEEQNDKQQQILAAAEKLIAESGFQGLSMSKLAKEAGVAAGTI
FT                   YRYFDDKEHLLDELRLRITQRVATAIQANVTRDMPLKQQYRTMWLNTWNLAASNLSTLS
FT                   NRIQYESLPCSNSHKTRELEKKMFHQVALMFDMGKEQGVFKTLDNEILFGLSLETSVRL
FT                   AKKHALGFYQLDDKALDAAIDASWDAIINH"
FT                   /protein_id="YP_004187283.1"
FT   gene            62707..64725
FT                   /db_xref="GeneID:10164760"
FT                   /locus_tag="VVM_00117"
FT   CDS_pept        62707..64725
FT                   /locus_tag="VVM_00117"
FT                   /gene_family="HOG000033015" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154905"
FT                   /db_xref="GeneID:10164760"
FT                   /translation="MKLNPRQDEAVKYVSGPCLVLAGAGSGKTRVITNKIAYLVQQCGY
FT                   KARNIAAVTFTNKAAREMKERVGQTLGKGESKGLMVSTFHTLGLNIIKREYRHLGLKSG
FT                   FSLFDDQDQLALLKELTEKQLDGDKDLLRQLMSTISNWKNDMLSPEQAVARAQGEQQQL
FT                   FAFCFEMYQKQMKAYNALDFDDLILLPVLLLRGHDEVRQYWQNRIRYLLVDEYQDTNTS
FT                   QYELVRLLVGERGRLTVVGDDDQSIYSWRGAKPQNLVLLGQDYPNLRLIKLEQNYRSTS
FT                   RILRAANILIANNPHVYEKSLFSEIPDGEKLKVLLANNDEHEAERVTGEIIAHKFLNRT
FT                   DYRDYAILYRGNHQSRLIEKSLMQNRVPYRLSGGTSFFARAEIKDIMAYLRVLVNPDDD
FT                   NAFLRIVNTPKREIGPVTLEKLGSYANMRGKSLFEASFELGLEQHLTGRGLDNLRRFTH
FT                   WLVAIADQAERGDTVEAVRSLVRDIHYEDWLYETSASPKAAEMRMKNVSDLYSWIVADL
FT                   EGDNNDQEEKTLKEVVQRLTLRDMMERGEEDEDSDAVQLMTLHASKGLEFPYVYLIGTE
FT                   EGILPHQTSIDEDNVEEERRLMYVGITRAQRELTFVMCKERRQYGELIKPSQSRFLDEL
FT                   PFDDVEWEQTKKPVTQEERMAKGQAHIANLRAMFNKK"
FT                   /protein_id="YP_004187284.1"
FT   gene            complement(64787..65239)
FT                   /db_xref="GeneID:10164761"
FT                   /locus_tag="VVM_00118"
FT   CDS_pept        complement(64787..65239)
FT                   /locus_tag="VVM_00118"
FT                   /gene_family="HOG000254082" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c5"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154906"
FT                   /db_xref="GeneID:10164761"
FT                   /translation="MFGKPADLPWECKVSLMDMSRRMISVLFAALTFSTAAMATSTDHD
FT                   AIAERIKPVGDVYLAGSEPVKAEPTGPRDGATVYGTFCIACHSSGVNGAPKTGNAADWA
FT                   PRIAQGHDVLNKHAIEGFNAMPPRGTCMDCSDDEIIAAIDHMIKGL"
FT                   /protein_id="YP_004187285.1"
FT   gene            65494..65570
FT                   /db_xref="GeneID:10164762"
FT                   /locus_tag="VVM_t00004"
FT   tRNA            65494..65570
FT                   /note="anticodon CCG"
FT                   /db_xref="GeneID:10164762"
FT                   /locus_tag="VVM_t00004"
FT                   /product="tRNA-Arg"
FT   gene            65609..65684
FT                   /db_xref="GeneID:10164763"
FT                   /locus_tag="VVM_t00005"
FT   tRNA            65609..65684
FT                   /note="anticodon GTG"
FT                   /db_xref="GeneID:10164763"
FT                   /locus_tag="VVM_t00005"
FT                   /product="tRNA-His"
FT   gene            65711..65787
FT                   /db_xref="GeneID:10164764"
FT                   /locus_tag="VVM_t00006"
FT   tRNA            65711..65787
FT                   /note="anticodon TGG"
FT                   /db_xref="GeneID:10164764"
FT                   /locus_tag="VVM_t00006"
FT                   /product="tRNA-Pro"
FT   gene            65862..65937
FT                   /db_xref="GeneID:10164765"
FT                   /locus_tag="VVM_t00007"
FT   tRNA            65862..65937
FT                   /note="anticodon GTG"
FT                   /db_xref="GeneID:10164765"
FT                   /locus_tag="VVM_t00007"
FT                   /product="tRNA-His"
FT   gene            65962..66038
FT                   /db_xref="GeneID:10164766"
FT                   /locus_tag="VVM_t00008"
FT   tRNA            65962..66038
FT                   /note="anticodon TGG"
FT                   /db_xref="GeneID:10164766"
FT                   /locus_tag="VVM_t00008"
FT                   /product="tRNA-Pro"
FT   gene            complement(66461..66577)
FT                   /db_xref="GeneID:10164767"
FT                   /locus_tag="VVM_00122"
FT   CDS_pept        complement(66461..66577)
FT                   /locus_tag="VVM_00122"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154907"
FT                   /db_xref="GeneID:10164767"
FT                   /translation="MKIKVLNAKKLKYRHKRATRYEKGEISSQIERFISNFA"
FT                   /protein_id="YP_004187286.1"
FT   gene            67069..68784
FT                   /db_xref="GeneID:10164768"
FT                   /locus_tag="VVM_00123"
FT   CDS_pept        67069..68784
FT                   /locus_tag="VVM_00123"
FT                   /codon_start="1"
FT                   /product="peptide ABC transporterATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154908"
FT                   /db_xref="GeneID:10164768"
FT                   /translation="MSLLEVKNLRIEYPSRHGVHAAVKSLSFNIERGEIVGVVGESGAG
FT                   KSTVGNAVSDLLSPPGRIASGDVFLDGEKISGLSPEAMRKVRGSRIGFIFQDPMTSLNP
FT                   LFTVEQQLKETIHANMNVSDEEAYTRALSLMKQVGIPQPENRLKQYPHQFSGGMRQRVV
FT                   IAIALAGEPDLIIADEPTTALDVSIQDQILNLIRELCIKHNVGCMLVTHDMGVVSNVTD
FT                   RVAVMYRGDLVEFGPTAKVLGNPDHPYTRSLISAVPRSDRKLDRFPLVSYIEEASELQP
FT                   LDIKNHWLGQSEDQRKYTGPLLNVENVNLRFVTKDSLFESRREYVQASNNVSFQVHEGE
FT                   TFGLVGESGSGKSTIARVIAGLYAPNSGKVTFEGIDLTALTSEKARRPLRRQMQMVFQN
FT                   PYTSMNPRMKIFDIIAEPIRFHKLTNSEAETRQIVNDLLEHVGLGRMAGVKYPHEFSGG
FT                   QRQRISIARALATRPRLLICDEPTSALDVSVQAQILNLLKDLQSELNLTMLFISHDLPV
FT                   IRQMCDRVGVMQMGTLLEVAPTEQLFRSPQHEYSKHLISLMPEFTGLREEVKTA"
FT                   /protein_id="YP_004187287.1"
FT   gene            68860..70416
FT                   /db_xref="GeneID:10164769"
FT                   /locus_tag="VVM_00125"
FT   CDS_pept        68860..70416
FT                   /locus_tag="VVM_00125"
FT                   /gene_family="HOG000164956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dipeptide-binding ABC transporterperiplasmic
FT                   substrate-binding component"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154909"
FT                   /db_xref="GeneID:10164769"
FT                   /translation="MKTMKSKLTVALMAAGLSLSAAAADIKVAYDADPVSLDPHEQLSG
FT                   GTLQMSHMVFDPLVRYTQKLDFEPRLAEKWERVNDTTYRFQLRKGVKFHSGNELTADDV
FT                   VWTFDRLKDSPDFKAIFEPYEKMVKVDDYTVELVSKGAYPLVLQTATYIFPMDSKFYSG
FT                   TTADGKDKAEVVKHGNSFASTNVSGTGPFIVTSREQGVKVEFERFKDYWDKESKGNVDK
FT                   LTLVPIKEDATRVAALLSGGVDMIAPVAPNDHQRVKDAKGIELVTLPGTRIITFQMNQN
FT                   SNEALKDVRVRQAIVHAINNQGIVDKIMKGFATAAGQQGPEGYAGYNAELVPRFDLKKA
FT                   KQLMKEAGYEKGFTLTMIAPNNRYVNDAKVAQAASAMLSKIGIKVDLKTMPKAQYWPEF
FT                   DKCAADMLMIGWHSDTEDSANFSEFLTMTRNEETGRGQYNCGHYSNPEVDKLVEAANVE
FT                   TDPAKRAAMLQKVETTLYNEAAFVPLHWQNLAWGAKSTLDIKPIVNAMDFPYFGDLVVK
FT                   E"
FT                   /protein_id="YP_004187288.1"
FT   gene            70568..71545
FT                   /db_xref="GeneID:10164770"
FT                   /locus_tag="VVM_00127"
FT   CDS_pept        70568..71545
FT                   /locus_tag="VVM_00127"
FT                   /gene_family="HOG000170242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide ABC transporterpermease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154910"
FT                   /db_xref="GeneID:10164770"
FT                   /translation="MFSFLVKRLFQALIVMFVISLVAFAIQDNLGDPLRELVGQSVSEA
FT                   ERQALRDELGLNDPFITKYTRFIGAALQGDLGTSYFFKRPAVDVILDKLVATLELVFGA
FT                   TVLIIVFSIPLGVYSAIHPKSFFTKVVMAGSSIGISIPVFLTAIMLMYVFSIELQWLPS
FT                   YGRGETYNLLGWESGFFTLDGLKHLVLPCIALASIMLPLFIRLVRSEMLEVLSSEYIKF
FT                   AKAKGLALNKIYYQHALKNTMLPVLTVGGVQIGTMVAYTILTETVFQWPGTGFLFLEAI
FT                   NRVDTPLITAYVIFVGLIFVVTNTIVDLLYGLINPTVNLTGKGA"
FT                   /protein_id="YP_004187289.1"
FT   gene            71548..72486
FT                   /db_xref="GeneID:10164771"
FT                   /locus_tag="VVM_00129"
FT   CDS_pept        71548..72486
FT                   /locus_tag="VVM_00129"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dipeptide transport system permease DppC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154911"
FT                   /db_xref="GeneID:10164771"
FT                   /translation="MEHVNKAPSVWERFKESDFLYYFKRDKVAMSSFAVFMLFLLLAIA
FT                   APLIAPSNPYDLSSIDIMDAELPPSWMEGGDENFVLGTDEQGRDILSTILYGSRLSLTI
FT                   GFLAVALQLFLGIVIGLSAGYFGGRIDNFLMRFADVQLSFSTMMVAIIVSAIFKASFGS
FT                   DFYSQYAVVMLVVIIGVAEWPQYARTIRASVLAEKKKEYVEAARVMGFKAPRIMFRHIL
FT                   PNCLSPILVISTVQVANAIMSEAALSFLGLGLPVDQPSLGALISIGFNYIFSGAWWITA
FT                   FPGIVLVTLVLVINLLGDWLRDVFNPKIYKG"
FT                   /protein_id="YP_004187290.1"
FT   gene            72673..73617
FT                   /db_xref="GeneID:10164772"
FT                   /locus_tag="VVM_00130"
FT   CDS_pept        72673..73617
FT                   /locus_tag="VVM_00130"
FT                   /gene_family="HOG000218265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154912"
FT                   /db_xref="GeneID:10164772"
FT                   /translation="MELSKSAHLPIFKPQRLWLMAALCFFGVATPAAAEGFLCEATQAS
FT                   TNELPMLDKACPIGDGVWGKKAPKSGKEDFFWIQCGILNQPMPLADAKPLYKQITTDVW
FT                   MKPENKTYRCLIGPYQSFAQASKDLKQVKKLGNYREAFIRVVKPHSAVKPVTASKEQKA
FT                   ITKPTAPKTQPKVPVAANKPMPAPAQATLATTPVKRGNDDSSSIDIRKSAELKGRTYVV
FT                   PYLMDDEHQFYMEHNQAWNRLDYSSAEVVCSDLHMRLLTEEEFFTLLDSKVMENQQWPM
FT                   QLPYWGRGKKGFFTDGRVTQVKGSSLLNVLCVK"
FT                   /protein_id="YP_004187291.1"
FT   gene            complement(73675..76401)
FT                   /db_xref="GeneID:10164773"
FT                   /locus_tag="VVM_00136"
FT   CDS_pept        complement(73675..76401)
FT                   /locus_tag="VVM_00136"
FT                   /gene_family="HOG000004652" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154913"
FT                   /db_xref="GeneID:10164773"
FT                   /translation="MKKVSLLAASVAIALTGCGGSDSGSGSNGNVAPGGIIVTGFDGYF
FT                   NQAVVFLDKDNNGKLDIGSDTIFGLTDKEGRRTIPAGTQGVLALQTLTPGGTVQTALTQ
FT                   YDADTYAGKYTIDMDHPTQAMAHEVVLRTLPGEKVISPLTDLVVVQAGANPTKEKIEEA
FT                   KTEVNETLGITGNIAFTDVIAAKNHALHKTAQILTESKVNAGVNYTAENALKIAQEANK
FT                   IVTAPENQDKLDQPNFKPTVEVTPSGDVQVTVNNKLIVNKSVADNIRAQLNTPSTSHSL
FT                   DLTLDLAVGQDALFSDSDNNNIALDVQVIDPIDNQAVSGLIITANNGGSLTIKGELTPV
FT                   RQSYILQITGTDIDAEAAVVGKVSTLFTLTVETPNSAPTIVPKIAEDLQAWIGSIELTQ
FT                   GVAVTNEQYRIDNLFDDADGDELIIDASSTIKELELSVIAVGGTKELKIAGTPTNTYPA
FT                   GETITISAFDGIERTSKSFVLKQVDAKPIASFEVNTNALANLQSEITSQLVELKVNEPL
FT                   PSVQLSITLDDIFKAVNAHGPVEYFAGMKGENQDHNTSVAGIKVAVDSMGVLTISGTPL
FT                   EASTNGEFYIAAGIYPDAEDGVISEMTRIALPEVKAADTPPPVSLGFTKQHFNNQQWVM
FT                   GSFADRDGEIGYASLLNTNGTFEWCWGDQEREGYQVFKSNISDSNGAPDPINTLSALNK
FT                   VSGYLESTNKDCWPVTLNNDGTLTAHHSDEGVDTNWNYEMLYQNSNNGHYQIIVKINNQ
FT                   ELFWLDSASTPLDQTLAVNTQIAEGKVEYYMSVEGDGQHHPELDGPKLSYSYGKREYQA
FT                   NNQYQDNSILPEGFNTPGTWQSVKDMAGLERAELEEEREDQKTRVRYVHRDFGDFYIGI
FT                   TWSKEVNGYESPAQYSLFSHNQEAMDKLVKAMPLMTN"
FT                   /protein_id="YP_004187292.1"
FT   gene            76654..77517
FT                   /db_xref="GeneID:10164774"
FT                   /locus_tag="VVM_00138"
FT   CDS_pept        76654..77517
FT                   /locus_tag="VVM_00138"
FT                   /gene_family="HOG000073381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154914"
FT                   /db_xref="GeneID:10164774"
FT                   /translation="MKQWARLITIGACLGSASAGAQATLDKSKYGYSYFTLGFENVVYE
FT                   ELFPGLDSDASVVSPVLNTGGLYHINTRFDFSIDALATFSPMSATEEWQKDGTLIQTNQ
FT                   FEYLKAATNILLHYKLQDNWRVLAGTSLSYQTYKRYGLKNHNGYVNDVFREGNTWEEKS
FT                   TDIFLDAGVAYDSGHLYGKSDWRVSGRWIFGVPIWSVTENSRFEDIQFNDFGFRTNAEA
FT                   TLSYQIMPGLHLGWFVMLGYEKRFESDPQRVMYTTASGVEKQGQAWLPEAQTWTLNTGL
FT                   QALWNF"
FT                   /protein_id="YP_004187293.1"
FT   gene            complement(77539..79107)
FT                   /db_xref="GeneID:10164775"
FT                   /locus_tag="VVM_00140"
FT   CDS_pept        complement(77539..79107)
FT                   /locus_tag="VVM_00140"
FT                   /gene_family="HOG000005367" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154915"
FT                   /db_xref="GeneID:10164775"
FT                   /translation="MTHRKPLFVVFAITFVTGMWFWLSSSQATSSVLSEAETRVAAPHA
FT                   KAISVESKVPNTTTPTQNANLHVSPLFTQAAAILPTPPSEETGQTPTPEEELEIALPSS
FT                   ASGTTVIVSDKELAKGVGANSKPRLNAEVARQLQSQIFGWELDQGAPIHYSLNIDQLFV
FT                   DADDDFLTLTVRINVPGLKIRNLGTVQILGTATKAVAQPQLMIAARDDHHGSDDQAWVK
FT                   AYFDLPAIGETAAPFDHPLIGQTFYRLETTQTLAGIRYPYEVIYCQAWKLINHQVYFAS
FT                   ARNRRQCPSDEELKLIGEFEQQDDKLILTSSQSAFDAKQTWMTRQSYPSNLTEGLVNHL
FT                   TTVHDGNQYETYTMLTDKAAMEARLNVETGRKLYEMTFFDYLFIDAEQNYLPAEVGNYI
FT                   YERQAADPTVYQRFDSDLNIHRVSGSFDCTTLLPYFELSVIAGRGDYEDVISYSHNEDG
FT                   VSSVACFVFPSGPNKRSLAINHDYRDDNDLQQGEIYSYILRPKPQFAHLLEELKINLIY
FT                   HHPQL"
FT                   /protein_id="YP_004187294.1"
FT   gene            complement(79116..79688)
FT                   /db_xref="GeneID:10164776"
FT                   /locus_tag="VVM_00142"
FT   CDS_pept        complement(79116..79688)
FT                   /locus_tag="VVM_00142"
FT                   /gene_family="HOG000290395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154916"
FT                   /db_xref="GeneID:10164776"
FT                   /translation="MSAQSTSLTHIIQQWQAGDKEAESQLYQFAYLQLRKIAQQERERN
FT                   AEKYGLENEVLADSVNSTTALIHDAYLKLSTSDMSEISGKRDFFLMAAKVMRQILIDNA
FT                   RSLQAQKRQQVTQLPSEHQEKFEQLIIMDKALDNFSVRYPRQSNALKLKYLMGMKNQEI
FT                   SELLECSASLIEKDLKFSRSWLQSRMA"
FT                   /protein_id="YP_004187295.1"
FT   gene            complement(79685..81124)
FT                   /db_xref="GeneID:10164777"
FT                   /locus_tag="VVM_00144"
FT   CDS_pept        complement(79685..81124)
FT                   /locus_tag="VVM_00144"
FT                   /gene_family="HOG000004653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome segregation ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154917"
FT                   /db_xref="GeneID:10164777"
FT                   /translation="MKLLHTLTLCLGLSAFYSQAATPKTGYFIDSPVTGLYYKTSSNLS
FT                   GTTHKGAFQYHPGDVVSFFLGNDDSGYLLTTLSGQEVITPTLASTKPSRSINMTRLLLS
FT                   LDSTPENRDEIVLLNKLLSDPKLQQQLQGLDLNFLDSSANQLDVELVSVKEAVEHLNQS
FT                   QRYIEQHFTSEEVIFSPLNVRLRNIIINKKDWQGRACALDLRHLDRPDYRTPVGVMSFE
FT                   VTHDSLIQHPSVGDYFNGCYLNRQHAYREKTVEPLSHFEQWEGVVGCASQGCTRHDLNG
FT                   FSLEDFDDEGDWKYRSVALNFDPQTQLLMGKMQGLGRKAQVAHSNKAESLWFTYPEAKG
FT                   QHIAYEGIWKETQYQEQTLTERCLNIADGRVWLGPSNVSLCPLAASAYRQDVTQEYQDM
FT                   WWLRNASGHAQLEQMNVMVRWFPQPYPAQYTTWEYLPAGQNWDQGILYRYQQQVSPQRD
FT                   GSDRIDTYTISEFVKQQGEPS"
FT                   /protein_id="YP_004187296.1"
FT   gene            complement(81153..82487)
FT                   /db_xref="GeneID:10164778"
FT                   /locus_tag="VVM_00145"
FT   CDS_pept        complement(81153..82487)
FT                   /locus_tag="VVM_00145"
FT                   /gene_family="HOG000000020" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154918"
FT                   /db_xref="GeneID:10164778"
FT                   /translation="MQLGTSTTQVFYRLLDLNEEEKQQALQQLEQDAPEVYRALTPLMQ
FT                   PQESEPLTELLGFHAHHATDTSLDLAGQLIDKYQLTHELGRGGMGVVYAAYRADETFEQ
FT                   QLAIKFIQPSLTQVLGKKALFDEAQLLARLNHPCIAKVFDGGVYQDSVYIVMEQVDGVT
FT                   LDTYLKHHTLDQTAKLTLFLQLCQAVEHAHHNQVLHADLKPENILIDHAQRPKLLDFNL
FT                   TQKVSDQAKQQGKTGLVAFSEHYASPEQKSGDYLTQQSDLYSLGKILQLLFPHMKKRSD
FT                   LCFIAEKATQAIAEQRYLSVSELRVDIENMLACRPISLKQHIPLYTTKRLIQRRPMPTF
FT                   LLTLLVMTGVMFTSTLINKNRQLEQEKLIAEEMMYEVTRLMFHTKGNQLAQMSVSSMLE
FT                   ITRRRILSNPDIPKHIKQKMLLAMITPTPEKQVVEVDCQPNCQHP"
FT                   /protein_id="YP_004187297.1"
FT   gene            complement(82640..83437)
FT                   /db_xref="GeneID:10164779"
FT                   /locus_tag="VVM_00148"
FT   CDS_pept        complement(82640..83437)
FT                   /locus_tag="VVM_00148"
FT                   /gene_family="HOG000144929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome segregation ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154919"
FT                   /db_xref="GeneID:10164779"
FT                   /translation="MSFEFFDQSWDKELLLMLGINLGLLILLAWFVLLWLMLREFRKAM
FT                   RPASDTLASDAASPATIAMCEESVNHAIDYSNENRDTLNALIQIQQALEKQVADIRAAS
FT                   QNPSEHDLASIEALNQKLSKSQQLIRKLKGDLDKSVRGLRKAKAKLLEQNDTVDGLRKQ
FT                   KEDIEKQFEQLEREYIMISESGGFQDVEQGFQKEKDQLLATIENYKQQLANQAPASTSG
FT                   AASDELKQKLLAMQKQLMHVNKEKAFIEQKYLELTQKLENEDR"
FT                   /protein_id="YP_004187298.1"
FT   gene            83538..84434
FT                   /db_xref="GeneID:10164780"
FT                   /locus_tag="VVM_00149"
FT   CDS_pept        83538..84434
FT                   /locus_tag="VVM_00149"
FT                   /gene_family="HOG000144928" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154920"
FT                   /db_xref="GeneID:10164780"
FT                   /translation="MKILIVDDSKATLEIVRKALLGFGYRRLSIEKTNCAREALEKMAH
FT                   WRPDIVLTDWHMPDMSGLELVQTVASRFPEVKIAMITTVDDDEQIAQAKAAGASFVLSK
FT                   PFDDDALHRKLLPLVQGAEESEKAFDELVEIQKELALPKLSQLEKLLRKVVHDEIALTN
FT                   IRLQQFDESKVPCMIAIYEDGETQKPRAVAVLDIYAVCVLASANTHITAEQLSQAIHKK
FT                   MVSKAILDTCQMVLDKSSLAFLDSLTRKSLRLKSVSFVPEAFDKLKVLFSKPADKRLDF
FT                   SCQLGEMAQGKITLVGF"
FT                   /protein_id="YP_004187299.1"
FT   gene            84510..85517
FT                   /db_xref="GeneID:10164781"
FT                   /locus_tag="VVM_00151"
FT   CDS_pept        84510..85517
FT                   /locus_tag="VVM_00151"
FT                   /gene_family="HOG000220181" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="gluconate utilization system Gnt-I
FT                   transcriptional repressor"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154921"
FT                   /db_xref="GeneID:10164781"
FT                   /translation="MAQHNKKPRTTLQDVADQVGVTKMTVSRYMRNPDSVAEKTREKIA
FT                   TAIEQMGYIENRAPAMLSKSSSRAIGILLPSLSNQIFASFVQGIETVTKAHGYETLLAH
FT                   FSYDELEEERKIASLLSYQVDGLILTESHHTERTLQMIKNAGIPVVETMELPAQPIDMA
FT                   VGLDHEDASYSVVKRMLASGKRTIVYFGARLDTRTKLRMQGYDRAMREAGLEPKHVLTG
FT                   EHSSFSLADELLERALATYPEMDGVFCTNDDIAIGTLLCAQQRGIEVPKQLAIVGYNAL
FT                   DIGQTIRPKLTSVDTPRFQIGEKSAELLLARLRGETLEQNVVDMGYRITAGESV"
FT                   /protein_id="YP_004187300.1"
FT   gene            complement(85568..87364)
FT                   /db_xref="GeneID:10164782"
FT                   /locus_tag="VVM_00153"
FT   CDS_pept        complement(85568..87364)
FT                   /product="phosphogluconate dehydratase"
FT                   /gene_family="HOG000173157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00153"
FT                   /EC_number="4.2.1.12"
FT                   /db_xref="GI:320154922"
FT                   /db_xref="GeneID:10164782"
FT                   /translation="MTHPIILEVTQRLVERSQATRAAFVARTEEQAKAGKGRVGLSCGN
FT                   LAHAVAASCSAEKKNILDFTHANVALISAYNDMLSAHQPYQHYPEQIKRALAEYGHTAQ
FT                   VAGCVPAMCDGVTQGQAGMDMSLFSRDLIAQSTALSLSHNVFDATLLLGICDKIAPGQL
FT                   MGALAYAHLPTAFVPAGLMATGISNEEKVDVRQKYAAGEVGKDALLDMECRAYHSVGTC
FT                   TFYGTANTNQLVFEAMGLMLPGSAFIHPNSELRHALTEHAAIKMAAMTAGSAHFRSLAE
FT                   VVTEKSLINGIIALLASGGSTNHTIHMLAVARAAGIELTWQDISDLSDVVPLLARIYPN
FT                   GPADMNAFQQAGGVPALLHRLNESALLHRDVKPVFGEFDDQMSLPSLVDGKLVWTPCEG
FT                   TFDSHVIADKCCVFQSTGGTKVLTGNLGKAVVKVSAVKEDQRVIEAPALVFQCQHEVEA
FT                   AYQRGELNRDCIVVVTHNGPAANGMPELHKLMPILGNVQKAGFKVALVTDGRLSGASGK
FT                   IPSAIHVSPEAIRGGAIGLVRNGDVIRVDCQTGELNNLSDTTGRCMLEIDTEASQQTWG
FT                   RNLFSTLRHSVSSAEHGASFIV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187301.1"
FT   gene            complement(87361..87882)
FT                   /db_xref="GeneID:10164783"
FT                   /locus_tag="VVM_00154"
FT   CDS_pept        complement(87361..87882)
FT                   /product="gluconokinase"
FT                   /gene_family="HOG000032567" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00154"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="GI:320154923"
FT                   /db_xref="GeneID:10164783"
FT                   /translation="MAGSSVIVMGVCASGKTTIGELLAEKLGRKFIDGDDLHPRANIQK
FT                   MASGQPLNDHDRKPWLERIRDAAYSLESKNEHGIIVCSALKKSYRDQIRDGNNNVTFLF
FT                   LDGDKSLILERMRQRQGHFMKENMVNSQFETLERPDGEPRTLFVSIDATIEDVVTNAAE
FT                   LILEQDEAQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187302.1"
FT   gene            88035..89411
FT                   /db_xref="GeneID:10164784"
FT                   /locus_tag="VVM_00155"
FT   CDS_pept        88035..89411
FT                   /locus_tag="VVM_00155"
FT                   /gene_family="HOG000237114" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="low-affinity gluconate/H+ symporter GntU"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154924"
FT                   /db_xref="GeneID:10164784"
FT                   /translation="MEQLAHTPDPTYLLTIAALAIAALLVLIIKLKVHAFASLTIVSLG
FT                   TAIATGVTSDKVVPTMMGGFGGTLASVALLVGLGAMIGKILEVTGGAKVLADTLIGRFG
FT                   KDRAPFALGIASLLFGFPIFFDAGLVVMMPIIFSVAKRFGGSPIKYALPSAGAFAVMHA
FT                   FVPPHPGPVAAAEFLGANIGLLLVVGILVAIPTWYLGAYLFGLYAGKKFDIPLSKAFFN
FT                   SDAIVDESKLPKFATVMIILVLPVLLICLDTGLNTLAVAGVIDGKTALVEFLRMLGKTP
FT                   VALLITLIVCLVVFAKDYGMAKLEKLCGDSLAPICGVILVTGAGGMFGGVLRASGIGNA
FT                   LADVLTDTGMPVIVAAFVISTCLRVAQGSATVALTTTAALIAPVVAATTGLSELDLCFI
FT                   VIAIAGGATVLSHFNDSGFWLVSRLLEMDEKTTLKTWTVMETLLGGIAFLIVAVLSFIL
FT                   "
FT                   /protein_id="YP_004187303.1"
FT   gene            89421..90032
FT                   /db_xref="GeneID:10164785"
FT                   /locus_tag="VVM_00157"
FT   CDS_pept        89421..90032
FT                   /product="4-Hydroxy-2-oxoglutarate
FT                   /gene_family="HOG000233114" [ FAMILY / ALN / TREE ]
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00157"
FT                   /EC_number="4.1.3.16"
FT                   /EC_number="4.1.2.14"
FT                   /db_xref="GI:320154925"
FT                   /db_xref="GeneID:10164785"
FT                   /translation="MTTLEQRLREIKIVPVIAINDVAHALPLAKVLVENGLPCAEVTFR
FT                   TEAAAESIRIMREAYPDLLIGAGTVLTTEQVDIAIEAGVDFIVSPGFNPTTVKYCQQRG
FT                   VTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVNMLKALTAVYPVEFMPTGGVSPSN
FT                   VEDYLALKSVVACGGTWMVPTSMMDSGDWEGIAELVRAVK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187304.1"
FT   gene            90739..91002
FT                   /db_xref="GeneID:10164786"
FT                   /locus_tag="VVM_00158"
FT   CDS_pept        90739..91002
FT                   /locus_tag="VVM_00158"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154926"
FT                   /db_xref="GeneID:10164786"
FT                   /translation="MADGEISGRLADGVSIGAKIQQGQHIAYVGKVVLKSGWTGEMLHL
FT                   EIYDGSATGILRAPLSESPYQRRKDLINPTDIFNMAQKRLPS"
FT                   /protein_id="YP_004187305.1"
FT   gene            91002..91532
FT                   /db_xref="GeneID:10164787"
FT                   /locus_tag="VVM_00159"
FT   CDS_pept        91002..91532
FT                   /locus_tag="VVM_00159"
FT                   /gene_family="HOG000144926" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154927"
FT                   /db_xref="GeneID:10164787"
FT                   /translation="MKLVFFLCGFALCFSQASFSKDNFLRNEYNLGEILDAIKFDANND
FT                   SIEDFILAANQITVENSDQTYVITSNLDEIQCKAHVNSDQKETKLLILHGQSREVHRLS
FT                   QAHLILPCVGDFHGVKYGMSFISQQALSKSLGYDLVSDPNQMLVVIPTEAGIDTYLYWT
FT                   GERYQLFYPPEEP"
FT                   /protein_id="YP_004187306.1"
FT   gene            complement(91700..93055)
FT                   /db_xref="GeneID:10164788"
FT                   /locus_tag="VVM_00161"
FT   CDS_pept        complement(91700..93055)
FT                   /product="glutathione reductase"
FT                   /gene_family="HOG000276712" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00161"
FT                   /EC_number="1.8.1.7"
FT                   /db_xref="GI:320154928"
FT                   /db_xref="GeneID:10164788"
FT                   /translation="MATHFDYICIGGGSGGIASANRAAMYGAKVALIEAKDLGGTCVNV
FT                   GCVPKKVMWHGAQIAEAMSLYAPDYGFDVEVKGFDWSKLVESRQAYIGRIHQSYDRVLG
FT                   NNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDL
FT                   AEQPKRVAVVGAGYIAVEIAGVLNALGTETHLFCRKESPLRSFDPMIIDTLVEVMAAEG
FT                   PTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLSATGVATNE
FT                   RGYIKVDEFQATNVAGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLV
FT                   PTVVFSHPPIGTIGLSEPEAIAQYGKENVKVYTSGFTAMYTAVTQHRQPCKMKLVCAGE
FT                   DEKVVGLHGIGFAVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187307.1"
FT   gene            complement(93207..94046)
FT                   /db_xref="GeneID:10164789"
FT                   /locus_tag="VVM_00163"
FT   CDS_pept        complement(93207..94046)
FT                   /locus_tag="VVM_00163"
FT                   /gene_family="HOG000262479" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA catabolism protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154929"
FT                   /db_xref="GeneID:10164789"
FT                   /translation="MLSYRHSFHAGNHADVVKHIVQSLILDSLKQKDKPFVYHDTHSGV
FT                   GRYDLTHEWSEKTGEYKQGVARIWDRSDLPADIASYIDSIKALNNGDKLRYYPGSPRVA
FT                   RAQLRDQDRMVLTELHPSDYPLLEQEFHRDRQVSIYKEDGFQRLKASLPPQERRGLVLI
FT                   DPPYELAKEYRDVVQAIYQSHKRWATGIYAIWYPVVNRCDIDDMLEGLEGLGIRKILQI
FT                   ELGVSPDTNERGMTASGMIVINPPWKLESQMQQILPFLKEAIAPATGHWKVEWIVPE"
FT                   /protein_id="YP_004187308.1"
FT   gene            94320..96362
FT                   /db_xref="GeneID:10164790"
FT                   /locus_tag="VVM_00164"
FT   CDS_pept        94320..96362
FT                   /product="oligopeptidase A"
FT                   /gene_family="HOG000245986" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00164"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="GI:320154930"
FT                   /db_xref="GeneID:10164790"
FT                   /translation="MSNPLLTFTDLPPFSQIKPEHVFPAVEQAIADCRAKIEQVLEGNN
FT                   TPSWETVIAPIEEVDDRLSRIWSPVSHMNSVVNSDELRDAYESCLPMLSEYGTWVGQHK
FT                   GLFEAYKAIKASEAFAKLTTAQQKTITDALRDFELSGIGLPADEQKRYGEISKRMSELS
FT                   SKFSNNTLDATMGWTKHITDEKELAGMPESALAAAKAAAEAKELGGYLITLDVPSYLPV
FT                   MTYCDNQALRREVYEAYVTRASDRGPNAGKWDNTEIINEQLKLRHEIARMLGFNTYSEK
FT                   SLATKMAENPAQVLGFLNDLATKAKPQGEREVAELRQFAEQEFGVSELNVWDIAYYSEK
FT                   QKQHLFQISDEELRPYFPESKAVSGLFEVLKRVFGMSVKEREGIDVWHNSVRFFDIFDA
FT                   QGELRGSFYLDLYAREHKRGGAWMDECRVRRINAQGELQTPVAYLTCNFNRPIGDKPAL
FT                   FTHDEVVTLFHEFGHGIHHMLTQVTTGAVSGINGVPWDAVELPSQFLENWCWEEEALAF
FT                   ISGHYETGEPLPKAMLEKMLAAKNFQSAMGILRQLEFGLFDFTLHTEFDPEIGPRVLET
FT                   LAEVKQKVAVLPAVEWARFSHSFGHIFAGGYCAGYYSYLWAEVLSSDAFSRFEEEGIFN
FT                   AETGQSFLNHILEMGGSEEPMALFKRFRGREPQIDALLRHSGIAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187309.1"
FT   gene            complement(96443..96907)
FT                   /db_xref="GeneID:10164791"
FT                   /locus_tag="VVM_00167"
FT   CDS_pept        complement(96443..96907)
FT                   /locus_tag="VVM_00167"
FT                   /gene_family="HOG000115326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator AsnC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154931"
FT                   /db_xref="GeneID:10164791"
FT                   /translation="MHSANAKIDDLDRAILKTLMADAKTPYAEMAKQFNVSPATIHVRI
FT                   EKMKAAEIIEGTEVVVNTKKLGYDVCCFIGINLNAARDYHSALEKLNALDEVVEAYYTT
FT                   GAYNIFVKLMCKSIEELQFVLIDKLQAIDEVQSTETLISLQNPINRNVNP"
FT                   /protein_id="YP_004187310.1"
FT   gene            complement(96922..97035)
FT                   /db_xref="GeneID:10164792"
FT                   /locus_tag="VVM_00169"
FT   CDS_pept        complement(96922..97035)
FT                   /locus_tag="VVM_00169"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154932"
FT                   /db_xref="GeneID:10164792"
FT                   /translation="MEKQNRTGSPSSHSAYEQKTLIVKDKLPLLVLYPYAD"
FT                   /protein_id="YP_004187311.1"
FT   gene            97034..100162
FT                   /db_xref="GeneID:10164794"
FT                   /locus_tag="VVM_00168"
FT   CDS_pept        97034..100162
FT                   /locus_tag="VVM_00168"
FT                   /gene_family="HOG000218237" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sensory box/GGDEF family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154933"
FT                   /db_xref="GeneID:10164794"
FT                   /translation="MLIMLCSFWASAHEKNILVVHSYHQGFFWTDSFQLGLAQTLGERD
FT                   IALRVLYLDTKRNQSASFLNQLYFLYKTKVEQERFDAIVVSDNVALQLMQRLAEPLAGT
FT                   PVIFGGINNYTPEMHAGLNATGVIEDIDLLSNVSLIERLQPQAQQIFVVTDHSITGVAL
FT                   RAQVDKFLSRYPEYQQKVQHLVPNTVAELIERVQTLDLDSAVLFWAYYRDADGTLSDDD
FT                   DWQELNRVSRAPIYMVHDLGLGHGAVGGVIQSGYKQGFATGEVLNQVLDSPASPLPKVK
FT                   VVEPDIKLDYQAVARWKLGVEGEPASVLVNKPEPFSVRYAQEIRLYSAVFVMLVLVIVL
FT                   LVYYLRRIQQSETLARESQSMLESIFDQSLQYIGILDRNGCLVSSNAQLQDLLFFQGVP
FT                   LDRPLWQHQHWEDASATRLADYFSATEAQLSTFEAEIWSRNLGAMMLEVSLKPLHSVGE
FT                   QRGQYLFEARDITSRKLMEEKLYKRESNLRNYYEQQPVMMVTLDKNNRIQQVNRFAQQL
FT                   LGYQPLEMLGHLLQEFYCDAQAMTPRQMLLQPTPALQGVWRREIEYRHQDGSAVWIREN
FT                   IRPLTESGQILIVGEDISHNKQLARQLEYQAKYDLLTDTFNRNQFDIELKRALREVESH
FT                   RRVHAMLYIDLDQLKVLNDTAGHDAGDGAIQFCASMLEEVLPHTAILARLGGDEFAVLL
FT                   KDSNEHTAIGVAKTIIATLSSQPFIWEKVQINLTCSIGIRMIDHTAESPQMVHAQADTA
FT                   CHAAKEQGRNRFKLFSLDSEELQRRQQEMESVNLVHDALANDRLELFAQRIIPLSKECD
FT                   KMHFEILTRIRDKQGEYLSPAIFMPASERYNIAHLIDEQVVTKTLDWLEAHPDALHQLG
FT                   RCSINLSGHSMGNPEFMAFLLDRLTNSVIPCHKLCLEITETAAMKNVALAMDFFAQVKA
FT                   LGCLIALDDFGSGLSSFGYLKQLPVDVVKIDGIFVQDMHRNESDHIMVRAINELAQQMG
FT                   KVTVAEFVENNEIIAQLMELGVDYAQGYVIGYPTPLAELVAQWQDEFTSRSGS"
FT                   /protein_id="YP_004187312.1"
FT   gene            100272..101051
FT                   /db_xref="GeneID:10164793"
FT                   /locus_tag="VVM_00174"
FT   CDS_pept        100272..101051
FT                   /product="SAM-dependent methyltransferase"
FT                   /gene_family="HOG000218236" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00174"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320154934"
FT                   /db_xref="GeneID:10164793"
FT                   /translation="MQLQLICEDAALQPYLDAIASKWQLTHDADSHFALVLTFERLELR
FT                   KLDEPKLGAIYVDLAGGAVAHRRKFGGGKGQAIAKAAGLNKGATPTVLDGTAGLGRDAF
FT                   VLASLGCKVQMVERNPVVAALLDDGLTRAKKDDEIGAWVSERMSLLHASSHDALAALAS
FT                   DAEFVRPDVVYLDPMYPHPENKKKTALVKKEMRVFQSLVGADTDADALLTPALALATKR
FT                   VVVKRPDYAEWLDGVKPSMAIETKKNRFDVYVNASMS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187313.1"
FT   gene            101211..101708
FT                   /db_xref="GeneID:10164795"
FT                   /locus_tag="VVM_00176"
FT   CDS_pept        101211..101708
FT                   /locus_tag="VVM_00176"
FT                   /gene_family="HOG000218235" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154935"
FT                   /db_xref="GeneID:10164795"
FT                   /translation="MTKRFCKMDRREIASQLGEIHQLVAAPKYLCRSCARASSSKSSLC
FT                   KPQAIPSLKSKAKPLAVKAATLPLPTSIAENQRPQTLLTAESVSAFDINLPSLGKKQLK
FT                   QAKQALKKQRKYHKKLAKLAKKKVKQLQKREKLEGKLNKYNGILRVLSHKQVLQGSAEQ
FT                   VH"
FT                   /protein_id="YP_004187314.1"
FT   gene            complement(101799..102689)
FT                   /db_xref="GeneID:10164796"
FT                   /locus_tag="VVM_00178"
FT   CDS_pept        complement(101799..102689)
FT                   /locus_tag="VVM_00178"
FT                   /gene_family="HOG000269445" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative acetate efflux pump MadN"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154936"
FT                   /db_xref="GeneID:10164796"
FT                   /translation="MFYLSAVTLLWAFSFSLIGVYLAGQVDSWFSVLMRVALASVVFVP
FT                   FLKFKGVSKRLIGKLMVVGGFQLGLMYCFYYQSFLLLSVPEVLLFTVFTPIYVTLIYDL
FT                   LHGRFSPWYLVTAIIAVLGAVFIKFATINPNFLLGFLVVQGANLCFAIGQVGYKYIMEK
FT                   EQLELPQHTVFGYFYLGALCVALVAFALMGNPSKLPTTELQWGILIYLGLIASGLGYFA
FT                   WNKGATLVNAGALAVMNNALVPAGLIVNIVIWNRDVDLLRLTLGGGVILFSLWLNETWV
FT                   KAKVERDFARKASQA"
FT                   /protein_id="YP_004187315.1"
FT   gene            complement(102755..103180)
FT                   /db_xref="GeneID:10164797"
FT                   /locus_tag="VVM_00179"
FT   CDS_pept        complement(102755..103180)
FT                   /locus_tag="VVM_00179"
FT                   /gene_family="HOG000238899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="universal stress protein A"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154937"
FT                   /db_xref="GeneID:10164797"
FT                   /translation="MSYQHILVAVDLSDDSKLLIDKAVSLAKALEAKVSFIHIDVNYAE
FT                   LYTGLIDINMAEAQHQAMEASRTQLANLAEYANFPITHTLVGSGDLSNELCDTIGEYQV
FT                   DLLVCGHHQDFWSKLLSSTRQLINCSPVDMLVVPLKE"
FT                   /protein_id="YP_004187316.1"
FT   gene            103348..103875
FT                   /db_xref="GeneID:10164798"
FT                   /locus_tag="VVM_00180"
FT   CDS_pept        103348..103875
FT                   /locus_tag="VVM_00180"
FT                   /gene_family="HOG000223382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferritin-like protein 2"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154938"
FT                   /db_xref="GeneID:10164798"
FT                   /translation="MLSQTMVEQLNAQINLEFFSSNLYLQMSAWCEDKGFDGAAQFLRV
FT                   HAVEEMQHMQRLFTYVSETGALPILGAIAAPKHDFASLGEVFRETYEHEQMITQQINKL
FT                   AHVAFTSQDYSTFNFLQWYVAEQHEEEKLFKGILDKIELVGEDGKALFFIDKDLAQMAK
FT                   EGSSSIMDAPAA"
FT                   /protein_id="YP_004187317.1"
FT   gene            103962..104285
FT                   /db_xref="GeneID:10164799"
FT                   /locus_tag="VVM_00182"
FT   CDS_pept        103962..104285
FT                   /locus_tag="VVM_00182"
FT                   /gene_family="HOG000218234" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="universal stress protein B"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154939"
FT                   /db_xref="GeneID:10164799"
FT                   /translation="MINGDIILFALMVVTGVNLARYLTALRSLIYIMREAHPLLYQQVD
FT                   GNGFFTTHGNVTKQVRLYHYLKSKEYHHHHDEVFTGKCDRVRELFVLSVSLTGVTLLAA
FT                   FLL"
FT                   /protein_id="YP_004187318.1"
FT   gene            104388..105575
FT                   /db_xref="GeneID:10164800"
FT                   /locus_tag="VVM_00183"
FT   CDS_pept        104388..105575
FT                   /locus_tag="VVM_00183"
FT                   /gene_family="HOG000043046" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NAD(FAD)-utilizing dehydrogenase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154940"
FT                   /db_xref="GeneID:10164800"
FT                   /translation="MSNKFDVVVIGAGAAGLMCAAEAGRRGRKVLVLDHAKKPGRKILI
FT                   SGGGRCNFTNNEVSAKNYLCRNPHFVKSALSQYSNWDFISMIYKYGIEFEERDHGQLFC
FT                   LDSAKEIVNMLLSECDQPNIAQRYQVQLTEIEKTEQGFVLRAGAEAFECQSLVVATGGL
FT                   SMPKLGATPFGYKIAEQFGIPVVPTTAGLVPFTLHKQDKEDFAELSGIAIPAEITAEDG
FT                   TLFKEALLFTHRGLSGPAVLQISSYWKAGQAVSINLVPEVDVLELLQRNLEKHPNQSMK
FT                   NTLAKVLPKRLVEVLIERNELTDKPLKQYNGKELQEIVEYLEHWKIAPNGTEGYRTAEV
FT                   TLGGVDTDYLSSKTMECKTVPGLYFIGEVMDVTGWLGGYNFQWCWSSGFVAGQWV"
FT                   /protein_id="YP_004187319.1"
FT   gene            complement(105657..106838)
FT                   /db_xref="GeneID:10164801"
FT                   /locus_tag="VVM_00187"
FT   CDS_pept        complement(105657..106838)
FT                   /locus_tag="VVM_00187"
FT                   /gene_family="HOG000270888" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HemY-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154941"
FT                   /db_xref="GeneID:10164801"
FT                   /translation="MIRLIFLFVVLGAGLFVGTQFSGQQGYVLISIANTTIEMSVTTLV
FT                   IFIVAALAGLFGLEYLVKKVLYTGFTTWNWFSVRKMRRSRRYTNEGIIKLLEGDWKGAE
FT                   KKVTRWASHHDMPLLCYLVASEAADGQGDRAKRDHYLALAAEQENAYLAVELTRSKQLV
FT                   REGEFALAFDSLQSLKGRYPNNPIVLNLLKTTYLELKLWQPLIDLLPTLNKQALISPED
FT                   AEQMHQRAQCGLLADVAGQQGSEGLIKHWNTLPRKVKQNPHLVACFAKQLIARKADHEA
FT                   LTVIKEALKKSPSPELYALLPQLNLSDVHPVIVMLEQNVKNDNHNAEAHSALAQLYFRE
FT                   GKWPQAQSHFETALKVRSSVSDYAFLADALEKQNLNKAAHEVSRKALTLVQNH"
FT                   /protein_id="YP_004187320.1"
FT   gene            complement(106835..108046)
FT                   /db_xref="GeneID:10164802"
FT                   /locus_tag="VVM_00188"
FT   CDS_pept        complement(106835..108046)
FT                   /locus_tag="VVM_00188"
FT                   /gene_family="HOG000270899" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HemX-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154942"
FT                   /db_xref="GeneID:10164802"
FT                   /translation="MTSKKNNEPNKPEETTSQPITSDASTPETSNTESTASVSADEPTV
FT                   TPTTPPPAAAAKKEDKKPSQKLSILAIIIALLGTGGVAFQLQQQNSQYQAQIAALQNQL
FT                   QQTQSAMNTELNQVKQETVAKATEVTHKAEVVLAQQQKSIESLQLAMADVKGRRPNDWL
FT                   LAEADYLVKLAGRKLFLEHDVVSATSLMESADQRIAALNDPSLVPLRKAMAKDITDLKT
FT                   IPLIDRDGLVLRLTALQQQVDQLPLANAILPEAKTVEKQQVSDDINNWQNNLMASLKAF
FT                   SENFITFRTRDGNVIPLLSPEQHFYLKENIKAKIETAIKAVYQEQGEVYTTSLTTAEAW
FT                   SQAFFNQDNNTVKEFTQSLKQLSEQKIQVQYPVKLQTQNQLADVIRERLRREVTSMTST
FT                   EAQQ"
FT                   /protein_id="YP_004187321.1"
FT   gene            complement(108061..108792)
FT                   /db_xref="GeneID:10164803"
FT                   /locus_tag="VVM_00190"
FT   CDS_pept        complement(108061..108792)
FT                   /product="uroporphyrinogen-III synthase"
FT                   /gene_family="HOG000247993" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00190"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="GI:320154943"
FT                   /db_xref="GeneID:10164803"
FT                   /translation="MAVLVTRPAEQGQALCQLLQQAGVPALQQPLIDIVANSSLNTLAN
FT                   DLKQSDVIIAVSQHAVQCAEHILKAQQQNWPQNALYLAVGQKTAHYLSKVTHQDVNYPT
FT                   VSDSEHLLQLPEFNRIAGKRVLILRGNGGRELIRQALSQRGADVRYCETYQRELIPFDA
FT                   VSSLTLWRDQGVDTLIVTSAEQLDYLHTQMSDEGKFWLYQQRLLVPSERIAAIATQLGF
FT                   TQVCNVGSASNKDLLAALQPK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187322.1"
FT   gene            complement(108794..109732)
FT                   /db_xref="GeneID:10164804"
FT                   /locus_tag="VVM_00191"
FT   CDS_pept        complement(108794..109732)
FT                   /product="porphobilinogen deaminase"
FT                   /gene_family="HOG000228587" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00191"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="GI:320154944"
FT                   /db_xref="GeneID:10164804"
FT                   /translation="MTHSTPIRIATRKSPLALWQAYYVKDALQKAHPGLEVELVTMVTK
FT                   GDVILDTPLAKVGGKGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICERED
FT                   PRDAFVSNTYHHVDELPQGAVVGTCSLRRQCQLKAYRPDLVIKELRGNVGTRLSKLDAG
FT                   EYDAIILAAAGLKRLELEERIRSFIEPEQSLPAVGQGAVGIECRTNDERILKLLEPLNH
FT                   TDTADRVKCERAMNLTLEGGCQVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEIRGPR
FT                   AQAEQLGVQLANQLLDEGAREILTKLYQDHE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187323.1"
FT   gene            110096..112630
FT                   /db_xref="GeneID:10164805"
FT                   /locus_tag="VVM_00192"
FT   CDS_pept        110096..112630
FT                   /product="adenylate cyclase"
FT                   /gene_family="HOG000270910" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00192"
FT                   /EC_number="4.6.1.1"
FT                   /db_xref="GI:320154945"
FT                   /db_xref="GeneID:10164805"
FT                   /translation="MQAYTEKLIQRLDTLNRQRIERALALMDLQSQQVFHLIPVLLHFN
FT                   HPAIPGYFDADVPFGVHGLKLNDIQQQFVDDTELTLGQSLPRAPHAQILGLYTMGSTSS
FT                   IGQSTSSDLDIWVCIPTQMGHDERESLANKCLLITDWAQMHGVEANFFLMDEDRFRSNR
FT                   SEEMTGDNCGSSQHMLLLDEFYRSAVRLAGQRLLWQIVPPEMEECYEQYVAELCNGGHI
FT                   NCNEWIDFGQLSRIPAEEYFGSNLWQLYKSIDSPYKSVLKAILLEAYSWEYPHTQLLSI
FT                   DSKRRFFAHEPDLYGMDAYYLMLEKVTRYLERINDHTRLDLVRRCFYLKTHEKLSREPG
FT                   VGSVAWRREALHELTSQWQWSQEVIVELDNRRNWKVEQVKVVHHALLDALMQSYRNLIQ
FT                   FARRNDITSAISPQDISILARKLYAAFEVLPGKVTLLNPQISPDLHEPDLSFIEVREGR
FT                   INKSGWYLYKQPLIAHRILGQPYLEHHEYLSKLVAWAFFNGLITESTRLHAVVREAQLD
FT                   IDKFYQMVSDLRNTFSLRKRRPTMQALASPCEISQLAMFINFENDPTAELSGRSLKVDL
FT                   KNADIFSFGTEQKCLIGSVDLVYRNSWHEVRTLHFRGETAMLDALKTVLGKMHQDAIPP
FT                   ESVDVFCYSKNLRGVMRNMVYQLLAECIDLRLKPVEQEKRRRFKAIRLAAQTFGLFFER
FT                   RGVSVQKLENSVDFYRSISTNKLKGSPLLMLDREDDYHLPPVVDGFASEGLIQFFFEDT
FT                   EKGFNIYVLDEANQVEVYHQFSGSKDEMIASVNSFYTAVKDDKHVASKCINFNLPQYYQ
FT                   IIHPQEEGQESYIIPYRNDACTQTKMSKAVNV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187324.1"
FT   gene            complement(112747..113061)
FT                   /db_xref="GeneID:10164806"
FT                   /locus_tag="VVM_00195"
FT   CDS_pept        complement(112747..113061)
FT                   /locus_tag="VVM_00195"
FT                   /gene_family="HOG000190728" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="frataxin-like CyaY"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154946"
FT                   /db_xref="GeneID:10164806"
FT                   /translation="MNNTEFHQLVDNELQLIEEAIDESGADIDYETTGNVMTLEFDDRS
FT                   QIIINRQEPMQEIWLASKSGGFHFQYKAGQWICSKTGVEFAHMVKQECEKHAGESIDWA
FT                   "
FT                   /protein_id="YP_004187325.1"
FT   gene            113137..113253
FT                   /db_xref="GeneID:10164807"
FT                   /locus_tag="VVM_00196"
FT   CDS_pept        113137..113253
FT                   /locus_tag="VVM_00196"
FT                   /gene_family="HOG000290399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative lipoprotein L"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154947"
FT                   /db_xref="GeneID:10164807"
FT                   /translation="MKKILTVLLTLSVALLAGCGQSGALYIPDDAQQSEQSQ"
FT                   /protein_id="YP_004187326.1"
FT   gene            113302..114555
FT                   /db_xref="GeneID:10164808"
FT                   /locus_tag="VVM_00197"
FT   CDS_pept        113302..114555
FT                   /product="diaminopimelate decarboxylase"
FT                   /gene_family="HOG000045070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00197"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="GI:320154948"
FT                   /db_xref="GeneID:10164808"
FT                   /translation="MDYFNYQDDGQLWAEEVSLTSLAEQYGTPLYVYSRATLERHWHAF
FT                   DRSVEGHPHLVCYAVKANSNLGVLNTLARLGSGFDIVSGGELERVLAAGGDPRKVVFSG
FT                   VGKTEAEMRRALELNIKCFNVESEPELERLNRVAGELGVKAPISLRINPDVDAQTHPYI
FT                   STGLRDNKFGIAFDRAPAVYQFAQSLANLNVQGIDCHIGSQLTAIEPFIDATDRLLALI
FT                   DDLKEQGINIRHLDVGGGLGVVYRNELPPQPSEYAKALLGRLENHQDLELIFEPGRAIA
FT                   ANAGVLLTKVEFLKHTEHKNFAIIDAAMNDLMRPALYQAWQDIVPVQPRQGEAVTYDLV
FT                   GPICETGDFLGKDRSLVLAENDLLAVRSAGAYGFVMSSNYNTRVRAAEVMVDGKQHYLV
FT                   RQREELRSLWELEHILPE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187327.1"
FT   gene            114566..115396
FT                   /db_xref="GeneID:10164809"
FT                   /locus_tag="VVM_00200"
FT   CDS_pept        114566..115396
FT                   /product="diaminopimelate epimerase"
FT                   /gene_family="HOG000220466" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00200"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="GI:320154949"
FT                   /db_xref="GeneID:10164809"
FT                   /translation="MHFHFSKMHGLGNDFMVVDCITQNVYFSQELIRRLADRHTGVGFD
FT                   QLLVVEAPYDPETDFHYRIFNADGSEVEQCGNGARCFARFVRMKGLTNKYSISVSTKKG
FT                   KMILDVEEDDQITVNMGVPEFEPNKIPFRAKQKEKTYIMRVGEKTLFCGAVSMGNPHVV
FT                   TVVDDVDSAEVETLGPLLESHERFPERVNAGFMQVVNREQIRLRVYERGAGETQACGSG
FT                   ACGAVAVGILQGLLDENVTVSLPGGDLHIHWQGPGKPLYMTGPATHVFDGQLSC"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187328.1"
FT   gene            115439..116140
FT                   /db_xref="GeneID:10164810"
FT                   /locus_tag="VVM_00201"
FT   CDS_pept        115439..116140
FT                   /locus_tag="VVM_00201"
FT                   /gene_family="HOG000265996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154950"
FT                   /db_xref="GeneID:10164810"
FT                   /translation="MSYPEADALTAEVVAEYLQDHADFFVHRPELVDRLNFPHPEQGTV
FT                   SLVHIQLNRQRQRIEALEEEITTLMSLAANNDRTFYEFMDLQEQILRCRDFQQVVKAIE
FT                   QKAHELGLVAYVRLLNQCEAKHQLSMENYQRFATNHLNGKSAYLGRLRNADREALFGDL
FT                   PVPEMGSYVVLPLVKQHPLGLLAFSSADGGHFQPEMDTLFLRHLSLVVAHLAQTLAWQL
FT                   QHDDSVKHTTA"
FT                   /protein_id="YP_004187329.1"
FT   gene            116109..117059
FT                   /db_xref="GeneID:10164811"
FT                   /locus_tag="VVM_00203"
FT   CDS_pept        116109..117059
FT                   /locus_tag="VVM_00203"
FT                   /gene_family="HOG000045294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tyrosine recombinase XerC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154951"
FT                   /db_xref="GeneID:10164811"
FT                   /translation="MTTASNTPLPSGLRKPLDQFYEYLRAEKGLSLHTQRNYKQQLETM
FT                   AEHLHSMGLKAWPQVDAGWVRQLAGKGMREGMKASSIATRLSSLRSFFDFLILRGILTA
FT                   NPAKGVSAPRKKRPLPKNLDVDEVNQLLEVNEDDPLAIRDRAIMELMYGAGLRLAELVD
FT                   IDVRDVHLRSGEIRVIGKGNKERKVPFAGMAVEWVGKWLKVRSGLADPSEPALFVSKLG
FT                   TRISHRSVQKRMAEWGQKQAVASHITPHKLRHSFATHILESSNNLRAVQELLGHENIST
FT                   TQIYTHLDFQHLADVYDQAHPRARKKSSQHKEEDE"
FT                   /protein_id="YP_004187330.1"
FT   gene            117056..117772
FT                   /db_xref="GeneID:10164812"
FT                   /locus_tag="VVM_00205"
FT   CDS_pept        117056..117772
FT                   /product="2-haloalkanoic acid dehalogenase"
FT                   /gene_family="HOG000248345" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00205"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="GI:320154952"
FT                   /db_xref="GeneID:10164812"
FT                   /translation="MKHYRPLQPIAAMTFDLDDTLYDNRPVIERLEREVLAWLAAQHPA
FT                   TQVMSHSDWSQLKREVAASSPQLRSDVTQLRHQQLTQAFLRLGYDVVAAQQAADEGVAV
FT                   ALYWRSQLVVPSETHRVMRLLADKLPLVAITNGNVDVAAIGLQGYFQAILKAGPDGVAK
FT                   PAGDLFQRAEQILQLPAQRILHVGDHLLSDVHGANLHGFMSCWINPKQINLRQQAKAKT
FT                   LPNLEINELSQLLLLL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187331.1"
FT   gene            117941..120391
FT                   /db_xref="GeneID:10164813"
FT                   /locus_tag="VVM_00207"
FT   CDS_pept        117941..120391
FT                   /locus_tag="VVM_00207"
FT                   /gene_family="HOG000218583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sensory box/GGDEF family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154953"
FT                   /db_xref="GeneID:10164813"
FT                   /translation="MQAMTTDYRWDAHNTYLVQIFSTQTASITQGYARHLLAHLPNVDI
FT                   IGHSTQHTIYGGEILTGGCLVVIAEFCHTTLTSAVVSYSGSAELDGYDLCQALQLTPAS
FT                   RAVISFSVQVERQDYPLYGAFNDGIATPVCGGLAQSGADGCWVLHQDQLYTQAAVAVAL
FT                   HSEQLKVWTSAYSEWNPVGMYHAVTAAEGQRLISLGNKPAYEVYKRYLADGHELSASHL
FT                   LNFPLYRERGKHKEVCAVREIHHDGSISFDKTWSIGDQVRFCYNHPSLTLEQLKHGVVE
FT                   LALHQPETVFIYNCASRLDFIDGCQEVAPFHQITTSHGSYCMGELYHDGLQQEILHHSL
FT                   TYLAMRESDEVTELKLPADDVDSTISPLFCLIRNAIADLDQVQSHMEYQLERQALKLQE
FT                   SYRRDSRTGLQNRIALKEYLSTIRDDEHLLTLKLLNFSHINEKYGYQVGDELLRMLSVS
FT                   FLTRLRRRLGKQADMQLYSIGVGEWAFVFRAEICGETIKQQFTRFADVIEQTNFEPSGL
FT                   EQVDYLSISLCGGLASRRDFPQASGDELLLKAIEARRAGVRSNTHICNAKDIQVSDEQR
FT                   KEQLAWLSCVSRAILQQNIVTYAQPLFHADGTTPYSQECLVRIVENDGRIILPGQFLPI
FT                   IADTHLYTRLSRHMIQSTLNYMRERDGMFSINLSPQDLMSDKTMLLLETAIRQLNDPSR
FT                   IGLEVLESEQIKDYGRMIEVCSHFRQLGARIIVDDFGSGYSNIDEIIKLEPDIIKLDGS
FT                   LIRNIDQDSKQRKIASQLVRLCQVLEAKTVAEFVHNQQVCEIAQDMGVDYLQGYYLGQP
FT                   SRLF"
FT                   /protein_id="YP_004187332.1"
FT   gene            complement(120436..121044)
FT                   /db_xref="GeneID:10164814"
FT                   /locus_tag="VVM_00211"
FT   CDS_pept        complement(120436..121044)
FT                   /locus_tag="VVM_00211"
FT                   /gene_family="HOG000278320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154954"
FT                   /db_xref="GeneID:10164814"
FT                   /translation="MKPQACPQCGLRYQCLCDQFPSLQSEVALVLLMHPNEVERETNTG
FT                   KLLHWCRLPVRQFVWQRAAPPQALLDLLSDAQFMPVVLYPSEQSITLTQIKERAQQTQR
FT                   QPLFIILDATWQEARKMLNKSEWLQALPQLALHGDSASNYQLRRNQQQGNLCTLEIAAE
FT                   LVKQLGEAHNATSMTELLRDYLAAFHADRSGHALKSEPQ"
FT                   /protein_id="YP_004187333.1"
FT   gene            complement(121041..122591)
FT                   /db_xref="GeneID:10164815"
FT                   /locus_tag="VVM_00214"
FT   CDS_pept        complement(121041..122591)
FT                   /locus_tag="VVM_00214"
FT                   /gene_family="HOG000218311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154955"
FT                   /db_xref="GeneID:10164815"
FT                   /translation="MKAFKNPVALSTLLLLQACSTSAPVATQSAPVLPTANLSQPESVV
FT                   AQSFMLSGSLVVGHEAQYITPCGSTQQYWLQLSAQQRQQLMALTSLPYQSMYGEVIGHL
FT                   KTTGDEGFASEYDALFVVEQLNLVDASNPTRCEQAARPTQAFGNEPNWRIDFAANQLTI
FT                   KQLSKQEQTRVISRSQLSPRKREYQFDDGQLLLTENLCKDTMSNSLYGWKATLDWQDTQ
FT                   LSGCATTSNIDATLGWGGLYTATSTQSSGFSVHMQLNADHSAETRYLYANEERPLVEKG
FT                   YWQQLNPNQIQVVMTHHQGQKLVTERIFTRTGSQLKADKEKVGQVVYPIAQGGLILYPA
FT                   AAGEMMSDAPITTQTAIPTDTRNVASSAEFRRDVDQAIREYFRLHKTDPSNNQYRWLTY
FT                   DLNGDGKEELLAQLDWCGSGGCTLLIFENHQETWRFNSRITLVNTPIYLGNQRNHGWQD
FT                   LIFNVSGGGAKAQSHLMQYDGISYPLNPSVAPVALGEQISPVELFADGISPVREGVKL"
FT                   /protein_id="YP_004187334.1"
FT   gene            122741..123103
FT                   /db_xref="GeneID:10164816"
FT                   /locus_tag="VVM_00215"
FT   CDS_pept        122741..123103
FT                   /locus_tag="VVM_00215"
FT                   /gene_family="HOG000263533" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154956"
FT                   /db_xref="GeneID:10164816"
FT                   /translation="MLRDEVKEGDWVMIYHSSCKHVGVAGIAKVVREAYPDHFQFDANS
FT                   DYYDVKSTPENPRWIMVDVEFVRKTERVIPLAVLKAMPELENMPLVKKGNRLSVMPVTE
FT                   QEWQAILTKEKLPSRR"
FT                   /protein_id="YP_004187335.1"
FT   gene            complement(123201..124031)
FT                   /db_xref="GeneID:10164817"
FT                   /locus_tag="VVM_00217"
FT   CDS_pept        complement(123201..124031)
FT                   /locus_tag="VVM_00217"
FT                   /gene_family="HOG000184784" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cof protein HD superfamily hydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154957"
FT                   /db_xref="GeneID:10164817"
FT                   /translation="MTASLPNKEITKIVASDLDGTLLAPNHQLSEFSKQTLKALHEQGY
FT                   TFIFATGRHHVDVAGIRAQVGIPAYMITSNGARVHDQHDQLMYSKNVPAELVQPVIDIV
FT                   KQDPEIFVHLYQNEDWRLNREDEVMRKFHEETGFTYKVYDIDNAPTDGIAKIFFTHPEQ
FT                   DHEHLVGFENQLREAFGDKLNIAFSTPWCLEVMAAEVSKGDALKAVAESLGLTLENCVA
FT                   FGDGMNDVEMLSMAGKGLVMETSHEKVKKALPDNEIIGSNADDAVAHYLQKHLL"
FT                   /protein_id="YP_004187336.1"
FT   gene            complement(124212..125210)
FT                   /db_xref="GeneID:10164818"
FT                   /locus_tag="VVM_00219"
FT   CDS_pept        complement(124212..125210)
FT                   /product="lysophospholipase L2"
FT                   /gene_family="HOG000285163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00219"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="GI:320154958"
FT                   /db_xref="GeneID:10164818"
FT                   /translation="MVNNSSPLSYTQEALFEQAIGGPIAALWQQRQEGFLKTRDKMQLY
FT                   WCKLTNPQHKKAVLVVNGRIESAWKYQELLFDLYRQGYDVYSYDHRGQGLSDRLVKDSD
FT                   IGHVYEFDDYILDMEAVIAHFDFSSYQQRHIVSHSMGGAVATRYLQTHPQHGFDKLVLS
FT                   APMFGIDLPWYLSPVAMAVSQILTAVYPTPTYAPGHKSYYEKPFEDNPLSQSQARYQWF
FT                   RQLYRDKPELQVGGPSTRWVWQGLMAAKQCILLTRQLTIPVLLLQAGGDRIVSNQAQSQ
FT                   FFKKLHKTNKRSEMVTIEGAQHELLFEKDHYRNQALSAMFRFLQKEESNQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187337.1"
FT   gene            125274..125891
FT                   /db_xref="GeneID:10164819"
FT                   /locus_tag="VVM_00220"
FT   CDS_pept        125274..125891
FT                   /locus_tag="VVM_00220"
FT                   /gene_family="HOG000122945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154959"
FT                   /db_xref="GeneID:10164819"
FT                   /translation="MDTHVWLAYVVTAIVFSLAPGSGTVNSISNGLSYGTRKSLASIVG
FT                   LQIGLAVHIVLVGAGIGALVAQSATAFTVIKWVGAVYLVWLGIQKWRDTSSLATASQQH
FT                   AISSTALLRKAVLINLTNPKSIVFLVALFPQFIDPSQDQVTQLAVLGITTVVIDAFVML
FT                   GYTTLASQLGRFIRSEKVMGKINKVFGSMFMGCGALLAAAKS"
FT                   /protein_id="YP_004187338.1"
FT   gene            126014..127168
FT                   /db_xref="GeneID:10164820"
FT                   /locus_tag="VVM_00222"
FT   CDS_pept        126014..127168
FT                   /locus_tag="VVM_00222"
FT                   /gene_family="HOG000277322" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative signal transduction protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154960"
FT                   /db_xref="GeneID:10164820"
FT                   /translation="MFRDGESNAYPVHIESNRATYRLIVENFLSVGTNPAIASSRCFIN
FT                   FPYQTLIRRLPLSLPKNKVVIEVLETCQPTDELLDAIRDLYREGYVIALDDFTLTPEWR
FT                   RFLPYVHIVKLDVMDLGMEKACELVKEHLARRVKYHFLAEKVETAEEFELAKEAGFKFF
FT                   QGYFFSKPEVVQTRYVSPEQTVALELFREVCKSEPDFGRIEQIISQDVALSYKLLRFVN
FT                   TQSTRLEVTISSFRQALIYLGQDKLKMFVSLVVASYVSTNKPRELYNLSLQRAQFCELM
FT                   SRRHPFSKHNEQGFMIGLLSILDAMMDLSVESLVNHLPLSEIAKQALLCRGGAYGALIA
FT                   LEECFEQADWRGIEQWCEQLGLSIEEVRYELVEAQRWSQEFALI"
FT                   /protein_id="YP_004187339.1"
FT   gene            127275..127610
FT                   /db_xref="GeneID:10164821"
FT                   /locus_tag="VVM_00224"
FT   CDS_pept        127275..127610
FT                   /locus_tag="VVM_00224"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154961"
FT                   /db_xref="GeneID:10164821"
FT                   /translation="MLPHQFFKLLSDETRVRCLMLVAREGKICVGELTYALQESQPKVS
FT                   RHLAQLRASGLLVDERQGQWVFYRLSEQLPGWMKKMVDDLIASNCLKQVYQQDIARLHQ
FT                   QDRVACC"
FT                   /protein_id="YP_004187340.1"
FT   gene            127640..128641
FT                   /db_xref="GeneID:10164822"
FT                   /locus_tag="VVM_00226"
FT   CDS_pept        127640..128641
FT                   /product="NAD-dependent glyceraldehyde-3-phosphate
FT                   /gene_family="HOG000071679" [ FAMILY / ALN / TREE ]
FT                   dehydrogenase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00226"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="GI:320154962"
FT                   /db_xref="GeneID:10164822"
FT                   /translation="MTIKVGINGFGRIGRLAMRAAFDWPELEFVLINDVAGDATTLGHL
FT                   LEFDSVQGRWHHEVTVQGQQLHINGHVIETTQQRDISAVDWSGCDVVIEATGVHRKSRF
FT                   LNQYLEQGVKRVVVSAPVKEEGIANIVVGVNDEIFNPEQHRIVTAASCTTNCIAPVVKV
FT                   IHEKFGIEQASFTTIHDLTNTQTILDAPHKDLRRARACGMSLIPTTTGSATAIVEIFPE
FT                   LKDRINGHAVRVPLANASLTDIIFDVKRDTTAEEVNALLKEASQGELNGILGFEERPLV
FT                   SIDYRGDQRSTIVDALSTMVVGTRMVKIYAWYDNEMGYATRTAELVRKVGAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187341.1"
FT   gene            128641..129150
FT                   /db_xref="GeneID:10164823"
FT                   /locus_tag="VVM_00229"
FT   CDS_pept        128641..129150
FT                   /locus_tag="VVM_00229"
FT                   /gene_family="HOG000271003" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative protein-tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154963"
FT                   /db_xref="GeneID:10164823"
FT                   /translation="MATSITNHPVWQLDLPSGALVLTPCPGTKGVDLRSSLQQLADSGV
FT                   QAVVTALGDTELASKEVAELGQLVVELGMRWYQIEIEDDCAPDETFAVHWQQASPELQA
FT                   ILRDGGKVALHCMGGSGRTGLFAAHLLLEQGWALDDIIREVQALRPGAFTREVQLSYIE
FT                   SVANAQ"
FT                   /protein_id="YP_004187342.1"
FT   gene            129215..130435
FT                   /db_xref="GeneID:10164824"
FT                   /locus_tag="VVM_00230"
FT   CDS_pept        129215..130435
FT                   /locus_tag="VVM_00230"
FT                   /gene_family="HOG000286883" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="permease of the major facilitator superfamily"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154964"
FT                   /db_xref="GeneID:10164824"
FT                   /translation="MMIAQLSKSVRQYMLVTFNYWNFTLTDGALRMLVVLYFHDLGYSA
FT                   LAIASLFLFYEFFGVVTNLIGGWLGARLGLNKTMNIGLAMQIIALLMLAVPAAWLTIPW
FT                   VMAAQALSGIAKDLNKMSAKSAIKTLVPDEQQGALFKWVAILTGSKNALKGAGFFLGGL
FT                   LLAVLGFQYAVLVMAGGLTLVLIGSLLSLESEMGKAKNKPKFNEIFSKSAPVNILSAAR
FT                   LFLFGARDVWFVVALPVYLGGVFGWDHLWVGGFLALWVMGYGVVQGIAPRITGKAQGRV
FT                   PDGHSAFYWAALLALLTGAIAYAVQQAWHPQQVIVIGLLLFGAVFAINSSLHSYLIVSY
FT                   AKGDGVSLDVGFYYMANAMGRLIGTLLSGWIYQEFGLAACLWVSCFFLALTTLISIKLP
FT                   RFAAKTA"
FT                   /protein_id="YP_004187343.1"
FT   gene            130535..131548
FT                   /db_xref="GeneID:10164825"
FT                   /locus_tag="VVM_00233"
FT   CDS_pept        130535..131548
FT                   /locus_tag="VVM_00233"
FT                   /gene_family="HOG000004738" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="inner membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154965"
FT                   /db_xref="GeneID:10164825"
FT                   /translation="MRERVQFFDLLRCVAAVAVIAIHVLAPYRHELGGIPFDQWVTAVG
FT                   INGISRWAVPVFILITGALMLSDTRPFDLPYYARRRLGKVLIPFLFWSLFYALLSGLSA
FT                   SGFDSSKVTEVLSNSPEHATYYHLGFFYYFIPLYFVIPMFQWLVRHQRQDILYLFTALW
FT                   LFTTVLYLAGIDGPWSYELWLYSGYLPLGYLLFSKVPNQRSVVVGSVLLGGMALAATVI
FT                   MVVSNSLATGEYTVGRWLSYKTINVVLAASMVFVLCRSVGERLSAQWQKWVALISRHSL
FT                   GIYLLHPIFLWPMKELGWYQGHPAWVIPLWVVLSGAGALALSYLFSLSAKTRWLLP"
FT                   /protein_id="YP_004187344.1"
FT   gene            complement(131545..131874)
FT                   /db_xref="GeneID:10164826"
FT                   /locus_tag="VVM_00235"
FT   CDS_pept        complement(131545..131874)
FT                   /locus_tag="VVM_00235"
FT                   /gene_family="HOG000218310" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154966"
FT                   /db_xref="GeneID:10164826"
FT                   /translation="MPISFVFAVLALIAIGGWLFVRFYRTHIQGNNAPEQKVQVTVLDK
FT                   QVIPIADAQPGEDDQEYWIYVQRGALGPKREFQVGVHYFHALNPGDKGELTYKGDKFLH
FT                   FALKR"
FT                   /protein_id="YP_004187345.1"
FT   gene            132110..132478
FT                   /db_xref="GeneID:10164827"
FT                   /locus_tag="VVM_00237"
FT   CDS_pept        132110..132478
FT                   /locus_tag="VVM_00237"
FT                   /gene_family="HOG000218309" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154967"
FT                   /db_xref="GeneID:10164827"
FT                   /translation="MSEIEQVVTRTRRLETLLRTQYHAEGKGLHQLVTSCEERLPHDVI
FT                   GKLRFIATVRNKVVHEDNYQLDDKQSFLAACDECEKELTPRSGRFIWRVAILLMLSMTL
FT                   GAMAFYYANWDVLSQHFK"
FT                   /protein_id="YP_004187346.1"
FT   gene            132974..133108
FT                   /db_xref="GeneID:10164828"
FT                   /locus_tag="VVM_00238"
FT   CDS_pept        132974..133108
FT                   /locus_tag="VVM_00238"
FT                   /gene_family="HOG000144925" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154968"
FT                   /db_xref="GeneID:10164828"
FT                   /translation="MSGVGGSCCSFGLIVVFFDGVDLKFKKVNRGCMEDLSLDEKTMM"
FT                   /protein_id="YP_004187347.1"
FT   gene            133510..134130
FT                   /db_xref="GeneID:10164829"
FT                   /locus_tag="VVM_00240"
FT   CDS_pept        133510..134130
FT                   /locus_tag="VVM_00240"
FT                   /gene_family="HOG000204433" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154969"
FT                   /db_xref="GeneID:10164829"
FT                   /translation="MWSWLAIGLSGMTSVLGARQASPFQSLFFKVFTLVLLLILVLTQG
FT                   PDSAHSYWIAAGLLVSIFADTLHSLKSKKTLYFSGFLLAQLCYSKSFWLQLNGDIVWWL
FT                   LALLLAASIVAFFLLLPQLDSLVFPVVIMGIMLVQLAWAAGEVWLQASNFSNAIGFAGT
FT                   LVMIYSALAYAIHGYRKPMKRAYVWVSGSYFVAHALIVASIIY"
FT                   /protein_id="YP_004187348.1"
FT   gene            134258..134428
FT                   /db_xref="GeneID:10164830"
FT                   /locus_tag="VVM_00242"
FT   CDS_pept        134258..134428
FT                   /locus_tag="VVM_00242"
FT                   /gene_family="HOG000222013" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154970"
FT                   /db_xref="GeneID:10164830"
FT                   /translation="MDRTELLAHFGGETRFHTCKLQGLDLDSLLSFLLEREKISEQQGK
FT                   FCVNLARICNH"
FT                   /protein_id="YP_004187349.1"
FT   gene            134621..135214
FT                   /db_xref="GeneID:10164831"
FT                   /locus_tag="VVM_00243"
FT   CDS_pept        134621..135214
FT                   /locus_tag="VVM_00243"
FT                   /gene_family="HOG000112970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multiple antibiotic resistance protein MarC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154971"
FT                   /db_xref="GeneID:10164831"
FT                   /translation="MDILAAATMLFLIMDPLGNLPIVLSILKHIDAKRRRKVLIRELLF
FT                   ALLILMLFLFAGQSIMKFLQVEPETLSISGGIILFIIAIKMIFPSAGSITGLAAGEEPF
FT                   IVPMAIPMIAGPSVIAALLLLSSQHPNNLTDLSIAVLIAWFATFIILMFYSFFHRILGE
FT                   RGLKAVERLMGLLLVMISTQMFLNGVKSYMGAVS"
FT                   /protein_id="YP_004187350.1"
FT   gene            complement(135280..135546)
FT                   /db_xref="GeneID:10164832"
FT                   /locus_tag="VVM_00245"
FT   CDS_pept        complement(135280..135546)
FT                   /locus_tag="VVM_00245"
FT                   /gene_family="HOG000001825" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154972"
FT                   /db_xref="GeneID:10164832"
FT                   /translation="MKALLFLAKAAISFVWLILLFNIFSPFPGNAAIVLYIMTAFLFIM
FT                   HGLQMLIFVGAFGDKITMTRWEKNSILIFGIFALLDIRRKYMM"
FT                   /protein_id="YP_004187351.1"
FT   gene            complement(135565..136158)
FT                   /db_xref="GeneID:10164833"
FT                   /locus_tag="VVM_00246"
FT   CDS_pept        complement(135565..136158)
FT                   /product="methyltransferase"
FT                   /gene_family="HOG000050676" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00246"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320154973"
FT                   /db_xref="GeneID:10164833"
FT                   /translation="MVRRRQQNTSQNKPTTGCVRIISGLWRGRKLPVHDAEGLRPTTDR
FT                   VKETLFNWLAQDIPRARCLDLFAGSGGLGFEAASRQAEQVTMLELNPKAFAQLQQNVTA
FT                   LKANNIKVIQGDALQFLKQQGTPHHVVFIDPPFRQGLLAEAVTLLEQNGWLAEDAMIYI
FT                   ETEKELQVEALPASWHLHREKTAGQVSYRLYERQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187352.1"
FT   gene            136364..137551
FT                   /db_xref="GeneID:10164834"
FT                   /locus_tag="VVM_00247"
FT   CDS_pept        136364..137551
FT                   /locus_tag="VVM_00247"
FT                   /gene_family="HOG000036278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal recognition particle receptor protein FtsY
FT                   subunit alpha"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154974"
FT                   /db_xref="GeneID:10164834"
FT                   /translation="MTEKKKRGLLSWLGFGDDDQVKQPEPAQSEEVISESDEKTVESVE
FT                   PIASQEVVEEAAAEPISEPAAEEPVEATPVVVEAPRVQEQEKPTESFFARLKRSLSRTK
FT                   ANIGAGFFGLFKGKKIDDDLFEELEEQLLVADVGMDTTLKIIENLTEKASRRDLKDGEA
FT                   LYGLLKEEMAEILSKVEQPLQVDSSKTPYVILMVGVNGVGKTTTIGKLAKQFQNQGKKV
FT                   MLAAGDTFRAAAVEQLQVWGERNNVPVIAQHTGADSASVIYDAIEAAKARGVDVVIADT
FT                   AGRLQNKSNLMEELRKIVRVMKKIDDSAPHEIMLTLDAGTGQNAISQAKLFSDVAPITG
FT                   ITLTKLDGTAKGGVIFAIADQFNIPIRYIGVGEGIEDLRPFETQEFIDALFSREE"
FT                   /protein_id="YP_004187353.1"
FT   gene            137572..138249
FT                   /db_xref="GeneID:10164835"
FT                   /locus_tag="VVM_00249"
FT   CDS_pept        137572..138249
FT                   /locus_tag="VVM_00249"
FT                   /codon_start="1"
FT                   /product="cell division transporter, ATP-binding protein
FT                   FtsE"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154975"
FT                   /db_xref="GeneID:10164835"
FT                   /translation="MIRFQQVSKAYRGGRQALQKVDFHLRRGEMAFLGGHSGAGKSTLL
FT                   KLICAIERPTDGRISFNGHDITRIPNKDVPFLRRNIGIVFQDHRLLMDRSVYDNVALPM
FT                   RIESISENEIKRRVSAALDKTGLLDKARCLPSQLSGGEQQRVGIARAVVNRPTLLLADE
FT                   PTGNLDPELSNRVLRLFEEFNRAGVTILLATHDINLVNSRPQYRHFELNQGFLSEVEDY
FT                   GRE"
FT                   /protein_id="YP_004187354.1"
FT   gene            138236..139204
FT                   /db_xref="GeneID:10164836"
FT                   /locus_tag="VVM_00250"
FT   CDS_pept        138236..139204
FT                   /locus_tag="VVM_00250"
FT                   /gene_family="HOG000270397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell division protein FtsX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154976"
FT                   /db_xref="GeneID:10164836"
FT                   /translation="MAANKRLKKPASKSTSNRPKTDGFVSIHIKQAKASFKAIWHRPLG
FT                   NILTLAVISMALAMPACLYLLGKNIAVATSHVTSPAQVSAYLREGVPEARVMVLKDELE
FT                   TQQDVELVEYISPQQGLEHLSQYSGFDQALSLLEDYALPGVLVITPAVEENNAIKALAQ
FT                   QLRQEEDITDVRLDEDWLTRLDAIKTVATIIVMTLTLLMLGAVFLIVGNTLRFNVLANK
FT                   EEIQTMKLIGATDNFILRPYLYSGMWFGLLGAVSAWCFTALITVLLNGAVADLAALYDS
FT                   QFRLIGLSWDESLLLVMTGTFLGCVAAKVSAQRHLKEIEPV"
FT                   /protein_id="YP_004187355.1"
FT   gene            139381..140238
FT                   /db_xref="GeneID:10164837"
FT                   /locus_tag="VVM_00254"
FT   CDS_pept        139381..140238
FT                   /locus_tag="VVM_00254"
FT                   /gene_family="HOG000270269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor RpoH"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154977"
FT                   /db_xref="GeneID:10164837"
FT                   /translation="MTTQAYPMALVTQDSLDGYIRSVNSYPMLTADEERDLAERLHYKG
FT                   EIEAAKGLILSHLRFVVHVARGYSGYGLPMADLVQEGNIGLMKAVKRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKIATTKAQRKLFFNLRKSKKRLGWFNNGEVETVARELGV
FT                   EPAEVREMESRLAAVDSTFDLPNEEDDSSSVSTAPVLYLEDKSSDVADNLEAQNWEAHT
FT                   NNRLAMALASLDERSQHIVRSRWLDDDKATLQDLAEMYGVSAERIRQLEKNAMKKLKMA
FT                   VGEI"
FT                   /protein_id="YP_004187356.1"
FT   gene            complement(140263..140409)
FT                   /db_xref="GeneID:10164838"
FT                   /locus_tag="VVM_00255"
FT   CDS_pept        complement(140263..140409)
FT                   /locus_tag="VVM_00255"
FT                   /gene_family="HOG000144924" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154978"
FT                   /db_xref="GeneID:10164838"
FT                   /translation="MINNYFTELFTGLASFRDHFRHSISIKNTRHDVVTGNKKAEIIDL
FT                   GFC"
FT                   /protein_id="YP_004187357.1"
FT   gene            140674..140994
FT                   /db_xref="GeneID:10164839"
FT                   /locus_tag="VVM_00257"
FT   CDS_pept        140674..140994
FT                   /product="thiosulfate sulfurtransferase GlpE"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00257"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="GI:320154979"
FT                   /db_xref="GeneID:10164839"
FT                   /translation="MEQFKHIDVQGAHALISRGEARLVDIRDPQSFAVAHAQSAFHLTN
FT                   DSIVNFMQQVEFEQPVLVMCYHGISSQGAAQYLVNQGFEEVYSVDGGFEAWHRASLPVE
FT                   AS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187358.1"
FT   gene            141079..141921
FT                   /db_xref="GeneID:10164840"
FT                   /locus_tag="VVM_00258"
FT   CDS_pept        141079..141921
FT                   /locus_tag="VVM_00258"
FT                   /gene_family="HOG000269640" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GlpG protein (membrane protein of glp regulon)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154980"
FT                   /db_xref="GeneID:10164840"
FT                   /translation="MQRLIVLNNPRMAQAFIDYMASRQIDLRMMPEGEGQFALWLMDDQ
FT                   HWVETEAELKQFLANPGDSKYSAASWDMAETRKTQFSYRSPSLLAMVKAKAGPVTMAVM
FT                   VACVAVYVLMMFGWESALLSAMHFPAEAAQQWQLWRWVSHALLHFSVTHIVFNLLWWWQ
FT                   FGGDIEQRLGSGKLLQIFVISAALSGAGQFWVEGANFGGLSGVVYALLGYAWILGYRVP
FT                   HLGLSVPRPVVAFMLVWLILGYVQPFMAIANTAHLVGLLSGMGLAYLDSTKQKHQKAA"
FT                   /protein_id="YP_004187359.1"
FT   gene            complement(141970..142380)
FT                   /db_xref="GeneID:10164841"
FT                   /locus_tag="VVM_00260"
FT   CDS_pept        complement(141970..142380)
FT                   /locus_tag="VVM_00260"
FT                   /gene_family="HOG000269819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flagellar biosynthesis protein FliL"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154981"
FT                   /db_xref="GeneID:10164841"
FT                   /translation="MYKRYIAQIIIAFSLLFSLPLHAEEEQTGPQLAYFTLEPDLTTNF
FT                   YTKGKKLGYIQVRIDIMVMSNADLALVEHHQPLIRDAVVELLGQQSEDTVKSLAGREDL
FT                   RKHLVEKLNEILLPETGKTVIADLLFTKYLYQ"
FT                   /protein_id="YP_004187360.1"
FT   gene            142553..143092
FT                   /db_xref="GeneID:10164842"
FT                   /locus_tag="VVM_00261"
FT   CDS_pept        142553..143092
FT                   /product="chorismate--pyruvate lyase"
FT                   /gene_family="HOG000137785" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00261"
FT                   /EC_number="4.1.3.40"
FT                   /db_xref="GI:320154982"
FT                   /db_xref="GeneID:10164842"
FT                   /translation="MNQPNSLYLALLIEAKWQNPEDFHFSSDFAKHWLLEQGSLSRRLA
FT                   RHCQHLTVELMRNEKSGMGQLTRQETQGLSPEICLIREVVLSGDQTPWVLGRTLIPETT
FT                   LADQPYDLATLGDIPLGLTVFSAEQVERDALQVAWIETPQGRLLARRSRLWMNHKPMLV
FT                   AELFLPDAPIYSRESV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187361.1"
FT   gene            143093..143947
FT                   /db_xref="GeneID:10164843"
FT                   /locus_tag="VVM_00263"
FT   CDS_pept        143093..143947
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /gene_family="HOG000003696" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00263"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="GI:320154983"
FT                   /db_xref="GeneID:10164843"
FT                   /translation="MSVEKAKAYWQLMRMDRPIGTLLLLWPTLWALIIAAEGTPDWHVL
FT                   LVFVLGVVLMRSAGCVINDFADRKVDGHVKRTQQRPLPSGRVTAKEAIILFLLLGISSF
FT                   LLVLTMNPLTIQLSFAGIVLAFIYPFMKRYTHLPQLFLGLAFSWAIPMAWAAQANELPW
FT                   VVWFVFAINALWTIAYDTQYAMVDRDDDVHIGVKSTAILFGRHDKLIIGLLQLLTLVML
FT                   VWLGLHYQLGQSFYWSVLAAGALFVYQQHLIRHRQRELCFQAFLNNNYVGMVLALGLFV
FT                   AFW"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187362.1"
FT   gene            complement(143960..144094)
FT                   /db_xref="GeneID:10164844"
FT                   /locus_tag="VVM_00265"
FT   CDS_pept        complement(143960..144094)
FT                   /locus_tag="VVM_00265"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154984"
FT                   /db_xref="GeneID:10164844"
FT                   /translation="MIGPGWRASERMQPTPLQLQVGRVYNKGIPWMPLFFFFCATNAK"
FT                   /protein_id="YP_004187363.1"
FT   gene            complement(144177..146606)
FT                   /db_xref="GeneID:10164845"
FT                   /locus_tag="VVM_00267"
FT   CDS_pept        complement(144177..146606)
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /gene_family="HOG000218231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00267"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="GI:320154985"
FT                   /db_xref="GeneID:10164845"
FT                   /translation="MSSGQSFSHSLLKLPLSTLVKGTAIPSNPIDDHHIDINKPIVYAL
FT                   PFRSAVDLLTLQKHALELGLPDPLSPLEIHGKSLKRYVFIASRPTLVQSDNDVPSDSIA
FT                   LFSDLLALHAEDSELDVQVIPATVLWGRKPGKEGNNKPYLQAMNGLQKAKAVITAGRDC
FT                   LVRFSPVVSLRYMAQSHGTDSSIAHKLARVARIHFSRQKLAASGPDLPSRQVLFARLMK
FT                   SPAIEQAIEEEAKSKNISMEKARKEAQDIMDEIAADFSYSLVKQGDRLLGWLWNKLYQG
FT                   LNINNAATVRRLAQDGHEIVYVPCHRSHMDYLLLSYVLYHEGMVPPHIAAGINLNFFPA
FT                   GPIFRRGGAFFIRRSFKGNRLYSTIFREYLAELFAKGYSVEYFSEGGRSRTGRLLPAKT
FT                   GMLAMTIQAMLRGLNRPVTLVPVYIGYEHVMEVATYAKELRGKRKEKENAGLVLRTLRK
FT                   LRNFGLGYVNFGEPIPLNQYLNEHAPEWTKDIDPMGASRPQWINPVVNQLANKMMTHIN
FT                   DAAAANALTLCATALLASRQRALSKDSLIHQIECYLQLLKNVPYSKTYTVPSESAEALV
FT                   EHAISLDKFVIETDTMGDIISLDRNQSILMTYYRNNIIHLFALPSLIAQMIIRQENLTV
FT                   SQIQQQVAEIYPFLKAELFLSHKEEELDELVVKVLNELVSQDLISLKEDKVAKNQANTL
FT                   TLVLLGRTISETLQRYSIAFNLLVSNPELAKADLEQKSQDIAQRLTRLHGINAPEYFDK
FT                   GVFASLFSTLKQQGYLDSDGNCDGEKTAQFATLLYALLYPEVKLTIEESVFQLKSA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187364.1"
FT   gene            146924..147547
FT                   /db_xref="GeneID:10164846"
FT                   /locus_tag="VVM_00268"
FT   CDS_pept        146924..147547
FT                   /product="SOS-response repressor and protease LexA"
FT                   /gene_family="HOG000232167" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00268"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="GI:320154986"
FT                   /db_xref="GeneID:10164846"
FT                   /translation="MKPLTPRQQQVFDLIKSKIEVTGMPPTRAEIARELGFRSANAAEE
FT                   HLKALARKQVIEIVPGASRGIRILLEEEAANDEPGLPLIGRVAAGEPILAQEHVEMHYQ
FT                   VDPSMFRPQADFLLRVHGESMKDIGIMDGDLLAVHKTQDVRNGQVVVARVEDDVTVKRL
FT                   ERKGSTVLLHAENEEFAPIEVDLTSQQLTIEGIAVGIIRNTDWM"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187365.1"
FT   gene            147735..148547
FT                   /db_xref="GeneID:10164847"
FT                   /locus_tag="VVM_00269"
FT   CDS_pept        147735..148547
FT                   /locus_tag="VVM_00269"
FT                   /gene_family="HOG000218232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="O-methyltransferase-related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154987"
FT                   /db_xref="GeneID:10164847"
FT                   /translation="MSSIKQSSEKGYPVPARLLQPLWLRSRESLVDGGLIYDPIAAKAC
FT                   LSCQLAPECLSGDVAQKQLLHATLAQQCDQQVSQFLQQHPEGWIINVGAGLDTRFYRLD
FT                   NGRCHWVELDVTENLLWRQRLFHKNERYQQQHGSVDDLSCLEQLAINDKTPVLIVCELA
FT                   LLDCPLTQVANFVQLLGRRFVSAQVCMVLAGDLTDSSLGQKLGSDRYAHAMAVPAEQVL
FT                   QWLPWAQWVKVFSPFDRFCARWKTWQRWLSKIPMLKHRLTPVVVHMKW"
FT                   /protein_id="YP_004187366.1"
FT   gene            complement(148597..149997)
FT                   /db_xref="GeneID:10164848"
FT                   /locus_tag="VVM_00272"
FT   CDS_pept        complement(148597..149997)
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00272"
FT                   /EC_number="1.6.1.1"
FT                   /db_xref="GI:320154988"
FT                   /db_xref="GeneID:10164848"
FT                   /translation="MAHANHFDVIVIGSGPGGEGAAMGLTKAGLKVAVVEKESSVGGGC
FT                   THWGTIPSKALRHAVSRIIEFNSNPLFCKNNSSLHATFSTILGHAKSVIDKQTRLRQGF
FT                   YDRNQCQLIFGTARFTDAHTISVTQNDGTEEVYMADKFVIATGSRPYQPADVDFNHERI
FT                   YDSDSILSLKHDPRHIIIYGAGVIGCEYASIFRGLGVKTDLINTRDRLLAFLDNEVSDA
FT                   LSYHFWNSGVVIRNDETYERIEGTEDGVIVHLQSGKKMKADCLLYANGRTGNTDKLNLP
FT                   AVGLQGDSRGQLKVDGNYQTEVEHVYAVGDVIGYPSLASAAYDQGRFVAQAITKGKADG
FT                   YLIDDIPTGIYTIPEISSVGKTEQELTAAKVPYEVGRSSFKHLARAQIAGKDIGSLKIL
FT                   FHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEANTIEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187367.1"
FT   gene            150087..150923
FT                   /db_xref="GeneID:10164849"
FT                   /locus_tag="VVM_00273"
FT   CDS_pept        150087..150923
FT                   /locus_tag="VVM_00273"
FT                   /gene_family="HOG000270364" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="unsaturated fatty acid biosynthesis repressor
FT                   FabR, TetR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154989"
FT                   /db_xref="GeneID:10164849"
FT                   /translation="MEVITHISRKPINGMADVDKLSTKDCITALASSNVLAMAHHRLSL
FT                   AVIRAIVTAGRQFKIRANIIMKSMGIRAQQKEKTRRSLIDAAFSQLSADRSFSNLSLRE
FT                   VAREAGIAPTSFYRHFKDMDELGLTMVDEGGLLLRQLMRQARQRIVKEGSVIRTSVETF
FT                   MEFIESSPNVFRLLLRERSGTSAEFRAAVVREMQHFAAELTEYLISTGMNREEALAQAE
FT                   ASVILVFSSGAEALDLDRRERDELAERLIMQLRMVAKGAYWYRKERERNRLKGEIE"
FT                   /protein_id="YP_004187368.1"
FT   gene            150923..151303
FT                   /db_xref="GeneID:10164850"
FT                   /locus_tag="VVM_00274"
FT   CDS_pept        150923..151303
FT                   /locus_tag="VVM_00274"
FT                   /gene_family="HOG000270375" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154990"
FT                   /db_xref="GeneID:10164850"
FT                   /translation="MSNDNENNVNRSSEKKTLVLALITGMCGDAILSWLTMSEVSFSIF
FT                   PIIALVLAVQALYREYLNHPVSEEIPLVGLACFFVGAFGHSAFIKAQHPEAGSNFFAIM
FT                   VVLLLLAWIGSKLGYIRRPSAD"
FT                   /protein_id="YP_004187369.1"
FT   gene            complement(151361..152470)
FT                   /db_xref="GeneID:10164851"
FT                   /locus_tag="VVM_00276"
FT   CDS_pept        complement(151361..152470)
FT                   /product="tRNA (Uracil54-C5-)-methyltransferase"
FT                   /gene_family="HOG000218626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00276"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="GI:320154991"
FT                   /db_xref="GeneID:10164851"
FT                   /translation="MATLDVNPQRYQQQLAEKVQRLTDMFAPYQAPELEVFESPEQHYR
FT                   MRAEFRVWHEGEEMYYIMFNQETREKYRVDQFPAASRLINDLMPLLIDAMKDNESLRRK
FT                   LFQVDFLSTLSGEILVSLLYHRQLDDAWIENAKALKQRLNDEGFNLNLIGRARKMKIVL
FT                   DRDYVVEKLDVNGKPYVYQQVENSFTQPNGKVAEKMLEWAVDCTQESQGDLLELYCGNG
FT                   NFSLALAQNFERVLATELAKPSVESAQYNIAANKIENVQIIRMSAEEFTEAMEGKREFR
FT                   RLKDNGIDLKSYNCNTIFVDPPRSGMDVDTCKMVQGYERILYISCNPETLKENLDILSE
FT                   THHITRFALFDQFPYTHHMEAGVMLERKA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187370.1"
FT   gene            152873..154714
FT                   /db_xref="GeneID:10164852"
FT                   /locus_tag="VVM_00277"
FT   CDS_pept        152873..154714
FT                   /locus_tag="VVM_00277"
FT                   /gene_family="HOG000269547" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane vitamin B12 receptor BtuB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154992"
FT                   /db_xref="GeneID:10164852"
FT                   /translation="MQKSLLAIAMASLLTPISYLHAQEVQTNDTVVVTANRFEQVESSV
FT                   LASISVVTKAEIEQLNVTTALDILKTLPGVEVNSQGGKGQISSLFLRGTSSKHTLVLVD
FT                   GVKINSATAGGAELGLIPAFAIEQIEVVRGPRAAIYGSDAIGGVIHIKTIPANRQTKHD
FT                   ANLGYGNDDHSSLAWRSSGELNDSTEASFVFSDEKSDGYRVNEVAPSGDSHGYQSQTLF
FT                   GSLRHEINDAWSVQFNGYQLSSDVEYANQFSGVKNESNTDFYSIAGSLNFHKDNYSSQL
FT                   MVSRSDNESWDGVASGMVAKTALFSSRNSVSWLNHWVVVPALTLAAGVDYDQENARQGG
FT                   ANATNYSKTEKDNKAAYVTAHFSKNIVTAEASIRSDDDSAFGKHNTWNLGLGIAPSDYV
FT                   EFIASTGTGFKAPTFNDLYWPSSGNPNLKPETSKSSEVGIRSYLPFVQIDISAYRNEIE
FT                   DMIDWAPTGPGGAWTPSNIDNAKIEGIEIEALFETGVIEHRVSAEWKDPRDKSDDSLLI
FT                   RRARENFSWVSTYSADRFGFSAVANYVGDRKDSTGKTMDAYTLLDISANYKMTEALTLG
FT                   ARVGNLFDKEYQTAHSSGGKYYVGEGRNWFATVNYRF"
FT                   /protein_id="YP_004187371.1"
FT   gene            154760..155443
FT                   /db_xref="GeneID:10164853"
FT                   /locus_tag="VVM_00280"
FT   CDS_pept        154760..155443
FT                   /locus_tag="VVM_00280"
FT                   /gene_family="HOG000229449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154993"
FT                   /db_xref="GeneID:10164853"
FT                   /translation="MKKKVVISWSSGKDSTLTLLRLMEHPDYQVVGLYTTYVDNEVPFQ
FT                   ATPLAVVEMQAQLLNLPLIKIALPQVFPSNEVYQQTIVHALQASAIELDAVAFGDMFCN
FT                   GIADYRRSYIEPAGWECVFPLIGESSLDLAHEIIARGIKTILVTTDGHALKPDWCGRWY
FT                   NRELLASLPADVDPCGEDGEFHTLVVKAPGFAGEIRLQLTVQESDGRFTYQRYNATLLN
FT                   QHERV"
FT                   /protein_id="YP_004187372.1"
FT   gene            155477..156268
FT                   /db_xref="GeneID:10164854"
FT                   /locus_tag="VVM_00281"
FT   CDS_pept        155477..156268
FT                   /product="glutamate racemase"
FT                   /gene_family="HOG000262397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00281"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="GI:320154994"
FT                   /db_xref="GeneID:10164854"
FT                   /translation="MESSNQPNVLIFDSGVGGLSVFQEINKRLPEVNYYYLFDNQAYPY
FT                   GELSQETLLARVEALVVKMTQQFAIDLVVIACNTASTIVLPTLRAKLPIPVVGVVPAIK
FT                   PASLLANRAVGLIATPATVTRQYTHDLIRDFAHEKEVELLGSTRLVDIAEEKLRGRQVD
FT                   QQELAMILKPMKHKVDVAVLGCTHFPLLKEEIQQVLGDEIILVDSGEAIARRVQSLLHQ
FT                   LSPQSTKTPWRIFSTAQPWDEAALNGSLKTMGFNAIELYPL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187373.1"
FT   gene            complement(156246..156692)
FT                   /db_xref="GeneID:10164855"
FT                   /locus_tag="VVM_00284"
FT   CDS_pept        complement(156246..156692)
FT                   /locus_tag="VVM_00284"
FT                   /gene_family="HOG000269562" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154995"
FT                   /db_xref="GeneID:10164855"
FT                   /translation="MTFKKVIASAALAILGGFIFSQLDIYPAISFVIGVVLTTLLLSFF
FT                   PHTPTLTDSDSSLPTKTLYVGNLPYKANETHVRELFAQHGQVYGVRLMKDKRTGKRRGF
FT                   GFVVMASGDAENAINALNEKEYAQRTLKVRIANEMKHPIEDKVL"
FT                   /protein_id="YP_004187374.1"
FT   gene            157228..158765
FT                   /db_xref="GeneID:10164856"
FT                   /locus_tag="VVM_r00004"
FT   rRNA            157228..158765
FT                   /db_xref="GeneID:10164856"
FT                   /locus_tag="VVM_r00004"
FT                   /product="16S ribosomal RNA"
FT   gene            158828..158904
FT                   /db_xref="GeneID:10164857"
FT                   /locus_tag="VVM_t00009"
FT   tRNA            158828..158904
FT                   /note="anticodon GAT"
FT                   /db_xref="GeneID:10164857"
FT                   /locus_tag="VVM_t00009"
FT                   /product="tRNA-Ile"
FT   gene            158915..158990
FT                   /db_xref="GeneID:10164858"
FT                   /locus_tag="VVM_t00010"
FT   tRNA            158915..158990
FT                   /note="anticodon TGC"
FT                   /db_xref="GeneID:10164858"
FT                   /locus_tag="VVM_t00010"
FT                   /product="tRNA-Ala"
FT   gene            159270..162157
FT                   /db_xref="GeneID:10164859"
FT                   /locus_tag="VVM_r00005"
FT   rRNA            159270..162157
FT                   /db_xref="GeneID:10164859"
FT                   /locus_tag="VVM_r00005"
FT                   /product="23S ribosomal RNA"
FT   gene            162279..162398
FT                   /db_xref="GeneID:10164860"
FT                   /locus_tag="VVM_r00006"
FT   rRNA            162279..162398
FT                   /db_xref="GeneID:10164860"
FT                   /locus_tag="VVM_r00006"
FT                   /product="5S ribosomal RNA"
FT   gene            162427..162503
FT                   /db_xref="GeneID:10164861"
FT                   /locus_tag="VVM_t00011"
FT   tRNA            162427..162503
FT                   /note="anticodon GTC"
FT                   /db_xref="GeneID:10164861"
FT                   /locus_tag="VVM_t00011"
FT                   /product="tRNA-Asp"
FT   gene            complement(162733..163266)
FT                   /db_xref="GeneID:10164862"
FT                   /locus_tag="VVM_00289"
FT   CDS_pept        complement(162733..163266)
FT                   /locus_tag="VVM_00289"
FT                   /gene_family="HOG000151591" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154996"
FT                   /db_xref="GeneID:10164862"
FT                   /translation="MGLDNVDVWFQDEARFGQQNTTTRLWAERGSRPRVVKQQQFEYAY
FT                   LFGSVCPARGIGEAMVVPWVNKNIMVEHLKQLSAVTEKGRHAVVIMDGAGWHTNDIAEP
FT                   FDNVSIIKLPPYSPELNPIEQVWSWLRQHSLANQSFADYEDIVSKVCRAWNSFLECSAR
FT                   VRQMCSRRWIDLTS"
FT                   /protein_id="YP_004187375.1"
FT   gene            complement(163292..163573)
FT                   /db_xref="GeneID:10164863"
FT                   /locus_tag="VVM_00291"
FT   CDS_pept        complement(163292..163573)
FT                   /locus_tag="VVM_00291"
FT                   /gene_family="HOG000224070" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154997"
FT                   /db_xref="GeneID:10164863"
FT                   /translation="MREKPGTGRPAFLNAEQREQLSQYIKARAMDSSGGRLTGNDIHAY
FT                   IVNEFGKHYHPDSIYYLLNHMGFAWITSRSKHPRQSQQIQDDFKKIQN"
FT                   /protein_id="YP_004187376.1"
FT   gene            complement(163700..165040)
FT                   /db_xref="GeneID:10164864"
FT                   /locus_tag="VVM_00293"
FT   CDS_pept        complement(163700..165040)
FT                   /product="CDP-diacylglycerol--serine
FT                   /gene_family="HOG000270167" [ FAMILY / ALN / TREE ]
FT                   O-phosphatidyltransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00293"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="GI:320154998"
FT                   /db_xref="GeneID:10164864"
FT                   /translation="MMASRNPFAQLPSIAVDADALEVLHTAKDFRTRLIDAIAKATSRI
FT                   CLVALYLEDDEAGREILTALYEAKQRNPGLDISVCVDWHRAQRGLIGAEKSEGNAALYK
FT                   AFANKYQHKIPVYGIPVRGREVFGVLHLKGFIVDDTVIYSGASLNNVYLQYSERYRFDR
FT                   YHVIHNESLADTMFNFVQNEMIAHPAVNDLAKEDRPETKEIKTAIRQFRSALARAKYRF
FT                   ESQEAAEHQFSITPMVGLGKRRNFLNQNIAKLIDAAQNEIFICTPYFNFPKDIAKGVKR
FT                   ALKRGVKVTIVVGDKTANDFYIAPDKEFKTIGGLPYLYELNLRKFAKAYEAQIAARNLS
FT                   IRLWKDGDNSFHLKGIWVDKRYMLLTGNNLNPRAWALDLENGLLIRDDFAQLTEQFDSE
FT                   VDNILQHTQLICTYKQLEKVEEYPEVVQKLVRKITRIKADGVLKRIL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187377.1"
FT   gene            complement(165130..165567)
FT                   /db_xref="GeneID:10164865"
FT                   /locus_tag="VVM_00295"
FT   CDS_pept        complement(165130..165567)
FT                   /locus_tag="VVM_00295"
FT                   /gene_family="HOG000218462" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative acyltransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320154999"
FT                   /db_xref="GeneID:10164865"
FT                   /translation="MTHSIHFEVLDPIKVPIIKKLYKAHYPGTKVKKDEQIVVAIQDKQ
FT                   TIGVVRFRRVEEHQLMTGMLVIPSQREKGIAHCLLKYCAEELLNEKVFCFAYRHLEPFY
FT                   AQHSFVTVSSEQLPNSLKQKFLRYSESGKDLVPMQYQAQIR"
FT                   /protein_id="YP_004187378.1"
FT   gene            165631..166674
FT                   /db_xref="GeneID:10164866"
FT                   /locus_tag="VVM_00296"
FT   CDS_pept        165631..166674
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /gene_family="HOG000284356" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00296"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="GI:320155000"
FT                   /db_xref="GeneID:10164866"
FT                   /translation="MQIKQNISLKPYHTFAIEQCSHYLVEVGSVDELVDIYANPDFREL
FT                   PKLILGSGSNVLFTQPFSGVVVVNRLSGKTLSEDESFYYIHAEGGEDWPNLVEWCVQQG
FT                   IGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCQYVDILMLDDFSQRRLSAEECQFGYR
FT                   DSVFKHALYNQCVVIAVGLKLPKTWQANNSYGPLQEIAEHELSPMSIFHKVCEVRREKL
FT                   PDPKQIGNAGSFFKNPIIDKAHWQQLKAQFPNIVAYPAGEQMKVAAGWLIDQCDFKGVQ
FT                   VGGAQVHPKQALVLTNAQSCTAQDIIQLASLICDAVWDKYQIALEHEVRFISAVGETSL
FT                   SELRVES"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187379.1"
FT   gene            166671..167639
FT                   /db_xref="GeneID:10164867"
FT                   /locus_tag="VVM_00298"
FT   CDS_pept        166671..167639
FT                   /product="biotin-protein ligase/Biotin operon repressor"
FT                   /gene_family="HOG000041812" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00298"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="GI:320155001"
FT                   /db_xref="GeneID:10164867"
FT                   /translation="MRKEHVVKLHLLKRLADGQFHSGETLGHELGISRAAISKHINALQ
FT                   DWGVDVYRIQGRGYQLAQPMTLLDEHQLVEQSANNVELIPVIDSTNQYLLERIENLQTG
FT                   HVCLAEYQSQGRGRRGRQWFSPFGSNLYMSMYWRLDAGMAAAMGLSLVVGIAAVEALET
FT                   LGVQGVKLKWPNDVYYQDKKLAGILVEMTGQAGGAAHLVIGMGLNIQMQADCHSIDQPW
FT                   TALSQIESGARLDRTELALTLMAKWREALSEYEQCGLNGFIERWNRLDNFKGRQVKLLI
FT                   GPREIHGEVQGIDSQGGVILKTVEGIQTFVGGEISLRANDQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187380.1"
FT   gene            complement(167671..168594)
FT                   /db_xref="GeneID:10164868"
FT                   /locus_tag="VVM_00300"
FT   CDS_pept        complement(167671..168594)
FT                   /product="pantothenate kinase"
FT                   /gene_family="HOG000248571" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00300"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="GI:320155002"
FT                   /db_xref="GeneID:10164868"
FT                   /translation="MSPFLSFSRATWSELRNSVPMTLSEEDLKALQGINENLTMQEAVE
FT                   VYLPLSRLLNLYVQARQSRNSVLHQFLNNDEHAPPFVIGIAGSVAVGKSTTARVLCALL
FT                   SRWENHPKVELVTTDGFLYPKKELDQRGIMHKKGFPESYDMKKLVQFVSDVKAGKPELE
FT                   VPVYSHITYDITEEVKRVDRPDVLIIEGLNVLQSGMDYPHDPHRVFVSDFLDFSIYVDA
FT                   ESNTIEQWYVERFLKFRKGAFTQPGSYFSHYTQLSEQQAIEKAQQIWRDINGINLTENI
FT                   LPTKERAQLILRKGQNHLVEEILLRK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187381.1"
FT   gene            168806..168881
FT                   /db_xref="GeneID:10164869"
FT                   /locus_tag="VVM_t00012"
FT   tRNA            168806..168881
FT                   /note="anticodon TGT"
FT                   /db_xref="GeneID:10164869"
FT                   /locus_tag="VVM_t00012"
FT                   /product="tRNA-Thr"
FT   gene            168929..169013
FT                   /db_xref="GeneID:10164870"
FT                   /locus_tag="VVM_t00013"
FT   tRNA            168929..169013
FT                   /note="anticodon GTA"
FT                   /db_xref="GeneID:10164870"
FT                   /locus_tag="VVM_t00013"
FT                   /product="tRNA-Tyr"
FT   gene            169049..169123
FT                   /db_xref="GeneID:10164871"
FT                   /locus_tag="VVM_t00014"
FT   tRNA            169049..169123
FT                   /note="anticodon TCC"
FT                   /db_xref="GeneID:10164871"
FT                   /locus_tag="VVM_t00014"
FT                   /product="tRNA-Gly"
FT   gene            169138..169213
FT                   /db_xref="GeneID:10164872"
FT                   /locus_tag="VVM_t00015"
FT   tRNA            169138..169213
FT                   /note="anticodon GGT"
FT                   /db_xref="GeneID:10164872"
FT                   /locus_tag="VVM_t00015"
FT                   /product="tRNA-Thr"
FT   gene            169315..170499
FT                   /db_xref="GeneID:10164873"
FT                   /locus_tag="VVM_00302"
FT   CDS_pept        169315..170499
FT                   /locus_tag="VVM_00302"
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor Tu"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155003"
FT                   /db_xref="GeneID:10164873"
FT                   /translation="MSKEKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGAAR
FT                   DFASIDNAPEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALGALNGEEQWEAKIIELAEALDTYIPEPERAIDLPFLMPIEDVFSIQ
FT                   GRGTVVTGRIERGILKVGDEVAIVGIKDTTTTTCTGVEMFRKLLDEGRAGENVGALLRG
FT                   TKRDEVERGQVLAKPGSITPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   DISLPEGVEMVMPGDNIQMVVELISPIAMDEGLRFAIREGGRTVGAGVVAKIFE"
FT                   /protein_id="YP_004187382.1"
FT   gene            170732..171112
FT                   /db_xref="GeneID:10164874"
FT                   /locus_tag="VVM_00304"
FT   CDS_pept        170732..171112
FT                   /locus_tag="VVM_00304"
FT                   /gene_family="HOG000219148" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="preprotein translocase subunit SecE"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155004"
FT                   /db_xref="GeneID:10164874"
FT                   /translation="MKANNAETPDSSNAADTFKWVTTFVLLAAAVVGNYLYGELSVVIR
FT                   AAGVVVLIAAALGVAATTTKGKEAIVFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIV
FT                   MALVLWGIDGIMVRLIAFATGV"
FT                   /protein_id="YP_004187383.1"
FT   gene            171126..171674
FT                   /db_xref="GeneID:10164875"
FT                   /locus_tag="VVM_00305"
FT   CDS_pept        171126..171674
FT                   /locus_tag="VVM_00305"
FT                   /gene_family="HOG000219264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcription antitermination protein NusG"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155005"
FT                   /db_xref="GeneID:10164875"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKMHGMEEYFGEVLVP
FT                   TEEVVEMRAGQRRKSERKFFPGYVLVQMIMNDESWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEADAILNRLEKASEAPRPRTMYEVGEVVRVNEGPFADFNGTVEEVDYEKSRLKVSVS
FT                   IFGRATPVELEFGQVEKLD"
FT                   /protein_id="YP_004187384.1"
FT   gene            171817..172245
FT                   /db_xref="GeneID:10164876"
FT                   /locus_tag="VVM_00307"
FT   CDS_pept        171817..172245
FT                   /locus_tag="VVM_00307"
FT                   /gene_family="HOG000082123" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L11p (L12e)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155006"
FT                   /db_xref="GeneID:10164876"
FT                   /translation="MAKKVEAYIKLQVAAGMANPSPPVGPALGQRGVNIMEFCKAFNAK
FT                   TESMEKGLPVPVVITVYSDRSFTFVTKTSPAAVLLKKAAGIKSGSGRPNTEKVGTVTDA
FT                   QIQEIAEAKAADMTGADIEAMKRSIAGTARSMGLVVEG"
FT                   /protein_id="YP_004187385.1"
FT   gene            172250..172951
FT                   /db_xref="GeneID:10164877"
FT                   /locus_tag="VVM_00308"
FT   CDS_pept        172250..172951
FT                   /locus_tag="VVM_00308"
FT                   /gene_family="HOG000207015" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L1p (L10Ae)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155007"
FT                   /db_xref="GeneID:10164877"
FT                   /translation="MAKLTKRMRVIREKVDVTREYEINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRDIRVAVFAQGANAEAAKEAGADIVGMEDLAEQV
FT                   KKGEMNFDVVVASPDAMRVVGQLGTILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFSAEQIKENLEALLVALKKAKPSSAKGSYLKKVSISTTMGAGV
FT                   AVDQGTLNTQA"
FT                   /protein_id="YP_004187386.1"
FT   gene            173242..173730
FT                   /db_xref="GeneID:10164878"
FT                   /locus_tag="VVM_00310"
FT   CDS_pept        173242..173730
FT                   /locus_tag="VVM_00310"
FT                   /gene_family="HOG000004851" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L10p (P0)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155008"
FT                   /db_xref="GeneID:10164878"
FT                   /translation="MALNLQDKKAIVAEVNEAAAGALSAVVADSRGVSVDAMTTLRKQA
FT                   REAGVYMKVVRNTLARRAVEGTEYECLTDTFTGPSLIAFSNEHPGAAARLFKDFAKENK
FT                   KFEIKAAAFEGALTDAEVLATLPTYDEAIARLMMCLKEASAGKLVRTIAAIRDQKEAA"
FT                   /protein_id="YP_004187387.1"
FT   gene            173791..174159
FT                   /db_xref="GeneID:10164879"
FT                   /locus_tag="VVM_00311"
FT   CDS_pept        173791..174159
FT                   /locus_tag="VVM_00311"
FT                   /gene_family="HOG000248813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L7/L12 (P1/P2)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155009"
FT                   /db_xref="GeneID:10164879"
FT                   /translation="MSITNEQILDAIAEMSVTQVVELISAMEEKFGVTAAAAVVAGGAA
FT                   AGAAVEEQTEFNVILASAGANKVAVIKAVRGATGLGLKEAKALVDGAPAALKEGVEKAE
FT                   AEALKKELEEAGATVEIK"
FT                   /protein_id="YP_004187388.1"
FT   gene            174411..178439
FT                   /db_xref="GeneID:10164880"
FT                   /locus_tag="VVM_00312"
FT   CDS_pept        174411..178439
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /gene_family="HOG000218612" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00312"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="GI:320155010"
FT                   /db_xref="GeneID:10164880"
FT                   /translation="MVYSYTEKKRIRKDFGTRPQVLDIPYLLSIQLDSFDKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYNGNSELQYVSYRLGEPVFDVKECQIRGVTYSKPLRVKLRLVI
FT                   FDKDAPAGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLYVRIDRRRKLPSTIILRALGKSTEEILD
FT                   TFFEKVNFEVKDQTLMMELVPDRLRGETATFDIEANGTVYVEKGRRVTARHIRQLEKEG
FT                   VDQIEVPVEYIVGKVSSKDYINEATGEIIVAANQEISLEALAKLSQAGHKQLEVLFTND
FT                   LDHGPFMSETLRIDSSVDRISALVEIYRMMRPGEPPTKEAAEALFESLFFSEERYDLST
FT                   VGRMKFNSSIGRDDAEEQGTLDETDIIEVMKKLIAIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDAVMPQDLINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHVTHYGRLCPIETPEGPNIGLINSLS
FT                   AFARCNEYGFLETPYRRVVDGVVTDEVDYLSAIEEGQFVIAQANAKLNEDGTFADELIT
FT                   ARQKGESGLHPREHVDYMDVATNQVVSIAASLIPFLEHDDANRALMGANMQRQAVPTLK
FT                   AEKPLVGTGIERNVAVDSGVTSVAKRGGIIQSVDASRIVVKVNEEELIPGEAGIDIYNL
FT                   TKYTRSNQNTCINQRPCVMPGEPVLRGDVLADGPSTDLGELALGQNMRIAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELTCVARDTKLGSEEITADIPNVGESALSKLDESGIV
FT                   YIGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPNSVSGTIID
FT                   VQVFTRDGVEKDKRALEIEQMQLKEAKKDLTEEFQILEGGLLNRVKAVLLSGGYSEAKL
FT                   DTTDRKKWLELTLEDDALQTQLEQLAEQYDELKADFDKKFETKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPVEDMPYDEKGQPVDIVLNPLGVPSRM
FT                   NIGQILEVHLGLAAKGIGDKINQMVKEQQELAKFREFLQKVYDLGETRQKVDIASLSDE
FT                   EVRTLIGNLRGGLPIATPVFDGASEASIKELLKLGGLPESGQLTLFDGRTGDAFERPVT
FT                   VGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAY
FT                   TLQEMLTVKSDDVNGRTKMYKNIVDGNHAMEPGMPESFNVLLKEIRSLGINIELEDEQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187389.1"
FT   gene            178515..182717
FT                   /db_xref="GeneID:10164881"
FT                   /locus_tag="VVM_00316"
FT   CDS_pept        178515..182717
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /gene_family="HOG000218386" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00316"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="GI:320155011"
FT                   /db_xref="GeneID:10164881"
FT                   /translation="MKDLLNFLKAQHKTEEFDAIKIGLSSPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRDRMGH
FT                   IELASPVAHIWFLKSLPSRIGLLMDIPLRDIERVLYFEMYVVTEPGMTDLEKSQMLTEE
FT                   EYLDRLEEWGDEFTAKMGAEAIKDLLGSMDLHAEVEQMREELDTTNSETKRKKLTKRLK
FT                   LVEAFISSGNNPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYSKLETRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARTLMMSTNNILSPASGDPIIVPSQDVVLGLYYMTREM
FT                   INAKGEGMYLAGPAEAEKAYRTKTAALHARVKVRITETVVDEDGHSTTETKMVDTTIGR
FT                   AMLWQIVPKGLPFSIVNQKLGKKQISNLLNEAYRKLGLKDTVIFADQIMYTGFAYAALS
FT                   GVSVGIDDMVVPPAKYTEIAEAEEEVREIQEQYQSGLVTAGERYNKVIDIWASTNDRVA
FT                   KAMMENLSSETVINRDGEEEQQESFNSIYMMADSGARGSAAQIRQLAGMRGLMARPDGS
FT                   IIETPITANFKEGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDVVVTEH
FT                   DCGTLEGVEMMPHIEGGDVKVALTELALGRVVAEDIVKPGTEEILIPRNTLLDEKWCQI
FT                   INDNSVDKITVRSVVTCDSDFGCCAQCYGRDLARGHLVNQGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASTAAAENSVQVKNNGSVKLNNAKFVINKDGKLVITSRASELTIIDEFG
FT                   RTKEKHKLPYGSSLSKADGDAVTAGETVANWEAHTMPIITEVAGRVQFVDMIDGVTVSR
FT                   QTDDLTGLSSSEVTDAAARPAAGKDMRPAIKLVDAAGNDVMIPGTDMPAQYFLPGKAIV
FT                   NIEDGAEVGIGDTLARIPQKSGGNKDITGGLPRVADLFEARKPKEPAILAEYSGTVSFG
FT                   KETKGKRRLIITREGGETYEEMIPKHRQLNVFEGERVERGDVIADGPEAPHDILRLRGI
FT                   HAVTQYIANEVQEVYRLQGVKINDKHIETIVRQMLRKCTITHAGDSEFLPGETVEYSQV
FT                   KIANRNLEAEGKEPARFERELLGITKASLATESFISAASFQETTRVLTEAAVSGKRDDL
FT                   RGLKENVIVGRLIPAGTGFAYHQDRQAKRAQEQEGPSAAQATDNLAALLNAGFSSDE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187390.1"
FT   gene            complement(182859..183347)
FT                   /db_xref="GeneID:10164882"
FT                   /locus_tag="VVM_00322"
FT   CDS_pept        complement(182859..183347)
FT                   /locus_tag="VVM_00322"
FT                   /gene_family="HOG000283202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulator of sigma D"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155012"
FT                   /db_xref="GeneID:10164882"
FT                   /translation="MLKKFKQTQEQWGGSSEVIDHWLETRQSLIVEYCKLAALQPCSTK
FT                   SNVLELPSPHELQQFCQHLVDYISEGHFKIYDMVMDKWRATGFEATTEINETYAKIVLT
FT                   TEPLLSFTDMYASVGEDDPLESFEPDLSKVGEIIELRFEVEDHLIQLIADSLSVPPGA"
FT                   /protein_id="YP_004187391.1"
FT   gene            183548..184333
FT                   /db_xref="GeneID:10164883"
FT                   /locus_tag="VVM_00323"
FT   CDS_pept        183548..184333
FT                   /product="NADH pyrophosphatase"
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00323"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="GI:320155013"
FT                   /db_xref="GeneID:10164883"
FT                   /translation="MLSNSDSKHGQKAYWCVVSGSDLWLVDGQLPLAISNELNLVAEKA
FT                   QQIGSYNNHPVMWLNEADVEQSLEMHSLRECLHFPEPLFLLMSKAIQYGYMTQTMRFCP
FT                   QCGGRNHLNHNQLAMQCGECRTLHYPRIFPCIIVAVRKQQHILLAQHPRHRSGMYTVIA
FT                   GFVEVGETLEQCVAREVKEETGIEVTNIRYFGSQPWAFPSSMMMAFLADYHAGELKPDY
FT                   SELADAKWFTSDNLPPVAPTGTIARALIEQTLLNMRSDS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187392.1"
FT   gene            184439..184924
FT                   /db_xref="GeneID:10164884"
FT                   /locus_tag="VVM_00324"
FT   CDS_pept        184439..184924
FT                   /locus_tag="VVM_00324"
FT                   /gene_family="HOG000005311" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155014"
FT                   /db_xref="GeneID:10164884"
FT                   /translation="MKASYWLGALVILTLSGAANASIEIKAKRMLTEKTMTENMAKVQS
FT                   ACGNQTLQANIDWSAWDGYNFSEERLDPVKTTGWLGGLINYIYDDMVKLCTTTEHAELY
FT                   KAEFQKVEKIQFAGQESIKARKSSFALADGGKVLNVSLNPNAAYDSSTLKYIKQAWN"
FT                   /protein_id="YP_004187393.1"
FT   gene            184929..185669
FT                   /db_xref="GeneID:10164885"
FT                   /locus_tag="VVM_00325"
FT   CDS_pept        184929..185669
FT                   /locus_tag="VVM_00325"
FT                   /gene_family="HOG000290402" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155015"
FT                   /db_xref="GeneID:10164885"
FT                   /translation="MKKTILSLLAMSLSFSASASDAYSMEDLKALQASQSWQELLAHAN
FT                   DIRPSQRDTQWKALVEQAALGSFTQSIQAGNSDKAIYLGQEVLQVYPFLSQSDAFTQTF
FT                   SEQLVKAAQPCVRYSAESCVENYGNLLATLSPKAELSFAEGVKVYQNVSKSLSVPFFAS
FT                   AVKQSSQYCADEKVANALLYTLDRPKNANFALAKEVATTVCVGTALANFENYVIESKSV
FT                   RAALCPTYVSKGYVKGIIKQVCES"
FT                   /protein_id="YP_004187394.1"
FT   gene            185984..187051
FT                   /db_xref="GeneID:10164886"
FT                   /locus_tag="VVM_00326"
FT   CDS_pept        185984..187051
FT                   /product="uroporphyrinogen III decarboxylase"
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00326"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="GI:320155016"
FT                   /db_xref="GeneID:10164886"
FT                   /translation="MTELKNDRYLRALLKEPVDCTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELASEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLRFSTGEGPIFDNPIT
FT                   CKADVEKIGVPDPEGELQYVMNAVRQIRKDLNGDVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKIKKMMYAEPQTLHLLLDKLADSVIEYLNAQIKAGAQSVMVFDTWGGVLTPRDYNLF
FT                   SLQYMHKIVDGLIRENDGRRVPVTLFTKNGGMWLEQIAATGCDAVGLDWTINIADAKAR
FT                   VGDKVALQGNMDPSMLYASHDRIREEVASILEGFGHGGTGHVFNLGHGIHLDVPPENAG
FT                   VFVEAVHELSKPYHQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187395.1"
FT   gene            complement(187167..187760)
FT                   /db_xref="GeneID:10164887"
FT                   /locus_tag="VVM_00329"
FT   CDS_pept        complement(187167..187760)
FT                   /locus_tag="VVM_00329"
FT                   /gene_family="HOG000196500" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155017"
FT                   /db_xref="GeneID:10164887"
FT                   /translation="MPLEPLLTQIRACQVCASALPLGANPVVQAHSEAKILIIGQAPGT
FT                   KVHHTSIPWNDASGNRLRVWLDIEKPTFYDPKQIAIMPMGFCYPGRGQSGDLPPRKECA
FT                   PLWHEALLKHLPNIELTLLIGQYAQNRYLSNKPKTLTETVQNWQAWLPDYLPLPHPSPR
FT                   NTLWLRKNPWFEEQTVPYLRQQVHQLLSPSKVEI"
FT                   /protein_id="YP_004187396.1"
FT   gene            complement(187764..188690)
FT                   /db_xref="GeneID:10164888"
FT                   /locus_tag="VVM_00330"
FT   CDS_pept        complement(187764..188690)
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /gene_family="HOG000136697" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00330"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="GI:320155018"
FT                   /db_xref="GeneID:10164888"
FT                   /translation="MHQSKHKIFIVTEDNETYRQLLADHALPDLALTENIEQANIILAA
FT                   PPHIAPRLSECHQLEWLQSTYAGVNALMQPELRRDYKLTNVRGIFGPLIAEYVIGYAIQ
FT                   HYRHFARYAEQQQQRLWQPHPYSSLEGKTITILGTGSIGNHLAHACSAMGLHTIGVNRT
FT                   GIPPNGSHFQQTYHINELAAALKQAHIVVNTLPSTEHTHHLLNQASLSHCRHALLFNVG
FT                   RGDVIDNAALLLAIKHHWVEHAFLDVFEQEPLVTDHPFWGLKQITITPHIAALSFPEKV
FT                   MALFAENYHRWLEGYPLNHQVSFTKGY"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187397.1"
FT   gene            188841..189347
FT                   /db_xref="GeneID:10164889"
FT                   /locus_tag="VVM_00331"
FT   CDS_pept        188841..189347
FT                   /locus_tag="VVM_00331"
FT                   /gene_family="HOG000283285" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155019"
FT                   /db_xref="GeneID:10164889"
FT                   /translation="MYPNYAMFCDSTGFAEPRGYRNILDSVWEILTVKNAKVNFERQLE
FT                   KLEELFPSAEEFDLYAVYPAMDACQSLSTLLHGLLDRDYLFDSMIKISQQSVQTVVDLE
FT                   QAQGSEAITNENQKANEAVCAEWDVQWAIFRPLREAQERDIDLIKDLRQELRDDPISNL
FT                   GITLS"
FT                   /protein_id="YP_004187398.1"
FT   gene            complement(189401..190489)
FT                   /db_xref="GeneID:10164890"
FT                   /locus_tag="VVM_00333"
FT   CDS_pept        complement(189401..190489)
FT                   /locus_tag="VVM_00333"
FT                   /gene_family="HOG000289158" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="CBS-domain containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155020"
FT                   /db_xref="GeneID:10164890"
FT                   /translation="MLLLTIYISIAIGVSFICSVLEAVLLSISPSYIAQLRQQGHPAAA
FT                   QLTKLKADIDRPLASILTLNTIAHTIGAATAGAQAAVVFGSEWLGVFSGVLTLGILVLS
FT                   EIVPKTIGATYWRQLAPSAASTLRWMVWALTPFVWFSEQITKRLARNQETPKMRDELSA
FT                   MAILARESGEFAEGESKILSNLLGIQDVPVTQVMTPRPVVFRVEATMTINEFLAQHKET
FT                   PFSRPLVYSEQKDNIIGFVHRLELFKLQQSGAGEKQLGSVMRPIHVIMNTLALPKAFDQ
FT                   MMAKRLQLSIVVDEYGTVLGLVTLEDIFEYLLGEEIIDEADKSQDMQELAYQRWERWKN
FT                   KHGMIESRDDDEDEGSSDKTKS"
FT                   /protein_id="YP_004187399.1"
FT   gene            190754..191026
FT                   /db_xref="GeneID:10164891"
FT                   /locus_tag="VVM_00334"
FT   CDS_pept        190754..191026
FT                   /locus_tag="VVM_00334"
FT                   /gene_family="HOG000043828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155021"
FT                   /db_xref="GeneID:10164891"
FT                   /translation="MNKTQLIDFIAEKADLSKAQAKAALEATLNGVTDALKEGDQVQLI
FT                   GFGTFKVNHRAARTGRNPKTGDEIQIAAANVPAFVAGKALKESVN"
FT                   /protein_id="YP_004187400.1"
FT   gene            191186..191770
FT                   /db_xref="GeneID:10164892"
FT                   /locus_tag="VVM_00336"
FT   CDS_pept        191186..191770
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /gene_family="HOG000218531" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00336"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="GI:320155022"
FT                   /db_xref="GeneID:10164892"
FT                   /translation="MGDATSFYWVTDKLTGPHKASDYVFSGDYGWYQSEYRWDEGALRE
FT                   LIREGEQLDSKLGLVPYRIHVRFNVEGDAVYQQYRLNGKVLPIQKEQLQRYQYEADALV
FT                   KETKQQAREGLELVQGYWDGETFETCSGEEYSTLEFNQTLPGFVVNRLASVDSYVAFLG
FT                   KKSSRRLEVETLLLLDEDDRDCVEKPVLLEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187401.1"
FT   gene            complement(191849..193138)
FT                   /db_xref="GeneID:10164893"
FT                   /locus_tag="VVM_00339"
FT   CDS_pept        complement(191849..193138)
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /gene_family="HOG000033463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00339"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="GI:320155023"
FT                   /db_xref="GeneID:10164893"
FT                   /translation="MRVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLEN
FT                   VNIAVEDIAGLVAFAKEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGS
FT                   KAFTKDFLARHQIPTAAYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEE
FT                   AEEAIKDMLAGNAFGEAGSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKD
FT                   TGPNTGGMGAYSPAPVVTPEIHNRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDKDGT
FT                   PKVIEYNCRFGDPETQPIMMRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGG
FT                   YPAAYNKGDVISGLPQVEIEGEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQR
FT                   AYELAKQIRWDGMFHRNDIGYRAIAREQQK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187402.1"
FT   gene            complement(193294..194886)
FT                   /db_xref="GeneID:10164894"
FT                   /locus_tag="VVM_00341"
FT   CDS_pept        complement(193294..194886)
FT                   /product="IMP
FT                   /gene_family="HOG000230373" [ FAMILY / ALN / TREE ]
FT                   cyclohydrolase/Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00341"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="GI:320155024"
FT                   /db_xref="GeneID:10164894"
FT                   /translation="MNNARPIRRALISVSDKTGIVEFAQALAERGVDILSTGGTARLLA
FT                   EQGIAVTEVSDYTGFPEMMDGRVKTLHPKVHGGVLGRRGQDDEVMAKHGINPIDMVVVN
FT                   LYPFAETVAKEGCTLADAVENIDIGGPTMVRSAAKNHKDVTIVVNASDYHRVITEMDAN
FT                   DTSLTLETRFDLAIAAFEHTAAYDGMIANYFGTMVPSYGENKEGDEESKFPRTFNQQFI
FT                   KKQDMRYGENSHQAAAFYVEANPQEASVATARQIQGKALSYNNIADTDAALECVKEFNE
FT                   PACVIVKHANPCGVALGKDILEAYNRAYQTDPTSAFGGIIAFNQELDAETATAIVERQF
FT                   VEVIIAPSVSAEAIEVVAAKKNVRLLECGEWTTKTTGFDVKRVNGGLLVQDRDQGMVSL
FT                   DDLKVVSKRQPTEEELKDALFCWKVAKYVKSNAIVYSKGDMTIGVGAGQMSRVYSAKIA
FT                   GIKAADEGLQVEGCVMASDAFFPFRDGIDAAAEAGIKCVIQPGGSMRDDEVIAAADEHG
FT                   MAMIFTGMRHFRH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187403.1"
FT   gene            195157..195555
FT                   /db_xref="GeneID:10164895"
FT                   /locus_tag="VVM_00342"
FT   CDS_pept        195157..195555
FT                   /locus_tag="VVM_00342"
FT                   /gene_family="HOG000266084" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HTH-type transcriptional regulator ZntR"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155025"
FT                   /db_xref="GeneID:10164895"
FT                   /translation="MFQIGELAKRCGVSADTLRFYEKNALIKPAGRSESGYRLYNYENQ
FT                   KQVGFILKAKELGLSLEEIKELLEIKLEATEHSCAEVKAITSAKLALIDEKIAELNKIR
FT                   RALKKINDACCGHVEDNASHCSILAALE"
FT                   /protein_id="YP_004187404.1"
FT   gene            complement(195615..197255)
FT                   /db_xref="GeneID:10164896"
FT                   /locus_tag="VVM_00344"
FT   CDS_pept        complement(195615..197255)
FT                   /locus_tag="VVM_00344"
FT                   /gene_family="HOG000148080" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155026"
FT                   /db_xref="GeneID:10164896"
FT                   /translation="MVGSSLRVINIKQRLYVLTFVITSLLLLPFIALLYAYQSDLMEAK
FT                   QVKTRHLVETAVSLQQHYYQQEQAGRLSREEAQTQAKAAISQLRYEKEDYFWINDDQPN
FT                   MIMHPMKPQLNGKSLSAVKDPTGKALFVEMVSVAKTSGAGFVHYMWPKPGSDVDVEKVS
FT                   YVQMFQPWGWITGSGVYIDDVEALVWQRIRASLLQLSLTGAVMLLLAGWIGNSITQPCR
FT                   ATQRALEDIAQGDGDLTKQLPADGQDELAQIARAFNQFTSKIRLIVQGIAPVTRDVTGS
FT                   ASELTQVARNALEKATAQQHSVDSVASAMKQLHDSNMQVADSAQEAASAAQTASEKGKE
FT                   GSAIIEKASGYMHALSHTVTQTELNVQELAKETQKVGSVLEVIRGVAEQTNLLALNAAI
FT                   EAARAGEQGRGFAVVADEVRTLATRTSSSTDEIQHIIAQLQQRANDVCLSMEQTQRQST
FT                   ETQQQASLAQQALSDIDAQIAVILQLNQHIARASGEQTSATELINHNLLQIVDHSEQTA
FT                   AQANQVAAASEQLMASGNQLQVNFAAFKV"
FT                   /protein_id="YP_004187405.1"
FT   gene            complement(197510..197806)
FT                   /db_xref="GeneID:10164897"
FT                   /locus_tag="VVM_00345"
FT   CDS_pept        complement(197510..197806)
FT                   /locus_tag="VVM_00345"
FT                   /gene_family="HOG000256331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-binding protein Fis"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155027"
FT                   /db_xref="GeneID:10164897"
FT                   /translation="MFEQNLTSEALTVTTVTSQDQITQKPLRDSVKASLKNYLAQLNGQ
FT                   EVTELYELVLAEVEQPLLDTIMQYTRGNQTRAATMMGINRGTLRKKLKKYGMN"
FT                   /protein_id="YP_004187406.1"
FT   gene            complement(197830..198693)
FT                   /db_xref="GeneID:10164898"
FT                   /locus_tag="VVM_00348"
FT   CDS_pept        complement(197830..198693)
FT                   /product="tRNA dihydrouridine synthase B"
FT                   /gene_family="HOG000217855" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00348"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="GI:320155028"
FT                   /db_xref="GeneID:10164898"
FT                   /translation="MAVSEMMSSNPQLWKTSKSKQRMVHEGESGIRSVQIAGSDPQLMA
FT                   DAAQFSVENGAQIIDINMGCPAKKVNKKLAGSALLKYPDIIEQILKAVVDAVDVPVTLK
FT                   TRTGWDTENKNCIHIAKLAEDCGIQALALHGRTKACMYKGEAEYDSIKAVKQAVSIPVI
FT                   ANGDIDSPEKAKYVLEYTGADALMIGRPAQGRPWIFQEIHHYLENGTTMPELPIEEVKS
FT                   IMLGHVQALHEFYGEYLGPRIARKHVGWYLKEHEQASEFRRTFNAIDAAMLQLEALEGY
FT                   FDNVAS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187407.1"
FT   gene            complement(198938..199825)
FT                   /db_xref="GeneID:10164899"
FT                   /locus_tag="VVM_00351"
FT   CDS_pept        complement(198938..199825)
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /gene_family="HOG000007390" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00351"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320155029"
FT                   /db_xref="GeneID:10164899"
FT                   /translation="MPWIQIKLNATNENAELIGDMLMEETGALSVTFLDAHDTPVFEPL
FT                   PGETRLWGDTDVLALYDAEADTQLIMSQIKASNMLAEGFAYKIEQLEDKDWEREWMDNF
FT                   HPMKFGQRLWICPSWRDIPDPTAVNVMLDPGLAFGTGTHPTTALCLEWLESLDLSGKTV
FT                   IDFGCGSGILAIAAIKLGAEKVIGIDIDPQALLASKDNAQRNGVADQLDVYLPQDQPEG
FT                   LLADVVVANILAAPLRELSSIIKGLVKPNGQLAMSGVLDTQAEDVANYYRDELHIDPIV
FT                   EQSEWCRISGRKQG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187408.1"
FT   gene            complement(199946..201292)
FT                   /db_xref="GeneID:10164900"
FT                   /locus_tag="VVM_00352"
FT   CDS_pept        complement(199946..201292)
FT                   /product="biotin carboxylase of acetyl-CoA carboxylase"
FT                   /gene_family="HOG000008988" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00352"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="GI:320155030"
FT                   /db_xref="GeneID:10164900"
FT                   /translation="MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLA
FT                   DETVCIGPARGIDSYLNIPRIISAAEVTGAVAIHPGYGFLSENADFAEQVERSGFIFVG
FT                   PKADTIRMMGDKVSAITAMKKAGVPCVPGSDGPLDNDEVKNRAHAKRIGYPVIIKASGG
FT                   GGGRGMRVVRKEADLVQAIAMTRAEAKAAFNNDMVYMEKFLENPRHVEVQVIADGQGGA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEEMRKYIGERCTRACVEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMVTGVDLIKEQLRVAAGQPLSFTQNDIKIRGHAIECRIN
FT                   AEDPERFLPSPGKIERFHAPGGMGVRWESHIYSGYTVPPHYDSMIGKLITYGENRDVAI
FT                   ARMKNALGEMFIEGIKTNIPLQVSIMNDENFQHGGANIHYLEKKLGLQH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187409.1"
FT   gene            complement(201305..201769)
FT                   /db_xref="GeneID:10164901"
FT                   /locus_tag="VVM_00354"
FT   CDS_pept        complement(201305..201769)
FT                   /locus_tag="VVM_00354"
FT                   /gene_family="HOG000008875" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155031"
FT                   /db_xref="GeneID:10164901"
FT                   /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRHGQMMAAPAPM
FT                   HYAAAPVAQPAPVAAAPVATAEAAPAAAAVPAGHQVLSPMVGTFYRSPSPDAKAFIEVG
FT                   QSVTAGQTLCIVEAMKMMNQIEADKSGVVTAILVEDGQPVEFDQPLVVIE"
FT                   /protein_id="YP_004187410.1"
FT   gene            complement(201830..202279)
FT                   /db_xref="GeneID:10164902"
FT                   /locus_tag="VVM_00355"
FT   CDS_pept        complement(201830..202279)
FT                   /product="3-dehydroquinate dehydratase II"
FT                   /gene_family="HOG000217278" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00355"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="GI:320155032"
FT                   /db_xref="GeneID:10164902"
FT                   /translation="MSAKSRILVLNGPNINLLGLREPGHYGHQTLPQIVDTLTQQAQTA
FT                   GIELEHLQSNREYELIEAIHAAHGNVDFIIINPAAFTHTSVALRDALLGVAIPFIEVHL
FT                   SNVHAREPFRHHSYLSDKALGVICGLGAQGYEFALSAAIARLQAK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187411.1"
FT   gene            complement(202576..204528)
FT                   /db_xref="GeneID:10164903"
FT                   /locus_tag="VVM_00358"
FT   CDS_pept        complement(202576..204528)
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00358"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="GI:320155033"
FT                   /db_xref="GeneID:10164903"
FT                   /translation="MSEAHIYPVKENIKAHTHADNDTYLAMYQQSVTDPEGFWSEHGKI
FT                   VDWIKPFTKVKQTSFDTGHVDIRWFEDGTLNVSANCIDRHLAERGDDVAIIWEGDNPAD
FT                   DKTLTYNELYTEVCRFSNALKEQGVRKGDVVCLYMPMVPEAAVAMLACTRIGAVHTIVF
FT                   GGFSPEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNVDEALTNPEVKTISKVVVFKR
FT                   TGGNIDWHEHRDVWWHEATAKVSDVCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYATMTFKYVFDYQPGETFWCTADVGWITGHTYLVYGPLANGAKTILFEGVPNYPNTS
FT                   RMSEVVDKHQVNILYTAPTAIRALMAKGNEAIEGTDRSSLRIMGSVGEPINPEAWEWYY
FT                   KTIGNEKSPIVDTWWQTETGGILITPLPGATALKPGSATRPFFGVQPALVDNMGNVIED
FT                   QAAEGNLVILDSWPGQMRTVYGDHERFEQTYFSTFKGMYFTGDGARRDEDGYYWITGRV
FT                   DDVLNVSGHRMGTAEIESALVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAGEYPTAEL
FT                   HKEVKDWVRKEIGPIATPDVLHWTDALPKTRSGKIMRRILRKIATGDTSNLGDTSTLAD
FT                   PSVVDKLIAEKAELV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187412.1"
FT   gene            complement(204703..205338)
FT                   /db_xref="GeneID:10164904"
FT                   /locus_tag="VVM_00359"
FT   CDS_pept        complement(204703..205338)
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /gene_family="HOG000277090" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00359"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GI:320155034"
FT                   /db_xref="GeneID:10164904"
FT                   /translation="MNWFRRNYWYYRLKGSPYQSLFCAPNNKEYVSLDCETTSLDPNRA
FT                   ELVTIAATKIIDNRIITSKPFEVRLRAPQSLDSGSVKIHKIRHQDLVDGLSEKEALLKL
FT                   IDFIGNRPLVGYHIRYDKKILDLACLRHLGFPLANPLVEVSQIYHDKLEKHLPNAYFDL
FT                   SLDAICRHLDLPIQDKHDALQDAIAAALVFVRLTRGDLPSLSLPYASS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187413.1"
FT   gene            complement(205406..207232)
FT                   /db_xref="GeneID:10164905"
FT                   /locus_tag="VVM_00363"
FT   CDS_pept        complement(205406..207232)
FT                   /locus_tag="VVM_00363"
FT                   /gene_family="HOG000277101" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative signal-transduction protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155035"
FT                   /db_xref="GeneID:10164905"
FT                   /translation="MPDKFNMQSPPFDRLSEGQQHLLRSSLDVAYFRTKDVVLAAGQPS
FT                   PHLHILIKGAVEERSANQQEVFAHYANDDMFDVRALFEPTVRHQYVALEDTLSYLLPKA
FT                   IFLELYNENGQFAAYFDNNLAKRQELIEAAQQQQNLAEFILTKVDKAIYHPPKILSPEM
FT                   PINQVTRTLKENGIDAALVRLHDDDGRLLNHPNAHPYAIVTRTNMLHSVMLDDKPLDTP
FT                   VGDIATFPVFHVDDGDFLFNAMITMTRNRMKRLMVCDGHQAVGMLDMTQILSAFSTHSH
FT                   VLTLSIARASSVEELALASNRQRQLVESLLKNGIRTRFIMELISAVNEQIIEKAFELVV
FT                   PPALHDHCCLIVLGSEGRGEQILKTDQDNALIIKDGLEWQQSGVVMQQLTHTLQQLGYP
FT                   LCPGNVMVNNPKWVKSQSDWRKTLTAWVRSAKPETVMDLAIFADAHAVAGNKALLEPVK
FT                   QHLSELMADQELILTEFTRPALNFSVPLTLFGNVKADKSGLDIKQGGIFPIVHGVRALS
FT                   LEYALQENNTFDRIEGLVARNVLEKSTAANLSEALKLFFKLRLAQQLTEQHSNNKLNLK
FT                   LLDRTERDLLRHSLHVVKKFKQWLGYHYQIKD"
FT                   /protein_id="YP_004187414.1"
FT   gene            207446..208636
FT                   /db_xref="GeneID:10164906"
FT                   /locus_tag="VVM_00364"
FT   CDS_pept        207446..208636
FT                   /locus_tag="VVM_00364"
FT                   /gene_family="HOG000272903" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative 3-phenylpropionic acid transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155036"
FT                   /db_xref="GeneID:10164906"
FT                   /translation="MFKPSPYGWISQYFLGFFFAYGVYLPFWSLWFKEQGVSSTDIGLL
FT                   VGIGLATRCVANMVITPRIHKAEHIMPALRWLSFAALIFVGFHFFTGGSFWLMALATVL
FT                   FNLCCGPVVPLSDALANYYARLKMLDYGRTRLWGSIAFIAGSTVVGYLISLYGTDMILY
FT                   TALVGVFISLLLSMRSANVMPVTRSEHHSERPKLTQLLTDGPVVKFLLLAALIQGSHAA
FT                   YYSFSAIYWQQAGHSEEIIGYLWSLGVVSEVAVFALSKRLFAGWSLRALFVAASIGVML
FT                   RWGITASTTLLLGLVLVQLLHGVTFAMAHIAAIQYIQNSEEHKMVALQALYNALPLGAF
FT                   IAAMTAFSGWGFEHWGANVFWVMAAMGLVALFIKVAPVTSQVQDVSVVKAEPNAQN"
FT                   /protein_id="YP_004187415.1"
FT   gene            208729..212160
FT                   /db_xref="GeneID:10164907"
FT                   /locus_tag="VVM_00365"
FT   CDS_pept        208729..212160
FT                   /locus_tag="VVM_00365"
FT                   /gene_family="HOG000272925" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sensor histidine kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155037"
FT                   /db_xref="GeneID:10164907"
FT                   /translation="MQGWLVIPVSLAYLGVLFLIAWYGDRQKNWLARWRPWIYSLSIAV
FT                   YCTSWTFYGTVGQASNNPWSFLPIYIAPILVFTLGWRVLARLILVAKREHITSIADFIA
FT                   ARYGKSQGLAVVVTLIAVVGILPYIALQLRGITMGLEIIAPDLSSRFGYQDSGVSWFVV
FT                   GALAIFTMLFGTRHIDNTEHHRGMMMAIAFESIVKLVAFLVVGMFIVWLAMQHQEVDLS
FT                   RVAAATYQSPNIATLLIHTLLTMLAIVCLPRQFHTMVVENERAQDLHTARWLFPLYLIL
FT                   MGIFVLPIAWAGQSLLSGSPADTYVISLPMAFGANDIALLAFLGGTSAASGMVIVSTIA
FT                   LAIMVSNDLVMPLLLRRMRLSNRNHHHFSGLLLRIRRALILVLLIGAWGFYQALDAIHS
FT                   LSAIGFLSFAAITQFAPALIGGMYWRQGNRKGVYVGLAAGFTLWLITLMSQTDMLAGDA
FT                   QSNLLIWLITPPEVLGEMGVKASDWGMFLSVTVNALCFLVVSMLTRPSLSERLQSASFV
FT                   GTPLPENENISLYQSRVTVGELEMLASRFVGRNRVKNAFAHYWSQQRETLLPNQQAPST
FT                   LIRHTERVLAGVFGASSAKLVLTSALQGRNMQLEEVATIVDEASELYDFSRGLLQGAIE
FT                   HIGQGIAVVDKQLRLVAWNQRYLELFEFPPGLIQVGRPIADVIRHNAEQGLCGPGDPED
FT                   HVRRRVYHLEQGSRHTSSRIRPDGRVIEVQGNPMPGGGFVMSFTDITVFRDAEQALKEA
FT                   NETLEERVHLRTRELEQLNKQLVVATQRSELESRSKSRFLAAVSHDLMQPLNAARLFAS
FT                   SLSEVAKDDESRKLAHHIESALGAAEDLIGDLLDISRLESGKLDVHVHGFAINDVLSNL
FT                   NAEFSALAKQQGIEFCMIPSSLNVTSDPKLLRRVVQNFLTNAFRYSPNGKVALGVRRVG
FT                   ERVRIDVWDNGMGIEEDKQQEIFEEFSRGTQVRSDQGLGLGLAISKGIAQVLGHEISMR
FT                   SWHGRGSVFSITLDRAQQVQALPTAEPAQAHSELSHLRILCVDNEPDILVGMENLLARW
FT                   GCEVKTATDIVQSLKALDGGWHPDVIFSDYRLDEGRTGLEVLQQCKLRLGSRFEGVIIS
FT                   ADRTDDMMQGIKANGFSFIAKPVKPLKLRAVLNRVA"
FT                   /protein_id="YP_004187416.1"
FT   gene            complement(212217..213344)
FT                   /db_xref="GeneID:10164908"
FT                   /locus_tag="VVM_00371"
FT   CDS_pept        complement(212217..213344)
FT                   /locus_tag="VVM_00371"
FT                   /gene_family="HOG000004656" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155038"
FT                   /db_xref="GeneID:10164908"
FT                   /translation="MNSLSPKLASRVADLTYDLVSDKKPVISRYIRQSISFSFEERAYT
FT                   GHTGGFLGIIGKSSTGFALIGEGKNQYKDDLIIALRGTHSRGDMIADANIGLKGAPNGA
FT                   VAHAGFVNLFNSIKPQVRSYLLQRNKLPKTVHCVGHSLGGALASLFSSWLKTEFSLRTY
FT                   LYTFGAPRVGLQGYADKQIDRSYRCTHGADPVPMFPLWPFVHSGSEYRLDASTGVVFST
FT                   HTMSENGNPGYVNTASYENWESLQKISHNFFNKRVVLDYNRRKEAAFNETWKDKILGAI
FT                   VTLLRDSGIASHLQFALMPTLTVYDILARYLAKIANISKQKYEQTKGIIGHILVFSGRA
FT                   AIEINELSYHFIKWAFSLMKKKLMLAVQAALNSLN"
FT                   /protein_id="YP_004187417.1"
FT   gene            complement(214608..216311)
FT                   /db_xref="GeneID:10164909"
FT                   /locus_tag="VVM_00374"
FT   CDS_pept        complement(214608..216311)
FT                   /locus_tag="VVM_00374"
FT                   /gene_family="HOG000262336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetate permease ActP"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155039"
FT                   /db_xref="GeneID:10164909"
FT                   /translation="MDIQTWTFILVGITFALYIGIAIWARAGSTSEFYVAGGGVHPVAN
FT                   GMATAADWMSAASFISMAGIISFIGYDGTVYLMGWTGGYVLLALCLAPYLRKFGKFTVP
FT                   DFIGDRYYSRTARLVAVFCAIFVSFTYVAGQMRGVGVVFARFLEVDINMGIIIGMAIVF
FT                   FYAVMGGMKGITYTQVAQYCVLIFAFMVPAIFTSLMMTGNPVPQLGFGSTMAGSDEYLL
FT                   TKLDGLTQELGFTAYTDGSKSMVDVFFICAALMVGTAGLPHVIIRFFTVPKVSDARISA
FT                   GWALVFIAILYTTAPAVAAFARVNMIDTINGPDMQGVAGTEAPSWYKNWESTGLVAWED
FT                   KNGDGKMFYSGDERNEMKINRDIIVLASPELAKLPNWVVALLAAGGLAAALSTAAGLLL
FT                   VISTAISHDLLKKGFRPNMTDKQELMAARIASAIAIVGAGYLGINPPGFVAQVVAFAFG
FT                   LAASSFFPAIILGIFYKKMNKEGAITGMLAGITFTAAYIVYFKFINPAASTPDNWLFGI
FT                   SPEGIGTLGMCLNFVVAIVVNKFTAEVPSDVQEMVESIRYPKGAGAAHDH"
FT                   /protein_id="YP_004187418.1"
FT   gene            complement(216324..216590)
FT                   /db_xref="GeneID:10164910"
FT                   /locus_tag="VVM_00375"
FT   CDS_pept        complement(216324..216590)
FT                   /locus_tag="VVM_00375"
FT                   /gene_family="HOG000262347" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155040"
FT                   /db_xref="GeneID:10164910"
FT                   /translation="MAFESTEHAQAYWKENLGIMGSLLAVWFLVSYGAGILFVDALNAI
FT                   QFGGFKLGFWFAQQGSIYTFVALIFVYVVRMNALDKKYNVQED"
FT                   /protein_id="YP_004187419.1"
FT   gene            complement(216806..217429)
FT                   /db_xref="GeneID:10164911"
FT                   /locus_tag="VVM_00376"
FT   CDS_pept        complement(216806..217429)
FT                   /locus_tag="VVM_00376"
FT                   /gene_family="HOG000112971" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multiple antibiotic resistance protein marC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155041"
FT                   /db_xref="GeneID:10164911"
FT                   /translation="MLSILITQFVVLWAVIDPVGSVPVYLSQTQHLTAKQRRLVALKAV
FT                   GISAGVLLFFLIAGQMLLEAMQIPLPAFQAAGGLVLLLFALSMIFGESKPEQEQKLSEE
FT                   LDKSALADLAVYPLAIPSIASPGAMMAVVMLTDNHRYSFADQAITAGVMLAVLLITLVL
FT                   LLGANTIQKWIGNVGAAIISRVMGLILAAVALNNLLQGIKDFYL"
FT                   /protein_id="YP_004187420.1"
FT   gene            complement(217578..218213)
FT                   /db_xref="GeneID:10164912"
FT                   /locus_tag="VVM_00377"
FT   CDS_pept        complement(217578..218213)
FT                   /locus_tag="VVM_00377"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator LuxR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155042"
FT                   /db_xref="GeneID:10164912"
FT                   /translation="MDSTYTIIIADDHPLFRNALFQSVHMAVSGANLLEADSLDALLNL
FT                   LIREEEPDLLLLDLKMPGANGMSGLIHLRAEYPDLPIVVVSASEEPAVVTQVKSHGAFG
FT                   FIPKSSDMRTLVSALNQVLNGDPYFPEGLITNNAACNDLAEKIAALTPQQYKVLGMLSD
FT                   GLLNKQIAYELNVSEATIKAHMTAIFRKLGVKNRTQAVILLQQLEPEQ"
FT                   /protein_id="YP_004187421.1"
FT   gene            complement(218399..220180)
FT                   /db_xref="GeneID:10164913"
FT                   /locus_tag="VVM_00379"
FT   CDS_pept        complement(218399..220180)
FT                   /product="cytochrome c-type biogenesis protein DsbD
FT                   /gene_family="HOG000254981" [ FAMILY / ALN / TREE ]
FT                   protein-disulfide reductase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00379"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="GI:320155043"
FT                   /db_xref="GeneID:10164913"
FT                   /translation="MRALLTFFVAGLLVLSSPAMALFGNNQNSSFASGSNDFVPVDQAF
FT                   PFNYFQQDHRITLDWQVKEGYYLYQQRLSFSAENVVLGDIQMENGQPYRDEFFGDVNIY
FT                   TNPLFVNIPMQDWQPGAKLIVQYQGCAKAGFCYPPETRVIDITSFTNGDMAPATMPTQT
FT                   ANPLDTSTPQPLTQQDQLASGLADNWWTPLLFLALGVGLAFTPCVLPMYPILTSIVLGS
FT                   GKLSQRRALGLSLVYVQGMALTYTLLGLVVASAGLQFQAAMQHPYVLIGLSILFVTLAL
FT                   SMFGVYTLQLPSSVQTWLNNLSNKQQGGSSAGVFAMGAISGLVCSPCTTAPLSGALLYV
FT                   AQSGDLLTGGVALYALAMGMGIPLILVAVFGNKLLPKAGGWMDRVKTLFGFVLLAAPIF
FT                   LLERILPEMWSTALWSALGIAAFGWLYHVKNSLEFGGWKQSAVGIIAVLGLFASAQPAL
FT                   NYWFTDSSQQTQTSEVSFIKIRNVEELQQQLALAKQAKKPVMLDFYADWCVACKEFEKY
FT                   TFHDPAVAAQLKQFVLLQADVTRNQAQDIELLQAQQVLGLPTIDFWDAQGNPVSNARLT
FT                   GFMQAAPFLEHIQRISN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187422.1"
FT   gene            complement(220323..221630)
FT                   /db_xref="GeneID:10164914"
FT                   /locus_tag="VVM_00381"
FT   CDS_pept        complement(220323..221630)
FT                   /locus_tag="VVM_00381"
FT                   /gene_family="HOG000272417" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C4-dicarboxylate transporter DcuA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155044"
FT                   /db_xref="GeneID:10164914"
FT                   /translation="MVAVELLVVLLFIYLGARIGGIGIGFAGGAGVIVLSLILGVPTKQ
FT                   AFIPVDVILIIMSVITAIAAMQVAGGMDWLVQIAENFLRKHPERITFYAPIVTFLMTLM
FT                   AGTGHTAFSTLPVIAEVAKGQGVRPSRPLSIAVVASQIAITASPISAAVVAFAAMLAPF
FT                   GVDYLTLLAVCIPTTFVACMIGALVANYMGSELKDDPEYQDRLEKGLIKLSTETQREIL
FT                   PTAKTATYIFLGAIAFVVCYAAAISSSVGLIENPALGRNEAIMTVMLAAAAAIVMFTKI
FT                   DASKIPSAATFRSGMTACVCVLGVAWLGSTFVNAHVDGIKDVAGALLSDYPWMLALVLF
FT                   FASMLLYSQGATTVALMPAALAIGVAPLTAVASFAAVSALFVLPTYPTLLAAVEMDDTG
FT                   STRIGKYVFNHPFFIPGVATIASAVALGFAFGSLFI"
FT                   /protein_id="YP_004187423.1"
FT   gene            complement(221786..223237)
FT                   /db_xref="GeneID:10164915"
FT                   /locus_tag="VVM_00383"
FT   CDS_pept        complement(221786..223237)
FT                   /product="aspartate ammonia-lyase"
FT                   /gene_family="HOG000061737" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00383"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="GI:320155045"
FT                   /db_xref="GeneID:10164915"
FT                   /translation="MATLTEAPKASTPATRIEEDLLGQRHVPADAYYGIHTLRAIENFN
FT                   ISNVTISDVPEFVRGMVMTKKAAALANKELGAIPKNVADYIIQACDLMLETGKCMDQFP
FT                   SDVFQGGAGTSVNMNTNEVLANIALELMGKEKGDYDVVNPNDHVNKSQSTNCAYPTGFR
FT                   IAVYNSIHKLMEAIEYLKGAFELKSQEFNDILKMGRTQLQDAVPMTVGQEFHAWAVTLN
FT                   EEIRALDYTSKLLLEVNLGATAIGTGLNTPPGYQALAVKHLAEVTGLAVVPAEDLIEAT
FT                   SDCGAYVMAHGALKRLAVKLSKICNDLRLLSSGPRAGLNELNLPEMQAGSSIMPAKVNP
FT                   VIPEVVNQVCFKVLGNDNTISFAAEGGQLQLNVMEPVIGQAMFESISLLQNACVNLRDK
FT                   CIDGITVNKEICENYVYNSIGIVTYLNPYIGHHEGDIVGKICAETGKSVREVVLERGLL
FT                   TSEELDDILSVQNFMHPTYKAKRYE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187424.1"
FT   gene            223546..224076
FT                   /db_xref="GeneID:10164916"
FT                   /locus_tag="VVM_00385"
FT   CDS_pept        223546..224076
FT                   /locus_tag="VVM_00385"
FT                   /gene_family="HOG000272432" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="FxsA protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155046"
FT                   /db_xref="GeneID:10164916"
FT                   /translation="MFPILLLLFICVPIVEIALFIQVGGFIGLWPTIGLVLITAFVGAS
FT                   LVRSQGLQTLMSVQQRLQQGELPAQQIVEGVMLAVSGVLLLTPGFMTDAMGMIVLIPGP
FT                   RAAIARYLMSKVVVNGAGGGFHSHYHSEGFDRSPFEQDPFYRQPFNDGKQGQTFEGEYE
FT                   SKDKQDDEQNRLR"
FT                   /protein_id="YP_004187425.1"
FT   gene            complement(224166..224639)
FT                   /db_xref="GeneID:10164917"
FT                   /locus_tag="VVM_00386"
FT   CDS_pept        complement(224166..224639)
FT                   /product="tRNA (cytosine34-2'-O-)-methyltransferase"
FT                   /gene_family="HOG000272756" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00386"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320155047"
FT                   /db_xref="GeneID:10164917"
FT                   /translation="MFDIALYEPEIAPNTGNIIRLCANCGANLHLIEPLGFDLEEKKVR
FT                   RAGLDYHDLARVTRHKNYQAFLDYLEQRGEYRIFACTTKTTGHHVDAQYRQGDVLLFGP
FT                   ETRGLPMEVIESLPMSQRIRIPMMPDARSLNLSNAVAIIAFEAWRQLGFQGAK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187426.1"
FT   gene            complement(224747..225355)
FT                   /db_xref="GeneID:10164918"
FT                   /locus_tag="VVM_00387"
FT   CDS_pept        complement(224747..225355)
FT                   /product="manganese superoxide dismutase"
FT                   /gene_family="HOG000013584" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00387"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="GI:320155048"
FT                   /db_xref="GeneID:10164918"
FT                   /translation="MSHTFPELPYSYDALEPYIDAKTMEVHYSKHHKTYYDKFLAAIQG
FT                   SELEHQTLTEIFSSISQHSPAVRNNGGGYYNHILYWQCMSPNGGGQPQGALAHAIQEKF
FT                   GTFAAFKEAFSQAAVNTFGSGFAWLVVKEGDIHITSTSNQDNPLMDIASVRGEPILALD
FT                   VWEHAYYIRYQNRRPEYIDAWWNVVDWQVVEQNYAQAIG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187427.1"
FT   gene            complement(225432..226820)
FT                   /db_xref="GeneID:10164919"
FT                   /locus_tag="VVM_00390"
FT   CDS_pept        complement(225432..226820)
FT                   /locus_tag="VVM_00390"
FT                   /gene_family="HOG000269851" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper sensory histidine kinase CpxA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155049"
FT                   /db_xref="GeneID:10164919"
FT                   /translation="MRLPKITSLYGRIFAIFWFTMFLVLMAVLALPHLDPRKARNIPAD
FT                   QYDRFIEAKQEIEKQYRGETDLGRILFRMERPGDRHGRDGRPRFFITDYDGNILTTLKQ
FT                   GDFQLKALKNFVTSIEQPDQPKQKLYGRFMLSGPLPVTLANKEYLLYVGMRWNQPPPFL
FT                   LRMFDHPFQLLLAVMLVSTPLLLWLAWALSQPARRLEKAAQRVAKGEFVTDPSLEKGTS
FT                   EFRQAGASFNRMVEAVNQMISGQQRLLSDISHELRSPLTRLRMANALATRKQGESNELQ
FT                   RIDTEAQRLEQMISELLELSRMQMNSHLDREEQPVASLWEEIIQDAQFEAEQMGKVLQY
FT                   TPLPERHISGNPKLLMSAIENIIRNAIYYGKDQVIIAIQAIDDTLHIVVDDNGEGVPEE
FT                   ELEAIFRPFYRVSTARDRHSGGTGLGLSITESAIRQHSGTINAERSDLGGLRVTITLPL
FT                   VKRR"
FT                   /protein_id="YP_004187428.1"
FT   gene            complement(226824..227507)
FT                   /db_xref="GeneID:10164920"
FT                   /locus_tag="VVM_00391"
FT   CDS_pept        complement(226824..227507)
FT                   /locus_tag="VVM_00391"
FT                   /gene_family="HOG000034819" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper-sensing two-component system response
FT                   regulator CpxR"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155050"
FT                   /db_xref="GeneID:10164920"
FT                   /translation="MANILLIDDDTELTSLLTEVLSYEGFNVTEANDGEQGLQALSAEI
FT                   DLILLDVMMPKLNGIDTLKKLREQWDTPVLMLTAKGEEIDRVIGLELGADDYLPKPFSD
FT                   RELLARIKAILRRTSATKAPKSSDCIEYQDLKIYPGRLEAYCAGTQLDLTATEFALLSH
FT                   FMQNPGSTLTKETLSLDVLGKRLAAFDRAIDMHVSNLRKKLPERADGKSRIKTLRGRGY
FT                   LMIVE"
FT                   /protein_id="YP_004187429.1"
FT   gene            227696..228211
FT                   /db_xref="GeneID:10164921"
FT                   /locus_tag="VVM_00392"
FT   CDS_pept        227696..228211
FT                   /locus_tag="VVM_00392"
FT                   /gene_family="HOG000285733" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="p pilus assembly/Cpx signaling pathway,
FT                   periplasmic inhibitor/zinc- resistance associated protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155051"
FT                   /db_xref="GeneID:10164921"
FT                   /translation="MKLAKKMVLAAVVLPLTLGTASAFAFGGGKGHHKGPDGECGMGMD
FT                   RGILRQLDLTDAQKEQLDAMRGSNRAQMKEMHQGNFAANQAERQAQHAKVQALLLADNF
FT                   DQATANELAKQMAEKQAERRVKMLEKQHQMLSILTPEQKAKFVELQNERMQECGDKMQK
FT                   RMEKHAKN"
FT                   /protein_id="YP_004187430.1"
FT   gene            228325..229239
FT                   /db_xref="GeneID:10164922"
FT                   /locus_tag="VVM_00393"
FT   CDS_pept        228325..229239
FT                   /locus_tag="VVM_00393"
FT                   /gene_family="HOG000069673" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cobalt-zinc-cadmium resistance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155052"
FT                   /db_xref="GeneID:10164922"
FT                   /translation="MIMKHQYARLVTMAAWTATAVATLLLLVKIVAWWVTGSVSLLASL
FT                   IDSFLDIAASVVNLIVVRYALQPADEEHTFGHGKAESLAALAQAMFISGSAVFLILNGI
FT                   DRFFRPHELNSPEYGVFVSLFAMVVTFALVTFQKYVVKKTGSQAIAADSLHYQSDLFMN
FT                   AAIMVALGLSYYGVGQADAVFAVGIGLFILYSAFKMVMEAIQTLLDRKLPDEELEQIRC
FT                   ECLAVENVLGVHQLRTRMSGPTRFIQLHLELDDDLPLIKAHQIADEVEERLLACFPDAD
FT                   VLIHQDPYSVVIVSEKEQIEQQW"
FT                   /protein_id="YP_004187431.1"
FT   gene            229526..230488
FT                   /db_xref="GeneID:10164923"
FT                   /locus_tag="VVM_00396"
FT   CDS_pept        229526..230488
FT                   /product="6-phosphofructokinase"
FT                   /gene_family="HOG000248870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00396"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="GI:320155053"
FT                   /db_xref="GeneID:10164923"
FT                   /translation="MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGL
FT                   YEGRIKQLDRSSVSDVINRGGTFLGSARFPEFKEVAVREKAIENLKAHGIDALVVIGGD
FT                   GSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTIGYLTALNTVIESIDRLRDTSSSHQR
FT                   ISIVEIMGRHCGDLTLMSAIAGGCEYIITPETGLDKEKLIGNIQDGISKGKKHAIIALT
FT                   ELMMDANELAKEIEAGTGRETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHG
FT                   GRCVGIVKEQLVHHDIIDAIENMKRPVRNDLFKVAEELF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187432.1"
FT   gene            complement(230569..231915)
FT                   /db_xref="GeneID:10164924"
FT                   /locus_tag="VVM_00399"
FT   CDS_pept        complement(230569..231915)
FT                   /locus_tag="VVM_00399"
FT                   /gene_family="HOG000272443" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155054"
FT                   /db_xref="GeneID:10164924"
FT                   /translation="MLDKHGLLSAPIAETLRKMTVPMIFGMVAILMFNLVDTFFISLLG
FT                   TEALAAISYTFPVTFAVNCITMGIGVGLSTSIGRLLGQGEAHQAARFTTHGLLLAVVLV
FT                   ALASTLGFFTVTPLFTLLGAKEALIPLIGQYMHVWYLTIPLLVIPMAGNSAIRATGDTK
FT                   TPAKIMMLAGLINGVLDPLLIFGIGPFPELGIQGAAIASALSWLGALIGSFYVLIQRER
FT                   LLGLPQWQRLKEDWQQILKVGTPAALSNAMNPLSGAILMMMLSSHGTAAVAAYGAAQRI
FT                   ESILILVLMALTSALTPFMAQNFGAKNPQRAFQGLFVSMRFSVLFQGLVFLMMVPLSIP
FT                   LAALFSQEQAVRDLLWHYLLVVPISYGFLGIVMMLVSGLNAMHQPLNAFRWSVIRLFVF
FT                   TLPAAYLGSWLYDIEGLFIGIAVGNILVGLCSYLYALKQRKQQLATLVP"
FT                   /protein_id="YP_004187433.1"
FT   gene            232167..232457
FT                   /db_xref="GeneID:10164925"
FT                   /locus_tag="VVM_00401"
FT   CDS_pept        232167..232457
FT                   /locus_tag="VVM_00401"
FT                   /gene_family="HOG000133897" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein 60 family co-chaperone GroES"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155055"
FT                   /db_xref="GeneID:10164925"
FT                   /translation="MNIRPLHDRVIVERQEVESKSAGGIVLTGSAAEKSTRGVVLAVGK
FT                   GRILENGTVQPLDVKVGDTVIFAESYGTKTEKIDGKEVLIMSENDIMAIVD"
FT                   /protein_id="YP_004187434.1"
FT   gene            232531..234171
FT                   /db_xref="GeneID:10164926"
FT                   /locus_tag="VVM_00402"
FT   CDS_pept        232531..234171
FT                   /locus_tag="VVM_00402"
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="heat shock protein 60 family chaperone GroEL"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155056"
FT                   /db_xref="GeneID:10164926"
FT                   /translation="MAAKDVKFGNDARVKMLEGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFQNMGAQMVKQVASQANDVAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVAAAVEELKALSKDCSTSTEIEQVGTISANSDSSVGKIIA
FT                   EAMEKVGRDGVITVEEGQALHDELDVVEGMQFDRGYLSPYFINNQESGSVELESPFILL
FT                   VDKKISNIRELLPALEAVAKASRPLLIIAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTGGTVISEEVGLELEKATLEDLGQAKRVSITKENTTIIDGVGEEA
FT                   MIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVEDA
FT                   LHATRAAVEEGIVAGGGVALIRAASKIVDLQGDNEEQNVGIRVALRAMEAPLRQITKNA
FT                   GDEESVVANNVRAGEGSYGYNAATGVYGDMLEMGILDPTKVTRSALQFAASVAGLMITT
FT                   EAMVTDLPQKDSGMPDMGGMGGMGGMGMM"
FT                   /protein_id="YP_004187435.1"
FT   gene            234514..235068
FT                   /db_xref="GeneID:10164927"
FT                   /locus_tag="VVM_00406"
FT   CDS_pept        234514..235068
FT                   /locus_tag="VVM_00406"
FT                   /gene_family="HOG000278376" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155057"
FT                   /db_xref="GeneID:10164927"
FT                   /translation="MKKILTAAVVTALTSTAAMAATPVMFSSINNFNAPDDSAVAGVRV
FT                   AALYGKVDNLKGVDLAVVGLSETDTTTGVNLGIFGASKVNQEMTGASLGFFNWNTGQTT
FT                   GVNLGAVNLTNDVKGANVSFVNYSEGNTMVDVGAANFSDTSTVQVGVFNKTAKIEGVQI
FT                   GLINCADNGFFPCFPIINFAK"
FT                   /protein_id="YP_004187436.1"
FT   gene            complement(235171..235665)
FT                   /db_xref="GeneID:10164928"
FT                   /locus_tag="VVM_00408"
FT   CDS_pept        complement(235171..235665)
FT                   /locus_tag="VVM_00408"
FT                   /gene_family="HOG000080250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155058"
FT                   /db_xref="GeneID:10164928"
FT                   /translation="MSLTLDSLLNIEPFSWVALLCCAVNGLLIGAERQTRGKPVGIRTS
FT                   ILIISGTYFFMSMAVYLSPNTLDQARVLGQIITGVGFLGAGVMMTQDGKIHGVTSAAVI
FT                   WVLASMGMMIGLGLMQQSVIMTVLALTVLLGVDKAENRIQALRRGVHQKIQQRRSSRLI
FT                   K"
FT                   /protein_id="YP_004187437.1"
FT   gene            complement(235715..236737)
FT                   /db_xref="GeneID:10164929"
FT                   /locus_tag="VVM_00409"
FT   CDS_pept        complement(235715..236737)
FT                   /product="lysine 2,3-aminomutase"
FT                   /gene_family="HOG000223517" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00409"
FT                   /EC_number="5.4.3.2"
FT                   /db_xref="GI:320155059"
FT                   /db_xref="GeneID:10164929"
FT                   /translation="MPHIITRKVESVEQNWLKQLANGISDPATLLKMLEIDPTPWQDGF
FT                   SARGLFAQRVPQSFVERMEKRNPNDPLLRQVLPVSEEHEIHPGYSVDPLEEQDNAIPGL
FT                   LHKYHNRALMIVKGGCAINCRYCFRRHFPYQDNKGSKTVWQQSLDYIAQNSALNEVIFS
FT                   GGDPLMAKDDELQWLIERIADIPHIKRLRIHSRLPVVIPARITTELCQLLEQTRLQVIL
FT                   VTHINHANEINAELTSQLHRLKRIGVTLLNQGVLLKGVNDSVEAQVHLSEALFDAGVLP
FT                   YYLHVLDKVQGAAHFYVSDQEAKAIMRGLITQVSGYLVPTLTREIGGRPSKTPLDLYLE
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_004187438.1"
FT   gene            236815..237336
FT                   /db_xref="GeneID:10164930"
FT                   /locus_tag="VVM_00410"
FT   CDS_pept        236815..237336
FT                   /locus_tag="VVM_00410"
FT                   /gene_family="HOG000010047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor P"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155060"
FT                   /db_xref="GeneID:10164930"
FT                   /translation="MIDSEPCVILENEYVKPGKGQAFNRVKIRKLLSGKVLEKTFKSGD
FT                   TCEVADVMDIDLDYLYSDGEFYHFMNNETFEQIAADAKAVGENVKWLVENNTCMLTLWN
FT                   GNPIAVTPPNFVELEVIETDPGLKGDTQGTGGKPATLSTGAVVRVPLFIQIGEVIKVDT
FT                   RSSEYVGRVK"
FT                   /protein_id="YP_004187439.1"
FT   gene            237563..238966
FT                   /db_xref="GeneID:10164931"
FT                   /locus_tag="VVM_00412"
FT   CDS_pept        237563..238966
FT                   /locus_tag="VVM_00412"
FT                   /gene_family="HOG000223446" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155061"
FT                   /db_xref="GeneID:10164931"
FT                   /translation="MNNSNLGQSLKVEERRQLLRRGIKTAIIGVPLLALGLTINSSVLM
FT                   TDAGYSYVHQNNITGELDVFTEPGIHFRMPFLSKITQYDQVITVSFGNNAGEDFYQRLD
FT                   PVQVRFADTYIGQIPVTFRFKLSTDPEALIKMHREFRNNSNLIDALLVKNARNVTVITA
FT                   TQYTGEEFFQGGLNQFKSKLGDQLREGIYLTERRQVEVEELDLAPVGVDQSNANQLQRT
FT                   NQLVWKTVPVLDSTGQPIRQDNPLQQYGIQVTQVTIGDPQPEKQLDQLLADKKRLVADR
FT                   IRAIQEQETSKAQAETEQLRKEIQRTREVQDAQRQKELAIISQQKEVEVARQIAEREIV
FT                   EVEKTKRLAEVEKEKELAIAEANLAIQKANSLSAEFEAKAILEKGRAEAEVLKAKYAAL
FT                   GANREVYLAELNRDVANSLYNNLQNFQVQMPQNYIGGSDETGLKTNLDVITGFGALGLM
FT                   DQTKKVVNK"
FT                   /protein_id="YP_004187440.1"
FT   gene            complement(239035..239412)
FT                   /db_xref="GeneID:10164932"
FT                   /locus_tag="VVM_00416"
FT   CDS_pept        complement(239035..239412)
FT                   /locus_tag="VVM_00416"
FT                   /gene_family="HOG000281495" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fumarate reductase subunit D"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155062"
FT                   /db_xref="GeneID:10164932"
FT                   /translation="MKPNYNVDRAPKRSDEPVWWSLFGAGGTWFAMITPVTVLVLGILV
FT                   PMGVINAEALSYDRVVSFATSIIGALFIIATLALPMWHAMHRVHHGMHDLKFHTGVVGK
FT                   IACYAIAGLISALAVVFIFML"
FT                   /protein_id="YP_004187441.1"
FT   gene            complement(239425..239808)
FT                   /db_xref="GeneID:10164933"
FT                   /locus_tag="VVM_00417"
FT   CDS_pept        complement(239425..239808)
FT                   /locus_tag="VVM_00417"
FT                   /gene_family="HOG000281484" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fumarate reductase subunit C"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155063"
FT                   /db_xref="GeneID:10164933"
FT                   /translation="MSNRKPYVREVKRTWWKDHPFYRFYMLREATVLPLILFTLFLTVG
FT                   LGSLVKGPEAWQTWLNFMANPVVIAINIVALLGSLLHAHTFFSMMPQVMPIRLKGKPVD
FT                   KKIIVLAQWAAVAFISLIVLIVV"
FT                   /protein_id="YP_004187442.1"
FT   gene            complement(239811..240569)
FT                   /db_xref="GeneID:10164934"
FT                   /locus_tag="VVM_00418"
FT   CDS_pept        complement(239811..240569)
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00418"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="GI:320155064"
FT                   /db_xref="GeneID:10164934"
FT                   /translation="MSANRIQKVDILRYDPATDAEPRFQAFEVPFDETMSVLDALGYVK
FT                   DHLDKNLSYRWSCRMAICGSCGIMVNGVPKLACKSFLRDYPDGVKIEPLANFPIEKDLI
FT                   VDMTPFIERLEAIKPYIIGNDRKPEDGTNLQTPEQLAKYKQFAGCINCGLCYAACPQFG
FT                   LNPEFIGPAALTLAHRYNLDSRDNGKAERMKLINGENGAWGCTFVGYCSEVCPKNVDPA
FT                   AAVNQGKVESSMDFVIAMLKPDGSPKKVEA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187443.1"
FT   gene            complement(240569..242386)
FT                   /db_xref="GeneID:10164935"
FT                   /locus_tag="VVM_00420"
FT   CDS_pept        complement(240569..242386)
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /gene_family="HOG000160475" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00420"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="GI:320155065"
FT                   /db_xref="GeneID:10164935"
FT                   /translation="MQTIITDIAVIGAGGAGLRTAIAAAEANPDLEVALISKVYPMRSH
FT                   TVAAEGGSAAVIKDEDSLDNHFNDTVGGGDWLCEQDVVEYFVENATREMIQMEQWGCPW
FT                   SRKENGEVNVRRFGGMKVERTWFAADKTGFHMLHTLFQTSMKYSNIKRFDEYFVVDLLV
FT                   DEGEVQGLIAIHMAEGELVTIKAKSVVLATGGAGRVYHCNTNGGIVTGDGMAMAYRHGV
FT                   PLRDMEFVQYHPTGLPGTGILMTEGCRGEGGIIVNKNGYRYLQDYGMGPETPVGQPKNK
FT                   YMELGPRDKVSQAFWHEQQKGNTIKHPLGDVVHLDLRHLGEEYLQERLPFICELAKAYV
FT                   NVDPAKEPIPIRPTVHYTMGGIETDKQCETRIKGLFAVGECASVGLHGANRLGSNSLAE
FT                   FVVFGRVAGEQAVKRAAEFKGWNEASIAAQVKAVEERIAALMNQEGDENWADIRTEMGH
FT                   TMEAGCGIYRQEDLMQATIEKITELKARYKKISIKDKGKVFNTDLLYAIEVGYGLEVAE
FT                   AMVHSAILRKESRGAHQRLDDGCTERDDVNFLKHSLAFFQEDQAPNISYSDVTITKSQP
FT                   KARLYGEAAEKAAAEEAAKAAEKNAEEQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187444.1"
FT   gene            242591..242722
FT                   /db_xref="GeneID:10164936"
FT                   /locus_tag="VVM_00421"
FT   CDS_pept        242591..242722
FT                   /locus_tag="VVM_00421"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155066"
FT                   /db_xref="GeneID:10164936"
FT                   /translation="MRIQLLERQGVNWMLPMIFIINNRNQFVAVFSLYNVVFVLNGA"
FT                   /protein_id="YP_004187445.1"
FT   gene            242791..243762
FT                   /db_xref="GeneID:10164937"
FT                   /locus_tag="VVM_00423"
FT   CDS_pept        242791..243762
FT                   /locus_tag="VVM_00423"
FT                   /gene_family="HOG000236579" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysyl-tRNA synthetase-related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155067"
FT                   /db_xref="GeneID:10164937"
FT                   /translation="MQADWKPTASIEQLRQRAVLIANIRQFFAQRGVLEVDTPAMSHAT
FT                   VTDIHLHTFQTEFVGPGYAQGRHLHLMTSPEFHMKRLLAAGSGCIYQMAKAFRNEENGR
FT                   HHNPEFTMLEWYRVGFDHHQLMDEMDDLLQLILKCGTAERMTYQQAFLTVLGVCPLEGS
FT                   MAELKSVAARLGLSDIAEPEEDRDTLLQLLFSIGVEAKIGQQVPAFVYDFPASQAALAK
FT                   INPNDPRVADRFEVYFKGIELANGFHELDNPQEQLTRFEQDNAKRIDMGLTPQPIDYHL
FT                   IAALESGLPACAGVALGVDRLIMLSLGCTHIDEITAFPFPIA"
FT                   /protein_id="YP_004187446.1"
FT   gene            244262..244897
FT                   /db_xref="GeneID:10164938"
FT                   /locus_tag="VVM_00425"
FT   CDS_pept        244262..244897
FT                   /locus_tag="VVM_00425"
FT                   /gene_family="HOG000262674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155068"
FT                   /db_xref="GeneID:10164938"
FT                   /translation="MKTREKIVHAALELFNQHGERSITTNHIADHIDISPGNLYYHFRN
FT                   KQEIVREIFALYAQELIERFTPVQENQESLVLLKRYLDSIFTLMWKYRFFYANLPEILS
FT                   RDEELHQQYIEVQDKLQANLVAIMREFVSLQLLELNEDELKSLVRTLHLIACSWLAYQS
FT                   AMSPKVAITEQMVQQGMLQMIAVVKPIATEQGMEQLLLLEDGVRALHG"
FT                   /protein_id="YP_004187447.1"
FT   gene            245031..245984
FT                   /db_xref="GeneID:10164939"
FT                   /locus_tag="VVM_00428"
FT   CDS_pept        245031..245984
FT                   /locus_tag="VVM_00428"
FT                   /gene_family="HOG000262269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155069"
FT                   /db_xref="GeneID:10164939"
FT                   /translation="MNYDIFNGDADGIIALLQLRLAEPRSATLVTGVKRDIKLVEKVAA
FT                   QAGDHLTILDISMEKNIAGVQAALAAGAQLFYADHHKAGEIPAHPHLDAHIDLDANICT
FT                   ALIVDKLLDGRFHHWAITAAYGDNLIARADELAIKAGLNEQQRAQLCELGTLINYNGYG
FT                   EKLADLHFDPAELFLSLLAYSSPFDVIADASSPYHRLKQAYEHDLYVAQAVLPKHQSDK
FT                   LALIELPDTPASRRISGVFGNLLANQTPERAHAVLTRNQDDTYTVSLRAPLTNKQGAGD
FT                   ICSSFATGGGRAAAAGINALTAEELPRFIEVVEAYY"
FT                   /protein_id="YP_004187448.1"
FT   gene            complement(246053..247180)
FT                   /db_xref="GeneID:10164940"
FT                   /locus_tag="VVM_00431"
FT   CDS_pept        complement(246053..247180)
FT                   /locus_tag="VVM_00431"
FT                   /gene_family="HOG000270189" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell wall endopeptidase family M23/M37"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155070"
FT                   /db_xref="GeneID:10164940"
FT                   /translation="MAKQKTNKSGFFFLSTCVLLTFLSFPTNAASPSELQGVKNEISRQ
FT                   QKALLNQEKQLDELQKSLRSQETSIAQLEKEIKQTKQALATAKANVGQLQRKMDELEGQ
FT                   KKAQTERLETLIQTYYVTQRANASASLLQQGVEEDRISQYFQHLAKARAETINELESTK
FT                   KQLEQSQQQLLNEQSQIESLLKQQSTKHEQLAKTQGQRKKTLGNIKQSISSDKNYLAEL
FT                   QRNETRLKAEIAKAAKRNAIPMDGLAKQAGKLPWPLKGSILHQFGTKQTGQINWKGIVI
FT                   AARYGEQVKSVYPGTVVFAEYLRGYGLVVLIDHGKGDMTLYGYNQALLKKEGDKVTAGE
FT                   VIALAGDTGGQDRASLYFEIRRNSEAQNPRNWLVR"
FT                   /protein_id="YP_004187449.1"
FT   gene            complement(247237..248058)
FT                   /db_xref="GeneID:10164941"
FT                   /locus_tag="VVM_00433"
FT   CDS_pept        complement(247237..248058)
FT                   /product="serine acetyltransferase"
FT                   /gene_family="HOG000049437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00433"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="GI:320155071"
FT                   /db_xref="GeneID:10164941"
FT                   /translation="MKHCEKQKVWQSIVKEARELSEQEPMLASFYHATIIKHESLCAAL
FT                   SYILANKLNTASMPAMAVREVVEEAFAADPNITDSAACDICATVNRDPAVSMYSIPLLY
FT                   LKGYHALQGYRVANWLWKQGRYALATYLQNQISVACQVDIHPAARIGKGIMLDHATGIV
FT                   IGETAVVENDVSILQDVTLGGTGKECGDRHPKIREGVMIGAGAKILGNIEVGEGAKIGS
FT                   CSVVLQPVPPHTTVAGVPARIVGRPQSDKPSLDMDQGFNGKYPNFIDGDGI"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187450.1"
FT   gene            complement(248098..249135)
FT                   /db_xref="GeneID:10164942"
FT                   /locus_tag="VVM_00435"
FT   CDS_pept        complement(248098..249135)
FT                   /product="glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /gene_family="HOG000246854" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00435"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="GI:320155072"
FT                   /db_xref="GeneID:10164942"
FT                   /translation="MTQTLVNNAYGKEISMTVIGAGSYGTSLAISLSRNGANVVLWGHE
FT                   PEHMAKLEADRANHEFLPGIEFPPSLIVESDLAKAVQASRDLLVVVPSHVFGIVLNSLK
FT                   PYLRDDSRICWATKGLEPETGRLLKDVAFDVLGEHYSLAVLSGPTFAKELAAGMPTAIS
FT                   VASPDAQFVADLQEKIHCSKTFRVYANSDFTGMQLGGAVKNVIAIGAGMSDGIGFGANA
FT                   RTALITRGLAEMCRLGAALGAQPETFMGMAGLGDLVLTCTDNQSRNRRFGLALGQGKDV
FT                   DTAQADIGQVVEGYRNTKEVWMLAQRMGVEMPIVDQIYQVLYQGKDARLAAQDLLARDK
FT                   KSEGK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187451.1"
FT   gene            complement(249319..249786)
FT                   /db_xref="GeneID:10164943"
FT                   /locus_tag="VVM_00437"
FT   CDS_pept        complement(249319..249786)
FT                   /locus_tag="VVM_00437"
FT                   /gene_family="HOG000218192" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein export cytoplasm chaperone protein (SecB
FT                   maintains protein to be exported in unfolded state)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155073"
FT                   /db_xref="GeneID:10164943"
FT                   /translation="MAEAAPQDTQQHFAIQRIFLKDVSFEAPNSPVMFQKEWNPDVKLD
FT                   LDTQSRELGEGVYEVILRLTVTVKNAEETAFLCEVQQGGIFTAEKMEAGQLAHCLGAFC
FT                   PNILFPYARETISSLVVKGTFPQLNLAPVNFDALFMNYLQQQAAQQGAEQA"
FT                   /protein_id="YP_004187452.1"
FT   gene            complement(249970..250404)
FT                   /db_xref="GeneID:10164944"
FT                   /locus_tag="VVM_00438"
FT   CDS_pept        complement(249970..250404)
FT                   /locus_tag="VVM_00438"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155074"
FT                   /db_xref="GeneID:10164944"
FT                   /translation="MQEYIDFIQQNMIMFLAWVGLVIAVIMSFVKSATAAYKIITVNEL
FT                   TALVNRENGQVIDIRAKDEFKKGHITDAVHILPSDIKNGNFGSLENRKSDPIIVVCKTG
FT                   QTAQESANLLAKAGFENVSVLKNGLISWSEANLPLVRSKR"
FT                   /protein_id="YP_004187453.1"
FT   gene            250524..250724
FT                   /db_xref="GeneID:10164945"
FT                   /locus_tag="VVM_00439"
FT   CDS_pept        250524..250724
FT                   /locus_tag="VVM_00439"
FT                   /gene_family="HOG000144796" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155075"
FT                   /db_xref="GeneID:10164945"
FT                   /translation="MSVWAIEVIGDIDFRKESKWWIIMAMKSFCPSETIIGGWLSAFFF
FT                   MACKNTTGVRQHNLILSYSFA"
FT                   /protein_id="YP_004187454.1"
FT   gene            250771..252351
FT                   /db_xref="GeneID:10164946"
FT                   /locus_tag="VVM_00440"
FT   CDS_pept        250771..252351
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   /gene_family="HOG000223664" [ FAMILY / ALN / TREE ]
FT                   phosphoglycerate mutase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00440"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="GI:320155076"
FT                   /db_xref="GeneID:10164946"
FT                   /translation="MSPKCRKLLKFDEVITMSAKKPLALVILDGYGYREDTASNAIANA
FT                   KTPVMDALIANQPNTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSIL
FT                   DGEFQQTAALVEAIDTAVKAEKAVHIMGLMSPGGVHSHEDHILAAVEMAAERGAEKIYL
FT                   HCFLDGRDTPPRSAEGSLQRFQDLFAKLGKGRVASLVGRYYAMDRDNNWDRVQVAYDLL
FT                   TQAKADFTYDSAVAGLAAAYERGENDEFVKATEIKAEGQESAAMQDGDAVIFMNYRADR
FT                   ARQITRTFVADFAGFERAVFPAVNFVMLTQYAADIPLAIAFPPASLENTYGEWLSKQGQ
FT                   TQLRISETEKYAHVTFFFNGGVETEFAGEERQLVASPKVATYDLQPEMSSTELTEKMVA
FT                   AIKSGKYDTIICNYPNADMVGHTGVYEAAEKAIEALDASVGQVVEAIKEVGGQLLITAD
FT                   HGNAEMMVDPETGGIHTAHTSLPVPLIYVGDKAVEFKEGGKLSDLAPTMLSLAGLEIPA
FT                   EMTGQVLVK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187455.1"
FT   gene            complement(252411..253298)
FT                   /db_xref="GeneID:10164947"
FT                   /locus_tag="VVM_00444"
FT   CDS_pept        complement(252411..253298)
FT                   /locus_tag="VVM_00444"
FT                   /gene_family="HOG000280202" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155077"
FT                   /db_xref="GeneID:10164947"
FT                   /translation="MGFEWLALAAALLWAIASLLSVTPAQHLGSFAYSRWRMGCTAVML
FT                   SSMALFTGGWSSVVAEHITPMMFSGLIGIFIGDTALFACLNRMGPRQAGLLFSCHAVFS
FT                   AILGYFLFSESMTSMELLGSLLVFSGVVLAIFFGRRGQSQNALETVKGAAWVGIALGLL
FT                   AALCQALGGIIAKPVMQTDIDPVAASAIRMISAFVAHCLLRATGAKISRATQKMNRRIF
FT                   TITAINGFLAMAVGMTLILYALRDGNVGMVALLSSTTPIMLLPILWFYTKQRPNRYAWL
FT                   GAFVAVAGTAILVQ"
FT                   /protein_id="YP_004187456.1"
FT   gene            complement(253415..254830)
FT                   /db_xref="GeneID:10164948"
FT                   /locus_tag="VVM_00445"
FT   CDS_pept        complement(253415..254830)
FT                   /locus_tag="VVM_00445"
FT                   /gene_family="HOG000218107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155078"
FT                   /db_xref="GeneID:10164948"
FT                   /translation="MQKLNMTVVWKLLVCFALPIGILLMPIDAIPIDDLTLIQHRLLAI
FT                   FLLAALLWVLEPVPVFATSILIIALELIMISDKGLHLFRTPPAGHDLGELIGYTDIFSA
FT                   FSSPIIILFMGGFALAIAASKYELDNNLARVLLKPFGQQPKFIMLGLMLITAVFSMFMS
FT                   NTATTVMMLALLGPIVASAPKGDLGIKALVLCIPIAANTGGIATPIGTPPNAIALQYLT
FT                   GENSIDFLSWMAMGLPFVLVQLTIAWLLLQKLFPSSEAKMTLKLDGKFKKSWRAVVVYV
FT                   TFAATILLWMTTQLHGMNTYVVAIIPLAVFTLTGIMGKEELKLINWDVLWLVAGGIAIG
FT                   IGLEKTGLAKALAHAINYEALSPFAIIVSLSLVCWLMANFMSNTATANLLMPIAAAIGT
FT                   SMSSLEAVGGLQGLLVVVAFSASLGMILPVSTPPNSLAYSTGLIESKDMAKVGLLIGVI
FT                   GLAIVYGAVLILA"
FT                   /protein_id="YP_004187457.1"
FT   gene            complement(254991..255848)
FT                   /db_xref="GeneID:10164949"
FT                   /locus_tag="VVM_00446"
FT   CDS_pept        complement(254991..255848)
FT                   /product="phosphatidylserine decarboxylase"
FT                   /gene_family="HOG000282407" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00446"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="GI:320155079"
FT                   /db_xref="GeneID:10164949"
FT                   /translation="MDKIKVGLQYWIPQHGLTRLVGKLASAKAGSLTTAIIRWFIKQYN
FT                   VNMDEAKHADPKHYKTFNEFFVRELKEGARPIAEGDAIITHPADACVSQFGPITNGQLI
FT                   QAKGHDFSAQELLGGDAALAEEFKDGSFATLYLSPRDYHRVHMPCDGTLRQMIYVPGDL
FT                   FSVNPLTAENVPNLFARNERVVCIFDTEFGPMAQVLVGATIVGSIEQVWAGTITPPRGN
FT                   TVYKWDYPASGNHAVILKKGEEMGRFKLGSTVINLFAKDAIRFDESMANGQPTVMGTPY
FT                   AHQQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187458.1"
FT   gene            complement(255957..257015)
FT                   /db_xref="GeneID:10164950"
FT                   /locus_tag="VVM_00448"
FT   CDS_pept        complement(255957..257015)
FT                   /locus_tag="VVM_00448"
FT                   /gene_family="HOG000006957" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosome small subunit-stimulated GTPase EngC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155080"
FT                   /db_xref="GeneID:10164950"
FT                   /translation="MAKKKKLTQGQVRRVRDNQQKRLKKQADTIQWDEAMLGDSRRGLV
FT                   ITRFGQHADIEDAETGLIERCNLRRGIESLVSGDKVIWRKGLESMAGISGVVEAVEPRT
FT                   SVLTRPDYYDGLKPVAANIDQMVIVSSVLPELSLNIIDRYLIAAETLGIEPLLVLNKID
FT                   LLQEAELATYREWLADYEKIGYKILYVSKRSGAGISELEAQLQDRINIFVGQSGVGKSS
FT                   LVNALIPELDIEEGEISELSGLGQHTTTAARLYHIPSGGNLIDSPGVREFGLWHLEPEE
FT                   ITKAYLEFRPYLGGCKFRDCKHADDPGCIIREAVENGEISEVRYDNYHRIIESMAENKA
FT                   NRQYSRNKKADL"
FT                   /protein_id="YP_004187459.1"
FT   gene            257147..257692
FT                   /db_xref="GeneID:10164951"
FT                   /locus_tag="VVM_00449"
FT   CDS_pept        257147..257692
FT                   /locus_tag="VVM_00449"
FT                   /gene_family="HOG000246596" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3'-to-5' oligoribonuclease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155081"
FT                   /db_xref="GeneID:10164951"
FT                   /translation="MSFSDQNLIWIDLEMTGLDPDVHKIIEIASIVTDSELNILAEGPV
FT                   LAIHQSEEELAKMDEWCTNTHTGSGLVERVRGSQITEQEAVEQTIAFLEKWVPKGVSPI
FT                   CGNSIGQDRRFLYRHMPELEGYFHYRYIDVSTLKELTRRWNPEVLKGFSKQGTHLALDD
FT                   IRESIAELKFYRQTIFKI"
FT                   /protein_id="YP_004187460.1"
FT   gene            257849..257924
FT                   /db_xref="GeneID:10164952"
FT                   /locus_tag="VVM_t00016"
FT   tRNA            257849..257924
FT                   /note="anticodon GCC"
FT                   /db_xref="GeneID:10164952"
FT                   /locus_tag="VVM_t00016"
FT                   /product="tRNA-Gly"
FT   gene            258035..258110
FT                   /db_xref="GeneID:10164953"
FT                   /locus_tag="VVM_t00017"
FT   tRNA            258035..258110
FT                   /note="anticodon GCC"
FT                   /db_xref="GeneID:10164953"
FT                   /locus_tag="VVM_t00017"
FT                   /product="tRNA-Gly"
FT   gene            258206..258281
FT                   /db_xref="GeneID:10164954"
FT                   /locus_tag="VVM_t00018"
FT   tRNA            258206..258281
FT                   /note="anticodon GCC"
FT                   /db_xref="GeneID:10164954"
FT                   /locus_tag="VVM_t00018"
FT                   /product="tRNA-Gly"
FT   gene            258377..258452
FT                   /db_xref="GeneID:10164955"
FT                   /locus_tag="VVM_t00019"
FT   tRNA            258377..258452
FT                   /note="anticodon GCC"
FT                   /db_xref="GeneID:10164955"
FT                   /locus_tag="VVM_t00019"
FT                   /product="tRNA-Gly"
FT   gene            258549..258624
FT                   /db_xref="GeneID:10164956"
FT                   /locus_tag="VVM_t00020"
FT   tRNA            258549..258624
FT                   /note="anticodon GCC"
FT                   /db_xref="GeneID:10164956"
FT                   /locus_tag="VVM_t00020"
FT                   /product="tRNA-Gly"
FT   gene            258679..258755
FT                   /db_xref="GeneID:10164957"
FT                   /locus_tag="VVM_t00021"
FT   tRNA            258679..258755
FT                   /note="anticodon CAT"
FT                   /db_xref="GeneID:10164957"
FT                   /locus_tag="VVM_t00021"
FT                   /product="tRNA-Met"
FT   gene            258790..258865
FT                   /db_xref="GeneID:10164958"
FT                   /locus_tag="VVM_t00022"
FT   tRNA            258790..258865
FT                   /note="anticodon GCC"
FT                   /db_xref="GeneID:10164958"
FT                   /locus_tag="VVM_t00022"
FT                   /product="tRNA-Gly"
FT   gene            258919..258995
FT                   /db_xref="GeneID:10164959"
FT                   /locus_tag="VVM_t00023"
FT   tRNA            258919..258995
FT                   /note="anticodon CAT"
FT                   /db_xref="GeneID:10164959"
FT                   /locus_tag="VVM_t00023"
FT                   /product="tRNA-Met"
FT   gene            259038..259114
FT                   /db_xref="GeneID:10164960"
FT                   /locus_tag="VVM_t00024"
FT   tRNA            259038..259114
FT                   /note="anticodon CAT"
FT                   /db_xref="GeneID:10164960"
FT                   /locus_tag="VVM_t00024"
FT                   /product="tRNA-Met"
FT   gene            259156..259232
FT                   /db_xref="GeneID:10164961"
FT                   /locus_tag="VVM_t00025"
FT   tRNA            259156..259232
FT                   /note="anticodon CAT"
FT                   /db_xref="GeneID:10164961"
FT                   /locus_tag="VVM_t00025"
FT                   /product="tRNA-Met"
FT   gene            259275..259351
FT                   /db_xref="GeneID:10164962"
FT                   /locus_tag="VVM_t00026"
FT   tRNA            259275..259351
FT                   /note="anticodon CAT"
FT                   /db_xref="GeneID:10164962"
FT                   /locus_tag="VVM_t00026"
FT                   /product="tRNA-Met"
FT   gene            complement(259927..261048)
FT                   /db_xref="GeneID:10164963"
FT                   /locus_tag="VVM_00452"
FT   CDS_pept        complement(259927..261048)
FT                   /locus_tag="VVM_00452"
FT                   /gene_family="HOG000272643" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155082"
FT                   /db_xref="GeneID:10164963"
FT                   /translation="MDYQQLAQQIKQWGKELGFEKVGICDIDLTEHEAQLQKWLDAGYH
FT                   GSMDWMARHGMMRARPAELLPGTVRVISVRMNYLPPQAQFAADLADPRQGYISRYALGR
FT                   DYHKLVRKQLSALAKKIEAEVGQFGYRPFVDSAPILERPLAQKAGLGWTGKHSLILDKD
FT                   AGSWFFLGELLIDLPLPVDQASEEACGKCQACITSCPTQAIVDNKVVDARRCISYLTIE
FT                   HDGIIAPEFRKAIGNRIYGCDDCQLVCPWNRYADLTQQGDFHRRSPLNNASLIALFQWD
FT                   EPTFLKNMEGSAIRRIGHLQWLRNIAVAMGNAPFSPQIVTALESRKGMSELLDEHINWA
FT                   LEEQAAQAGHFSLDVKKQRLIRIVDKGLPRDAR"
FT                   /protein_id="YP_004187461.1"
FT   gene            261234..261704
FT                   /db_xref="GeneID:10164964"
FT                   /locus_tag="VVM_00453"
FT   CDS_pept        261234..261704
FT                   /locus_tag="VVM_00453"
FT                   /gene_family="HOG000052238" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase YjeE"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155083"
FT                   /db_xref="GeneID:10164964"
FT                   /translation="MIMNAKQFELKDEQATILLGTQLAHLCSQQTTIYLHGDLGAGKTT
FT                   FSRGFVKALGHVGNVKSPTYTLVEPYQLADWQVYHFDLYRLADPEELEFMGIRDYFTAD
FT                   AICLVEWPEKGEGLLPKPDLDIDIRYQGEQRIAQVKANNDYGLKLLSKLELC"
FT                   /protein_id="YP_004187462.1"
FT   gene            261698..263416
FT                   /db_xref="GeneID:10164965"
FT                   /locus_tag="VVM_00454"
FT   CDS_pept        261698..263416
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /gene_family="HOG000263828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00454"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="GI:320155084"
FT                   /db_xref="GeneID:10164965"
FT                   /translation="MLSLKRIQKAAVWLSALYFLIPSLVWANVLQGVRVWPSPDETRVV
FT                   VDLADEANFSYFSLTKPDRLVVDLKSTSLKTKLPITVSDSPVLSRIRQSSPPEQGTYRL
FT                   VFELKKSAPAELFKLAPTPGGDYGHRLVIDLPHKARSTTTSSNNNAKPQTVNKDIQSVQ
FT                   RAEEILIVIDPGHGGEDPGSIGPTRRYEKNATLSISHKIAAELDAVPGIKTKLTRSGDY
FT                   FVNLNRRVAIARENDAHLLISVHADAFTSPQPRGGSVFVLNTRRANTEIARWVENHEKQ
FT                   SEILGGSGAAFTNINDKNVNQTLLDLQFSHSQKEGYKLATEILSEMGKVAQLHNSQPIN
FT                   TSLAVLRSPQIPSVLVETGFISNPTEEKLLFQRAHQDKLAKAISKAVLKYLKDNPPEGT
FT                   VFASSAKPIVHTVKRGESLSVIAERYGTSTQTIMKDNQLKSSTLSIGQTLKIHRGVPGP
FT                   KVIAAQPNTVETKTITHKVSKGEFLGMIADRYKVSVADIRRENKLKSDTLWVGQKLSIT
FT                   VNLKDQPIRKHTVARGEFLSKIAAKYGVSVSSIRQANNLRSDELAIGQVLIIPNK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187463.1"
FT   gene            263425..265419
FT                   /db_xref="GeneID:10164966"
FT                   /locus_tag="VVM_00457"
FT   CDS_pept        263425..265419
FT                   /locus_tag="VVM_00457"
FT                   /gene_family="HOG000256551" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155085"
FT                   /db_xref="GeneID:10164966"
FT                   /translation="MTIRILPARLANQIAAGEVVERPASVVKELVENSLDSGATKIDID
FT                   IEKGGAKLIRIRDNGSGIVKDELGLALSRHATSKIHTLDDLEAIMSLGFRGEALASISS
FT                   VSRLTLTSRPATQEQAWSAYTEGRDMQVKLQPTAHPIGTTVEVVDLFFNTPARRKFLRT
FT                   EKTEFAHIDELLKRIALSRFDVSITLRHNGKVIRQYRAAHNDLQAEKRLATVCGQAFVR
FT                   CMLKIELEHQGLKLHGWITTPEGARQQSDLQYCYVNGRMMRDKLINHAIRQSYETSLKP
FT                   EQFAAYVLFIELDPHQVDVNVHPAKHEVRFHQARLVHDFIYQALASALAQSDSIEQPQI
FT                   NESAFHYQAEPEVAPQGSFPAESNEVPQAVYHAIEKAPAYPRKAGQEQQLQPVAPLESS
FT                   FSSEQGREVAPAPHNERNAWMESRSPARHTTSSNQSERYGEPAPSKQQVKAYAELLHTP
FT                   DFPSQNVECHPSPSIASPVQELGKAVSVVAQRYLLTTTKAGCQLISLARAEFYRILGQL
FT                   NGDKAPLKSQPLLVPLSLKLEKGLVHAAQEHQDRFARMGILFKMRNEKALMVMGVPAPL
FT                   RQQNLQLLIPDLLSYAASQAQKEELAQNDTAMAQWLALRVAKVKSHYTLSEAIQIISEL
FT                   EQLWQEKLPLQDSQLVTSVDFSATIAQLT"
FT                   /protein_id="YP_004187464.1"
FT   gene            265424..266371
FT                   /db_xref="GeneID:10164967"
FT                   /locus_tag="VVM_00461"
FT   CDS_pept        265424..266371
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   /gene_family="HOG000039996" [ FAMILY / ALN / TREE ]
FT                   transferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00461"
FT                   /EC_number="2.5.1.75"
FT                   /db_xref="GI:320155086"
FT                   /db_xref="GeneID:10164967"
FT                   /translation="MTEQLPLALFLMGPTASGKTELAIRLRQRYPVELISVDSALIYKG
FT                   MDIGTAKPDEREQQLAPHRLIDILDPTEAYSAADFRRDALAAMNEIVAQGKIPLLVGGT
FT                   MLYFKALLEGLSPLPAANAEIRQQIEQEALTKGWSVLHDELQEIDPVSAARIHPNDPQR
FT                   LSRALEVYRISGKTLTELTETKGESLPFRVKQFAIAPKERAELHRRIELRFDKMMEAGF
FT                   EQEMRALYTRKDLHPDLPSIRCVGYRQMWDYLDGNCTLDEAIYRGICATRQLAKRQITW
FT                   LRSWDNLTWLDSENIEQSLETLSEAIASDRDSCV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187465.1"
FT   gene            266549..266809
FT                   /db_xref="GeneID:10164968"
FT                   /locus_tag="VVM_00462"
FT   CDS_pept        266549..266809
FT                   /locus_tag="VVM_00462"
FT                   /gene_family="HOG000004931" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein Hfq"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155087"
FT                   /db_xref="GeneID:10164968"
FT                   /translation="MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVNQMVYKHAISTVVPARPVSHHSGERGSDRPSEKSED"
FT                   /protein_id="YP_004187466.1"
FT   gene            266851..268140
FT                   /db_xref="GeneID:10164969"
FT                   /locus_tag="VVM_00463"
FT   CDS_pept        266851..268140
FT                   /locus_tag="VVM_00463"
FT                   /gene_family="HOG000260368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein HflX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155088"
FT                   /db_xref="GeneID:10164969"
FT                   /translation="MFDRYESGERAVLVHVNFTQQGEWEDLAECEMLVSSSGVETLQVI
FT                   TASRQSPHAKYYVGEGKAQEIAQAVQLTGAEIVIFNHALSPAQERNLERLCQCRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHISTRLIRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRERIKAILRRLEKVAKQREQGRRARNRAEIPTISLVGYTNAGKSTLFNRITEAGV
FT                   YAADQLFATLDPTLRKIELADVGPAILADTVGFIRHLPHDLVAAFKATLQETQEADILL
FT                   HVVDASDERFRENIQAVHVVLEEINAHEIPTLVVMNKIDNMEDQRPRIERDDEGVPQVV
FT                   WLSAMDGQGIDLLFEALTERLASSMVECQLRIPPQHQGRFRSTFFQMKCIQQEEYDQDG
FT                   NLLIDIRMQQVDWSRLEKREGAVLSDFIVT"
FT                   /protein_id="YP_004187467.1"
FT   gene            268186..269385
FT                   /db_xref="GeneID:10164970"
FT                   /locus_tag="VVM_00465"
FT   CDS_pept        268186..269385
FT                   /locus_tag="VVM_00465"
FT                   /gene_family="HOG000260983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HflK protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155089"
FT                   /db_xref="GeneID:10164970"
FT                   /translation="MAWNEPGNNNGNNGRDNDPWGNNNRGGQRPGGRDQGPPDLDEVFN
FT                   KLSQKLGGKFGNKGGRGPSIGGGGAIGFGVIAVIAVLVWVFAGFYTIGEAERGVVLRLG
FT                   KYDRIVDPGLNWRPRFIDEVTPVNVQAIRSLRSSGTMLTKDENVVTVSMDVQYRVADPY
FT                   KYLFRVTNADDSLRQATDSALRAVIGDSLMDSILTSGRQQIRQSTQQTLNQIIDSYDMG
FT                   LVIVDVNFQSARPPEQVKDAFDDAIAAREDEERFIREAEAYKNEILPKATGRAERLKKE
FT                   AQGYSERTINEALGQVAQFEKLLPEYQAAPKVTRDRLYLDTMEEVYSSTSKVLIDSESS
FT                   GNLLYLPIDKLAGQDSQTDTKRKTKSSSTYDQIQLESESSADNTQNTQSRSTGSRQGRY
FT                   "
FT                   /protein_id="YP_004187468.1"
FT   gene            269388..270368
FT                   /db_xref="GeneID:10164971"
FT                   /locus_tag="VVM_00466"
FT   CDS_pept        269388..270368
FT                   /locus_tag="VVM_00466"
FT                   /gene_family="HOG000260972" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HflC protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155090"
FT                   /db_xref="GeneID:10164971"
FT                   /translation="MRKLMIPVLVLVLATLLMSLFVIPEGERGIVVRFGRVLKDTNDVT
FT                   RVYEPGLHFKMPLFDRVRTLDARIQTMDGRSDRFVTSEKKDVIIDSYVKWRIEDFGRYY
FT                   LATGGGNTLTAEALLERKVTDILRAEIGAREIKQIVSGPRNGDVLPESVTSAEVSTEAA
FT                   RQALEIDGERDLIMSNVLKDTRESAMKDLGVRVVDFRMKKINLPDEISESIYRRMRAER
FT                   ESVARKHRSQGREKAEVIRAQAELEVATILAEADKTARVTRGEADAKAAKIYSDSYNKD
FT                   PEFFSFMRSLKAYEKSFGTKSDILVLDPKSEFFQYMNNAKGAAAN"
FT                   /protein_id="YP_004187469.1"
FT   gene            complement(270448..270633)
FT                   /db_xref="GeneID:10164972"
FT                   /locus_tag="VVM_00469"
FT   CDS_pept        complement(270448..270633)
FT                   /locus_tag="VVM_00469"
FT                   /gene_family="HOG000272722" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein YjeT (clustered with HflC)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155091"
FT                   /db_xref="GeneID:10164972"
FT                   /translation="MSNSLWVALGLVLIVEGLGPLLAPRGWRNMVAQLSEQPDNQLRRI
FT                   GGCLVVAGAVIAYMMS"
FT                   /protein_id="YP_004187470.1"
FT   gene            270807..272123
FT                   /db_xref="GeneID:10164973"
FT                   /locus_tag="VVM_00470"
FT   CDS_pept        270807..272123
FT                   /product="adenylosuccinate synthetase"
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00470"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="GI:320155092"
FT                   /db_xref="GeneID:10164973"
FT                   /translation="MANNVVVLGTQWGDEGKGKIVDLLTEDAKYVVRYQGGHNAGHTLV
FT                   IDGVKTVLHLIPSGILRDNVKCVIGNGVVLSPEALIKEMKPLEERGIPVRERLFISEAC
FT                   PLILPYHVAMDQAREIARGKKAIGTTGRGIGPAYEDKVARRGLRVGDLFDMEAFAEKLK
FT                   EVMEFHNFQLVNFYKAEAVSYEEVLEQAKGYAELLTSMVIDVTDELDAARKRGDKIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVAAGSGFGPRYLGYILGIAKAYCTRVGAGPFPT
FT                   ELYDGQEKQDPVGKHLGTVGHEFGATTGRLRRTGWFDAVAMRRAIQINSVSGFCLTKLD
FT                   VLDGLKELKICTGYQMEDGSVLEVSPMAAEAFEKVTPIYETMPGWSENTFGAKSLEDLP
FT                   QAAINYIKRIEELTGVPVDIISTGPDRNETIIKVHPFES"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187471.1"
FT   gene            272358..272993
FT                   /db_xref="GeneID:10164974"
FT                   /locus_tag="VVM_00472"
FT   CDS_pept        272358..272993
FT                   /locus_tag="VVM_00472"
FT                   /gene_family="HOG000271807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sodium-type polar flagellar protein MotX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155093"
FT                   /db_xref="GeneID:10164974"
FT                   /translation="MRLRTVAASLLLVLSAPFSKANVAEVGAPVPIYTEAELIKLIEQN
FT                   KHLERVRADNCQLVEDIVARATRINLPAYEFLYGDMLAWGVCVEQDVELGLYYMENAAH
FT                   QGLPAALEQLGRYYSRGTLVQQDKERAIPYLREAAAMGNLNARIHLAELLLRDYGSPLD
FT                   YEDAYRWLYNSVTADQRQHQRISMLRQGLEQRMPENIIARAKRRDTFW"
FT                   /protein_id="YP_004187472.1"
FT   gene            complement(273098..274282)
FT                   /db_xref="GeneID:10164975"
FT                   /locus_tag="VVM_00474"
FT   CDS_pept        complement(273098..274282)
FT                   /product="flavohemoprotein"
FT                   /gene_family="HOG000238921" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00474"
FT                   /EC_number="1.14.12.17"
FT                   /db_xref="GI:320155094"
FT                   /db_xref="GeneID:10164975"
FT                   /translation="MLSENTINIVKSTAPLLAETGPKLTAHFYQRMFEHNPELKDIFNM
FT                   SNQRNGDQREALFNAICAYASNIDNLPALLGAVEKIAHKHSSFLITADQYQIVGSHLLA
FT                   TIDELFSPGQAVLDAWAEAYGVLANVFIQREEQIYQDNESQTGGWRGLREFELVEKQYE
FT                   SAHICSFIFKPVDGGSVVSFKPGQYLGIYINDEQFENQEIRQYSLSSSVRPDCYRISVK
FT                   REEGGRVSNYLHDHLDVGSKVKLAAPAGDFFLDAAPTAPVVLISAGVGLTPTLSMLESL
FT                   TEHQAPVTWIHATENGQQHAFKQHVKQLVETHPHFNSLVWYNQPNSDDKIGDDFQFSGW
FT                   VNLHEIETVLKQADVQVYFCGPVGFMQFIAKQLLEMGVPEQQFHYECFGPHKVV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187473.1"
FT   gene            274413..274838
FT                   /db_xref="GeneID:10164976"
FT                   /locus_tag="VVM_00476"
FT   CDS_pept        274413..274838
FT                   /locus_tag="VVM_00476"
FT                   /gene_family="HOG000249814" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrite-sensitive transcriptional repressor NsrR"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155095"
FT                   /db_xref="GeneID:10164976"
FT                   /translation="MQLTSFTDYALRTLIYLASLPDNEQTNITDVTELFGVSRNHMVKV
FT                   INRLGQLNYIQTVRGKNGGIRLNRPAKTILVGEVVRDLEPLDLVNCSVEFCHITPACRL
FT                   KERLYRAKLAFLAELDDCSIAELLDDNAELLILLQKA"
FT                   /protein_id="YP_004187474.1"
FT   gene            complement(274902..276308)
FT                   /db_xref="GeneID:10164977"
FT                   /locus_tag="VVM_00478"
FT   CDS_pept        complement(274902..276308)
FT                   /locus_tag="VVM_00478"
FT                   /gene_family="HOG000250646" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytosine deaminase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155096"
FT                   /db_xref="GeneID:10164977"
FT                   /translation="MLKRNVIAAAIAGMSLFSSMSYAAQPADLMITDAMILTMNKDKVV
FT                   YQNGTVVVKENKIIAVGDADVAKQYQAKQVLDVDGDIVMPGLINTHTHVSMTVFRSLGD
FT                   DVPDRLHRYIFPLEAKLVSRDMVRIGANLGNVEMLKGGVTTYADMYYFEDEVAKTVDQI
FT                   GMRAVLGQSVIQFPVADAKNADEGIQYALNFIDQYQDHPRITPAFAPHAPYTNTTETLQ
FT                   KIAKLSLEKNVPVLIHLAESTREQEKIAERSNGLSPVQYMHQIGALNANLVGAHMILVD
FT                   DKDIELVKQADMGVAHNMSANIKSAKGVAPALKMYDENVRIGLGTDGPMSGNTLSTIDE
FT                   FNQVAKVHKLVNHDRAAMPPLKVIDMATMGAAKALHMEDKIGSLEVGKLADIIVIDTKA
FT                   PNMVPVYNPYSALVYSANSGNVRHAIVDGKLIMQERQINTVNEEQIRQEALAFTDIVRK
FT                   TVLDSGEEIR"
FT                   /protein_id="YP_004187475.1"
FT   gene            276559..279012
FT                   /db_xref="GeneID:10164978"
FT                   /locus_tag="VVM_00479"
FT   CDS_pept        276559..279012
FT                   /locus_tag="VVM_00479"
FT                   /gene_family="HOG000071120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3'-to-5' exoribonuclease RNase R"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155097"
FT                   /db_xref="GeneID:10164978"
FT                   /translation="MSDVIQNDPFADRESENYENPIPSREFILEFLEQAGVPMNRNDLF
FT                   EALQLKDEDQYEGLRRRLRAMERDGQLVFTRRQCYALPEKLEMIKGYVIGHKDGHGWVR
FT                   PEGSVNKDDDILLPHHQMKTLIHGDFVLVQPTDNSKRGRREGRLVRVLDERKAQIVGRF
FT                   FLEYGYSYVVPDDSRISHDILIPNEHKAGARMGNVVVIEITDRGARSRGMMGKVVEVLG
FT                   ENMAPGMETQIAIRTHQIPHEWPEEVDKQIANLGEEVPEEAKVGRVDLRQLPLVTIDGE
FT                   DARDFDDAVYCEKKKSGGWRLWVAIADVSYYVRPDSALDKEAINRGNSVYFPSQVVPML
FT                   PEVLSNGLCSLNPQVDRLCMVCEMTISDSGKLSGYKHYEAVMNSHARLTYTKVSQILEG
FT                   DEELRERYAPLVPHLEELHAMYKVLKEARDQRGAIEFETVETKFIFNAERKIDRIEPVI
FT                   RNDAHKIIEECMIMANIASASLVEKAKEPALYRIHESPGELRLQGFRDFLGELGLDLKG
FT                   GLEPSPTDYADLVKQIGERADKELIQTMLLRSMKQAVYNADNAGHFGLALQRYAHFTSP
FT                   IRRYPDLLLHRAIKYLIAKEKGQNQDRWTPTGGFHYSFDDMDFYGEQCSMTERRADDAT
FT                   RDVADWLKCEYMQDHVGDELDGVIANVTSFGFFVRLTELHIDGLVHISTLANDYYQFDP
FT                   IGQRLIGESFGHIYRLGDAVKVKVLAVNLNDKQIDFELVGTSRKLRGEGKTAKKRVAEA
FT                   KEKAKAKKKGVARASKAPMRHEPVVEPTKRPEEKDGKKKKVKKAQKKKPHSKPKKAKRS
FT                   KNAAE"
FT                   /protein_id="YP_004187476.1"
FT   gene            279050..279793
FT                   /db_xref="GeneID:10164979"
FT                   /locus_tag="VVM_00483"
FT   CDS_pept        279050..279793
FT                   /product="23S rRNA (guanosine-2'-O-) -methyltransferase
FT                   /gene_family="HOG000218798" [ FAMILY / ALN / TREE ]
FT                   RlmB"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00483"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320155098"
FT                   /db_xref="GeneID:10164979"
FT                   /translation="MSNEFIYGIHAVRAVLDKEPERFIEAYVLKGRQDDRLMPILNELQ
FT                   MVGVSLQQMTRKTLDDKAHGANHQGIIARVKPAKQLNENDLDDILAKHASPLLLILDGV
FT                   TDPHNLGACLRNADAAGVAAVIVPKDKSAPMTATVSKVACGAAETVPLVRVTNLARTMR
FT                   HLQEQGIWIVGTAGEATHDIYQAKLTGSLAIVMGAEGDGMRRLTRETCDDLIKIPMAGA
FT                   VSSLNVSVASGICLFEAVRQRLASQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187477.1"
FT   gene            279873..280574
FT                   /db_xref="GeneID:10164980"
FT                   /locus_tag="VVM_00486"
FT   CDS_pept        279873..280574
FT                   /product="phosphoglycolate phosphatase"
FT                   /gene_family="HOG000248344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00486"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="GI:320155099"
FT                   /db_xref="GeneID:10164980"
FT                   /translation="MSQVVMTQQEIKLIAFDLDGTLLDSVPDLAVAADQATRAVGFPGV
FT                   TELQVRDYVGNGADILIGRALSQSLTINPELSDELRAQARELFDDFYQQTGHKLSHLYP
FT                   TVKETLKELHQAGFTLALVTNKPSKFVPDVLQQHGIADYFVDVLGGDSFPEKKPNPIAL
FT                   NWLMEKHQIQPTEMLMVGDSKNDILAAKNAGCASFGLTYGYNHGEPIAASEPDFVADSL
FT                   AQLLDVVLVSA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187478.1"
FT   gene            280710..281726
FT                   /db_xref="GeneID:10164981"
FT                   /locus_tag="VVM_00487"
FT   CDS_pept        280710..281726
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00487"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="GI:320155100"
FT                   /db_xref="GeneID:10164981"
FT                   /translation="MSKPIVLSGVQPSGELSIGNYLGALRQWQQMQDDYDCQYCVVDLH
FT                   AITVRQDPKALHEATLDALAICLAVGVDPKKSTLFVQSHVPEHAQLGWLLNCYTQMGEL
FT                   SRMTQFKDKSARYANDVNVGLFGYPVLMAADILLYGAHQVPVGSDQKQHLELARDIATR
FT                   FNNIYSPENPIFTIPEPYIPTVNARVMSLQDATKKMSKSDDNRKNVITLLEDPKSIIKK
FT                   INKAQTDTETPPRIAHDWDNKAGISNLMGLYSAATGMSFEEIEAKYQGVEMYGPFKKDV
FT                   GEALVSMLEPIQAEYHRIREDRGYMNEVMRQGADKASERAAETLKKVYEVVGFVGRP"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187479.1"
FT   gene            282197..283288
FT                   /db_xref="GeneID:10164982"
FT                   /locus_tag="VVM_00492"
FT   CDS_pept        282197..283288
FT                   /locus_tag="VVM_00492"
FT                   /gene_family="HOG000041950" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155101"
FT                   /db_xref="GeneID:10164982"
FT                   /translation="MLKRNAVAMAISSLLMASAAQAATIYENENGDYLKLYGEVGVGGH
FT                   IGANFEYGEFYTDEKSYIDDSFATMGVRGKNGRMHYRLELDYERENWQYGSGDLVLSID
FT                   KLFLGYDLLESNDFNQYIEVGLTDTAFDDYDKWGDFTFDTTVETGEAGDQDMTIKYEGR
FT                   FFSDIKVGTSYTYGGKSSSGSELGDIVNGYLGYFGERFSAVVGLEGRGGSDGKSKYGEQ
FT                   QLLGFGARFAVTEAIHLGFNAFLEKEDIAQDKTLVSTDPTTGEKSYVYNNFQTEENKGA
FT                   LVSAKYIFTPQWEFTASYNFEQYEKWDNTSDVWDGKDNSWGKERVWGTLGVNYKPTKST
FT                   VIALEMNTGEAAQDAYAYARVYF"
FT                   /protein_id="YP_004187480.1"
FT   gene            283312..286443
FT                   /db_xref="GeneID:10164983"
FT                   /locus_tag="VVM_00494"
FT   CDS_pept        283312..286443
FT                   /locus_tag="VVM_00494"
FT                   /gene_family="HOG000127540" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="extracellular deoxyribonuclease Xds"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155102"
FT                   /db_xref="GeneID:10164983"
FT                   /translation="MNKKMTLLAGAISSVLSGAALADINDIIITEYMEGGYNNKAVEIT
FT                   NLGTTDYVFPNTIDIAYQKDGAAWNRMNQSADQSKSALDGITLAPGKTLVLRNPSNTAN
FT                   EQAQITALEAAKTKFGAQVVDATVYYNGNDAVALRDVTNPDAPVILDVVGVVGSADNWG
FT                   KDVTLRRFESAKAQKDAYVAKDWLVEAKDTFSGLGDPAFAEPLATAPCSDAEAGVLHKY
FT                   IGEVQGEGYSSPLIESGYTSKDEYLVTGVVSAVATSLVKGFYLYDDNADGNVKTSDGVF
FT                   VKTSGAVSKDMIGQQICVRAKVNEDYGMTTLLPTGNIWEVKNSTPVEVTPVKLERIDSD
FT                   DDTFRSTLERLEAMPVVLVEDMDVAEGNQDMRVSRTFSFDYSAKRNNMVIAYKRPNPQP
FT                   NQDHVAGSDAAKAQTAQNKDYRIVVESDEKPADGKIPYYPEFASDPHNNYIRINDSVVG
FT                   MTGVLHYSYNEFRLIPTANVTKANFVHNTPRTSSPVIKESYGDDGFTIKVATQNVLNYF
FT                   NSPYGGHDNQFGDNRGAESQQEFERQQAKIVEAIYGLDADIVGLMEVENNGFGDFSAIR
FT                   ELLEAINAKYYKENYKDRFARESIHNRYVFVGFDKNGDQVLDQFDTIGSDAITTGIIYR
FT                   PSKVSVIAGKVIPMPWQDAPMIVDADGKPVVDGKGELAESGKNYQRNTVAATFRVLNTG
FT                   KQLTVSVNHLKSKGSTCWDDYVGTKAVDDDAQGSCENFRVASTYHLGQEMAKIGGDQIV
FT                   LGDMNSYAHEDPMLVLTSNPTKKALKAADYIKVGNKWQFNGEQGPVITQTFGFINAVDY
FT                   KTPAGETSWSYSYNDEVGSLDHLLITSSLKSRLVDAVDWHINAPESTLFDYSNKYKGGD
FT                   SNEANPFYKADAFRSSDHDSALVTIGYKYGEAGESQVVIGTKSDRADVYFPVSESVKNG
FT                   DVAELTISPAPQGVVPLRETVGKDGAQTLRFDVAGLPKGEYTMTMRVLRSAATRAAADE
FT                   TVVESKSMTVTVAKRDSSNVKPVVPAYDGSGGAFGFGALLSLFGFGFLRRRRSL"
FT                   /protein_id="YP_004187481.1"
FT   gene            286586..287164
FT                   /db_xref="GeneID:10164984"
FT                   /locus_tag="VVM_00498"
FT   CDS_pept        286586..287164
FT                   /product="para-aminobenzoate synthase, amidotransferase
FT                   /gene_family="HOG000025029" [ FAMILY / ALN / TREE ]
FT                   component"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00498"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="GI:320155103"
FT                   /db_xref="GeneID:10164984"
FT                   /translation="MLLIIDNYDSFTYNLYQYFCELGAQVQVVRNDEIDLAGIAQLNPT
FT                   HLVISPGPCTPNEAGISLAAIEHFADKLPILGVCLGHQAIAQVFGAKVVRARQVMHGKT
FT                   SPITHNGRSVFKGLNNPLTVTRYHSLVVENGSLPECFELTAWTTHADGSMDEIMGYQHK
FT                   TLAIDAVQFHPESIKTEQGHQLLANFLAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187482.1"
FT   gene            287515..288726
FT                   /db_xref="GeneID:10164985"
FT                   /locus_tag="VVM_00500"
FT   CDS_pept        287515..288726
FT                   /product="acetylornithine
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   aminotransferase/N-succinyl-L,L-diaminopimelate
FT                   aminotransferase/Succinylornithine transaminase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00500"
FT                   /EC_number="2.6.1.11"
FT                   /EC_number="2.6.1.17"
FT                   /EC_number="2.6.1.81"
FT                   /db_xref="GI:320155104"
FT                   /db_xref="GeneID:10164985"
FT                   /translation="MTVEMKVERGLFDEVMVPCYNPMEMIPVKGQGSRIWDQNGNEYID
FT                   FAGGIAVSCLGHCHPVMVNALTEQAGKLWHLSNVMTNEPALRLAKKLTEVSFAERVFFA
FT                   NSGAEANEAALKLARRYAADVYGPEKSEIIAFKQGFHGRTFFTVTVGGQAAYSDGFGPK
FT                   PGDVTHLPYNDIEALQAHISDRTCAVMMEPLQGEGGIIPPTAEFIQAVRELCDKHNALL
FT                   VFDEVQTGNGRTGEFYAYQGLGVTPDILSTAKSLGGGFPIGAMLTTAKLAEHLKVGTHG
FT                   STYGGNPLACAVAEAVVTEVSKPETLQGVKEREQWFREGLAKLNEKYQIFAEIRGKGLL
FT                   LGAALNEQWQGRARDVLVAAGKEGLLVLVAGANVVRFTPSLVITKQEIEEGFAKLDKAI
FT                   ASLV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187483.1"
FT   gene            288962..289981
FT                   /db_xref="GeneID:10164986"
FT                   /locus_tag="VVM_00502"
FT   CDS_pept        288962..289981
FT                   /product="arginine N-succinyltransferase"
FT                   /gene_family="HOG000258231" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00502"
FT                   /EC_number="2.3.1.109"
FT                   /db_xref="GI:320155105"
FT                   /db_xref="GeneID:10164986"
FT                   /translation="MLVVRPIAMSDYESLHTCAVESGHGFTSLPVNEELLTNRIKHSEY
FT                   SFAKANVTEPGDEGYLMVGFDSETGEVAGTTGIEASIGWDVPFYSYHISKIVHSSPKLG
FT                   VNNVVKLLTFGNNYTGCSEICTLFLREKFREGLNGRLMSKCRFLMMAEHPHRFSQTIFA
FT                   EMRGVSDAQGNSPFWQWLQEHFFSIDFTMADYLTGIGKKGFIADLMPKLPIYINLLSPE
FT                   AQAVIGQVHDNTRPALKLLEREGFTNRGYVDIFDGGPTVECDLRNIESVRHSVRAKVRI
FT                   SEHSSSKAFLIANTSFEDFRATAAKAAYDPATSSVILSPAVAEALNVEDGHYVRMLPQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187484.1"
FT   gene            289999..291456
FT                   /db_xref="GeneID:10164987"
FT                   /locus_tag="VVM_00504"
FT   CDS_pept        289999..291456
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /gene_family="HOG000271506" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00504"
FT                   /EC_number="1.2.1.71"
FT                   /db_xref="GI:320155106"
FT                   /db_xref="GeneID:10164987"
FT                   /translation="MTQWIAGEWVEGLGEEFTSLSPYDNQVVWRGKGATAEQVEMAVKA
FT                   ARQAFVGWKTLSVAEREAVVLAFAEQVKENSEEIAQVIAKETGKPLWETRTEAAAMAGK
FT                   IAISIRAYHERTGESQKEAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGN
FT                   TVVFKPSEQTPWTGELAMRLWQAAGLPQGVINLVQGGKETGIALAESKGIDGLLFTGSA
FT                   NTGHLLHRQFAGQPGKMLALEMGGNNPMVITDHYGDLDATVYTIIQSAFISAGQRCTCA
FT                   RRLYIPLGEKGDALITRLVEATKKLRVDQPFAEPAPFMGPQISVSAANFILAAQANLQS
FT                   LGGESLIEAKAGEAAFVTPGIIDVTNIAELPDEEYFGPLLQVVRYQTLEQAVELANDTR
FT                   FGLSAGLVSTDDGEWQYFVDHIRAGIVNRNRQLTGASGDAPFGGPGASGNLRPSAYYAA
FT                   DYCAYPMASMEGEETLLPATLSPGVEL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187485.1"
FT   gene            291669..292460
FT                   /db_xref="GeneID:10164988"
FT                   /locus_tag="VVM_00508"
FT   CDS_pept        291669..292460
FT                   /locus_tag="VVM_00508"
FT                   /gene_family="HOG000281323" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155107"
FT                   /db_xref="GeneID:10164988"
FT                   /translation="MTPAVLFQSLWNDYIQRLCPSAAKVHQLLEEDEPLINDHIALRTF
FT                   NVAPLGIETLAKPFLELGYVACGDYLFKSKKLIAKHFEHPDPTQPKVFISALKVDECSA
FT                   ELQAIVEKLVAQVDASRLEDSAFLHGGRLWDLSFVDYQTLAKESEYASWLAAHGYGANH
FT                   FTVSVNQLKALDSVKGVNDHLRNAGFVINEVGGEVKGSPEVLLEQSSTMADKVAVHFSE
FT                   GSEIVPGGFYEFAKRYPMDNGELYPGFVEASADKIFESTNG"
FT                   /protein_id="YP_004187486.1"
FT   gene            complement(292671..293303)
FT                   /db_xref="GeneID:10164989"
FT                   /locus_tag="VVM_00509"
FT   CDS_pept        complement(292671..293303)
FT                   /locus_tag="VVM_00509"
FT                   /gene_family="HOG000250565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cyclic AMP receptor protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155108"
FT                   /db_xref="GeneID:10164989"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHAGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERTAWVRAKSPCEVAEISFKKFR
FT                   QLIQVNPDILMRLSAQMASRLQVTSQKVGDLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEEQNLISAHGKTIVVYGTR"
FT                   /protein_id="YP_004187487.1"
FT   gene            complement(293546..294415)
FT                   /db_xref="GeneID:10164990"
FT                   /locus_tag="VVM_00510"
FT   CDS_pept        complement(293546..294415)
FT                   /product="phosphoribulokinase-like protein"
FT                   /gene_family="HOG000272991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00510"
FT                   /EC_number="2.7.1.19"
FT                   /db_xref="GI:320155109"
FT                   /db_xref="GeneID:10164990"
FT                   /translation="MSAKHPIIAVTGSSGAGTTTTSEAFRKMFNMMNIKPAWVEGDSFH
FT                   RFTRPEMDVEIRKAKEQGRHISYFGPQANDFPALGEFFRQYGKSGTGEVRRYLHTFDEA
FT                   VPYNQMPGTFTPWQKLPENTDVLFYEGLHGGVVDGEVNVAQHVDFLIGMVPIVNLEWIQ
FT                   KYVRDTRDRGHSREAVMDSIVRSMDDYLNYITPQFSRTHINFQRVPTVDTSNPLNAKGI
FT                   PSLDESFVVIRLRGIKNVDFPYLLAMIDGSFMSRHNTLVVPGGKMSFAMELIVQPILQQ
FT                   LIETGKIG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187488.1"
FT   gene            complement(294544..294756)
FT                   /db_xref="GeneID:10164991"
FT                   /locus_tag="VVM_00511"
FT   CDS_pept        complement(294544..294756)
FT                   /locus_tag="VVM_00511"
FT                   /gene_family="HOG000006551" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155110"
FT                   /db_xref="GeneID:10164991"
FT                   /translation="MIVPWQQISPEALSNLIREFVLREGTDYGESEYSLEEKIAQVQQQ
FT                   LECGEAVVVFSELHETVDIQLKQKF"
FT                   /protein_id="YP_004187489.1"
FT   gene            complement(294812..295789)
FT                   /db_xref="GeneID:10164992"
FT                   /locus_tag="VVM_00512"
FT   CDS_pept        complement(294812..295789)
FT                   /locus_tag="VVM_00512"
FT                   /gene_family="HOG000264008" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrolase alpha/beta fold family functionally
FT                   coupled to Phosphoribulokinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155111"
FT                   /db_xref="GeneID:10164992"
FT                   /translation="MTQFTAAAGIKNPHLQTLLPRLIRKKALFEPLWQTLDTPDGDFLD
FT                   LAWSESPHNDQAKNKPLFVLFHGLEGCFYSPYANGLMKAFADAGWLAVMMHFRGCSGKP
FT                   NRLARAYHSGEVEDARLFLTHLHDAFPHTVKVAVGISLGGNMLANYLAKYQGDERLDAA
FT                   TIVSAPLDLSACSQRIEQGFSRVYRRYLLSSLKRNALRKHHLLAGELDLSYQAIKRVTR
FT                   LYDFDDLITAPLHGFQDAADYYQQCSGLNKLRDIRIPTQIIHAKDDPFMTDAVIPKFVL
FT                   PDNIDYRLFDHGGHVGFLSGTALQPRFWLEEALPAYYESMAVSG"
FT                   /protein_id="YP_004187490.1"
FT   gene            complement(295935..296414)
FT                   /db_xref="GeneID:10164993"
FT                   /locus_tag="VVM_00513"
FT   CDS_pept        complement(295935..296414)
FT                   /locus_tag="VVM_00513"
FT                   /gene_family="HOG000218402" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155112"
FT                   /db_xref="GeneID:10164993"
FT                   /translation="MSSEHVQPSLTLERLWQFSLQYYSIREVKEACLALQNNFNGNVNL
FT                   LLLFKWLDEQQLTFQEQEWHQVQACLGRSETLLHTYRDLRRQFKQHLPDTLYREALQFE
FT                   LQLEKQQQSDLVDCINTLTLSPNQQQPLTQRYCQHLGAAHLYNAFAVASPSQKLG"
FT                   /protein_id="YP_004187491.1"
FT   gene            complement(296411..298333)
FT                   /db_xref="GeneID:10164994"
FT                   /locus_tag="VVM_00514"
FT   CDS_pept        complement(296411..298333)
FT                   /locus_tag="VVM_00514"
FT                   /gene_family="HOG000271640" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155113"
FT                   /db_xref="GeneID:10164994"
FT                   /translation="MITFSDIQLLRGGSPLLDQASATIHPGDKIGLVGKNGCGKSTLFA
FT                   LIKDELSIDAGSFSSPQHWELAWVAQETPALERSAIEYVIDGDREYRQLERQLAEAEAQ
FT                   EQGTRIAELHGKIETIGGYSIRARASELLDGLGFSQEQMHWNLTQFSGGWRMRLNLAQA
FT                   LLCRSDLLLLDEPTNHLDLDAVMWLERWLQSYPGTLILISHDRDFLDPIVNRIVHIENQ
FT                   KLNEYTGNYSSFENQRAQKLILQQSMFEKQQKQMAHMQSYIDRFRYKASKARQAQSRIK
FT                   ALEKLEKVLPAQFDNPFSFEFREPAALPNPIMMMDDVSAGYGDNLILDKIRLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLSGELKAQGGDLTYSQGVKIGYFAQHQLETLHPEETPLQHMM
FT                   QIAPDKTEQELRNYLGSFGFHGDKALEKVAPFSGGEKARLVLALIVWQKPNLLLLDEPT
FT                   NHLDLDMRQALTLALQTFEGAMVIVSHDRYLIRATTDDLYLVHDRQVAPFDGDLNDYYK
FT                   WLTEQQKAERREAAAEMPAKDSSNSAAAKKEQKRREADFRKLTAPIRKKLTQLEAKMDK
FT                   LGEALAEAEQQLSDNSLYDAENKAKLTQVLALQAQSKSALEEIEMEWMAEQEVLEQMEQ
FT                   EFNSQ"
FT                   /protein_id="YP_004187492.1"
FT   gene            298536..299114
FT                   /db_xref="GeneID:10164995"
FT                   /locus_tag="VVM_00516"
FT   CDS_pept        298536..299114
FT                   /locus_tag="VVM_00516"
FT                   /gene_family="HOG000149972" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein KefG"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155114"
FT                   /db_xref="GeneID:10164995"
FT                   /translation="MMINSAITKKQPKVLVIYAHPESHTSVANQVMIKKISSLSHVTIR
FT                   DLYAIYPDFFIDVKAEHKLLLEHDVIVLHHPMFMYSCPALLKEWIDRVLGKGFAFGQGQ
FT                   ALAGKYWRSVITTGGKKEAFSAKGYNKYPLEEILQPFELTAALCQMHWIEPLVLYWARN
FT                   VSDVERYQHAEQYRQWLNDPLGGFDGSHQ"
FT                   /protein_id="YP_004187493.1"
FT   gene            299098..300900
FT                   /db_xref="GeneID:10164996"
FT                   /locus_tag="VVM_00517"
FT   CDS_pept        299098..300900
FT                   /locus_tag="VVM_00517"
FT                   /gene_family="HOG000179076" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Glutathione-regulated potassium-efflux
FT                   system protein KefB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155115"
FT                   /db_xref="GeneID:10164996"
FT                   /translation="MALTSDFLQTSVVFLSAAVVAVPLAQRSGLGSVLGYLLAGVAIGP
FT                   WGLGLISDVDAILHFAELGVVLLLFLIGLELNPKKLWQMRGPILGLGGAQVVITTLLIA
FT                   CIIQWFGVSWNTALVIGMGLALSSTAIALKVLEEQGLARTETGQSGFAVLLFQDIAVIP
FT                   MLALLPLLAGSGMSGDWLSSLLTFSAVVGLLVGGHFLLRPLFRYVVLTGVRELFTVTAL
FT                   LVVLGIAMLMQQLGLSMALGTFLAGVLLAESEYRHELEIAIEPFKGLLLGLFFIAVGMA
FT                   VNLGLLVVHPIEVISAVLGLVALKGAVLYLLGRVSRMRAKARSRMAAILSQGGEFAFVI
FT                   FTAASKEGLLNPSEVSFLLVVVSLSMVTTPLLLNIQKWWYARTLNQESDVLAPDVVDTE
FT                   PRVIIAGFGRFGQIVGRLLYANKIKVTVLESDASQIQLLRKYGYKVFYGDATQLDLLRA
FT                   AGAAKAEALVICTDSPDQVMSIVELCQQHFPNLKVLARARSRVEAYQLLSHGVSTYSRE
FT                   TFLGALDLGRQTLVEIGMHPYQAKRAEAHFRKLDNAMLKELLPQHNQDKKLAQRAKEAR
FT                   KELEEIFAHEMENDHQSRNFWDER"
FT                   /protein_id="YP_004187494.1"
FT   gene            300903..301109
FT                   /db_xref="GeneID:10164997"
FT                   /locus_tag="VVM_00520"
FT   CDS_pept        300903..301109
FT                   /locus_tag="VVM_00520"
FT                   /gene_family="HOG000273035" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative cytoplasmic protein ,probably associated
FT                   with Glutathione-regulated potassium-efflux"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155116"
FT                   /db_xref="GeneID:10164997"
FT                   /translation="MLVKSKKRFIAGASCPSCQQQDTLLWWSENNIELVECVECDFKEQ
FT                   RKPKSVDKNKHADQEMIGIFKPE"
FT                   /protein_id="YP_004187495.1"
FT   gene            301205..301804
FT                   /db_xref="GeneID:10164998"
FT                   /locus_tag="VVM_00521"
FT   CDS_pept        301205..301804
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   /gene_family="HOG000154889" [ FAMILY / ALN / TREE ]
FT                   SlyD"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00521"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="GI:320155117"
FT                   /db_xref="GeneID:10164998"
FT                   /translation="MKIEKNVVVSLAYQVKLEDGIVVDSSTTDAPLDYLHGHNNLITGL
FT                   ENELEGKVAGDKFTVTVAPEDAYGEHNDALVQRVPAEVFQGVDQIEVGMRFLADTDQGP
FT                   IPVEVTEVDGDEVVVDGNHMLAGQTLTFDVEVVAVREATAEEIEHGHIHQGGGCCGGHD
FT                   HDHDHDHEGGCCGGEGHGHSHGEKDGCCGGGSCGSH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187496.1"
FT   gene            301916..302872
FT                   /db_xref="GeneID:10164999"
FT                   /locus_tag="VVM_00524"
FT   CDS_pept        301916..302872
FT                   /product="isoaspartyl aminopeptidase"
FT                   /gene_family="HOG000174613" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00524"
FT                   /EC_number="3.4.19.5"
FT                   /db_xref="GI:320155118"
FT                   /db_xref="GeneID:10164999"
FT                   /translation="MSRAMMNKPFSIAIHGGAGTILRSQMSDELKEAILSDLQHAVRAG
FT                   YQLLEQGADALDAVVAAVKVLEDSPNFNAGKGSVLTHNEMVEMDASVMHGRELKAGAVA
FT                   GVRHIKNPIELARDVMQNSAHVLLIGEGAEKFAFEQGHQYTEQDYFFTDRRYEQLLSMR
FT                   EKGLFALSEAKYPDDKKHGTVGAVALDQQGNLAAATSTGGVTNKKYGRVGDSALIGCGT
FT                   VAENGVVAVSTTGVGEFFIRKRVAEDVAARMRYLNEDVHTACEQIIHGELKSMGGEGGL
FT                   IAVDAQGEIHFAMNSSGMYRAAINVQGELCVKIYADE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187497.1"
FT   gene            302845..302964
FT                   /db_xref="GeneID:10165000"
FT                   /locus_tag="VVM_00526"
FT   CDS_pept        302845..302964
FT                   /locus_tag="VVM_00526"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155119"
FT                   /db_xref="GeneID:10165000"
FT                   /translation="MRENLRGRINNAASRHPTTRNKTPSPADLLGLVEFELNF"
FT                   /protein_id="YP_004187498.1"
FT   gene            complement(302967..303194)
FT                   /db_xref="GeneID:10165001"
FT                   /locus_tag="VVM_00527"
FT   CDS_pept        complement(302967..303194)
FT                   /locus_tag="VVM_00527"
FT                   /gene_family="HOG000273046" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein SlyX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155120"
FT                   /db_xref="GeneID:10165001"
FT                   /translation="MTEKTIALLENRINDLECQVAFQEQTIEELNDALTQQQLLIAKMQ
FT                   DQMKYVVGKMKNMDSSNMVDPAKEPPPPHY"
FT                   /protein_id="YP_004187499.1"
FT   gene            complement(303197..304177)
FT                   /db_xref="GeneID:10165002"
FT                   /locus_tag="VVM_00529"
FT   CDS_pept        complement(303197..304177)
FT                   /locus_tag="VVM_00529"
FT                   /gene_family="HOG000273047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="WD40 repeat-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155121"
FT                   /db_xref="GeneID:10165002"
FT                   /translation="MQRILHSLLLLIVIPLLNGCFFSTQDEQRWEIEPQGSTSFALSRD
FT                   GRFALLYSTQRHLVLWDLVESKELAQLGEQDPEANVVSNIRISDNGRFAVTATQMNFAV
FT                   WDLGLSQSEGLWSISDGLIRDVDISSNGEQVLLGLSNGKAIYVNLVTGRRMEFLAHREK
FT                   VNSVAISANGRFALTGGNDYKAYLWDTETGLVMRTFEHEERVNRVALQRDGQLAFTSDG
FT                   GNQAIVWDLKTGQQISQLKSWSRQLIFSTARFSDDGRLLVTGTPSGRVAVWNTTSGKQI
FT                   ESYEVEPLKDARPPRAVVYDAAFDAQRRVITATSAGIAQAWPLEN"
FT                   /protein_id="YP_004187500.1"
FT   gene            304306..305088
FT                   /db_xref="GeneID:10165003"
FT                   /locus_tag="VVM_00530"
FT   CDS_pept        304306..305088
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   /gene_family="HOG000154888" [ FAMILY / ALN / TREE ]
FT                   FkpA"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00530"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="GI:320155122"
FT                   /db_xref="GeneID:10165003"
FT                   /translation="MKSVLKVSLLAATVMLAVGCQKEEAKPAAAPQAEQVQAETGKAVH
FT                   FKSEDDKAAYAIGVSFANYLSASLDKPSEIGINLNKDLVLKGIEHVFAGNPELNEEETR
FT                   AALEALDKRVAETMQKKAAEKAEAAKKAGDEFRAEFEKQEGVVKTDTGLLYQVITPAEG
FT                   EKPKDTDTVQVHYKGTLTDGTQFDSSYDRGEPATFPLNRVIPGWTEGVQLMPVGSKFKF
FT                   VIPPELAYGAQDTPSIPANSTLVFEVELLKIENGDNAQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187501.1"
FT   gene            305297..305962
FT                   /db_xref="GeneID:10165004"
FT                   /locus_tag="VVM_00532"
FT   CDS_pept        305297..305962
FT                   /locus_tag="VVM_00532"
FT                   /gene_family="HOG000192034" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="yheO-like PAS domain"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155123"
FT                   /db_xref="GeneID:10165004"
FT                   /translation="MKPFTEHDKIILRSYEAVVDGIASLIGPFCEIVLHSLEDLNTSAI
FT                   KIANGENTGRQVGSPITDLALKMLRDIEGSERNFSRSYFTRAKGGVLMKSITVAIRNGD
FT                   NRVIGLLCINVNLDAPFSQVLQSFMPTEEAKQAASSVNFASDVEELVDQTVERTIEEIN
FT                   ADKSVSNNTKNRQIVMELFDKGIFDIKDAINRVADRLNISKHTVYLYIRQRKTEEDEK"
FT                   /protein_id="YP_004187502.1"
FT   gene            305959..306354
FT                   /db_xref="GeneID:10165005"
FT                   /locus_tag="VVM_00533"
FT   CDS_pept        305959..306354
FT                   /locus_tag="VVM_00533"
FT                   /gene_family="HOG000229180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA 5-methylaminomethyl-2-thiouridine synthase
FT                   TusD"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155124"
FT                   /db_xref="GeneID:10165005"
FT                   /translation="MSTLRYTLVVNGSVYGSQSARTAYQFASALIEKGHTLVSVFFYQD
FT                   GVTNGTELTVPANDEFHLTKAWQQLAKQHNVRLETCVAAALRRGVVSQSEASQHGLLQH
FT                   NLAEGFEQAGLGSLAEAMLTQDRVVQF"
FT                   /protein_id="YP_004187503.1"
FT   gene            306351..306707
FT                   /db_xref="GeneID:10165006"
FT                   /locus_tag="VVM_00535"
FT   CDS_pept        306351..306707
FT                   /locus_tag="VVM_00535"
FT                   /gene_family="HOG000284344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA 5-methylaminomethyl-2-thiouridine synthase
FT                   TusC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155125"
FT                   /db_xref="GeneID:10165006"
FT                   /translation="MSQLTYLFRTAPHSHSSGREGVDALLAASAYCEALSVVFIGDGVY
FT                   QLLAGQQTASILCKDYAPMFKLFDLYDIEHVYVCQQSLQQRGLTSEDLLIEVEVVDTVR
FT                   LQGVLHNSAQLLSF"
FT                   /protein_id="YP_004187504.1"
FT   gene            306716..306991
FT                   /db_xref="GeneID:10165007"
FT                   /locus_tag="VVM_00536"
FT   CDS_pept        306716..306991
FT                   /locus_tag="VVM_00536"
FT                   /gene_family="HOG000284333" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA 5-methylaminomethyl-2-thiouridine synthase
FT                   TusB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155126"
FT                   /db_xref="GeneID:10165007"
FT                   /translation="MLHLIKSSHALEEALLLCTASDAIVLLEEAVYAATSVHPLQSLLP
FT                   QQGVYVLHGDVLARGLESRLSTNVAIVDYHQLVDLTVEHSPSLTWS"
FT                   /protein_id="YP_004187505.1"
FT   gene            307163..307537
FT                   /db_xref="GeneID:10165008"
FT                   /locus_tag="VVM_00537"
FT   CDS_pept        307163..307537
FT                   /locus_tag="VVM_00537"
FT                   /gene_family="HOG000040063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="30S ribosomal protein S12p (S23e)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155127"
FT                   /db_xref="GeneID:10165008"
FT                   /translation="MATINQLVRKPRAKQVVKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVNNRKQGRSKYGVKRPKS"
FT                   /protein_id="YP_004187506.1"
FT   gene            307655..308125
FT                   /db_xref="GeneID:10165009"
FT                   /locus_tag="VVM_00538"
FT   CDS_pept        307655..308125
FT                   /locus_tag="VVM_00538"
FT                   /gene_family="HOG000039067" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="30S ribosomal protein S7p (S5e)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155128"
FT                   /db_xref="GeneID:10165009"
FT                   /translation="MPRRRVIGQRKILPDPKFKSELLAKFVNILMVDGKKSVAEKIVYT
FT                   ALDTMAEKSGKDHLAVFEEALENVRPAVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWL
FT                   VEAARKRGEKSMAARLAAEMLDASDNKGTAVKKREDVHRMAEANKAFAHYRW"
FT                   /protein_id="YP_004187507.1"
FT   gene            308201..310300
FT                   /db_xref="GeneID:10165010"
FT                   /locus_tag="VVM_00539"
FT   CDS_pept        308201..310300
FT                   /locus_tag="VVM_00539"
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor G"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155129"
FT                   /db_xref="GeneID:10165010"
FT                   /translation="MARKTPIERYRNIGICAHVDAGKTTTTERILFYTGLSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTTFWRGMEAQFQDHRVNIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGSSGVEPQSETVWRQADKYHVPRMVFVNKMDRAGADFLRVVDQIKNRLG
FT                   ANPVPIQLNVGAEEDFKGVIDLIKMKMINWNEADQGMTFTYEEIPADMIELAEEWRNNL
FT                   VEAAAEANEELMDKYLEEGELTEAEIKQALRARTLNNEIVLATCGSAFKNKGVQAVLDA
FT                   VIEYLPSPIDVPAIKGIDENDNEVERHADDNEPFSALAFKIATDPFVGTLTFIRVYSGV
FT                   VNTGDAVYNSVKQKKERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCNSD
FT                   HKVILERMEFPEPVIQIAVEPRSKADQEKMGIALGKLAAEDPSFRVETDAETGQTLISG
FT                   MGELHLDIIVDRMKREFSVDCNVGKPQVAYRETIRGKSEVEGKFVRQSGGRGQYGHVWI
FT                   KLEPSEPGAGFVFVDEVVGGVIPKEYISSVAKGIEEQMNSGVLAGYPVLDIKATLFDGS
FT                   YHDVDSSEMAFKIAGSMAFKKGALEAQPVILEPMMKVEVTTPEDWMGDVVGDLNRRRGI
FT                   IEGMDEGVAGLKIIRAQVPLSEMFGYATDLRSATQGRASYSMEFFEYAEVPKNIAEAIV
FT                   AERGY"
FT                   /protein_id="YP_004187508.1"
FT   gene            310451..311635
FT                   /db_xref="GeneID:10165011"
FT                   /locus_tag="VVM_00542"
FT   CDS_pept        310451..311635
FT                   /locus_tag="VVM_00542"
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor Tu"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155130"
FT                   /db_xref="GeneID:10165011"
FT                   /translation="MSKEKFERVKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGAAR
FT                   DFASIDNAPEERERGITISTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALGALNGEEQWEAKIIELAEALDTYIPEPERAIDLPFLMPIEDVFSIQ
FT                   GRGTVVTGRIERGILKVGDEVAIVGIKDTTTTTCTGVEMFRKLLDEGRAGENVGALLRG
FT                   TKRDEVERGQVLAKPGSITPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   DISLPEGVEMVMPGDNIQMVVELISPIAMDEGLRFAIREGGRTVGAGVVAKIFA"
FT                   /protein_id="YP_004187509.1"
FT   gene            311843..312031
FT                   /db_xref="GeneID:10165012"
FT                   /locus_tag="VVM_00544"
FT   CDS_pept        311843..312031
FT                   /locus_tag="VVM_00544"
FT                   /gene_family="HOG000262408" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155131"
FT                   /db_xref="GeneID:10165012"
FT                   /translation="MYVCLCHGVSDKKIRKLVIEQGVADIRGIKKCTALGSQCGKCIRM
FT                   AKEIINETAPALFKQAS"
FT                   /protein_id="YP_004187510.1"
FT   gene            312105..312581
FT                   /db_xref="GeneID:10165013"
FT                   /locus_tag="VVM_00545"
FT   CDS_pept        312105..312581
FT                   /locus_tag="VVM_00545"
FT                   /gene_family="HOG000262383" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterioferritin"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155132"
FT                   /db_xref="GeneID:10165013"
FT                   /translation="MKGDPIIIQHLNKVLGNELIAINQYFLHARMYKDWGLKHLADKEY
FT                   HESIDEMKHADHLVERILFLEGIPNLQDLGKLMIGEDTQEMLECDLKLEMAAIPDLKAA
FT                   IAYAEDVHDYVSRDLFQDILEDEEEHVDWLETQLGLIQLTGIENYLQAQFVDED"
FT                   /protein_id="YP_004187511.1"
FT   gene            complement(312678..313688)
FT                   /db_xref="GeneID:10165014"
FT                   /locus_tag="VVM_00548"
FT   CDS_pept        complement(312678..313688)
FT                   /product="UDP-glucose 4-epimerase"
FT                   /gene_family="HOG000168001" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00548"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="GI:320155133"
FT                   /db_xref="GeneID:10165014"
FT                   /translation="MNILVTGGSGYIGSHTCIQMIEAGMTPIILDNLYNSKLLVLDRIE
FT                   QVTGVRPTFYQGDIRDSEILQHIFAQHDIQGVIHFAGLKAVGESVEKPLMYYDNNVSGT
FT                   LNLVREMDKAGVKSLIFSSSATVYGDPASVPIREDFPTSATNPYGRSKLMVEECLTDFH
FT                   KANPDWSITLLRYFNPVGAHESGLLGEDPQGIPNNLLPFVAQVAVGRREKLGVFGDDYP
FT                   TPDGTGVRDYIHVIDLADGHLAALNKVGQQAGLHIFNLGTGQGNSVLEMVAAFEKAAQR
FT                   PIPYEIKPRRAGDIAECWADPAYAEQVLGWKATRSLETMVVDTWRWQSNNPNGYE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187512.1"
FT   gene            complement(313867..314637)
FT                   /db_xref="GeneID:10165015"
FT                   /locus_tag="VVM_00550"
FT   CDS_pept        complement(313867..314637)
FT                   /product="triosephosphate isomerase"
FT                   /gene_family="HOG000226413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00550"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="GI:320155134"
FT                   /db_xref="GeneID:10165015"
FT                   /translation="MRRPVVMGNWKLNGSKTMVAELLTGLNAELEGVEGVDVAVAPPAL
FT                   YIDLAERLIAEGGNKIILGAQNTDINNSGAFTGDMSPAMLKDFGATHIIIGHSERREYH
FT                   NESDKFVAKKFAFLKENGLKPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNG
FT                   AIIAYEPIWAIGTGKAATAEDAQRIHASIRAMIAAKDAAVAEQVIIQYGGSVKPENAEA
FT                   YFAQPDIDGALVGGASLDAKSFAAIAKAAAKMKA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187513.1"
FT   gene            314940..315287
FT                   /db_xref="GeneID:10165016"
FT                   /locus_tag="VVM_00551"
FT   CDS_pept        314940..315287
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   /gene_family="HOG000179526" [ FAMILY / ALN / TREE ]
FT                   delta-isomerase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00551"
FT                   /EC_number="5.3.3.10"
FT                   /db_xref="GI:320155135"
FT                   /db_xref="GeneID:10165016"
FT                   /translation="MPNLVLEYSNSVEERVNIPGLLEDLHHIAIKSGLFDAPSVKSRTL
FT                   RCHHWLIGEEGDSVDFIHVSFDLLSGRTEEQKRELSRQLMAALQETASHVRSLTVNIRD
FT                   MDKDSFQKVVN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187514.1"
FT   gene            315294..315767
FT                   /db_xref="GeneID:10165017"
FT                   /locus_tag="VVM_00552"
FT   CDS_pept        315294..315767
FT                   /locus_tag="VVM_00552"
FT                   /gene_family="HOG000253106" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155136"
FT                   /db_xref="GeneID:10165017"
FT                   /translation="MRYFLGNGGVSGLGLYLMSLKELLFSFQGRIGRKTYWLWNLCYYL
FT                   GILGFVTAVSKLFPAYSYILLPIFLLALLIPDLAVTTKRWHDRNKSAYWLVLNIPLILG
FT                   RLATPLSAPLAQEPSGMETLIGSIALLCGAWILLECGFLKGTKGSNRYGEPER"
FT                   /protein_id="YP_004187515.1"
FT   gene            complement(315835..316173)
FT                   /db_xref="GeneID:10165018"
FT                   /locus_tag="VVM_00553"
FT   CDS_pept        complement(315835..316173)
FT                   /locus_tag="VVM_00553"
FT                   /gene_family="HOG000218194" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155137"
FT                   /db_xref="GeneID:10165018"
FT                   /translation="MGSLQTEQQLPSFDEMMALAAENPDAFNQFKQDMCQEMIQSASEA
FT                   MRERLLAQQSHIDLVISRCKNPVHTNVVLMNELTKQMVKFREALDSDGSELQAPSAEVI
FT                   PFAPKGFY"
FT                   /protein_id="YP_004187516.1"
FT   gene            316554..317045
FT                   /db_xref="GeneID:10165019"
FT                   /locus_tag="VVM_00554"
FT   CDS_pept        316554..317045
FT                   /locus_tag="VVM_00554"
FT                   /gene_family="HOG000244966" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155138"
FT                   /db_xref="GeneID:10165019"
FT                   /translation="MHFHDVKVKIGRPTRHWSLTQKGHEQFADRHGELTIQVIDAVEAL
FT                   FGAEGLAKVAAEREQKTFLHYQKALATCLDLTSRLETLTLMREEEGYMAELEKTDEGYL
FT                   LTENHCPICKAAQRCPSLCQSELNVFQKLLGDECHIERSEHIIEGQRRCAYRIIIANGG
FT                   "
FT                   /protein_id="YP_004187517.1"
FT   gene            complement(317118..318125)
FT                   /db_xref="GeneID:10165020"
FT                   /locus_tag="VVM_00557"
FT   CDS_pept        complement(317118..318125)
FT                   /product="fructose-1,6-bisphosphatase GlpX type"
FT                   /gene_family="HOG000241252" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00557"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="GI:320155139"
FT                   /db_xref="GeneID:10165020"
FT                   /translation="MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRTLLN
FT                   KTDISGEIVIGEGEIDDAPMLYIGENVGLGGDEVDIAVDPIEGTRMTAMGQSNALAVLA
FT                   AGEKGSFLKAPDMYMEKLVVGPGAKGVIDLNKPLKENLENIAQALGKTLDTLVVITLAK
FT                   PRHDEVIAEMQRMGVRVFAVPDGDVAASILTCMPDSEVDVMYCIGGAPEGVVSAAVIRA
FT                   LDGDMHGRLLPRNEVKGDNEENRKFADFELERCAEMGVEANKVLKLEDMARSDNVIFSA
FT                   TGITKGDLLEGISRQGNIATTETLLIRGRCRTIRRIKSIHYLERKDDEVKAIIL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187518.1"
FT   gene            complement(318335..318577)
FT                   /db_xref="GeneID:10165021"
FT                   /locus_tag="VVM_00559"
FT   CDS_pept        complement(318335..318577)
FT                   /locus_tag="VVM_00559"
FT                   /gene_family="HOG000218436" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative cytoplasmic protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155140"
FT                   /db_xref="GeneID:10165021"
FT                   /translation="MSFEVLEKLEAKIQTAVDTIALLQMEVDELKEDKAKLETEANELR
FT                   AQREQLEQKAQQTQQEHAQWQERIRALLGKMEDVE"
FT                   /protein_id="YP_004187519.1"
FT   gene            complement(318799..319320)
FT                   /db_xref="GeneID:10165022"
FT                   /locus_tag="VVM_00561"
FT   CDS_pept        complement(318799..319320)
FT                   /locus_tag="VVM_00561"
FT                   /gene_family="HOG000252803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease E inhibitor RraA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155141"
FT                   /db_xref="GeneID:10165022"
FT                   /translation="MEYNTSALCDIYMDQVDVVEPMFSNFGGRASFAGQITTVKCFEDN
FT                   ALIRETLEQDGVGRVLLVDGGGSLRRALLDGELAAIAEENEWEGIVVYGCVREVDELED
FT                   MNIGIQALASIPVGAAMQGVGEVDVPVNFGGVTFLPEDYLYADTTGIILSQEPLSADLE
FT                   EDEEEPELLD"
FT                   /protein_id="YP_004187520.1"
FT   gene            complement(319396..320313)
FT                   /db_xref="GeneID:10165023"
FT                   /locus_tag="VVM_00563"
FT   CDS_pept        complement(319396..320313)
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /gene_family="HOG000028297" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00563"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="GI:320155142"
FT                   /db_xref="GeneID:10165023"
FT                   /translation="MNQSLRIWLDAARPKTLPLALVSILTGSVLAYSFGQFSPVIALLS
FT                   FVTATLLQILSNLANDYGDAVKGTDNDKRLGPMRAMQSGAVSAQAMKRAIVFNIILTMI
FT                   SGLCLVFYALSSLQSILAFIGLGVLAIFAAIAYTMGSKPYGYVGLGDLSVFIFFGLLGV
FT                   SGTYFLHTGHLDTALLLPSLGCGLLAVAVLNINNMRDIENDAACGKRTVAVRLGQQRAK
FT                   QYHFALLCGALMAFASYLLLQPSSIWLCLPFLFSLIVLFNHGKAVWQTEKPAQIAPMMP
FT                   VVVKCSLVTNILFATVVVAQTLVS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187521.1"
FT   gene            complement(320479..321810)
FT                   /db_xref="GeneID:10165024"
FT                   /locus_tag="VVM_00565"
FT   CDS_pept        complement(320479..321810)
FT                   /locus_tag="VVM_00565"
FT                   /gene_family="HOG000010036" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   HslU"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155143"
FT                   /db_xref="GeneID:10165024"
FT                   /translation="MSEMTPREIVHELNRHIIGQDNAKRSVAIALRNRWRRMQLEESLR
FT                   VEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIIRDLT
FT                   DVAVKLTHQQAMEKVKFRAEELAEERILDALLPPPRDAWGQNEQSEDTSNTRQIFRKKL
FT                   REGKLDDKEIEINVAAPQMGVEIMAPPGMEEMTNQLQGMFQSLAGNTSKKRKLKIKDAF
FT                   KALIEEEAAKLVNQDELKEQAIYSVENNGIVFIDEIDKICKRGESSGPDVSREGVQRDL
FT                   LPLIEGSTVSTKHGMVKTDHILFIASGAFQVAKPSDLIPELQGRLPIRVELEALSSHDF
FT                   KRILTEPRASLTEQYVALMKTEDVDIEFTEDGITQIAEAAWTVNETTENIGARRLHTVM
FT                   ERLMDEISFDATEKSGTKFVIDAAYVQQRLGEFVEDEDLSRFIL"
FT                   /protein_id="YP_004187522.1"
FT   gene            complement(321838..322311)
FT                   /db_xref="GeneID:10165025"
FT                   /locus_tag="VVM_00566"
FT   CDS_pept        complement(321838..322311)
FT                   /product="ATP-dependent protease HslV"
FT                   /gene_family="HOG000064533" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00566"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="GI:320155144"
FT                   /db_xref="GeneID:10165025"
FT                   /translation="MKGNARKVRRLYNNKVLAGFAGGTADAFTLFERFESKLQMHQGHL
FT                   TKAAVELAKDWRSDRALRKLEALLAVADETASLIITGNGDVVQPENDLIAIGSGGAYAQ
FT                   AAATALLENTELDAREIAEKALNIAGDICVFTNHNHTIEELEIPAELPNLSQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187523.1"
FT   gene            complement(322543..322983)
FT                   /db_xref="GeneID:10165026"
FT                   /locus_tag="VVM_00569"
FT   CDS_pept        complement(322543..322983)
FT                   /locus_tag="VVM_00569"
FT                   /gene_family="HOG000000723" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell division protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155145"
FT                   /db_xref="GeneID:10165026"
FT                   /translation="MLLGGFGYGLYTLSNDPEPPTPVAENKPVSKPKPPAKKELPPPPE
FT                   EKWQYVESLPNREIEVVAKEQEVPKIPYIMQCGAYKKREQAEHRKLDIAFQGITSTVKK
FT                   KEGSDWYRVVLGPYKLKRDAERDRHKLQRAKIEPCAIWQEEQ"
FT                   /protein_id="YP_004187524.1"
FT   gene            complement(323210..324217)
FT                   /db_xref="GeneID:10165027"
FT                   /locus_tag="VVM_00571"
FT   CDS_pept        complement(323210..324217)
FT                   /locus_tag="VVM_00571"
FT                   /gene_family="HOG000220180" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional (co)regulator CytR"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155146"
FT                   /db_xref="GeneID:10165027"
FT                   /translation="MATMKDVAQLAGVSTATVSRALMNPDKVSATTRKRVEDAVLEAGY
FT                   SPNSLARNLRRNESRTIVAIVPDICDPYYTEIIRGIEDAAIEQGYLVLLGDSGQQKRRE
FT                   SSLVNLVFTKQADGMLLLGTDLPFDVSKPEQKNLPPMVMACEFAPDLELPTVHIDNLTS
FT                   AFEAVNYLTQLGHKRIAQISGPKSAALCQFRQQGYQQALRRAGITMNPQYCVESEFSFE
FT                   GGAKAIRHLLEMNDAPTAVFCHCDTMAIGAIQEAKKLGFRVPQDLSIVGFDDIQFAQYC
FT                   DPPLTTISQPRYEIGRQAMLMMLELLKGHDIHSGSRLLETKLVVRGSAAPPGLR"
FT                   /protein_id="YP_004187525.1"
FT   gene            complement(324446..326650)
FT                   /db_xref="GeneID:10165028"
FT                   /locus_tag="VVM_00575"
FT   CDS_pept        complement(324446..326650)
FT                   /locus_tag="VVM_00575"
FT                   /gene_family="HOG000037413" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase PriA essential for oriC/DnaA-independent
FT                   DNA replication"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155147"
FT                   /db_xref="GeneID:10165028"
FT                   /translation="MRPSIARVALPVPLDKQFDYLVPGHLFPIIGGRVSVPFGRQTLIG
FT                   IVTALVQESDFPREQLKPIKAVLDHRPIWPDSVYSLLLWCSQFYQYPLGETLHNALPAA
FT                   LRKGKAADFATLQEWQLTELGKNQLMQGLNSRAIKQAKVLNMLANGPLPHQAFLDEEVA
FT                   STTLRTLEEKGWISCEEKTPQLARWGNPIEHPVDKPKLNQEQAIAIATVNSQTGFACYL
FT                   LEGVTGSGKTEVYLNLIKPILEQGKQALVLVPEIGLTPQTINRFRQRFDVPVAVIHSGL
FT                   NDTERLNAWLSARDKAAGIVIGTRSALLIPFAQLGIIIVDEEHDASYKQQDSLRYHARD
FT                   VAVMRAAKEGIPIVLGSATPALETLHNALTGKYHHLSLTQRAGVAVPTTNKVLDVKGLY
FT                   LESGLSAPLIAEMRRHLKAGNQVMLFLNRRGFSPALMCHECGWIAECKRCDAYYTYHQY
FT                   SNEIRCHHCGSQQPIIHQCQGCGSTQLVTVGVGTEQLENQLTALFPDYKAIRIDRDSTR
FT                   RKGSLESALEAIRKGEYQILIGTQMLAKGHHFPDVTLVALLDVDGSLYSSDFRASERLA
FT                   QLFIQVAGRAGRASKPGEVILQTHHPEHTLLKALLTKDYRHFAQSALEERKIAQLPPFS
FT                   FLTLFRAEANHSEIVETFLRQVRMTLESHPLFDHTCLVLGPTPAPLAKRAGKYRWQLLL
FT                   QTQHRSLMQKILSSTKPAIDLLPDAKKVRWNLDIEPQDLS"
FT                   /protein_id="YP_004187526.1"
FT   gene            326931..327152
FT                   /db_xref="GeneID:10165029"
FT                   /locus_tag="VVM_00576"
FT   CDS_pept        326931..327152
FT                   /locus_tag="VVM_00576"
FT                   /gene_family="HOG000284895" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L31p"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155148"
FT                   /db_xref="GeneID:10165029"
FT                   /translation="MKAGIHPEYKAVNATCSCGNSFVFNSTLDKDSIHLDVCDKCHPFY
FT                   TGKQRIVDTGGRVDRFNKRFGALSSGKK"
FT                   /protein_id="YP_004187527.1"
FT   gene            327431..328708
FT                   /db_xref="GeneID:10165030"
FT                   /locus_tag="VVM_00577"
FT   CDS_pept        327431..328708
FT                   /product="NADP-dependent malic enzyme"
FT                   /gene_family="HOG000132447" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00577"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="GI:320155149"
FT                   /db_xref="GeneID:10165030"
FT                   /translation="MSDDNSQQMTPEEVLRQQALDYHALPTAGKIAVALTKPAETAKDL
FT                   ALAYSPGVAEPVREIAQNPDNVYKYTSKGNMVAVISNGTAILGLGNLGPLASKPVMEGK
FT                   ALLFKRFAGLDSIDIEVKHRTIDEFVDTVANIADTFGGINLEDIKAPDCFEIEKRLIER
FT                   CDVPVFHDDQHGTAIVTAAGMLNAIELQGKKLNECIIVCLGAGAAAVACMELLIKCGAM
FT                   REKIYMLDRKGVIHTRRDDLNEYKQLFANNTDKRTLEDVISGADLFLGVSGPNLMPAEA
FT                   LKLMADKPVVFACSNPDPEIKPELAHEVRSDLIMGTGRSDYPNQVNNVLCFPFIFRGAL
FT                   DVRASEINDEMKLAAVEAIRQLAKEPVPEAVLKAAGVESLSFGPQYIIPKPMDSRLLPR
FT                   VAKAVAQAAVDTGVARIPMPENYMAE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187528.1"
FT   gene            complement(328795..329112)
FT                   /db_xref="GeneID:10165031"
FT                   /locus_tag="VVM_00579"
FT   CDS_pept        complement(328795..329112)
FT                   /locus_tag="VVM_00579"
FT                   /gene_family="HOG000271582" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methionine repressor MetJ"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155150"
FT                   /db_xref="GeneID:10165031"
FT                   /translation="MADWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTRRQ
FT                   INNLRHATNSELLCEAFLHAYTGQPLPTDEDLRKDRPDDIPTEAKELMTAMGIEFEAYD
FT                   D"
FT                   /protein_id="YP_004187529.1"
FT   gene            329324..330490
FT                   /db_xref="GeneID:10165032"
FT                   /locus_tag="VVM_00580"
FT   CDS_pept        329324..330490
FT                   /product="cystathionine gamma-synthase"
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00580"
FT                   /EC_number="2.5.1.48"
FT                   /db_xref="GI:320155151"
FT                   /db_xref="GeneID:10165032"
FT                   /translation="MSHRKPATIAVRTGIESDTQYRAVVPPIYLSTNYGFSAFGEVPKY
FT                   DYTRSGNPNRGLLEQALFELESGKGAVVTNCGTSALNLWVSAFLSPDDLIVAPHDCYGG
FT                   TYRLFNTRAKKGDFKVRFVDQSDSAALDAALALNPKLVLLETPSNPLVRVVDIAEVCEK
FT                   AHKVGALVAVDNTFLTPVYQKPLELGADFVIHSTTKYINGHSDVIGGVVITKTEEHATE
FT                   LAWWGNCLGATGTPFDSYMTLRGIRTLGARMRVHEESSQQILSYLQTQELVGTIYHPSL
FT                   PAHPGHEIAKKQQSGFGSMLSFEFAGSFEQLKVFVKALDLFSLAESLGGVESLVCHPAS
FT                   MTHRAMGEEALAEAGVTQQLLRLSVGLEDAQDLIADLKQAFQQAKESC"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187530.1"
FT   gene            330490..332901
FT                   /db_xref="GeneID:10165033"
FT                   /locus_tag="VVM_00582"
FT   CDS_pept        330490..332901
FT                   /product="aspartokinase/homoserine dehydrogenase"
FT                   /gene_family="HOG000271594" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00582"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="GI:320155152"
FT                   /db_xref="GeneID:10165033"
FT                   /translation="MSQVRQLHKFGGSSLADPDCYRRVVNILKEYSGDNDLVVVSAAGK
FT                   TTNRLIEFSEALEKDGRLAHEALQALRQYQTGLVEALIASNQRSELLDQLADEFSTLAE
FT                   LSAPLTTAQKAAILGHGEVWSSRLLAALLNQHDLAAVAQDARAFLRAETGTQPEVDRAR
FT                   SYPLIKEVLAQHSHRRVVITGFMAQNQAGETVLLGRNGSDYSATVIGALAEVAKVTIWS
FT                   DVAGVYSADPRLVSDACLLPLLRLDEASELARLAAPVLHSRTLQPVAQSATELNLRCSY
FT                   TPESGSTRIERVLASGRGAKIITSLDDVMLVQLNFSAGHDFDRQQQEVLSALKRAQLEP
FT                   LAFEAQKDQFTLRLAYTTEIAGGALAHLQELGLAAEIKLKEGFSLVAAVGAGVTNNASH
FT                   CFGFYQQLKHSPVEFISEAESGLSLVAVMRRVDIPVLVKAIHTQLFQAQKRVALALCGK
FT                   GNIGSSWLSLFAQQKSELEKRHGMNFELVAVVDSQTYLFNEQGLDAAAVHAHFDDDSVP
FT                   NDGANWLQRLSSIQDYDEVVVLDVTASRELAAQYLDIAHQGMHLISANKIAGSASSDYY
FT                   YQVQDAFSKIGRHWLYNATVGAGLPINHTVRDLRESGDEIVALSGIFSGTLSWLFQQFD
FT                   GSVPFAELVDLAWQQGLTEPDPRSDLDGSDVMRKLVILARESGLDIEPENVKVESLVPE
FT                   ELKELSLDDFFDQAHLLSERLQERLTKAQRQDQVLRYVARLEKNGKARVSVEALQREHA
FT                   LANLLPCDNIFAIESKWYRDNPLVIRGPGAGREVTAGAIQSDLNRLAGLF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187531.1"
FT   gene            333102..333995
FT                   /db_xref="GeneID:10165034"
FT                   /locus_tag="VVM_00585"
FT   CDS_pept        333102..333995
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /gene_family="HOG000246232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00585"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="GI:320155153"
FT                   /db_xref="GeneID:10165034"
FT                   /translation="MGYTHASHIDALNQNIAELSDNINVSFEFFPPSTPQMEETLWNSV
FT                   HRLKTLQPKFVSVTYGANSGERDRTHSIIKEIKAQTGLVAAPHLTCIDASREELINIAN
FT                   DYWANGIKNIVALRGDIPPGGGAPDMYASDLVTLLKSLHDFDISVAAFPEVHPEAKSAQ
FT                   ADLLNLKRKVDAGANRAITQFFFDVESYLRFRDRCVAAGIDVEIVPGILPVSNFKQASR
FT                   FAAQNNVKVPGWMAKQFEGLDDDPVTRQLVGASQAIDMVRILSREGVKDFHFYTLNRAE
FT                   MTYALCHTLGVRPKKA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187532.1"
FT   gene            complement(334102..334641)
FT                   /db_xref="GeneID:10165035"
FT                   /locus_tag="VVM_00587"
FT   CDS_pept        complement(334102..334641)
FT                   /locus_tag="VVM_00587"
FT                   /gene_family="HOG000011570" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator PadR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155154"
FT                   /db_xref="GeneID:10165035"
FT                   /translation="MSLPHVILTVLSTRDATGYDITKEFSASIGYFWKASHQQVYRELN
FT                   KMAEKELVTCVLEPQEGKPDRKVYSITDAGRSALGEWFDQPTAHPTVRDEFSAKLMACS
FT                   VQPSAPYRAQLAELVEESRKLVSHYKEIEAAYYATPSTLDKQGRLERLTLRRNLMMREA
FT                   WVRWAEEVLAELDILG"
FT                   /protein_id="YP_004187533.1"
FT   gene            335119..335250
FT                   /db_xref="GeneID:10165036"
FT                   /locus_tag="VVM_00589"
FT   CDS_pept        335119..335250
FT                   /locus_tag="VVM_00589"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155155"
FT                   /db_xref="GeneID:10165036"
FT                   /translation="MREVGRECQLQEEKWHEAIEEWEWYWMGSETKRAGVSRQLFYV"
FT                   /protein_id="YP_004187534.1"
FT   gene            complement(335257..337890)
FT                   /db_xref="GeneID:10165037"
FT                   /locus_tag="VVM_00597"
FT   CDS_pept        complement(335257..337890)
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /gene_family="HOG000238648" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00597"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="GI:320155156"
FT                   /db_xref="GeneID:10165037"
FT                   /translation="MNEKYAALKSNVSMLGHLLGNTIQEAHGDEILEKVETIRKLSKSA
FT                   RAGNQADRNNLIEEIKSLPDEQLTPVARAFNQFLNLTNIAEQYHTISRHCDAHVCEPDA
FT                   INTLFAKLGQNGINKLDTAQAIRELNIELVLTAHPTEITRRTMINKLVKINECLSKLEL
FT                   SDLSYKERHKTEKRLEQLIAQSWHSDVIRKQRPTPLDEAKWGFAVVENSLWEAVPDFLR
FT                   ELDEKLKDYLDQGLPIDARPVHFSSWMGGDRDGNPFVTHTVTREVLLLSRWKAADLYLK
FT                   DINELISELSMTKCNDTVRQLAGEDEHEPYRAILKQLRTLLSDTKEILDAKINGQKLAV
FT                   KAPLQSVEQLWDPLFACYQSLRECGMSMIAEGSLLDTLRRVKAFGVHLVRLDIRQESTR
FT                   HADVLSELTRYLGIGDYNHWSEQDKIAFLTNELSSKRPLLPRDWQPSEPVKEVLDTCKI
FT                   IAAQSREAFGAYVISMAKTASDVLAVHLLLQESGCPYRMDVCPLFETLDDLNNAEAVIK
FT                   QLMGIDLYRGFIQNHQMVMIGYSDSAKDAGVMAAGWAQYHAMEALVNVAEQEGIELTLF
FT                   HGRGGTIGRGGAPAHAALLSQPPKSLKGGLRVTEQGEMIRFKLGLPDVAVNSFNMYASA
FT                   ILEANLLPPPEPKQEWRDLMEVLSQVSCEAYRSVVRGEPDFVPYFRQATPELELGKLPL
FT                   GSRPAKRNPNGGVESLRAIPWIFSWSQNRLLLPAWLGAGEAIQYSIDKGHQALLEEMCR
FT                   EWPFFSTRLGMLEMVYLKCNSEISRYYDERLADKSLLPLGDRLRDQLQSDIKAVLNVEN
FT                   NENLMQSDPWGQESIRLRNIYIEPLNMLQAELLYRTRQAGVVSEALEEALMVTIAGIAA
FT                   GMRNTG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187535.1"
FT   gene            complement(338110..339246)
FT                   /db_xref="GeneID:10165038"
FT                   /locus_tag="VVM_00599"
FT   CDS_pept        complement(338110..339246)
FT                   /product="acetylornithine deacetylase"
FT                   /gene_family="HOG000243769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00599"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="GI:320155157"
FT                   /db_xref="GeneID:10165038"
FT                   /translation="MQLPSFLDVYRGLISTSSISSSDPSWDQGNQAVIEKLSDWFAALG
FT                   FDVDVTEVEPGKYNLLAQKGQGEGGLLLAGHSDTVPFDQGRWSFDPHQLTEKDNKFYGL
FT                   GTADMKGFFAFIYEAAKRMDWKGQNKPLYVLATCDEETTMLGARHFSAHTPFKPDYCII
FT                   GEPTNLVPVRGHKGHVANVVRVTGKSGHSSDPSLGVNAIEIMHEVLFALMQLRDTLIKQ
FT                   YHNPGFAIPSPTLNLGHIHGGDSANRICGCCELHYDVRPLPGISLDGLDNLLRGALKEV
FT                   EAKWPGRIEIVPLHEPIPGYECQHDHPFIHGIEDLCGTPSQTVNYCTEAPFLQQLCPTL
FT                   VLGPGSIDQAHQPDEFLAFDFIDPTIDVLSKAMRKYCF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187536.1"
FT   gene            339395..340399
FT                   /db_xref="GeneID:10165039"
FT                   /locus_tag="VVM_00600"
FT   CDS_pept        339395..340399
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /gene_family="HOG000254902" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00600"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="GI:320155158"
FT                   /db_xref="GeneID:10165039"
FT                   /translation="MLKTTIIGASGYTGAELALMVEKHPELTLAGLYVSANSTDAGKCI
FT                   SQLHGKLAGVIEMPVLPLTDPLGVAQDSDVIFLATAHEVSHDLAPLFLQQGCQVFDLSG
FT                   AFRVKGDDFYTQFYGFAHQHSEWLDKAAYGLAEWNEEAIKASQLVAVAGCYTTAAQLAI
FT                   KPLLVSQLVDTNQWPVINATSGVSGAGRKASMTNSFCEVSLQPYGIFNHRHQPEIVHHL
FT                   GCDVIFTPHLGNFKRGILATITMKLQDGVTKEQVAHAFAQAYDRKPAVRLKGDVIPRIQ
FT                   DVEFTPFCDLGWKVQGQHIIVISAIDNLLKGASSQAMQCLNIHYGFSPLTALL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187537.1"
FT   gene            340422..341213
FT                   /db_xref="GeneID:10165040"
FT                   /locus_tag="VVM_00601"
FT   CDS_pept        340422..341213
FT                   /product="acetylglutamate kinase"
FT                   /gene_family="HOG000233260" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00601"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="GI:320155159"
FT                   /db_xref="GeneID:10165040"
FT                   /translation="MTQPSLNPLVIKLGGAALSCSQTLSQLFGAIASYQQKEQRQIVIV
FT                   HGGGYLVDELMEKLQLPTVKKNGLRVTPYDQIPLIAGALAGTANKLLQGQAMADGLNAI
FT                   GLSLADGGLCQVEELDPELGAVGKATPGDSSLLQTILNAGALPIISSIGLTAQGQLMNV
FT                   NADQAAVAVAGALDAQLVLLSDVSGVLDGKGHLIKSLNQQEADALIVGKVITDGMIVKV
FT                   QAALEAANDLGRAIEVATWRYPENLEKLFAGESIGTQFLPA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187538.1"
FT   gene            341383..342639
FT                   /db_xref="GeneID:10165041"
FT                   /locus_tag="VVM_00603"
FT   CDS_pept        341383..342639
FT                   /product="argininosuccinate synthase"
FT                   /gene_family="HOG000230093" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00603"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="GI:320155160"
FT                   /db_xref="GeneID:10165041"
FT                   /translation="MALTAECRPDKWRMEMSKLNVNKVVVAYSGGLDTSVIIPWLKENY
FT                   DCEVVAFVADVGQGEEELVGIEEKAKASGASECYVVDLKEELVADYIYPTLKTGAYYEG
FT                   KYLLGTSMARPVIAKAQVEIARKVGADALCHGCTGKGNDQVRFEGAFAALAPDLKVIAP
FT                   WREWDLVSREQCLDYLAERNIPCAASLTKIYSRDANAWHISTEGGVLESTWNAPNEDCW
FT                   VWTVDPEQAPNEAEYVTLKVEKGEVVAVDGEQMTPYNALVYLNEKGAKHGVGRIDIVEN
FT                   RLVGMKSRGCYETPGGTIMMEALRAVEQLVLDKTSFEFREELGLKASHLVYDGRWFTPL
FT                   RKSIMAAADELAQDVNGEVVVKLYKGMATVTQKRSENSLYSEAFATFGEDEVYDQSHAG
FT                   GFIRLYSLSSRIRALNSQK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187539.1"
FT   gene            342879..344753
FT                   /db_xref="GeneID:10165042"
FT                   /locus_tag="VVM_00605"
FT   CDS_pept        342879..344753
FT                   /product="argininosuccinate lyase/N-acetylglutamate
FT                   /gene_family="HOG000242744" [ FAMILY / ALN / TREE ]
FT                   synthase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00605"
FT                   /EC_number="4.3.2.1"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="GI:320155161"
FT                   /db_xref="GeneID:10165042"
FT                   /translation="MALWGGRFTQAADTRFKDFNDSLRFDYRLAEQDIVGSIAWSKALL
FT                   SVNVLSKEEQQKLEFALNELKLEVMEDPHQILHSDAEDIHSWVEQQLIGKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCRQQGHQLLLGLDKLQTQMVNVAKQHQATVLPGYTHLQRAQPV
FT                   TFAHWCLAYVEMFERDYSRLSDALTRLDTCPLGSGALAGTAYPIDREQLAQDLGFRRAT
FT                   RNSLDSVSDRDHVMELMSVASISMLHLSRLAEDMIFYNSGESGFIELADTVTSGSSLMP
FT                   QKKNPDALELIRGKTGRVYGSLAGMMMTVKALPLAYNKDMQEDKEGLFDALDTWNDCME
FT                   MAALCFDGIKVNGERTLEAAKQGYANSTELADYLVAKGIPFREAHHIVGVAVVGAIAQG
FT                   CALEELSLEQLQSFSPVIEADVYQILTIESCLEKRSALGGVSPKQVAYAVEQADKRLAA
FT                   RDTTLVKVRPARITDIETLESMVAYWANLGENLPRTRSEIIRDIGLFAVSEHQGLVTGC
FT                   ASLYIYDSGLAEIRSLGIEAGWQRQGQGTAVVQYLIDKAKDMAIKKLFVLTRAPEFFLK
FT                   QNFVQTSKSLLPEKVLKDCDQCPRQHACDEVALEFNLSEQIISQVKVA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187540.1"
FT   gene            complement(344916..345029)
FT                   /db_xref="GeneID:10165043"
FT                   /locus_tag="VVM_00610"
FT   CDS_pept        complement(344916..345029)
FT                   /locus_tag="VVM_00610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155162"
FT                   /db_xref="GeneID:10165043"
FT                   /translation="MAGFAFNLLLFLHLWMKYVILPWQARKLSEKQRDKQK"
FT                   /protein_id="YP_004187541.1"
FT   gene            345462..346361
FT                   /db_xref="GeneID:10165044"
FT                   /locus_tag="VVM_00611"
FT   CDS_pept        345462..346361
FT                   /locus_tag="VVM_00611"
FT                   /gene_family="HOG000233514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrogen peroxide-inducible genes activator"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155163"
FT                   /db_xref="GeneID:10165044"
FT                   /translation="MNIRDFEYLVALAEHKHFRKAAEACFVSQPTLSGQIRKLEEEIGT
FT                   TLLERSSRRVLFTDAGLQLVEQAKNILKEVKTFKEMASGQSGAMTGPMHIGFIPTLGPY
FT                   LLPKIVPQLKERFPELELFLHEAQTQQLVRQLEDGKLDCLVLASVAETEPFKEIEVYNE
FT                   PLSVAVPCHHEWAALEQLDMLELNGKTVLALGDGHCLRDQALGFCFAAGARDDERFKAT
FT                   SLETLRNMVAAGAGITLLPELSVPKEKQKDGVCYIKAVNPVPSRTIVVVYRPGSPLRAR
FT                   FEQLAATIKELLVSGSEQ"
FT                   /protein_id="YP_004187542.1"
FT   gene            complement(346432..348945)
FT                   /db_xref="GeneID:10165045"
FT                   /locus_tag="VVM_00616"
FT   CDS_pept        complement(346432..348945)
FT                   /product="multimodular transpeptidase-transglycosylase"
FT                   /gene_family="HOG000041138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00616"
FT                   /EC_number="2.4.1.129"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="GI:320155164"
FT                   /db_xref="GeneID:10165045"
FT                   /translation="MKFIKRLLIFALICIILGVTTIFGFYQYVKPELPDVATLKNVELQ
FT                   TPMQVFSQDGKLIAQFGEKRRIPVTYDQIPQSLIHALIATEDSRFYDHYGIDPIGITRA
FT                   ALVVAMSGSAKQGASTITQQLARNFFLSNEKKLMRKVKEIFIAIHIEQLLSKQEIMELY
FT                   VNKIFLGYRSYGFGAAARVYFGKDLQDLSLSEIATLAGMPKAPSTLNPIYSLERATNRR
FT                   NVVLMRMLDEKYITQEEYDAARAETLISQFHGAEIEVSAPYVAELARAWMVQEYGEEKA
FT                   YTSGMNVYMTIDSKLQAAANKAAIDNLLAYDERHGYRGEESVLWKAGEAAWDEAKMDEH
FT                   LSNQPTYGELIPAIVTKVEGKNATIWVKREQSQTIAWSGMNWARKFITDERQGSAPNSA
FT                   KEILAPGEQIWVRKVVTTDDKGESQESWHLSQVPNANTAFIAMNPDNGAVLSLVGGFNF
FT                   VHNKFNRATMSVRQVGSSIKPFIYSAAIDNGMTLATLINDAPINKWDESQGTAWRPKNS
FT                   PPTYIGPTRLRIGLATSKNVMAVRTLREVGLDETREYLTRFGFELDQLPRSETIALGAG
FT                   SLTPMKMAQGFSVFANGGYYVEPYYISHIEDPYGNVVFESQPQTICQQDCPVATQTIVE
FT                   NENGESTESTQPFAKQVISEQNAFIMREMMYSNIWGGGNWREGTGWNGTGWRAQTLGRR
FT                   DIGGKTGTTNDSKDAWYNGYGPGVVAISWVGFDDHSRTLGKTTTNANLDGKQTSGAESG
FT                   AKTALPAWIDFMKLALEGVPEHEKVLPANIVRVRIDRETGLLTNKTDDSAMFEYFIKGT
FT                   EPTEYVSSVEEESIYSSSSDEEALF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187543.1"
FT   gene            349085..350092
FT                   /db_xref="GeneID:10165046"
FT                   /locus_tag="VVM_00617"
FT   CDS_pept        349085..350092
FT                   /locus_tag="VVM_00617"
FT                   /gene_family="HOG000218191" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilus biogenesis protein PilM"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155165"
FT                   /db_xref="GeneID:10165046"
FT                   /translation="MGKPFVTGIDIGHRSLKAVILKPYGEHYALLGYKEIIIKDGIFSD
FT                   NHTLNHQEIVNSLKELKKELPLFRYQVALAVPDSSVISKMLSIDAELDGREREFAILQA
FT                   FAHQSPFPVDELSIDYVQLVEETSKTNHSYQVYATKKEVVESRVRVAEEVGLKPVLVDV
FT                   HAHSLCNILTLAAERHPDKASYCLLDVGYDTTSLVMSRRNEPPLVKEFAYGVSHLNASI
FT                   GDDLTSPDAHEKTDIFNKELTERVRRQLQLFQSMDSQSKVNGLWICGEGAITPLLSETL
FT                   QRKLSLECEVLNPLALFEQKTAKRKRRIVDWHHFSVAAGLAIGGIQWLEDSHAA"
FT                   /protein_id="YP_004187544.1"
FT   gene            350082..350672
FT                   /db_xref="GeneID:10165047"
FT                   /locus_tag="VVM_00618"
FT   CDS_pept        350082..350672
FT                   /locus_tag="VVM_00618"
FT                   /gene_family="HOG000218190" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilus biogenesis protein PilN"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155166"
FT                   /db_xref="GeneID:10165047"
FT                   /translation="MQHKINLLPWREHKREEHKRRFVSLVALGALIAVGIQWGIGQYFS
FT                   YQQRLQQERLDYLTHYIAQLDQRIQAMNIAKEEHSQILARLKVVESLQAERNKTTAFMN
FT                   LMTELIPEGVYVDKIKMNTNDVELAGISDSTARLATMLDNLERSTFLKEVEMHSIVHDK
FT                   KRFGKSFQTFTVSFVFDEHADSANTLAKEGNHG"
FT                   /protein_id="YP_004187545.1"
FT   gene            350665..351255
FT                   /db_xref="GeneID:10165048"
FT                   /locus_tag="VVM_00620"
FT   CDS_pept        350665..351255
FT                   /locus_tag="VVM_00620"
FT                   /gene_family="HOG000218189" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilus biogenesis protein PilO"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155167"
FT                   /db_xref="GeneID:10165048"
FT                   /translation="MASWQDLDIDEITDWPILPQAAVVVLLMLIIQGFGYWFYLKPETE
FT                   VLQRMVTEEQTLKISARIKATKVAALPQLQSQLDELTQRYEFLLKQLPVQKELATMLAS
FT                   VNELGIQSKLTFTRIDWGEKQTKDFLYQLPLNIELTGDYHDIGEFSEAIARLPRIISFT
FT                   DVTWHRVSMESSTLHFRVKANTYQFKSEAVHEK"
FT                   /protein_id="YP_004187546.1"
FT   gene            351245..351757
FT                   /db_xref="GeneID:10165049"
FT                   /locus_tag="VVM_00622"
FT   CDS_pept        351245..351757
FT                   /locus_tag="VVM_00622"
FT                   /gene_family="HOG000281372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155168"
FT                   /db_xref="GeneID:10165049"
FT                   /translation="MRSSLSLVAVLVLLSGCRANTEPMEGFIRQVESEARQEMAKLQPE
FT                   REYIPIDYLARENRRPFELPKEAVIASQPVVKKDCWQPPSRAKNGKLERYPLSQLRLKG
FT                   VMGSGNTIAGLVQTPQGKVEKVHPGQFIGQNNGKVTVVTPSYILINETLPDGLGCWQQR
FT                   KVRLALR"
FT                   /protein_id="YP_004187547.1"
FT   gene            351771..353555
FT                   /db_xref="GeneID:10165050"
FT                   /locus_tag="VVM_00624"
FT   CDS_pept        351771..353555
FT                   /locus_tag="VVM_00624"
FT                   /gene_family="HOG000255072" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilus biogenesis protein PilQ"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155169"
FT                   /db_xref="GeneID:10165050"
FT                   /translation="MICELMMKNKIQLFPGMISQFVCLLSVCIFTTFANAQSEAENALK
FT                   SIDFRTNAAKDAIIIVELTTPATVVDLKPVAEGLSIELINTSVKDEQLYLLDVKDFSTV
FT                   VESIEVFREVSKTRLVANVSGEFRHDYRLSGRYLEVTISRIKSEQEAREQSVLEKEGKL
FT                   ISINFQDIPVRNVLQLIADYNGFNLVVSDSVTGNVTLRLDGVPWQQVLDIILQVKGLDK
FT                   RVEGNVVLIAPQDELDLREKQQLEKERLAEELGSLKSEIIKVNFAKASDIAEMINGKES
FT                   VSMLSERGSVAIDERTNSLLLRELPENIEVIREIINSLDIPVKQVQIEARIVTVNEGNL
FT                   DELGVRWGFTSINGSTTVGGSIENNLATIGLYNAGSGSGSGDSGSGGSGSEGGSASIDD
FT                   FLNVNLAATSANASSIAFQVAKLGSDLLLDLELSALQRESKAEIISSPRLITTNKKPAY
FT                   IEQGTEIPYLESSSSGATTVSFKKAVLSLKVTPQITPDNRLVLDLSVTQDRPGEIVKTG
FT                   TGEAVAIDTQRIGTQVLVNNGETVVLGGIFQHSITNTTDKVPLLGDLPLLGALFRRSYE
FT                   NVGKRELLIFVTPKVILQ"
FT                   /protein_id="YP_004187548.1"
FT   gene            353757..354275
FT                   /db_xref="GeneID:10165051"
FT                   /locus_tag="VVM_00626"
FT   CDS_pept        353757..354275
FT                   /product="shikimate kinase I"
FT                   /gene_family="HOG000032568" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00626"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="GI:320155170"
FT                   /db_xref="GeneID:10165051"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRYLAQQLHMEFLDSDTVIEERTGA
FT                   DISWVFDVEGEEGFRKREEAVINDLTLEQGIVLATGGGSVKSRENRNRLSARGIVVYLE
FT                   TTIEKQLARTNRDKKRPLLQTDNPREVLESLAGERNPLYEEIADYTVRTDDQSAKVVAN
FT                   QIVKMLEES"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187549.1"
FT   gene            354308..355399
FT                   /db_xref="GeneID:10165052"
FT                   /locus_tag="VVM_00628"
FT   CDS_pept        354308..355399
FT                   /product="3-dehydroquinate synthase"
FT                   /gene_family="HOG000007970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00628"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="GI:320155171"
FT                   /db_xref="GeneID:10165052"
FT                   /translation="MERITVNLAERSYPITIGAGLFEDSAHLSSLTAGQKVVVITNVTV
FT                   APLYADKILSLLQSLGCQASLLELPDGEQYKSLDTFNQVMSFLLEGSFARDVVVIALGG
FT                   GVIGDLVGFSAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKSV
FT                   IIDTNCLKTLPEREFAAGIAEVIKYGIIYDAEFFTWLDEHLDALYSLDEQALTYAIARC
FT                   CEIKAEVVAQDEKESGIRALLNLGHTFGHAIEAELGYGNWLHGEAVAAGTVMAARTAQL
FT                   QGMIDQQQFDKIFSILSRAKLPVHTPESMTFDDFMTHMMRDKKVLSGKLRLVLPSSIGT
FT                   AEVVADVPQEVIRQAIEDCRTIN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187550.1"
FT   gene            355450..356946
FT                   /db_xref="GeneID:10165053"
FT                   /locus_tag="VVM_00630"
FT   CDS_pept        355450..356946
FT                   /locus_tag="VVM_00630"
FT                   /gene_family="HOG000218403" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="inner membrane protein DamX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155172"
FT                   /db_xref="GeneID:10165053"
FT                   /translation="MSRALPNVLELDSQTELLERLELLTNFGSNLITINGAKGFGKSWL
FT                   AQRYLEQYAQEKNQCLVLCHPSQDESQHRTLILSQLVSEPLFNPHDALIESAERLFADQ
FT                   ACDFAIVIDDAHLLSEALVSELWMWVLEAQANPQWTVNVLMFSESGQLESLLTRLGYGQ
FT                   EHKPVDLDIERLSETEAMRFFENLVVRYIDEANEKKVRAAFKKVDPIPGAIMALGDLKV
FT                   EKRIIIRSIVASPVNIVLTVLILLLLAAAGYWWMFSQPTADEKAQEISRTLEQTVIPTL
FT                   EPTAETKVIDAEQKTELARQQAEALSLQGAQDDTDALPPAVKEMTTSVGISDQDQQRVV
FT                   IESDVVDALLENKPQQADTSKMDALVAANTQTTPVIEADAPEKINQTLEQDQAPAVVRF
FT                   SFAREELKALSPRGYTLQLAAMTSLQDVQAFLDKHQLQNQVRIYPTLRNDTEWYIVTYR
FT                   DYPTIQMARDAVNELPKSLQSLGPWAKSLSQVHREIDRVK"
FT                   /protein_id="YP_004187551.1"
FT   gene            357026..357853
FT                   /db_xref="GeneID:10165054"
FT                   /locus_tag="VVM_00631"
FT   CDS_pept        357026..357853
FT                   /product="methyl-directed repair DNA adenine methylase"
FT                   /gene_family="HOG000281348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00631"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="GI:320155173"
FT                   /db_xref="GeneID:10165054"
FT                   /translation="MKKQRAFLKWAGGKYGLVEDIQKHLPPARKLVEPFVGAGSVFLNT
FT                   DYEHYLLADINPDLINLYNLLKEQPELYISEAKRWFTQENNRKDAYLSIRSEFNKTDDV
FT                   MFRSLAFLYMNRFGFNGLCRYNKKGGFNVPFGSYKKPYFPEAELEFFAEKAQKATFVCE
FT                   GYQETFRRARKGCVVYCDPPYAPLSNTANFTSYAGNGFTLDDQAALADIAEKTASERGI
FT                   PVLISNHDTKLTRRLYHGAELNVVKVKRTISRNGGGRNKVDELMALFHKPDIS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187552.1"
FT   gene            357975..358643
FT                   /db_xref="GeneID:10165055"
FT                   /locus_tag="VVM_00632"
FT   CDS_pept        357975..358643
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /gene_family="HOG000259347" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00632"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="GI:320155174"
FT                   /db_xref="GeneID:10165055"
FT                   /translation="MKDFLIAPSILSADFARLGEDVEKVLAAGADVVHFDVMDNHYVPN
FT                   LTFGAPVCKALRDYGITAPIDVHLMVKPVDRIIPDFAKAGASMITFHIEASEHVDRTLQ
FT                   LIKEHGCKAGVVLNPATPLAHLEFIMDKVDLILLMSVNPGFGGQSFIPHTLDKLRAVRK
FT                   MIDATGRDIRLEIDGGVKVDNIREIAEAGADMFVAGSAIFGQPDYKAVIDEMRAELAKA
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_004187553.1"
FT   gene            358941..359312
FT                   /db_xref="GeneID:10165056"
FT                   /locus_tag="VVM_00634"
FT   CDS_pept        358941..359312
FT                   /locus_tag="VVM_00634"
FT                   /gene_family="HOG000040438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="30S ribosomal protein S6p"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155175"
FT                   /db_xref="GeneID:10165056"
FT                   /translation="MRHYEIVFMVHPDQSEQVAGMIERYTGSITEAGGKIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEADQAVIDELETAFRYNDAVLRNMIMRTKAAITEPSIMLK
FT                   QKEERAPRREAEAKEFAAE"
FT                   /protein_id="YP_004187554.1"
FT   gene            359468..359623
FT                   /db_xref="GeneID:10165057"
FT                   /locus_tag="VVM_00635"
FT   CDS_pept        359468..359623
FT                   /locus_tag="VVM_00635"
FT                   /gene_family="HOG000261221" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="primosomal replication protein N"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155176"
FT                   /db_xref="GeneID:10165057"
FT                   /translation="MPVVVSGKGSQDITQQIVLGSNIKVSGFVAYQTGRNGVGKLVLHA
FT                   DDIIHI"
FT                   /protein_id="YP_004187555.1"
FT   gene            359640..359867
FT                   /db_xref="GeneID:10165058"
FT                   /locus_tag="VVM_00636"
FT   CDS_pept        359640..359867
FT                   /locus_tag="VVM_00636"
FT                   /gene_family="HOG000218466" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="30S ribosomal protein S18p"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155177"
FT                   /db_xref="GeneID:10165058"
FT                   /translation="MARFFRRRKFCRFTAEGVQEIDYKDVATLKNYITEAGKIVPSRIT
FT                   GTSAKYQRQLARAIKRSRYLALLPYTDKHQ"
FT                   /protein_id="YP_004187556.1"
FT   gene            359901..360350
FT                   /db_xref="GeneID:10165059"
FT                   /locus_tag="VVM_00638"
FT   CDS_pept        359901..360350
FT                   /locus_tag="VVM_00638"
FT                   /gene_family="HOG000040337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L9p"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155178"
FT                   /db_xref="GeneID:10165059"
FT                   /translation="MQVILLDKIGNLGSLGDTVNVKSGYARNFLIPQGKAVMATKGNVE
FT                   MFEARRAELEAKVAEQLASAEARAEKVNALEAVVIASKAGDEGKLFGSIGTRDIADAIT
FT                   AAGVEVVKSEVRLPEGALRTTGEFEISVQLHSEVFATVKLQVVAE"
FT                   /protein_id="YP_004187557.1"
FT   gene            complement(360435..361196)
FT                   /db_xref="GeneID:10165060"
FT                   /locus_tag="VVM_00640"
FT   CDS_pept        complement(360435..361196)
FT                   /locus_tag="VVM_00640"
FT                   /gene_family="HOG000218467" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155179"
FT                   /db_xref="GeneID:10165060"
FT                   /translation="MSNRWFLSLGLYAVSLTAYAEDNLDKDIALPSPWKSEVEFGYQAH
FT                   SGNSDSQALNARLSGEYTEGRHRSNGEWKFYNLYKDGEEDKRTSTYSLQSDYKLSPKTY
FT                   LYGSFKGIDSRYSAYFKDYTISAGLGYQFASTDTFVLEFEFGPGFRYQEPNLDEIDDDD
FT                   IIFPEIVEEGIFRGNLKTSWQALENLRLSADITVVSGHSNTRTDSDLSLTNNITEDIAL
FT                   KIAHSRQYHDRVPDGLSKADSVFSVNLLFAF"
FT                   /protein_id="YP_004187558.1"
FT   gene            361370..362764
FT                   /db_xref="GeneID:10165061"
FT                   /locus_tag="VVM_00641"
FT   CDS_pept        361370..362764
FT                   /product="replicative DNA helicase"
FT                   /gene_family="HOG000113196" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00641"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="GI:320155180"
FT                   /db_xref="GeneID:10165061"
FT                   /translation="MADNRKRKIPDSQVDAIKVPPHSLEAEQSVLGGLLLDNERWDTVA
FT                   ERVVSKDFYSRPHRLIFDAIKSILEENKPLDLITLSEHLERREQLEDVGGFAYLADLAK
FT                   NTPSAANINAYADIVAERALVRNLISVANEIADAGYDPQGRSSEDLLDLAESKVFAIAE
FT                   ERTSENEGPQNVDSILEKTLERIELLYKSPQDGVTGVDTGFTDLNKKTAGLQGSDLIIV
FT                   AARPSMGKTTFAMNLCENAAMDQDKPVLIFSLEMPAEQIMMRMLASLSRVDQTKIRTGQ
FT                   LDDEDWARISSTMGILMEKKNMYIDDSSGLTPTEVRSRARRVAREHGGLSMIMVDYLQL
FT                   MRVPALSDNRTLEIAEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPVNSDLRESG
FT                   SIEQDADLIMFIYRDEVYNPDSALKGTAEIIIGKQRNGPIGSVRLTFQGQWSRFDNYAG
FT                   PAFDDE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187559.1"
FT   gene            362769..363854
FT                   /db_xref="GeneID:10165062"
FT                   /locus_tag="VVM_00642"
FT   CDS_pept        362769..363854
FT                   /product="alanine racemase, biosynthetic"
FT                   /gene_family="HOG000031446" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00642"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="GI:320155181"
FT                   /db_xref="GeneID:10165062"
FT                   /translation="MNYMKAATACIDLVALQHNLQLIKQQAPHSKLMAVVKANGYGHGL
FT                   RHVAKHAVGADAFGVARIEEALQLRACGVVKPILLLEGFYSSGDLPVLVTNNIQTVVHC
FT                   EEQLRDLENAELETPVVVWLKIDSGMHRLGVRPEQYQAFVERLHQCPNVAKPLRYMSHF
FT                   GCADEMNNEMTPKQIELFLSLTRGCKGERSLAASAGLLAWQESQLEWVRPGIIMYGVSP
FT                   FGDKTASELGYKPVMTLKSHLIAVRDVKAGESVGYGATWISERDTKVGVIAIGYGDGYP
FT                   RTAPNGTPVLVNGRKVPIAGRVSMDMLTVDLGPDATDHVGDEAILWGADLPAEDVAQHI
FT                   GTIAYELVTKLTSRVEMSYSE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187560.1"
FT   gene            363862..365073
FT                   /db_xref="GeneID:10165063"
FT                   /locus_tag="VVM_00643"
FT   CDS_pept        363862..365073
FT                   /locus_tag="VVM_00643"
FT                   /gene_family="HOG000251554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155182"
FT                   /db_xref="GeneID:10165063"
FT                   /translation="MKSKPVFRFVVAATGLCALPTWADGWPSWSPETAVVPYYFVSDSM
FT                   GNTLGVAGLAKHVGQANASVLGTVLYSDKGSYVTYLSATNYQVGDFWLLGAESYQGKFV
FT                   DYDYYLGANASNDSTAADRTIATGKESITRFSFRYIVPWGHAAFRGARAALEPTRQIKG
FT                   FSPDRSGITTIEFQPFHTSREINAIAGQDSDSSGLSLKLDWDNRNDVRNPTQGFRTRLD
FT                   ITYADENWGNNSDWLKYEYSSSGFWNLGGVDDLLDQQVFAFNFYIADTPTWNNCNAQTC
FT                   QRPPEFDQVSLGGLYRLRSFSSGRFHGKSAINYSAEYRVLPKWQPLDDIPVLNIYDIPW
FT                   WQWVAFVDMGRVSDESSFSELHSDMQWSAGGAVRFQVEGIVVRAEMAWGSEESLFRVMV
FT                   NQPF"
FT                   /protein_id="YP_004187561.1"
FT   gene            complement(365127..365546)
FT                   /db_xref="GeneID:10165064"
FT                   /locus_tag="VVM_00644"
FT   CDS_pept        complement(365127..365546)
FT                   /locus_tag="VVM_00644"
FT                   /gene_family="HOG000123401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155183"
FT                   /db_xref="GeneID:10165064"
FT                   /translation="MWYQKCLTLPARKRGFHLITDEIEQQLPELSKLSVGLLHLFIQHT
FT                   SASLTLNENAEPTVRMDMEAHFNKFVPERAPYYQHTYEGDDDMPAHIKASLLGSSVTIP
FT                   IQNGRLALGTWQGIYLGEHRDHGGQRRIMATLYGE"
FT                   /protein_id="YP_004187562.1"
FT   gene            365867..367519
FT                   /db_xref="GeneID:10165065"
FT                   /locus_tag="VVM_00645"
FT   CDS_pept        365867..367519
FT                   /product="glucose-6-phosphate isomerase"
FT                   /gene_family="HOG000261370" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00645"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="GI:320155184"
FT                   /db_xref="GeneID:10165065"
FT                   /translation="MLKTINPTQTQAWNALTAHFESAQDMDLKDLFAQDAARFDKFSAR
FT                   FGSDILVDYSKNLINEETLKHLFALAKETELSAAIKAMFSGEAINQTEGRAVLHTALRN
FT                   RSNQAVLVDGEDVMPAVNAVLEKMKSFTDRVIGGEWKGYTGKAITDIVNIGIGGSDLGP
FT                   YMVTEALAPYKNHLNLHFVSNVDGTHIVETLKKVDPETTLFLIASKTFTTQETMTNAHT
FT                   ARDWFLATAGDQAHVAKHFAALSTNAPAVSEFGIDTDNMFEFWDWVGGRYSLWSAIGLS
FT                   IALAVGYDNFVELLEGAHEMDNHFVSTELESNIPVILALIGIWYNNFHGAESEAILPYD
FT                   QYMHRFAAYFQQGNMESNGKYVDRNGNPVTYQTGPIIWGEPGTNGQHAFYQLIHQGTKL
FT                   IPCDFIAPAVSHNPAGDHHQKLMSNFFAQTEALAFGKDEETVKAELVKAGKNAEEVAAI
FT                   APFKVFEGNRPTNSILVKQITPRTLGNLIAMYEHKIFVQGVIWNIFSFDQWGVELGKQL
FT                   ANQILPELADGSEISSHDSSTNGLINAFKAFKA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187563.1"
FT   gene            complement(367620..368081)
FT                   /db_xref="GeneID:10165066"
FT                   /locus_tag="VVM_00646"
FT   CDS_pept        complement(367620..368081)
FT                   /locus_tag="VVM_00646"
FT                   /gene_family="HOG000283169" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chemotaxis protein CheX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155185"
FT                   /db_xref="GeneID:10165066"
FT                   /translation="MRAEFVNPFLASLMNVLKTMASLELKPQKPRIKKDEIARGDVSGL
FT                   IGMVGAQTRGSMSITFDEGLALEIMQNMLGERPNGLNEEVTDMVGEITNMVTGGAKRIL
FT                   AESGFDFDMATPVVVSGKGHTIRHKCEGSIIIMPFSSQWGNAFIEICFE"
FT                   /protein_id="YP_004187564.1"
FT   gene            complement(368107..368346)
FT                   /db_xref="GeneID:10165067"
FT                   /locus_tag="VVM_00647"
FT   CDS_pept        complement(368107..368346)
FT                   /locus_tag="VVM_00647"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc uptake regulation protein Zur"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155186"
FT                   /db_xref="GeneID:10165067"
FT                   /translation="MEQGFIHRVESTNSFISCCSCNANQHFFQLLICDKCGDVVELQDD
FT                   TLISLLANNAEKYGFKLTNQVIETHGTCKTCLSE"
FT                   /protein_id="YP_004187565.1"
FT   gene            368850..369830
FT                   /db_xref="GeneID:10165068"
FT                   /locus_tag="VVM_00648"
FT   CDS_pept        368850..369830
FT                   /product="tRNA dihydrouridine synthase A"
FT                   /gene_family="HOG000259834" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00648"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="GI:320155187"
FT                   /db_xref="GeneID:10165068"
FT                   /translation="MTHSCRLSVAPMLDWTDRHCRYFHRLMTKETLLYTEMITTGAIIH
FT                   GKGDFLSYNQEEHPVALQLGGSNPQDLATCAKLAAERGYDEVNLNVGCPSDRVQNGRFG
FT                   ACLMAEPQLVADCVATMKEVVDIPVTVKTRIGIDDQDSYEFLTDFVSIVSEKGGCEQFT
FT                   IHARKAWLSGLSPKENREIPPLDYPRAYQLKKDFSHLTIAINGGVKSLEEAKEHLQHLD
FT                   GVMIGREAYQSPYLLASVDQELFGSQSPIKKRRQIVEEMYPYIEQQLANGAYLGHMTRH
FT                   MLGLFQNMPGARQWRRHISENAHKPGSGIEVLQQALAKIPQELDV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187566.1"
FT   gene            369989..370207
FT                   /db_xref="GeneID:10165069"
FT                   /locus_tag="VVM_00649"
FT   CDS_pept        369989..370207
FT                   /locus_tag="VVM_00649"
FT                   /gene_family="HOG000218415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155188"
FT                   /db_xref="GeneID:10165069"
FT                   /translation="MLELIFILVFAATLLVTGITMMTVFAATGIALVVMILLGMLGFVL
FT                   KLLPWLIVIAVAIWFFKHVVAQPRYKS"
FT                   /protein_id="YP_004187567.1"
FT   gene            370305..370967
FT                   /db_xref="GeneID:10165070"
FT                   /locus_tag="VVM_00650"
FT   CDS_pept        370305..370967
FT                   /locus_tag="VVM_00650"
FT                   /gene_family="HOG000283103" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fe3+-hydroxamate ABC transporter periplasmic
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155189"
FT                   /db_xref="GeneID:10165070"
FT                   /translation="MRNKIATICALLAPLGLFSATCQASVETTVGAEFWNVKTKVNEVD
FT                   RDRAATGSYYASIEHEVKYLPDMRVRYSSVDADYMAFDKLDLTLYFNLLEHDLMHFDAG
FT                   ITFSDLSNTKYLNVADLAAGESSFDEMIWAWYGYGEINVPKTNFDVIGEMNFGNNKGIK
FT                   STDLMAGMQYRLPFEGSEVALRAGYRVIDLEADAFASSLGKSFIFAHGWFLGAQYRF"
FT                   /protein_id="YP_004187568.1"
FT   gene            371116..371346
FT                   /db_xref="GeneID:10165071"
FT                   /locus_tag="VVM_00651"
FT   CDS_pept        371116..371346
FT                   /locus_tag="VVM_00651"
FT                   /gene_family="HOG000218416" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thymidylate kinase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155190"
FT                   /db_xref="GeneID:10165071"
FT                   /translation="MTITELRNLYREKQLVEAIIEPSIQEGAWVVEFRHARGGFVLLTD
FT                   SHGEECQYQDLDEASKSAMAVGFQQVRVETR"
FT                   /protein_id="YP_004187569.1"
FT   gene            371461..373311
FT                   /db_xref="GeneID:10165072"
FT                   /locus_tag="VVM_00652"
FT   CDS_pept        371461..373311
FT                   /product="sulfite reductase (NADPH) flavoprotein
FT                   /gene_family="HOG000282025" [ FAMILY / ALN / TREE ]
FT                   alpha-component"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00652"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="GI:320155191"
FT                   /db_xref="GeneID:10165072"
FT                   /translation="MSSQKKVSSGNTTPSGLAGLASPLNDQQINLLQQISDLSPQQLAW
FT                   VSGYFWGLSQSAAPSAVTPIAQAVSAVAAKPAGKLTIIFASQTGNAKGVAEALEQEAKA
FT                   EGIAVQLFDASDYKGKNLASETHVIIVASTNGEGEAPDNAIELHEFLQSKKAPKLPNLQ
FT                   YGVIGLGDSSYEFFCQTGKDFDAYLAKLGATPFIERVDCDVDYDASAAQWRKQALEKVK
FT                   DALSAGVEADVVQLPVAQLAAGHALYTKQNPYAATLLTSQKITGRDSGKDVRHVEIDLA
FT                   GSGITYQPGDALGVWFENSGELANQVLAKVGLSGVESIDVDGESLSIHSALVSKFEITS
FT                   SNPQQVEKFALLSGSKKLLKLVEEKDKLREYAGNTQLVDLLAEKQTKLTAEELVGLLRR
FT                   LTPRLYSIASSQTEVDEEVHLTVGLVEYEFKGEQRFGGASSYLAQRLEEGEQVNIFVEN
FT                   NNNFKLPADDNVPVIMVGPGTGIAPFRSFIQERDNRGAEGKNWLFFGDRTFTQDFLYQV
FT                   EWQKYLKSGLLTKLDVAFSRDQAEKVYVQQRILENAAQVWQWIQEGAYLYVCGDANRMA
FT                   KDVHQAFVAVAEQEGKMSRDDAEEFINDLRKAKRYQRDVY"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187570.1"
FT   gene            373311..375047
FT                   /db_xref="GeneID:10165073"
FT                   /locus_tag="VVM_00653"
FT   CDS_pept        373311..375047
FT                   /product="sulfite reductase (NADPH) hemoprotein
FT                   /gene_family="HOG000218418" [ FAMILY / ALN / TREE ]
FT                   beta-component"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00653"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="GI:320155192"
FT                   /db_xref="GeneID:10165073"
FT                   /translation="MTFSIENNKQIVLGEELGKLSDNERLKTQSNFLRGTIEQDLQDRI
FT                   TGGFTADNFQLIRFHGMYQQDDRDIRNERAKQKLEPLHNVMLRARMPGGIITPKQWLAI
FT                   DKFATEHSLYGSIRLTTRQTFQFHGVLKPNIKLMHQTLNSIGIDSIATAGDVNRNVLCT
FT                   TNPVESELHQEAYEWAKKISEHLLPKTKAYAEIWLDGEKVETTEDDEPILGKTYLPRKF
FT                   KTTVVIPPQNDVDVHANDLNFVAIAENGKLIGFNVLVGGGLAMTHGDTSTYPRRADDFG
FT                   YIPLEKTLDVAAAVVTTQRDWGNRSNRKNAKTKYTLDRVGTDVFKAEVEKRAGIKFETS
FT                   RPYEFTERGDRIGWVEGIDGKHHLTLFIENGRLLDYPGKPLKTGVAEIAKIHKGDFRMT
FT                   ANQNLIVAGVSKSNKAKIEKLAREHGLMDDGVSEQRKNSMACVAFPTCPLAMAEAERFL
FT                   PQFVTDVEGILEKHGLDKEDNIILRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNR
FT                   GGTRVPKMYKENITDTQILDEIDALVGRWAKERLDGECFGDFTIRAGIVEEVIISKRDF
FT                   YA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187571.1"
FT   gene            375040..375816
FT                   /db_xref="GeneID:10165074"
FT                   /locus_tag="VVM_00655"
FT   CDS_pept        375040..375816
FT                   /product="phosphoadenylyl-sulfate reductase (thioredoxin)"
FT                   /gene_family="HOG000249396" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00655"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="GI:320155193"
FT                   /db_xref="GeneID:10165074"
FT                   /translation="MLDSVASTLQLSELLTLTKAEQSLRLAEINVELEMLSAHDRVAWA
FT                   LQNLEGAHAVSSSFGIQAAVMLHLVSKQQADIPVILTDTGYLFPETYQFIDELTESLNL
FT                   NLKVYRANESANWQEARYGKLWEQGIEGIEKYNKLNKVEPMRRALNELNVKTWFSGLRR
FT                   EQSQSRAGLPILSIQNGVFKFLPVVDWSNKDVHYYLKEHGLSYHPLWEQGYLSVGDTHT
FT                   TQKWEPGMSEEETRFFGLKRECGLHEEDNEQDGSGI"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187572.1"
FT   gene            376343..377878
FT                   /db_xref="GeneID:10165075"
FT                   /locus_tag="VVM_r00010"
FT   rRNA            376343..377878
FT                   /db_xref="GeneID:10165075"
FT                   /locus_tag="VVM_r00010"
FT                   /product="16S ribosomal RNA"
FT   gene            377941..378017
FT                   /db_xref="GeneID:10165076"
FT                   /locus_tag="VVM_t00030"
FT   tRNA            377941..378017
FT                   /note="anticodon GAT"
FT                   /db_xref="GeneID:10165076"
FT                   /locus_tag="VVM_t00030"
FT                   /product="tRNA-Ile"
FT   gene            378028..378103
FT                   /db_xref="GeneID:10165077"
FT                   /locus_tag="VVM_t00031"
FT   tRNA            378028..378103
FT                   /note="anticodon TGC"
FT                   /db_xref="GeneID:10165077"
FT                   /locus_tag="VVM_t00031"
FT                   /product="tRNA-Ala"
FT   gene            complement(378131..378253)
FT                   /db_xref="GeneID:10165078"
FT                   /locus_tag="VVM_00658"
FT   CDS_pept        complement(378131..378253)
FT                   /locus_tag="VVM_00658"
FT                   /gene_family="HOG000167799" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155194"
FT                   /db_xref="GeneID:10165078"
FT                   /translation="MCLLVFVLKTNIENFTNNNKLLFCQLSKLLKSRFSNENHF"
FT                   /protein_id="YP_004187573.1"
FT   gene            378385..381270
FT                   /db_xref="GeneID:10165079"
FT                   /locus_tag="VVM_r00011"
FT   rRNA            378385..381270
FT                   /db_xref="GeneID:10165079"
FT                   /locus_tag="VVM_r00011"
FT                   /product="23S ribosomal RNA"
FT   gene            381392..381511
FT                   /db_xref="GeneID:10165080"
FT                   /locus_tag="VVM_r00012"
FT   rRNA            381392..381511
FT                   /db_xref="GeneID:10165080"
FT                   /locus_tag="VVM_r00012"
FT                   /product="5S ribosomal RNA"
FT   gene            381846..383383
FT                   /db_xref="GeneID:10165081"
FT                   /locus_tag="VVM_r00013"
FT   rRNA            381846..383383
FT                   /db_xref="GeneID:10165081"
FT                   /locus_tag="VVM_r00013"
FT                   /product="16S ribosomal RNA"
FT   gene            383446..383522
FT                   /db_xref="GeneID:10165082"
FT                   /locus_tag="VVM_t00032"
FT   tRNA            383446..383522
FT                   /note="anticodon GAT"
FT                   /db_xref="GeneID:10165082"
FT                   /locus_tag="VVM_t00032"
FT                   /product="tRNA-Ile"
FT   gene            383533..383607
FT                   /db_xref="GeneID:10165083"
FT                   /locus_tag="VVM_t00033"
FT   tRNA            383533..383607
FT                   /note="anticodon TGC"
FT                   /db_xref="GeneID:10165083"
FT                   /locus_tag="VVM_t00033"
FT                   /product="tRNA-Ala"
FT   gene            complement(383635..383757)
FT                   /db_xref="GeneID:10165084"
FT                   /locus_tag="VVM_00665"
FT   CDS_pept        complement(383635..383757)
FT                   /locus_tag="VVM_00665"
FT                   /gene_family="HOG000167799" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155195"
FT                   /db_xref="GeneID:10165084"
FT                   /translation="MCLLVFVLKTNIENFTNNNKLLFCQLSKLLKSRFSNENHF"
FT                   /protein_id="YP_004187574.1"
FT   gene            383889..386776
FT                   /db_xref="GeneID:10165085"
FT                   /locus_tag="VVM_r00014"
FT   rRNA            383889..386776
FT                   /db_xref="GeneID:10165085"
FT                   /locus_tag="VVM_r00014"
FT                   /product="23S ribosomal RNA"
FT   gene            386898..387017
FT                   /db_xref="GeneID:10165086"
FT                   /locus_tag="VVM_r00015"
FT   rRNA            386898..387017
FT                   /db_xref="GeneID:10165086"
FT                   /locus_tag="VVM_r00015"
FT                   /product="5S ribosomal RNA"
FT   gene            387046..387122
FT                   /db_xref="GeneID:10165087"
FT                   /locus_tag="VVM_t00034"
FT   tRNA            387046..387122
FT                   /note="anticodon GTC"
FT                   /db_xref="GeneID:10165087"
FT                   /locus_tag="VVM_t00034"
FT                   /product="tRNA-Asp"
FT   gene            387176..387252
FT                   /db_xref="GeneID:10165088"
FT                   /locus_tag="VVM_t00035"
FT   tRNA            387176..387252
FT                   /note="anticodon CCA"
FT                   /db_xref="GeneID:10165088"
FT                   /locus_tag="VVM_t00035"
FT                   /product="tRNA-Trp"
FT   gene            387477..388607
FT                   /db_xref="GeneID:10165089"
FT                   /locus_tag="VVM_00670"
FT   CDS_pept        387477..388607
FT                   /locus_tag="VVM_00670"
FT                   /gene_family="HOG000008864" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155196"
FT                   /db_xref="GeneID:10165089"
FT                   /translation="MKIEQIVWQEGHWQGLSSSSQLDSINTLIIVFGRASDTSLEQLSA
FT                   QMPYSQVIGCSTAGEIIDNTILEDAVVATIILFEKSTIHLASAHIEDGMRASFNIGVQL
FT                   GQELSSHKDNLKHVFVLSDGLLINGGHLVEGFHSVLPKNIKVTGGLAGDGEWFEQTTVI
FT                   SGNRSSSGLVVALGLYGEHLSVGYGSRGGWCPFGMERKVTRSTDNVLYELDDQDALSIY
FT                   KTYLGDLAQELPASGLRFPLEISVPGQELKLVRTLLAIDEAQGSITFAGNVPKGVTAKL
FT                   MRASSESLIEGARNAASLCHHDSSSPALAILISCVGRRLLLRQLAEDEVEAVSEELGEN
FT                   TRVCGFYSYGEIAPSSEEGSADLHNQTMTITVLSEI"
FT                   /protein_id="YP_004187575.1"
FT   gene            388609..390048
FT                   /db_xref="GeneID:10165090"
FT                   /locus_tag="VVM_00671"
FT   CDS_pept        388609..390048
FT                   /locus_tag="VVM_00671"
FT                   /gene_family="HOG000051333" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GGDEF domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155197"
FT                   /db_xref="GeneID:10165090"
FT                   /translation="MHRLLQRQLRKVFPQGLPDDPKIQLLVELVESGYQAFSEQLTILE
FT                   RSLDISSDELNQRNQTLNSILDSLPDMSLWMDKDGIIRDVRIGHFDPPLLSHDTDTDCI
FT                   FELPFIKASSEFQAFLENYQSRGGRSEDIAFQLDDHEYRVRANITAVGNHRWLLVLQDI
FT                   YLRKKLEEMQYQRLQQSKRAEKQLQQLVNSAPIGILICDPRLNILMTNDFICQLFGMSE
FT                   QDVLSHHPMDFISLRSRELFQRYIQKTINEQDSQEIARADLLLMLPEKKDIPIEMAFSR
FT                   LVFEGKPMIIMSITDISERKKLEAMLRNLAATDPLTGAFNRRSFMEQAEKSIRTCQRWN
FT                   CPLSIMILDIDHFKQFNDSYGHAAGDLVLVELVKMADLSTREIDIIGRLGGEEFAVVLP
FT                   GLGEKEAFEVAKRLRSVVENMQVHYEQQPLQMTISIGVATLQPSELNTPLEQLMKQADE
FT                   GLYYAKAHGRNCVISPLLMNG"
FT                   /protein_id="YP_004187576.1"
FT   gene            complement(390078..391370)
FT                   /db_xref="GeneID:10165091"
FT                   /locus_tag="VVM_00673"
FT   CDS_pept        complement(390078..391370)
FT                   /locus_tag="VVM_00673"
FT                   /gene_family="HOG000270677" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Na+/H+ antiporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155198"
FT                   /db_xref="GeneID:10165091"
FT                   /translation="MLIAFVNSKIGKMQTTIAITAGSMVLSLLILIAGQNNWFHLTEIA
FT                   TQTMSSIDFEDFLLKGILGFLLFAGGLGIKLPNLKDQKWEITVLALGATLFSTFFIGFA
FT                   LYGICQLIGIQFDLIYCLLFGALISPTDPIAVLAIVKKLKAPRRISTQIEGESLFNDGF
FT                   GLVIFVTLFTIAFGHETPTVGSVTMLFIQEAIGGILYGFALGLLFHYLICATDDHSMEL
FT                   LLTIGIPTAGYAFAEVLHVSGPLAMVVSGIMIGNWTRFIGFSKESEDHLDHFWELVDEF
FT                   LNGVLFLLIGMSMLLFKFHQEDWILMAIAIPLVLIARYLSVFLSYIGFKRFRQYNPWSI
FT                   KILTWGGLRGGLALAMALSIPSGIWVIPDKLIDVKEIILVMTYAVVVFSILVQGSTITP
FT                   MIEKAKQSEAEFEAKQSSVTAPEGKTESISS"
FT                   /protein_id="YP_004187577.1"
FT   gene            391596..395276
FT                   /db_xref="GeneID:10165092"
FT                   /locus_tag="VVM_00674"
FT   CDS_pept        391596..395276
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   /gene_family="HOG000251409" [ FAMILY / ALN / TREE ]
FT                   methyltransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00674"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="GI:320155199"
FT                   /db_xref="GeneID:10165092"
FT                   /translation="MGSNIRAQIEAQLKQRILLIDGGMGTMIQGYKLQEQDYRGERFAD
FT                   WHSDLKGNNDLLVLTQPQLIKEIHHAYLEAGADILETNTFNATTIAMADYDMESLSEEI
FT                   NFAAAKLAREAADEWTAKNPAKPRYVAGVLGPTNRTCSISPDVNDPGYRNVSFDELVAA
FT                   YSESTRALIRGGSDLILIETIFDTLNAKACAFAVESVFEELGFALPVMISGTITDASGR
FT                   TLSGQTTEAFYNSLRHVRPISFGLNCALGPDELRPYVEELSRISETFVSTHPNAGLPNA
FT                   FGEYDLSPEEMAEHVKEWAQSGFLNLIGGCCGTTPEHIRHMAMAVEGVSPRVLPEIPVA
FT                   CRLSGLEPLTIAKDTLFVNVGERTNVTGSARFKRLIKEELYDEALDVAREQVENGAQII
FT                   DINMDEGMLDAEACMVRFLNLCASEPEISKVPIMVDSSKWEVIEAGLKCIQGKGIVNSI
FT                   SLKEGKEKFVEQAKLIRRYGAAVIVMAFDEVGQADTRERKLEICTKAYRILVDEVGFPP
FT                   EDVIFDPNIFAVATGIDEHNNYAVDFIEAVADIKRDLPHAMISGGVSNVSFSFRGNNYV
FT                   REAIHAVFLYHCFKNGMDMGIVNAGQLEIYDNVPEKLREAVEDVVLNRRDDATERLLEI
FT                   AEEYRENAVGKQEDASALEWRTWSVEKRLEHALVKGITEFIVEDTEEARLNATKPLEVI
FT                   EGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAHLEPFINASKQAGSSNGKILLA
FT                   TVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPCEQILKVAKEQQVDIIGLSGLITPSL
FT                   DEMVHVAKEMERLGFDLPLLIGGATTSKAHTAVKIEQNYSHPVVYVNNASRAVGVCTSL
FT                   LSDELRPAFVERLQADYELVRDQHNRKKPRTKPVTLEAARANKVAIDWQSYTPPAPSQP
FT                   GVHVFDDFDVATLRQYIDWTPFFLTWSLVGKYPTIFEHEEVGEEAKRLFEDANEWLDRI
FT                   EQEGLLKARGMCGLFPAASVGDDIEVYTDESRTQVAKVLHNLRQQTEKPKGANYCLSDY
FT                   VAPKESGKKDWIGAFAVTGGVNERELADQFKAQGDDYNAIMIQAVADRLAEAFAEYLHE
FT                   RVRKEIWGYAADENLSNEELIREKYQGIRPAPGYPACPEHTEKGPLWELLNVEETIGMS
FT                   LTSSYAMWPGASVSGWYFSHPDSRYFAIAQIQQDQVESYAERKGWDLLEAEKWLGPNIN
FT                   G"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187578.1"
FT   gene            complement(395358..396707)
FT                   /db_xref="GeneID:10165093"
FT                   /locus_tag="VVM_00680"
FT   CDS_pept        complement(395358..396707)
FT                   /product="aspartokinase"
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00680"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="GI:320155200"
FT                   /db_xref="GeneID:10165093"
FT                   /translation="MSALNVAKFGGTSVANFEAMSRCSTIIENNPETRLVVSSACSGVT
FT                   NLLVELANGVQSQEIRAELLAQLAEIHDAILNQLEDATEAAAEVYAILDTITSLAEAAS
FT                   IQASNKLTDHLVACGELMSTHILAQLMRERGVNAVRFDIREVLRTDDNFGRAEPDVAKI
FT                   AELAQEKLLPLCRDYVVVTQGFIGSDEEGNTTTLGRGGSDYSAALIAEGVKASGLEIWT
FT                   DVPGIYTTDPRIAAKAAPIPEISFAEASEMANFGAKILHPSTLVPALRHDIPVFVGSSK
FT                   EPEKGGTWIRHEAQSSPLFRALALRCNQTMVTLRSAKMFHAYGFLAKVFEILAKHKISV
FT                   DLITTSEISVSLTLDKTDTSGGAPELPQAAREELEELCTVEVEYNLCLVALIGNHMETK
FT                   GYAKEVFSTLGDFNLRMICYGASDHNLCFLVDAHDSKSVIQKLHQDLFER"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187579.1"
FT   gene            397221..398342
FT                   /db_xref="GeneID:10165094"
FT                   /locus_tag="VVM_00681"
FT   CDS_pept        397221..398342
FT                   /product="serine--pyruvate
FT                   /gene_family="HOG000171815" [ FAMILY / ALN / TREE ]
FT                   aminotransferase/L-alanine:glyoxylate aminotransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00681"
FT                   /EC_number="2.6.1.51"
FT                   /EC_number="2.6.1.44"
FT                   /db_xref="GI:320155201"
FT                   /db_xref="GeneID:10165094"
FT                   /translation="MSIQSFIPPRRILMGPGPSDISPQVLQALSRPTVGHLDPLFIQMM
FT                   DELKQLLKYAFQTKNDFTIAVSAPGSAGMEACFVNLIEPGDKVIVCRNGVFGERMRENV
FT                   IRAGGEAILVDDEWGTPVSIEKVEQALTQHPDTKILAFVHAETSTGARSDAETLGKLAK
FT                   QYGVLTIVDTVTSLGGIPLKVDEWQLDAVYSGSQKCLSCVPGLAPVTFSSAAIEKIQSR
FT                   KTPVQSWFLDQSLVLGYWSGEGKRSYHHTAPVNSLYSLHEALLMLKNEGLENAWARHEK
FT                   MHNKLKVGLEKLGFQFVVDEEYRLPQLNAIYVPEGIDEAKVRSHLLETYNLEIGAGLGA
FT                   LAGKAWRIGLMGYGAREENVALCLRALEESLTQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187580.1"
FT   gene            complement(398407..400170)
FT                   /db_xref="GeneID:10165095"
FT                   /locus_tag="VVM_00684"
FT   CDS_pept        complement(398407..400170)
FT                   /locus_tag="VVM_00684"
FT                   /gene_family="HOG000280335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipid A core-O-antigen ligase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155202"
FT                   /db_xref="GeneID:10165095"
FT                   /translation="MATIHVSGTQLAEPKAQVPLNKKFLLALAILFLVAMHFFMPNPGG
FT                   AGLALSFNPTTWIAFSFVFALGCYQLASQQYLRYSKLTIGLFVSCLILTVPLFYANSHY
FT                   MQSVGRLVGLWAGFGFFVLLQQFSFSNKHKQRLLWLVVLAVVIESFIGYYQFLWLKPGN
FT                   WMGYDTLSNRPYGIFQQPNVMASFLATGLIISGYLLARQPHKYNKHLSEITLLYLIPLL
FT                   TVPLIVVLASRTGWLAAMIATLLLLPYLYRFGTKIRFWGWLGSIILGLSLSGALLQSTE
FT                   SNLAGQKINLESARAYTFPQALDMLIEKPFTGYGYGNFESAYTLYTARQHLLNNQYPPA
FT                   LPAMDHPHNELLYWGVEGGLVPLLGIFLAAILVLNRIYSAKKGTRLAMFALFVPIVLHS
FT                   QLEYPFYHSAAHWLIFIILIYWVDQRVAKVKSVNFSRISKTALRIASLVVPILTTFYMM
FT                   SALHTNYVLTKFETTRPVNPDLLQRVTNPVVWKDRFDWDVYSTYLNIGLATQDAKLIQP
FT                   YIDWSLDIIKTKPRPAFYSNLILAYQGLGDLSKAEQVKAEAEFLFPKNDFSNIHYQPPS
FT                   AALSHSVSSGQ"
FT                   /protein_id="YP_004187581.1"
FT   gene            complement(400237..403059)
FT                   /db_xref="GeneID:10165096"
FT                   /locus_tag="VVM_00688"
FT   CDS_pept        complement(400237..403059)
FT                   /locus_tag="VVM_00688"
FT                   /gene_family="HOG000050448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease ABC subunit A"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155203"
FT                   /db_xref="GeneID:10165096"
FT                   /translation="MDKIEVRGARTHNLKNINLTIPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEV
FT                   YDYLRLLYARVGEPRCPDHKVPLAAQTISQMVDKVLELPEGAKMMLLAPIVKERKGEHV
FT                   KTLENLAAQGFIRARIDGETCDLTDPPTLELHKKHTIEVVVDRFKVRGDLQQRLAESFE
FT                   TALELSGGIAVIAPMEGDGEEIVFSANFACPHCGYSMQELEPRLFSFNNPAGACGTCDG
FT                   LGVQQYFDPERVIQDANLSLAQGAIRGWDQKNYYYFQMLTSLAEHYDFDLHAPFNSLSK
FT                   RIQEVILKGSGRTEIEFKYINDRGDIRLKRHPFEGILNTLERRYRDTESNSVREELVKY
FT                   ISTKPCTSCGGTRLRLEARNVFINDTTLPQIVELSIADALTFFATLKLEGQRAQIAEKV
FT                   MKEINDRLQFLVNVGLNYLNLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIG
FT                   LHQRDNERLLKTLTHLRDLGNTVLVVEHDEDAIRCADHVIDIGPGAGVHGGQVVAEGTM
FT                   AEILANPDSLTGQYLSGAKQIIVPTQRTPRDKNKTVELIGASGNNLKEVHLSVPVGLFS
FT                   CITGVSGSGKSTLINDTFFKIAHTQLNGATTAQPAPYKSIKGLEHFDKVIDIDQSPIGR
FT                   TPRSNPATYTGIFTPIRELFSGTQESRSRGYKPGRFSFNVRGGRCEACQGDGVIKVEMH
FT                   FLPDVYVPCDVCKGKRYNRETLEVHYKGKSIDEVLEMTVEDAHEFFAPVPVIARKLQTL
FT                   MDVGLSYIRLGQAATTLSGGEAQRVKLARELSKRDTGKTLYILDEPTTGLHFHDIQQLL
FT                   TVLHRLRDHGNTVVVIEHNLDVIKTADWIIDLGPEGGQGGGEIIAQGTPEDVAQIEGSH
FT                   TARFLKPMLK"
FT                   /protein_id="YP_004187582.1"
FT   gene            complement(403202..404074)
FT                   /db_xref="GeneID:10165097"
FT                   /locus_tag="VVM_00690"
FT   CDS_pept        complement(403202..404074)
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /gene_family="HOG000283477" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00690"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="GI:320155204"
FT                   /db_xref="GeneID:10165097"
FT                   /translation="MIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVEEAIQ
FT                   AGMDGMCIVTGRGKHSIMDHFDKNYELEHQISGTNKEALLEDVRALIDSANFTYIRQRE
FT                   MKGLGHAILTGRELVGDQPFAVVLADDLCVNEEQGVLAQMVALFKQFRCSIVAVQEVPE
FT                   NETHKYGVISGEMIKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPG
FT                   KGGEIQITDALLKQAKAGCVLAYKFKGRRFDCGSVEGYIEATNYCYQNLYLKDEKTSEL
FT                   GKFSTQKEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187583.1"
FT   gene            complement(404260..404907)
FT                   /db_xref="GeneID:10165098"
FT                   /locus_tag="VVM_00692"
FT   CDS_pept        complement(404260..404907)
FT                   /locus_tag="VVM_00692"
FT                   /gene_family="HOG000284130" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator LuxR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155205"
FT                   /db_xref="GeneID:10165098"
FT                   /translation="MRKSSYARKPFFISLQNEQTPEFVTVLAKQIQMEIPVITPATLMQ
FT                   ADPNHRNRILLIDHQQHKVLLREIKNLPLIWKGFETVLCNVPSRLTTEELIGFGQCKAI
FT                   FYRDTAITDMAKGLNSVINGKSWLPRDVSAQLIHYYRNMVCSHTSPVNVDLTMREIQVL
FT                   RCVQSGKSNSQIAEDLFISEFTVKSHLYQTFRKLSVKNRVQAAAWADQNLIS"
FT                   /protein_id="YP_004187584.1"
FT   gene            405207..405746
FT                   /db_xref="GeneID:10165099"
FT                   /locus_tag="VVM_00693"
FT   CDS_pept        405207..405746
FT                   /locus_tag="VVM_00693"
FT                   /gene_family="HOG000106483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-stranded DNA-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155206"
FT                   /db_xref="GeneID:10165099"
FT                   /translation="MASRGINKVILVGNLGNDPEIRYMPSGGAVANITVATSETWRDKA
FT                   TGEPREKTEWHRVTLYGKLAEVAGEYLRKGSQVYIEGQLQTRKWQDQNGQDRYSTEVVV
FT                   QGYNGIMQMLGGRQQQGGAPAMGGAPQQQQGGWGQPQQPAAQPSYQKQAPAQQQPMQSQ
FT                   PQYNEPPMDFDDDIPF"
FT                   /protein_id="YP_004187585.1"
FT   gene            405953..407896
FT                   /db_xref="GeneID:10165100"
FT                   /locus_tag="VVM_00695"
FT   CDS_pept        405953..407896
FT                   /locus_tag="VVM_00695"
FT                   /gene_family="HOG000270419" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MshA biogenesis protein MshH"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155207"
FT                   /db_xref="GeneID:10165100"
FT                   /translation="MIVISAMFILFIGGTLSFKKLGQEYLNHYLAGIVEVLDKEMEDPD
FT                   AAYSMQRWMPKMLQASNIVEMKLSTDSGVVYRFKDTSPQIDVNRLYEQSYVLQRNPGYR
FT                   VEFKATPPYVGFGYSFQALWSITLAVGLIIFCLMRGVKWLKEQLYGSELLEERGRMILA
FT                   GRVEQYAKGDEREWPYTASEALDMLIEELRDARQERSRFDTFIRTQTFLDKLTGTANRV
FT                   LFDNKLESALHESGAQGAVLLMRIADWKSVSEENDKQMADEFVIEVGSLISNLVQRFPE
FT                   VVFSRYYPSDFALFIPHLGAKDVANLASQCIRQLEKLNPPYPLDKENWCHIGVTMYQEG
FT                   ERHSQIMDEAETALRSAQLQSNNNWSRFKKWNHIDETRGSVKWRTIFETAMSTENVLVF
FT                   GQLSYLLDGQQLNPLHTELTCRIVDPENGIVKASRYMSALKQVGFESQMDRAVIGKVFA
FT                   HLRANSENIGKLSLNLHVTPFANRHYFKWFRDELLQLPSEYRTKLSFEFVESHLVRHLD
FT                   YMRPVAKMLSGLGCQLVVGQAGRTIVSTHYLKDLGVDYLKLHRSLTKKIEQRHENQLFV
FT                   RSMLGAGAGTKVKVIAVGVEAKQEWSTLVELGIHGGQGRYFSVENQWLPPVVTTVEEKQ
FT                   TKTARRNRWRRK"
FT                   /protein_id="YP_004187586.1"
FT   gene            407909..409369
FT                   /db_xref="GeneID:10165101"
FT                   /locus_tag="VVM_00698"
FT   CDS_pept        407909..409369
FT                   /locus_tag="VVM_00698"
FT                   /gene_family="HOG000218144" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshI"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155208"
FT                   /db_xref="GeneID:10165101"
FT                   /translation="MNVKSLLEKLRGQANGGEQRFVMLQPDAVYFAAQGELSSESATSQ
FT                   ALFEPIDESWEKALEKVLQLQFTPGEKVTVLLASHHYQVFQIEKPAIPREEWPSALPFL
FT                   VKDLISERPTEIVADGRLLPNSNKLQVYVLSKKIVDKLLDLIVRNQCELHSIVPEDEIW
FT                   AHSAGELANFLLLQRSAKGQFKLGAFVEHTPMFQRTIRSVFPPLTGEAASALQLDGLAL
FT                   ELQRSIDYLSSQIKGVSLNQLKICCDEEDHAELVSALNERLSANASVLDDEGRLSGNIV
FT                   VDCAAQLGKAEINLYPEHLKPKKELFTLNNVAAGWGGIAAIFLMVYAFALWQQRAIDNQ
FT                   LANVQAESHQLTQQLSQLQARLDQHKPSSEKLAAVERLKVKVRAQEASLNAISQYDTSL
FT                   QTGYSGMMLSLAKLGRNDISLTDISVVGANLDVKGLAISANAVPNWVNQFKHELPLVGR
FT                   SFDKVKIGRNEDDVITFELKTKAEGKGQ"
FT                   /protein_id="YP_004187587.1"
FT   gene            409366..410016
FT                   /db_xref="GeneID:10165102"
FT                   /locus_tag="VVM_00700"
FT   CDS_pept        409366..410016
FT                   /locus_tag="VVM_00700"
FT                   /gene_family="HOG000270453" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155209"
FT                   /db_xref="GeneID:10165102"
FT                   /translation="MKQQWNAWNDKFLALSGREKWLITLCGLVVIVLLLFTLVIEPAWK
FT                   QLAAKKEQLSSTIQLNQKLQGDILVIQAKLNKDPNREIDIEMKSLLARSQELGMQLSEV
FT                   IGNLLSPSQMAELLETVLDKSSGVKLISLESLRAEPIEGNPENSEYSGYYVHPVRLEMT
FT                   GDFFAIQGYLSKLENLPVKYYWRRFHYQVEEYPQARVVLEVYTLGTRQEFIGG"
FT                   /protein_id="YP_004187588.1"
FT   gene            410009..410329
FT                   /db_xref="GeneID:10165103"
FT                   /locus_tag="VVM_00701"
FT   CDS_pept        410009..410329
FT                   /locus_tag="VVM_00701"
FT                   /gene_family="HOG000218145" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155210"
FT                   /db_xref="GeneID:10165103"
FT                   /translation="MVRFLLLSLCFAGGNAYATQDPTAPLGWTKPAQTKPSAQRQYRLP
FT                   TLQSIVCQSPKECVAILNDDVVSVGETIRGYKVTQIDSDVVTLKRGSKLWKLELFNLDI
FT                   KE"
FT                   /protein_id="YP_004187589.1"
FT   gene            410396..411991
FT                   /db_xref="GeneID:10165104"
FT                   /locus_tag="VVM_00702"
FT   CDS_pept        410396..411991
FT                   /locus_tag="VVM_00702"
FT                   /gene_family="HOG000270474" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshL"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155211"
FT                   /db_xref="GeneID:10165104"
FT                   /translation="MGHRDPVEVKQTLNQSINEANSRALDELPPSVEEDLMPELEAANT
FT                   VGSNTVKRFRIKASGVEARQFFTSLIKGTEFSVAVHPDVTGRITLNVSDVTLDDILLIV
FT                   QDMYGYDVIKTGKVIQVYPAGLRTVTIPVDYIQFQRSGRSLTSIVTGSVTSTGSTSSSG
FT                   DSDSNSNNSSNNSNNSGDNTTTASGGTRIETITESDFWPLLQQAVAGLIGSGKGQSVVV
FT                   TPQAGVITVRAFPDEIREVRQFLGISQERMQRQVILEAKILEVTLSDGYQQGINWSNIS
FT                   ASIGNSGSIVVNRPGSTVLPGLDAIGSLLGGQTNVTISDGSFEAVLSFMSTQGDLNVLS
FT                   SPRVTASNNQKAVIKVGNDQYYVTALSSNVGNDDKSKAVPEVTLTPFFSGISLDVTPQI
FT                   DDKGNVFLHVHPAVIEVEEETKQLNLGGDFQNVTLPLAKSSIRESDSVIRARDGDVVVI
FT                   GGLMKSNTIERVSKVPFFGDIPALGHLFRNTSNLTQKTELVILLKPTVVGVNTWQKELE
FT                   RSRDLLQEWFPDQQ"
FT                   /protein_id="YP_004187590.1"
FT   gene            411999..412847
FT                   /db_xref="GeneID:10165105"
FT                   /locus_tag="VVM_00704"
FT   CDS_pept        411999..412847
FT                   /locus_tag="VVM_00704"
FT                   /gene_family="HOG000270485" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155212"
FT                   /db_xref="GeneID:10165105"
FT                   /translation="MYLQHFGFHTQPFSQTPNTELFLGLAPHFEAIQTVMAALDMGEGI
FT                   VKVTGEVGTGKTMVCRMLIDQLSDKVNLVYLPNPVLSGHELQMAIAREMGLKTYDSVSL
FT                   VPQIQDRLIGMRQRGMRTVLLVDEAQALPLEAMEALRLFGNLETEQEKLLQIVLFGQPE
FT                   LDERIAQHELRQFRQRITFSCQLRPLTIEEGVAFIDSRLAKAGDGEHQYLSTEQKKALW
FT                   RGAGGIPRLINQLCHKAFLLAYMQQQKNVTNQHLFTAIHDTYDACKPLFKTPVLWGWRA
FT                   S"
FT                   /protein_id="YP_004187591.1"
FT   gene            412844..413965
FT                   /db_xref="GeneID:10165106"
FT                   /locus_tag="VVM_00705"
FT   CDS_pept        412844..413965
FT                   /locus_tag="VVM_00705"
FT                   /gene_family="HOG000218146" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshN"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155213"
FT                   /db_xref="GeneID:10165106"
FT                   /translation="MSEINKALAELASQKSQPAQLQRAELPKVTSVKPIVWIATGFGLS
FT                   LAVGGWAITQSAPVSQNYSEPVTTTVVTVAEETLRSPTQKTPSEGAQSVTVSQPNIVTT
FT                   ARVEKATSVAPSSVKPATAPSKSETTLVAKAAAKPSATENQPVSHSVPSQVKAQAPVAQ
FT                   NTPAVENSMLVEQVELTQEQLAEKAIGRAEKALDANNLQNALSAYSDALRHTPNNEVVR
FT                   QKLAALYFGKGDSRKAYELLQAGIALNPEGETLRIALSKMLIKANQNEAALTPLVALYD
FT                   DSGKEYLAMRAALAQKIKKDDIALESYQRLSQMDSENARWWLGLAIQQERALDFKSAQV
FT                   SYQAALSKVGISNQSQRFIKDRLALLQNLESAQ"
FT                   /protein_id="YP_004187592.1"
FT   gene            413962..415686
FT                   /db_xref="GeneID:10165107"
FT                   /locus_tag="VVM_00707"
FT   CDS_pept        413962..415686
FT                   /locus_tag="VVM_00707"
FT                   /gene_family="HOG000008427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshE"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155214"
FT                   /db_xref="GeneID:10165107"
FT                   /translation="MKVRLRKRLGDLLVEEGIINEAQLDQALGAQRSGGRKLGDTLIDL
FT                   GFLSEQQMLAFLSQQLDLPLIDLNRATVDIDAVQLLPEVHARRLRALVIGRNGDTLRIA
FT                   MSDPADLFAQEALIGQLGQYGIEFVIAPERQLVEGFDRYYRRTKEIANFAEQLQAEHQV
FT                   NDAFDFNIEDDDSDEVTVVKLINSMFEDAIQVGASDIHIEPDANVLRLRQRIDGVLHET
FT                   LLNEVNIAPALVLRLKLMANLDISEKRLPQDGRFNIRSKGQSVDIRMSTMPVQYGESVV
FT                   MRLLNQSSGVRKLEDSGLPDDLLVRLRRQLKRPHGMILVTGPTGSGKTTTLYGALTELN
FT                   QPGKKIITAEDPVEYRLSRVNQVQINPKINLDFSTVLRTFLRQDPDIILIGEMRDHETV
FT                   EIGLRAALTGHLVLSTLHTNDAVDSALRMIDMGAPGYLVASAVRAVVAQRLVRRVCPDC
FT                   KTEDHVGESRKAWLAQRFPNQVEAGFVKGRGCQNCNLTGYRGRIGVFEMLELEHGMMDA
FT                   LRANDAVEFAHAARRSPGYKPLLASAMELALQGVVSLDEVMNLGEGDSSGVAEAIIM"
FT                   /protein_id="YP_004187593.1"
FT   gene            415696..416916
FT                   /db_xref="GeneID:10165108"
FT                   /locus_tag="VVM_00709"
FT   CDS_pept        415696..416916
FT                   /locus_tag="VVM_00709"
FT                   /gene_family="HOG000253740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshG"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155215"
FT                   /db_xref="GeneID:10165108"
FT                   /translation="MATFHYQGRTLDGNKANGQIDAVTSEAAAEQLMNRGIIPVSITQG
FT                   KTGSGLDFDLNALFAPAVPLEILVLFCRQLYSLTKAGVPLLRSMRGLVQNCENKQLKAA
FT                   LEEVVAELTNGRSLSASMQLHSKVFSPLFVSMIHVGENTGRLDQALLQLANYYEQELET
FT                   RKRIKTAMRYPTFVISFIVVAMFILNVKVIPQFASMFSRFGVDLPLPTRILIGMSEFFV
FT                   NYWMLLAGFIVGLIFGFKAWVATADGRERWDKWRLKLPVVGGVVNRAQLSRFSRTFALM
FT                   LKAGVPLNQSLALSAEAMGNRYLELKILKMKADIEAGSQVSVTAINSGIFTPLVIQMIS
FT                   VGEETGRIDELLMEVADFYDREVDYDLKTLTARIEPILLVIVAGMVLVLALGIFLPMWG
FT                   MLDVIKG"
FT                   /protein_id="YP_004187594.1"
FT   gene            416920..417381
FT                   /db_xref="GeneID:10165109"
FT                   /locus_tag="VVM_00711"
FT   CDS_pept        416920..417381
FT                   /locus_tag="VVM_00711"
FT                   /gene_family="HOG000144797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshF"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155216"
FT                   /db_xref="GeneID:10165109"
FT                   /translation="MIRDSHRASLVLWLALVLVMMVVFVQRWRPVESEASKTAAQVSVK
FT                   RMLERANLYKQEWLLQGKPKQIEMDGQSIPLSTYGWVPLIGENGQLDCQRWLDFHSPER
FT                   RILESHLTNVSESKINETYQCQFNYQNGLLIVVSQQHKILKISVENMAE"
FT                   /protein_id="YP_004187595.1"
FT   gene            417460..418038
FT                   /db_xref="GeneID:10165110"
FT                   /locus_tag="VVM_00712"
FT   CDS_pept        417460..418038
FT                   /locus_tag="VVM_00712"
FT                   /gene_family="HOG000270486" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA pilin protein MshB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155217"
FT                   /db_xref="GeneID:10165110"
FT                   /translation="MKQNQNGFSLVELVVVIVVVGLLAVAALPRFLDVTDAAKKASIEG
FT                   VAGGFATGVLSARAQWEAEARPSRNTNSQEQNTVNYDGVDFWLTRSKDASNADTGFRDG
FT                   YPWGLAGNFASYPAALTGQMCVDLMENLLQNPPKVGIEGSGTTSDNGFKYSASADSANA
FT                   KCTYIQLDGNTKHQFEYEAKNGRVTVTLQ"
FT                   /protein_id="YP_004187596.1"
FT   gene            418072..418581
FT                   /db_xref="GeneID:10165111"
FT                   /locus_tag="VVM_00713"
FT   CDS_pept        418072..418581
FT                   /locus_tag="VVM_00713"
FT                   /gene_family="HOG000008197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA pilin protein MshA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155218"
FT                   /db_xref="GeneID:10165111"
FT                   /translation="MKRQGGFTLIELVVVIVILGILAVTAAPRFLNLQDDARVATLEGL
FT                   RGAIAGASGIVYGKAAVAGLEATERDATATPPVAPVVENGNGGNIDLTFGYPTASTTGV
FT                   MLAIDVSNEFAVIDSANDDNTDNTNAWIDIGITGYTNNCVRYTAATNATTPATAQVVSG
FT                   AGFCGQ"
FT                   /protein_id="YP_004187597.1"
FT   gene            418602..419096
FT                   /db_xref="GeneID:10165112"
FT                   /locus_tag="VVM_00714"
FT   CDS_pept        418602..419096
FT                   /locus_tag="VVM_00714"
FT                   /gene_family="HOG000270499" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA pilin protein MshC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155219"
FT                   /db_xref="GeneID:10165112"
FT                   /translation="MRSHVSKRIKAFTLVELMVVILLISIVSAYAASRYIGTGSFSAYA
FT                   AQEQAISIIRQLQVYRMQSNTTNSANPNFELTASGGCLGSTAGCTAASTPQAAESRSDV
FT                   MRLDGVSVSSTISPIRFDLRGNPLQTNGSALNSVTITFTASGESASVCINSQGYVSGGG
FT                   C"
FT                   /protein_id="YP_004187598.1"
FT   gene            419096..419662
FT                   /db_xref="GeneID:10165113"
FT                   /locus_tag="VVM_00715"
FT   CDS_pept        419096..419662
FT                   /locus_tag="VVM_00715"
FT                   /gene_family="HOG000270520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA pilin protein MshD"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155220"
FT                   /db_xref="GeneID:10165113"
FT                   /translation="MKKHQGMTLIESIVAMVLIAVAMVTLTSLLFPNVKNSAAPHYQTR
FT                   AIALGQGFMSQILARGFDHNSNFDGGSTRCGEDGVLCTAADGLGAEESQVVDYNDVDDY
FT                   IGCWYTSNTQSQCPAGSVQKSLADVFGSTINTEYPNFRVDVRVFYDGNMDGSDDGAVST
FT                   LKRIEMAIHAGQYGPYPLVAYKGNY"
FT                   /protein_id="YP_004187599.1"
FT   gene            419662..420351
FT                   /db_xref="GeneID:10165114"
FT                   /locus_tag="VVM_00718"
FT   CDS_pept        419662..420351
FT                   /locus_tag="VVM_00718"
FT                   /gene_family="HOG000218149" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshO"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155221"
FT                   /db_xref="GeneID:10165114"
FT                   /translation="MSSRGFTLVEMVLTLIVGSILVLGIAGFVELGTKGYADSVDRQRI
FT                   QTQAQFVLEKLSREFRHAVPNSFGDSGNCLSFYPIVYSGFYAVEGNDIRFLIGNTNVTP
FT                   PLANGLSLVINPSRQQDLVNDSFDVSGLTNSAGYFAVLNQAASLESNSINRRHYIFNAN
FT                   GRVEYCFTAGRISRNGVQVADSVSAASFNYLEPTLQRGGLVHIKLTFTQNDESSHYQQD
FT                   VQVLNVP"
FT                   /protein_id="YP_004187600.1"
FT   gene            420341..420757
FT                   /db_xref="GeneID:10165115"
FT                   /locus_tag="VVM_00719"
FT   CDS_pept        420341..420757
FT                   /locus_tag="VVM_00719"
FT                   /gene_family="HOG000000645" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155222"
FT                   /db_xref="GeneID:10165115"
FT                   /translation="MFPNRRKQQGNMLVVAIFVIVVMGFLASSLTRINWSNSDNLTREQ
FT                   LGTQAWLMAQSANEWALTQLYPLGVSASVSTACTAIQGATPNVSANSPCRNPQISCQSI
FT                   GTLQGETFYRLEASAVCGSGIVEVERRQEVWVKE"
FT                   /protein_id="YP_004187601.1"
FT   gene            420761..425032
FT                   /db_xref="GeneID:10165116"
FT                   /locus_tag="VVM_00720"
FT   CDS_pept        420761..425032
FT                   /locus_tag="VVM_00720"
FT                   /gene_family="HOG000144799" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155223"
FT                   /db_xref="GeneID:10165116"
FT                   /translation="MKRYIQLLWLTLVMLFFTPLSYGASCSVHGESDFTISFRVTGSNT
FT                   YQQFYLKQGSHGHVLWYTHQERVGSSYIFNEQNLEIGTSYDVRITSDASTNRLNYYRKK
FT                   ASSSDWQFIETKIQDLHNGNLSPVDGGTISNVSCGGGITTPPTYSNNAQFEFGTHICQS
FT                   MPCSIPLTKNYTYTPLVFVMPTIDSSNPDADAPSTLYVSSNLDSNSTSFTINQRTKNIS
FT                   GSNFTPIAMTSVSYLVIEPGVASFGGHQVLAGYVNSNAVASKSGSDSFSQVNFSSFGLN
FT                   SFNADPVLLHQIQTNNNADKWMTSGRVLQSSSTARRQSAQLFLELSASLVSGYSYKQEK
FT                   IAFLATLPTSANIAVDNNLVQFSNTFRTPSQSLPEPMQDGCDSYATTSLSSLSGVVAKK
FT                   QERAGGHGGWLRRCSIQNNQVSFVVDEDFSDRSHIREYVGYFAFEQQRPSIDLCQYFPQ
FT                   PAQSWKSGSELNIQNNGSSISGWSTDYVNAYLANGALKVGFDTISYHAGLSGACDVGSC
FT                   TSGGLKAGTPSPISPSFTSTASLSIDQWNYASICDGNYCSYSNSGSNEVTITILKPLNT
FT                   LTVNGYNTLSFKVVFNDVGGPYGTEVRSYNPGGKVETVLKANGRYAFRDITFSGTGGKF
FT                   SFERGVVLYVVNSFVQNNTTIMNDLDGLKDMIIYGPTATFNFNTPTSDFAAQILGDSVT
FT                   FSNPITLRGAVTTNRLTMSTGNIEIIGEGACLTPSSNYTLELVPSSDIALTCETLTPTV
FT                   RVLDNGVLATNFSGTVTVLVDGVPQQLTPVNGVLEQILSLTVNQTKTVAVEAYINGDQA
FT                   NTTVTGQYQFVPFKFAIDDQYVIASKPQSVEAQVMACDSGNVVDIGYNGTPVITSTLTQ
FT                   PLGGMGVLTYSPVFASGTSTSDLTFTDSGVVQVQLEDGSFDCTGVQGCPIEGSSTLKGQ
FT                   FVVNSRPWTFAICSGETPALPMDGTSLYPSGGKFKVASERFNLHVKPIIWQSGGAVSGE
FT                   IETSSYCNAAITQNFFASNAPSAVVEMSSALHSPMGGSTSVLLQGDNGLSKVHNSGSGS
FT                   GTNQHYDFTQLYWDEVGSLKVMADAQTNYLGMDINLGYRNIGRFVPEKLVLASNSWTYA
FT                   TGHSGFAYMNQPIEHAFSVEAQNASDQVTQNYGLFDSAYVSTVSYFNVDNAHKEIVDRV
FT                   KDYSTLTWQQPAWSLGALNVTLTQYEFVKKAIPPSPSPYTTEPDGPYTQGFGLWASTVV
FT                   DGVDFENKELEVHDSGAIVKSGKAFSEQPDFRYGRMRLQDVGGFTGNQIEVPLTTEYWN
FT                   GSQFLTNGDDSGSDFDGSQFCRQLIWHSQAQTSSNASLSGSGTVSVGRSDRLSAQQSTT
FT                   DTDNQIREQVRFWLRVSDTTLQKVATTDNDIQCNGSGARPWLRFNWRSLGDEDPNAVVT
FT                   FGINRGNDRVIYKGESGLTGQ"
FT                   /protein_id="YP_004187602.1"
FT   gene            425185..426228
FT                   /db_xref="GeneID:10165117"
FT                   /locus_tag="VVM_00726"
FT   CDS_pept        425185..426228
FT                   /locus_tag="VVM_00726"
FT                   /gene_family="HOG000019757" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155224"
FT                   /db_xref="GeneID:10165117"
FT                   /translation="MFKKLRGMFSNDLSIDLGTANTLIYVKGQGIVLDEPSVVAIRQDR
FT                   AGSAKSVAAVGHAAKQMLGRTPGNISAIRPMKDGVIADFNVTEKMLQHFIKQVHDNSIL
FT                   KPSPRVLVCVPCGSTQVERRAIRESALGAGAREVFLIDEPMAAAIGAGLRVSEPTGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAEKIKHEI
FT                   GSAYPGDEVHEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQCPPE
FT                   LASDISENGMVLTGGGALLKDLDRLLTEETGIPVVIAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT                   /protein_id="YP_004187603.1"
FT   gene            426285..427175
FT                   /db_xref="GeneID:10165118"
FT                   /locus_tag="VVM_00728"
FT   CDS_pept        426285..427175
FT                   /locus_tag="VVM_00728"
FT                   /gene_family="HOG000266097" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155225"
FT                   /db_xref="GeneID:10165118"
FT                   /translation="MKPIFGRGPSLQLRLFFAVITSASLMLADGRLDAFSGVRYFLNSL
FT                   VAPIQYTANLPRSMFDGVYERFSTRQSLLEGNQNLKREVLRLRSDLLLLEQYKEENQRL
FT                   RKLLGSSFVRDEKKMVAEVMAVDTSPYRHQVVIDKGRIDGVYIGQPVINEKGIVGQITF
FT                   VAAHNSRVLLLSDAKNAIPVQVVRNDIRVIASGNGDIDEIQLEHIPTSTDIQVDDLLVT
FT                   SGLGGVYPEGYPVAYVTSVEHDTRREFAAIKAKPVVEFDRLRYLLLVWPNEDRQHKVLN
FT                   ANVDEHATQEVSDGE"
FT                   /protein_id="YP_004187604.1"
FT   gene            427165..427653
FT                   /db_xref="GeneID:10165119"
FT                   /locus_tag="VVM_00729"
FT   CDS_pept        427165..427653
FT                   /locus_tag="VVM_00729"
FT                   /gene_family="HOG000266108" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rod shape-determining protein MreD"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155226"
FT                   /db_xref="GeneID:10165119"
FT                   /translation="MANSVLRSKIVIGASFFVALVLQTIPWPGALDLFRPSWLLLVTCY
FT                   WVLALPHRVNVGSALVLGLLWDLLIGSTLGIRGMMLSIVVYLVALNFLVIRNMALWQQA
FT                   LLIAFLSVLLEVFIFCGEYLIQDVVFNPLSLWTAVINCILWPWVFLLLRRVRRHWHVR"
FT                   /protein_id="YP_004187605.1"
FT   gene            427658..428218
FT                   /db_xref="GeneID:10165120"
FT                   /locus_tag="VVM_00730"
FT   CDS_pept        427658..428218
FT                   /locus_tag="VVM_00730"
FT                   /gene_family="HOG000241745" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="septum formation protein Maf"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155227"
FT                   /db_xref="GeneID:10165120"
FT                   /translation="MHKLVLASGSPRRKELLAQLGYTFDVVLPDIEECKAEQETAAEYV
FT                   LRLSQQKAQAGLALVSESSIVVGSDTVVVCDGQVLEKPHHFADAQRMLTQLSDRRHQVM
FT                   TAVTVVSAEKQHSIVVTTEVWFKKLTQEEIEQYWQSGEPCDKAGSYGIQGLGGRFVTRI
FT                   EGSYSAVVGLPLYETDQLLHEFI"
FT                   /protein_id="YP_004187606.1"
FT   gene            428241..429710
FT                   /db_xref="GeneID:10165121"
FT                   /locus_tag="VVM_00731"
FT   CDS_pept        428241..429710
FT                   /product="cytoplasmic axial filament protein CafA and
FT                   /gene_family="HOG000258025" [ FAMILY / ALN / TREE ]
FT                   Ribonuclease G"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00731"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="GI:320155228"
FT                   /db_xref="GeneID:10165121"
FT                   /translation="MSAELLLNVTPSETRVAMIEGGVLQEVHIEREARRGIVGNIYKGK
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIVPHTECVAENEKQQFQVRDISELVRQGQDIV
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESESERERLKKIVSHYCD
FT                   EHGGFIIRTAAEGADGKELSQDAAFLKRLWLKVMERRSKYKTRSTLYGELGLAQRILRD
FT                   FVGTELDKILVDSRQEFENLKEFTSEYVPELTDKLELYEGDKPIFDMYDTENEIQRSLE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGRRNLEETIFNTNIEATQAIARQLRLRNL
FT                   GGIIIIDFIDMSSEEHRKRVLTSLENALSKDRVKTNINGFTQLGLVEMTRKRTRESIEH
FT                   ILCSSCPTCEGRGSVKTVETVCYEILREITRVNRAYDADKFVVYASPAVADALHGDESH
FT                   ALAELEVFIGKQVRIQAEPLYIQEQFDVVMM"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187607.1"
FT   gene            429721..433608
FT                   /db_xref="GeneID:10165122"
FT                   /locus_tag="VVM_00733"
FT   CDS_pept        429721..433608
FT                   /locus_tag="VVM_00733"
FT                   /gene_family="HOG000218151" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155229"
FT                   /db_xref="GeneID:10165122"
FT                   /translation="MISGFTLFWRAVLWLLVTLLLLLAILVTGLRIALPQMNQFQDEIK
FT                   TWVKQGTGLDVSISSVSGSWRNSHPSVALQGFEAFLPGEKKVNISVDEVHIEFDLLESI
FT                   LRLQPVVANLNMSGLALDIRSIELVAAEGPPTREASSESQESSNLIKQLDNLLLRQLEE
FT                   FSVTQSKIWYQSVSGENRRLDIDRLRWRNQGAHHLAEGVVSVAGTNLNALLVSANFVDH
FT                   GSLLDVSGEFYVNAEEIAVTQWLTRYVKKETGIDSGKISLKSWLTLQHSQPRYAFVELL
FT                   PSELSWTENGQHELTLESGILKLSPDGEGWKVSGHSLTLRTDEIEWPQLDIAFDWQPQG
FT                   WKLNLSQLSLEALLPMAKLLPDSDQTTQILQKLQPSGTVEDIRVAMSGSDLDSLRYSAE
FT                   LDSLAMQQWDLLPGFHHVSGTLFGDVTQAKASMSVIDDVFPYGEVFQAPLNIKQGQVDI
FT                   VWQNDQNGWRLWADKVTAATPDLQVLGAFRLDFPKDKSPFLSFYAEADAYNVGETWRYL
FT                   PTLALGRELTDYLSTAIQGGKVNTAKLLWYGELADFPYTKNDGMFQAWVGLKQGKFSFD
FT                   TAWPPITDLQLDLLFQNDAMYLDSKSATLKDVKASRITGRIPELAEGGHIEIEAKATAA
FT                   GNAVRDYMTATPLVDSVGAALTALQVQGPVKSEFQLNIPFTSDKEPRAWGYAELAGNRV
FT                   DIDAPPMTLEKVSGRIEFDNDVVKASGLSARLLKQPIAIDFAGESADYGYSVVINTLAD
FT                   WDVKPLVPYVGEQWLGRLSGHAPWTMDIDLQLNDVGFTYQVDLNAKLNSVASRYPYPLN
FT                   KNVGEAWQARMQASGNQESITARLQMPNAKYQTEIDITGKVPVLSATNLVLGSGGFKIS
FT                   PVVGHHALIRTEYFDLDQWLSVLSQPPKGATSKLAQMDTPEIPLPTRIKVETPTLMLSG
FT                   IEFHDVDFSARKKNLNWQFNLKSQEAVGQANYLEPYDLAVSLERLHLYVPGLDEKKAQG
FT                   ESLLTAESPEAPLISQFDREFHQLMPNLTLNIDDFWLQGYKVGKVNIDLQRQGKALVWK
FT                   NISLVSGSNRVDVNGDWTLDGETSQSRMNLKVKSDNNSDLMERFGITSGIQKAPFEITS
FT                   QVTWDGAPWSMRVNTLDGDVQTEFGKGIITDVSGAARLLGLFSLDSIIRKMQLDFTDVF
FT                   DKGMAFNSIKGTGKIQDGVFVTNDIEMDALAGAMKIRGLANMVTRTVDAEVQFTPDITS
FT                   GIPMLTAFAVAPQTALYVLAISTVISPVVEVFTQVNYSVKGPLDSPTVSEISRSRGEFE
FT                   LPEKLRKEAQE"
FT                   /protein_id="YP_004187608.1"
FT   gene            433619..434443
FT                   /db_xref="GeneID:10165123"
FT                   /locus_tag="VVM_00737"
FT   CDS_pept        433619..434443
FT                   /locus_tag="VVM_00737"
FT                   /gene_family="HOG000222700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative amidohydrolase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155230"
FT                   /db_xref="GeneID:10165123"
FT                   /translation="MERIAIIQMTSTSDCTDNVAYIEHWAEQAALQGASLVVTPENALL
FT                   FGGREDYHQHAEPLGNGPLQQAMAQLAKRLAVTLVIGSMPIRQGHDVTTTSLVFGPNGE
FT                   RLGHYSKLHMFDVEVCDGHGHYRESDSFLAGDRSSVVATPIGRLGLSICYDVRFPALYQ
FT                   TLRQKGADILLVPAAFTAVTGEAHWEVLLRARAIENQCWVIAAAQGGMHSASRETWGHS
FT                   MVIDPWGKVVAKLPQQGDLLLAEIDLALSDTIRRKMPVVKHSRFTHLLDNKD"
FT                   /protein_id="YP_004187609.1"
FT   gene            434466..435911
FT                   /db_xref="GeneID:10165124"
FT                   /locus_tag="VVM_00739"
FT   CDS_pept        434466..435911
FT                   /locus_tag="VVM_00739"
FT                   /gene_family="HOG000224929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TldD protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155231"
FT                   /db_xref="GeneID:10165124"
FT                   /translation="MSINQIEEALLAPGGLTAEDIAATLGSIATRQIDYADIYFQSSWH
FT                   ESLVLEDSIIKDGSFNIDCGVGVRAVTGEKTGFAYSDQIQLDGLKQSAIAARGIAQQGQ
FT                   NGQVRAFKRSENQHYYAAVNPLAGWEKQQKTELLKSLDAYIRTKEPLIKEVSISLSGVH
FT                   EQMLVAATDGTYAGDIRPLVRLSISVLAEKGERRERGSAGGGGRFGYDFFLGDENGAQR
FT                   AFHFADEAIRMALVNLEADAAPAGSMPVVLGSGWPGVLLHEAVGHGLEGDFNRKGSSVF
FT                   SGKVGEQVTSSLCTIVDDGTLKDLRGSLNVDDEGVNGQYNTLIENGVLKGYMQDKLNAR
FT                   LMGVNPTGNGRRESYAHLPMPRMTNTYMLPGQHTPEEIISTVKKGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIEDGKITRPVKGATLIGSGIEAMQQVSMVGNDLSIDRGVGVCGKAG
FT                   QSIPVGVGQPTLKLDSITVGGTE"
FT                   /protein_id="YP_004187610.1"
FT   gene            complement(436051..437430)
FT                   /db_xref="GeneID:10165125"
FT                   /locus_tag="VVM_00744"
FT   CDS_pept        complement(436051..437430)
FT                   /locus_tag="VVM_00744"
FT                   /gene_family="HOG000241186" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative ATPase-like phosphate
FT                   starvation-inducible protein PhoH"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155232"
FT                   /db_xref="GeneID:10165125"
FT                   /translation="MGDTDRKLFVLDTNILLHEPFAIYSFKEHDVVIPMTVLEELDRIK
FT                   DSKRDVARDARVAIRALEDLFKDATPDEISEGIPVSKEGEGRGTISILADFELQETVKA
FT                   FADKAGDNRILNAVLYLQNKRAPREVVLVTKDINMRLRAKGAGVRYVEDYRTDQLIDDI
FT                   QYLTKGYQVREGEFWSQVDQVESYALEGRTFHKLDRAPFDPTFINQYVVDAEESDFVGR
FT                   VETIDGDKLTLLDLSRERLMHRKAWDITPKNIYQAMALDALLDPDIDLVILTGAAGSGK
FT                   TLLALAAALEQTIEKGMFDKIIVTRNTPDIGESIGFLPGTEEEKMMPWLAAVTDTLEAL
FT                   HKHDHCTEGSLKYIVDKANIQFKSINFMRGRSIQNAFVLLDECQNLTASQIKTIITRCG
FT                   EGTKIVCSGNLAQIDSHYLTPVTSGLTYMVERFKNFEGSANVHLNGVVRSRLAEFAEEN
FT                   L"
FT                   /protein_id="YP_004187611.1"
FT   gene            437952..440861
FT                   /db_xref="GeneID:10165126"
FT                   /locus_tag="VVM_00745"
FT   CDS_pept        437952..440861
FT                   /product="RNA polymerase associated protein RapA"
FT                   /gene_family="HOG000218482" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00745"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="GI:320155233"
FT                   /db_xref="GeneID:10165126"
FT                   /translation="MAFALGQRWISDTESDLGLGTVVALDARTVTLMFAASEENRVYAS
FT                   NDAPVTRVVFNVGDVVECQEGWSLKVEQVVEENGLYTYLGTREDTEETGVALREIFLSN
FT                   QIRFNKPQDKMYAGQIDRMDNFVLRYRALKNQYEQHRSPMRGLCGMRAGLIPHQLYIAH
FT                   EVGRRHAPRVLLADEVGLGKTIEAGMIIHQQVLLGRAERILIVVPETLQHQWLVEMMRR
FT                   FNLHFSIFDEERCVEAFAESDNPFDTQQYVLCSLDFLRKSRKRFEQALEADWDLLVVDE
FT                   AHHLEWSQDKPSRGYQVVEGLAERTPGVLLLTATPEQLGRESHFARLRLLDSDRFYDYA
FT                   AFVEEEAQYAPVADAITALFSGVKLADEAKNQITELLSEQDVEPLFRIIESNADEESKA
FT                   IARQELIDNLMDRHGTGRVLFRNTRAAIKGFPVRNVHLLPMPIPTQYTTSMRVSGMIGG
FT                   KLAPEARAMKNLYPEEIFQEFEGEESSWWQFDCRVNWLLEKLKAQRSEKVLVIASRAST
FT                   ALQLEQALREREGIRATVFHEGMSILERDKAAAYFAQEEGGAQVLICSEIGSEGRNFQF
FT                   ANQLVMFDLPFNPDLLEQRIGRLDRIGQKRDIDIHVPYLQGTAQEVLARWFNEGLNAFA
FT                   ETCPTGRTVYDQVSDQLIEMLASGSNEALDDVIAESAKLNQALKADLEQGRDRLLEMHS
FT                   NGGEKAQQIVAEIAAKDGDTNLVSFALSLFDTIGLNQDDKGENAIVVTPSEHMMVPSYP
FT                   GLPYEGATITFDRDTALSREDMHFISWEHPMIQGGIDLLMSEGVGTCAVSLLKNKALPV
FT                   GTLLLELIYAVDAQAPKRSGIGRFLPRTPIRLMMDARGNDLSGQVEFESFNRQLSPVNR
FT                   HLASKLVSSVQNDIHRLIEAGDQLVVENVEAIRQQAQQEMQQSLNSELERLQALKAVNP
FT                   NIRDEEIEAIDAQIKELNGYIAKAQFQLDSLRLIVVSHN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187612.1"
FT   gene            441095..441847
FT                   /db_xref="GeneID:10165127"
FT                   /locus_tag="VVM_00749"
FT   CDS_pept        441095..441847
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /gene_family="HOG000275919" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00749"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="GI:320155234"
FT                   /db_xref="GeneID:10165127"
FT                   /translation="MAMLEYLPPTDPWTEIIFEDDHILAVNKPSGLLSVPGRLPEHHDS
FT                   MWSRLQEQYPEIQVVHRLDMSTSGLMVFAKNKRAEAALKKQFQYRLTHKIYYARVWGHV
FT                   EADSGMIDLPLICDWPNRPMQKVCHEHGKPSQTEFQVAKREVHANGAQTTIMRLLPVTG
FT                   RSHQLRVHMQALGHPIVGDEFYAQGDAFTFSERLELHAAELSFYHPKSHWLRSLFVPCD
FT                   FYPDAEEMIFSYFDPARKLPDYKSLPKS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187613.1"
FT   gene            441904..442866
FT                   /db_xref="GeneID:10165128"
FT                   /locus_tag="VVM_00751"
FT   CDS_pept        441904..442866
FT                   /product="glycerate dehydrogenase"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00751"
FT                   /EC_number="1.1.1.29"
FT                   /db_xref="GI:320155235"
FT                   /db_xref="GeneID:10165128"
FT                   /translation="MSLPVVVFLDRATIPAHITLPTLAFEHRWVEYDCTSPEQVIERLQ
FT                   AADIVITNKVLLDQALLAQLPNLRMIAVAATGFNNVDVDFCAEKGIAVANVRGYATRSV
FT                   PEHVIAMLFALRRNLFGYHQDIAAGVWQQDKQFCFFSQPIGDVAGSTLGIIGSGALGQA
FT                   TAQLAQALGVKVLFAERKGQSDCRQGYHRFEEVLSQADAISLHCPLSAQTHHLIGAAEL
FT                   ASMKSNAILLNTGRGGLVDEQALVEALKKGDIAAAGVDVFSAEPADETNPLLANMHLPN
FT                   LLLTPHVAWGSDSAITQLCEILLENINAYWRGETLNRLV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187614.1"
FT   gene            complement(442926..443315)
FT                   /db_xref="GeneID:10165129"
FT                   /locus_tag="VVM_00753"
FT   CDS_pept        complement(442926..443315)
FT                   /locus_tag="VVM_00753"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155236"
FT                   /db_xref="GeneID:10165129"
FT                   /translation="MTKVLHTDSAPAAIGPYIQGVDLGNMVLTSGQIPVNPATGEVPAD
FT                   IAAQARQSLDNVKAVVEASGLTVGDIVKMTVFVKDLNDFGTVNEVYGNFFDEHNVAHYP
FT                   ARSCVEVARLPKDVGIEIEAIAVRK"
FT                   /protein_id="YP_004187615.1"
FT   gene            complement(443424..443885)
FT                   /db_xref="GeneID:10165130"
FT                   /locus_tag="VVM_00754"
FT   CDS_pept        complement(443424..443885)
FT                   /locus_tag="VVM_00754"
FT                   /gene_family="HOG000113530" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartate carbamoyltransferase regulatory chain
FT                   PyrI"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155237"
FT                   /db_xref="GeneID:10165130"
FT                   /translation="MNKETKLQVEAIKNGTVIDHIPAQVGIKVLKLFDMHNSSQRVTIG
FT                   LNLPSSALGNKDLLKIENVFINEEQASKLALYAPHATVNQIEDYQVVKKLALELPEFVS
FT                   DVFECPNSNCITHNEPVASNFRVFEKKGDVRLKCKYCEKVFSREIVTER"
FT                   /protein_id="YP_004187616.1"
FT   gene            complement(443900..444829)
FT                   /db_xref="GeneID:10165131"
FT                   /locus_tag="VVM_00756"
FT   CDS_pept        complement(443900..444829)
FT                   /product="aspartate carbamoyltransferase"
FT                   /gene_family="HOG000022685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00756"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="GI:320155238"
FT                   /db_xref="GeneID:10165131"
FT                   /translation="MTNSLYKKHIISIPELSRAELELIVKTAGQLKAEPNPELIKNKVV
FT                   ASCFFEPSTRTRLSFETAIQRIGGDVIGFDDGGNTSLAKKGETLSDSVQVISNYVDAFV
FT                   MRHPQEGAARLASEFSNGVPVINAGDGANQHPTQTLLDLFTISETQDRLDNLNVAFVGD
FT                   LKYGRTVHSLTQALAKFNNIRFFFVAPDALAMPDYILEDLDEAGISYSLHTDMETVIPE
FT                   LDILYMTRVQKERFDESEYAHIKSAYILTAALLEGARENLKVLHPLPRVDEITTDVDKT
FT                   PHAYYFQQAGNGVYAREALLALVLNESL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187617.1"
FT   gene            complement(445089..446093)
FT                   /db_xref="GeneID:10165132"
FT                   /locus_tag="VVM_00758"
FT   CDS_pept        complement(445089..446093)
FT                   /product="ornithine carbamoyltransferase"
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00758"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="GI:320155239"
FT                   /db_xref="GeneID:10165132"
FT                   /translation="MAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLL
FT                   GKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDG
FT                   IQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYL
FT                   GDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAE
FT                   GVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHN
FT                   DETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187618.1"
FT   gene            complement(446229..447449)
FT                   /db_xref="GeneID:10165133"
FT                   /locus_tag="VVM_00760"
FT   CDS_pept        complement(446229..447449)
FT                   /product="arginine deiminase"
FT                   /gene_family="HOG000284536" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00760"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="GI:320155240"
FT                   /db_xref="GeneID:10165133"
FT                   /translation="MSKLYVGSEVGQLRRVLLNRPERALTHLTPSNCHELLFDDVLLVE
FT                   AAGKEHDAFADTLRQQGVEVLLLHDLMVDTLAVPEAKQWLLDVQISDFRYGPIFARDLR
FT                   RYLSEMDNEHLATILLGGLAYSELPIQSASMLPRMKQPLDFVIEPLPNHLFTRDTSCWV
FT                   YGGVSLNPMMKPARQRETNHLRAIYQWHPIFAGQDFIKYFGNEDLHYDNANIEGGDVLV
FT                   IGKGAVLIGMSERTTPQGVENLAANLFRHGQAKEVIAIELPKHRSCMHLDTVMTHMDVD
FT                   TFSVYPEIMRKDLHTWRLTPKGNGEMQVEALHNYLHAIERALGLNHLNIITTGGDSYEA
FT                   EREQWNDANNVLTVKPGVVIGYERNVYTNEKYDKAGIEVLTIPGNELGRGRGGARCMSC
FT                   PIERDDI"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187619.1"
FT   gene            447494..447610
FT                   /db_xref="GeneID:10165134"
FT                   /locus_tag="VVM_00761"
FT   CDS_pept        447494..447610
FT                   /locus_tag="VVM_00761"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155241"
FT                   /db_xref="GeneID:10165134"
FT                   /translation="MYKMQIIWLCLSPVLLVIFGFKLQSNRLFWMFILFCGV"
FT                   /protein_id="YP_004187620.1"
FT   gene            complement(447815..447985)
FT                   /db_xref="GeneID:10165135"
FT                   /locus_tag="VVM_00763"
FT   CDS_pept        complement(447815..447985)
FT                   /locus_tag="VVM_00763"
FT                   /gene_family="HOG000144800" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155242"
FT                   /db_xref="GeneID:10165135"
FT                   /translation="MDQFVAVKYGMDRLEKPPTKRHTTYLLLLNLKMGRHHNAKQHIFN
FT                   NSANLLIFRTS"
FT                   /protein_id="YP_004187621.1"
FT   gene            448014..448436
FT                   /db_xref="GeneID:10165136"
FT                   /locus_tag="VVM_00764"
FT   CDS_pept        448014..448436
FT                   /locus_tag="VVM_00764"
FT                   /gene_family="HOG000282487" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease E inhibitor RraB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155243"
FT                   /db_xref="GeneID:10165136"
FT                   /translation="MSHEDEYLSVEELIEIQKEETRDIIAALLEDGSDPEALYEIEHHL
FT                   FAEDFDTLEKAVVEAFKMGFEVLEAEETEDEDGNKLLCCDATMQSTLDAETIDAQVEKL
FT                   VHLAEKYDIIYDGWGTYYEGEDALYQDDDEDEDFED"
FT                   /protein_id="YP_004187622.1"
FT   gene            448592..449368
FT                   /db_xref="GeneID:10165137"
FT                   /locus_tag="VVM_00765"
FT   CDS_pept        448592..449368
FT                   /locus_tag="VVM_00765"
FT                   /gene_family="HOG000218152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-galactosidase/beta-glucuronidase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155244"
FT                   /db_xref="GeneID:10165137"
FT                   /translation="MQLSLTGYWQLSPLTDLSIPQDDLCFPAPLSEILPASLSEQAIAA
FT                   QEWHLMHDIEVDDSLLTYPAVEMVLAGVDYHAEVRLNGIAVFDCDKSQFEYRKDIRPYM
FT                   QHGRNRFEILFLEEEEELLFEEDRLALCELGANAYQPSDERMGIWREPYLQFIRHVRLD
FT                   RVTTEQIWHHGGGCEFKVDLYYQTYASGLISASVKFDGRRYNIPLDLRSDHASALFQID
FT                   APSPATPYQLEIELDGQTLRAPVVLDEAISVTHFVR"
FT                   /protein_id="YP_004187623.1"
FT   gene            complement(449374..449868)
FT                   /db_xref="GeneID:10165138"
FT                   /locus_tag="VVM_00766"
FT   CDS_pept        complement(449374..449868)
FT                   /product="Acetyltransferase YjgM"
FT                   /gene_family="HOG000078529" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00766"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="GI:320155245"
FT                   /db_xref="GeneID:10165138"
FT                   /translation="MSEKMDFVLRPITVEDNASIANVIRQVSAEYGLTADKGYSVADPT
FT                   LDDLFSIYSQGNAAYWVVEHQGKIVGGGGFSALAGVEDVCELQKMYFLPICRGQGLAKQ
FT                   IVSLSRSTAKKMGYQRCYLETTACLKEAIALYEKLGFEHLQAPLGQTGHDACEVVMICH
FT                   L"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187624.1"
FT   gene            complement(449915..450379)
FT                   /db_xref="GeneID:10165139"
FT                   /locus_tag="VVM_00768"
FT   CDS_pept        complement(449915..450379)
FT                   /locus_tag="VVM_00768"
FT                   /gene_family="HOG000282879" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155246"
FT                   /db_xref="GeneID:10165139"
FT                   /translation="MILSPVAKRAKRIMRDKIMKKTITFAALHFTVAFTVAYILTGDIL
FT                   IGSLIAMIEPAVNTIAFYFHEKAWSTVPALKARQWMTKIKTASFATVHFSVAFSVVYLL
FT                   TGDAFVGGVMALLEPSINTVVYYFHEKVWLRHSAAKQTLDSHSFCLHPTV"
FT                   /protein_id="YP_004187625.1"
FT   gene            450599..451771
FT                   /db_xref="GeneID:10165140"
FT                   /locus_tag="VVM_00770"
FT   CDS_pept        450599..451771
FT                   /locus_tag="VVM_00770"
FT                   /gene_family="HOG000133184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="inner membrane protein YjgN"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155247"
FT                   /db_xref="GeneID:10165140"
FT                   /translation="MDTKHITNSIQFKGQGGEFFGIWIVNILLSVITLGIYSAWAKVRT
FT                   KRYFYGNTFIAGDNFEYHAQPMQLLKGRLVALALVVIWVVANSFFPLASLVLLALFYVA
FT                   LPWLLWSNARFDSAMTSYRNVHFAFNGSLKEAYMSILGRGLASLLIIAIYIAIVVASAN
FT                   ASAMVATLLGFGTLVLMFVLYAWVVAGIHQYFASGYQYGDWKFVAKIETGFFLKTYCKA
FT                   MLIGFLTAVAFMIVMGTFVLGTDIMNIFAGEVDLLEGKGDFAYVVVTYLVTITMSLGIT
FT                   AYTTTRIRNYVFSRLTATAEAQSETEFRFASTFGVWDYMSLIVTNFLLQVITLGLARPW
FT                   VMVRTSRYVASHTGVIGDMDTLKATDQDSAVKNAISDEVAQAFDLGLSIS"
FT                   /protein_id="YP_004187626.1"
FT   gene            451771..452766
FT                   /db_xref="GeneID:10165141"
FT                   /locus_tag="VVM_00772"
FT   CDS_pept        451771..452766
FT                   /locus_tag="VVM_00772"
FT                   /gene_family="HOG000005238" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155248"
FT                   /db_xref="GeneID:10165141"
FT                   /translation="MRIFGTAFPPRSSERCEAEIDTSQPHLLALHVNGEIFSADYHYLH
FT                   ISEPVGRLPVRISFPNGWVFVTEPSTALSKSLGFHKKQSFVDRMEGNIPAWILSAMVCL
FT                   AVIAGCYYYLLPWGSQKIAESLPDSLSIAVGEQVLDSLDLQLEPSQLPEEQQSAIRQRV
FT                   QQFAQVLPELPYDIKVEFRSMPEGANAFALPGGTIVLLDELVALAQTQQQLDSIILHEM
FT                   GHVHHRHMMKQVVHSTILSVAVSLITGESSGIVDNLAGVGVFIVSNGQSREAETQADLY
FT                   AKKAMKQIYGTSEPLAEMFELFQTQEMMDIPEWFSSHPNFSERIQAAREE"
FT                   /protein_id="YP_004187627.1"
FT   gene            complement(452863..455718)
FT                   /db_xref="GeneID:10165142"
FT                   /locus_tag="VVM_00777"
FT   CDS_pept        complement(452863..455718)
FT                   /product="valyl-tRNA synthetase"
FT                   /gene_family="HOG000020094" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00777"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="GI:320155249"
FT                   /db_xref="GeneID:10165142"
FT                   /translation="MEKTYNPTSIEQDLYKTWEEQGYFKPHGDTSKESYSIMIPPPNVT
FT                   GSLHMGHAFQDTIMDTLIRCERMKGKNTLWQVGTDHAGIATQMVVERKIAAEEGKTKHD
FT                   YGREAFIDKIWEWKGESGGTITKQLRRLGASVDWDRERFTMDDGLSNAVQEVFVRLYED
FT                   DLIYRGKRLVNWDPKLHTAISDLEVENKDTKGHMWHFRYPLADGVKTADGKDYIVVATT
FT                   RPETMLGDTGVAVNPEDPRYQDLIGKDIILPIVDRRIPIVGDEHADMEKGTGCVKITPA
FT                   HDFNDYEVGKRHQLPMINILTFDANIRDAAEVFTTNGEPSDAYGTELPAKYHGMERFAA
FT                   RKAIVAEFDELGLLEEVKDHDLQVPYGDRGGVVIEPMLTDQWYVRTAPLAKTAVEAVEN
FT                   GDIQFVPKQYENMYFSWMRDVQDWCISRQLWWGHRIPAWYDNQGNVYVGRSEEEVRQNH
FT                   NLESVIELHQDEDVLDTWFSSALWTFGTQGWPEQTDDLKVFHPSDVLVTGFDIIFFWVA
FT                   RMIMMTMHFVKDENGKPQVPFKTVYVTGLIRDENGDKMSKSKGNVLDPIDMIDGIDLES
FT                   LVEKRTGNMMQPQLAAKIEKNTRKTFENGIEAYGTDALRFTLAAMASTGRDINWDMKRL
FT                   EGYRNFCNKLWNASRYVMMNTEEQDCGFGAGEIEYSLADKWIESQFELAAKAFNNHIDN
FT                   YRLDMAANTLYEFIWNQFCDWYLELTKPVLWKGTEAQQRGTRRTLITVLEKTLRLAHPV
FT                   IPYITETIWQSIKPLVDGVEGETIMLQSLPQYDEANFNQEALDDIEWVKAFITSIRNLR
FT                   AEYDINPGKPLEVMLKADEKDAARLEANKQVLMSLAKLESVRVLAAGEETPACATALVA
FT                   KSELMIPMAGLIDKDAELARLDKEVAKTQGEIKRIEGKLGNEGFVAKAPEAVIAKEREK
FT                   LEGYQETLAKLEEQKATIAAL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187628.1"
FT   gene            complement(455804..456253)
FT                   /db_xref="GeneID:10165143"
FT                   /locus_tag="VVM_00778"
FT   CDS_pept        complement(455804..456253)
FT                   /product="DNA polymerase III subunit chi"
FT                   /gene_family="HOG000263567" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00778"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GI:320155250"
FT                   /db_xref="GeneID:10165143"
FT                   /translation="MQRATFYIVREHTPQATPEGFAHYVVFLAHHFAKQGAKVYLNGES
FT                   KRHAEQIAEYFWQVEPAQFVAHNLVGEGPKYATNIEIGHEGVKPSWNRQLVINLAKNET
FT                   TFANKFAEVVDFVPCEEKAKQLARERYKIYRQAGYQLQTIEIEHN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187629.1"
FT   gene            complement(456317..457825)
FT                   /db_xref="GeneID:10165144"
FT                   /locus_tag="VVM_00780"
FT   CDS_pept        complement(456317..457825)
FT                   /product="cytosol aminopeptidase PepA"
FT                   /gene_family="HOG000243132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00780"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="GI:320155251"
FT                   /db_xref="GeneID:10165144"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPVAEQLDKISDGYISS
FT                   LLRRGDLEGKPGQMLLLHQVPGVLSERVLLVGCGKERELGERQYKEIIQKTINTLNETG
FT                   SMEAVCFLTELHVKGRDTYWKVRQAVEATKDGLYTFDQFKSVKPETRRPLRKLVFNVPT
FT                   RRELNLGEKAITHGLAIASGVKACKDLGNMPPNIANPAYLASQARRLADDYETITTKII
FT                   GEQEMEKLGMSSYLAVGRGSKNESMMSIIEYKGHPDSEAKPIVLVGKGLTFDSGGISLK
FT                   PGEGMDEMKYDMCGAASVFGTMKALAKLNLPVNVIGVLAGCENMPGSNAYRPGDILTTM
FT                   SGQTVEVLNTDAEGRLVLCDALTYVERFEPDCVVDVATLTGACVIALGHHITGVLSNHN
FT                   PLAHELVNASEQSSDRAWRLPMADEYHEQLKSPFADMANIGGRPGGTITAACFLSKFAK
FT                   KYNWAHLDIAGTAWKSGAAKGSTGRPVSMLVQFLLNRSGQETEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187630.1"
FT   gene            458018..459118
FT                   /db_xref="GeneID:10165145"
FT                   /locus_tag="VVM_00781"
FT   CDS_pept        458018..459118
FT                   /locus_tag="VVM_00781"
FT                   /gene_family="HOG000283246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155252"
FT                   /db_xref="GeneID:10165145"
FT                   /translation="MIIVRYLIRETLKSQFAIFFVLFLVFLSQQFISVLADASDGDIPA
FT                   SLIMSIVALNMPSMGLLMLPLSLYIGILITFGRLYAESEIVVMNATGIGNKFLIQAALY
FT                   LAVITSGVAAFNSLWLSPWSMDRVEQLTEQVAAENSVDLLKKGQFQFTPDRSSVVFIDD
FT                   IKDKQLSNVFVAQLMPRDSILPSVMFANGGEVKELSDGRQIISMKQGTRYEGVPTRVEY
FT                   MITEFEQYDGLIGQRSVKQRGRDWDAIPTLELIGNPDPEAQAELQWRVSLFVCIPLLTM
FT                   LVIPLSAVNPRQGRFAKMGPAILIYLAYFLSISATKSALEEGDISASIGMWPINGLLLL
FT                   VAIMANFMDSIAVRRIKDNFRKKRLA"
FT                   /protein_id="YP_004187631.1"
FT   gene            459122..460195
FT                   /db_xref="GeneID:10165146"
FT                   /locus_tag="VVM_00783"
FT   CDS_pept        459122..460195
FT                   /locus_tag="VVM_00783"
FT                   /gene_family="HOG000263593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155253"
FT                   /db_xref="GeneID:10165146"
FT                   /translation="MFKILDLYIGRTIVATTSLVLVTFVGLSGIIKYVEQLRKVGKGTY
FT                   DLLHALYFVLLSIPRDIEMFFPMAALLGALIGLGMLASSSELVVMQAAGFSKLDIGVSV
FT                   LKTAVPLMLVVMALGQWGAPDAQKMARDLRSFALSGGSIVSVRSGVWAKDANDFIFIGK
FT                   VDEDKLYGLNMWKFDQNKKLQSVIFAEEVDYQQDNRWLMRYVQITDMQDEKVISKHSLE
FT                   QMEWETSLAPDKLAVVTVKPEELSLSGLYDYVTYLKASEQDASRYELAFWRKLTQPISI
FT                   AVMMLMALSFVFGPLRSVTMGARVISGVIAGFAFYISSEFFGPLTLVYGIPPVFGAVAP
FT                   SIVFFIVAVMLLNRKLQ"
FT                   /protein_id="YP_004187632.1"
FT   gene            complement(460297..460773)
FT                   /db_xref="GeneID:10165147"
FT                   /locus_tag="VVM_00786"
FT   CDS_pept        complement(460297..460773)
FT                   /locus_tag="VVM_00786"
FT                   /gene_family="HOG000262647" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transmembrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155254"
FT                   /db_xref="GeneID:10165147"
FT                   /translation="MMTTTTLPPAGLFRRLAALFYDALIIIALEMMAAGVVMAILFALN
FT                   GMGLISYGEYVDAADLLSRHPIISPLFTFYLAAVWIYFLVYFWTRAGQTLGMRAWKIQV
FT                   RNHDGSMITPTQALIRIATSAFGLANFTVPIDPKKRGFHDIWAKTEVVLLPKVR"
FT                   /protein_id="YP_004187633.1"
FT   gene            460962..461046
FT                   /db_xref="GeneID:10165148"
FT                   /locus_tag="VVM_t00036"
FT   tRNA            460962..461046
FT                   /note="anticodon CAA"
FT                   /db_xref="GeneID:10165148"
FT                   /locus_tag="VVM_t00036"
FT                   /product="tRNA-Leu"
FT   gene            complement(461324..462607)
FT                   /db_xref="GeneID:10165149"
FT                   /locus_tag="VVM_00789"
FT   CDS_pept        complement(461324..462607)
FT                   /locus_tag="VVM_00789"
FT                   /gene_family="HOG000218381" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deacetylase DA1"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155255"
FT                   /db_xref="GeneID:10165149"
FT                   /translation="MKLKKLALLTAASIVISGSALAQTSPKGTIYLTFDDGPINASLDV
FT                   IQVLNEGGIKATFYFNAWHLDGIGDENEDRALEALKLALDSGHIVGNHSYDHMIHNCVE
FT                   EFGPNSGAECNATGNHQINSYQDPVYDAATFEQNLAVLERYFPSISSYPNYKGDELARL
FT                   PYTNGWRVTKSFKADGLCATSDNLKPWEPGYVCDPDNPSNSVKASIEVQNILANKGYQT
FT                   HGWDVDWAPENWGIAMPANSLTEAVPFLSYVDAALNSCAPTTINPINSKAQQFPCGTPL
FT                   HADKVIVLTHEFLFEDGKRGMGATQNLPKLAEFIRIAKEAGYVFDTMDNYTPEWQVNTT
FT                   YSTGAYVLHQGTVYKAVTSHTAQADWAPSATSSLWTNADPATNWMLNVEYAQGDVVSYK
FT                   GVRYLVNVPHVSQVTWTPDTQNTLFTAL"
FT                   /protein_id="YP_004187634.1"
FT   gene            462920..463180
FT                   /db_xref="GeneID:10165150"
FT                   /locus_tag="VVM_00790"
FT   CDS_pept        462920..463180
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /gene_family="HOG000224223" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00790"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:320155256"
FT                   /db_xref="GeneID:10165150"
FT                   /translation="MLVKKMEQAAASKGIECKIDALSVNAFEEAIKEYDVCLLGPQVRF
FT                   QLESLQKTAQEHGKNIAAISPQAYGMMKGDEVLQQALDLIN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187635.1"
FT   gene            463269..464600
FT                   /db_xref="GeneID:10165151"
FT                   /locus_tag="VVM_00792"
FT   CDS_pept        463269..464600
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /gene_family="HOG000224102" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00792"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:320155257"
FT                   /db_xref="GeneID:10165151"
FT                   /translation="MKLYDAIIGVVEKYIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVG
FT                   SFILIFAFPPFSEDTTNTFGRVWLDFATKHFDTIMMPFNMSMGIMTIFVSLGVAYSLAK
FT                   AYKMDGITSAVLSLMCFLLVAAPAKDGALSMAHMGGTGIFTAVMCAFFAVELYRFMKKH
FT                   NITIRMPEQVPPAIARSFEVLLPVLAIFITLYPLSLFVQAQYDMLIPDAVMAMFKPLIS
FT                   ASNTLPAIIGALLVCQLLWFAGIHGAAIVVGLLSPIFLTNISANIDAFVAGQPVPNVFT
FT                   QPFWDFYIFIGGSGATLALVMLMSFSRSAHLKSIGRMSAVPGLFQINEPVIFGSPVVMN
FT                   PILFLPFVFAPVINATIAYFAVQFGFVGMGVATTPWTTPAIIGASWGSGWTFTPILLVV
FT                   GLLILDLFIYLPFFKMFEKQILEQEQPNTESQEQPQASGQGVTA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187636.1"
FT   gene            464654..464962
FT                   /db_xref="GeneID:10165152"
FT                   /locus_tag="VVM_00794"
FT   CDS_pept        464654..464962
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /gene_family="HOG000224338" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00794"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GI:320155258"
FT                   /db_xref="GeneID:10165152"
FT                   /translation="MEQELVVMEIICNAGEARSLCFEALKLSRQKEFVLADEKLAQAKE
FT                   CLNKSHLVQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAHELAVEMVELHKQLAG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187637.1"
FT   gene            464972..466294
FT                   /db_xref="GeneID:10165153"
FT                   /locus_tag="VVM_00795"
FT   CDS_pept        464972..466294
FT                   /product="6-phospho-beta-glucosidase"
FT                   /gene_family="HOG000239811" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00795"
FT                   /EC_number="3.2.1.86"
FT                   /db_xref="GI:320155259"
FT                   /db_xref="GeneID:10165153"
FT                   /translation="MSRKGLKLAIIGGGSSYTPELVEGVLKRAAFLPVEQIHFVDIEAG
FT                   AEKLEIIRQLSQRMVDKVCAKIEIKAGFDRREAILGADFVMTQFRVGGLAARASDERIP
FT                   LKYDVIGQETTGPGGFAKALRTIPVILDICRDIEELAPEAWMLNFTNPAGLVSEAVSKY
FT                   SKVKSIGLCNVPVSMQMMIAEMMDCEPKELQLEFAGLNHLVWVHNAWLDGKNITETVLE
FT                   KVGDGANFSMKNIWEEPWDPTFLKALGAIPCPYHRYFYQTDAMLAEEKQSAREKGTRAE
FT                   QVMETEKALFQLYQDPGLDHKPEELEQRGGAYYSDASLNLVDAIYNNRNSIHVVNVLNN
FT                   GAINTLPDNAVIECSSVVGSWGAKPIAIGTLSPKVSGLLHQVKAYEQLAIEAAVHGDYH
FT                   QALMALANNPLVLDIGRAKLILDDILQENAEYLPQFKLTSL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187638.1"
FT   gene            466314..467072
FT                   /db_xref="GeneID:10165154"
FT                   /locus_tag="VVM_00797"
FT   CDS_pept        466314..467072
FT                   /locus_tag="VVM_00797"
FT                   /gene_family="HOG000225034" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cellobiose phosphotransferase system YdjC-like
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155260"
FT                   /db_xref="GeneID:10165154"
FT                   /translation="MKVIFNADDFGLTRGVNDGIVHAHLDGVVRSTTMMVGMPAEAHAV
FT                   ELANHLPELKVGLHLRFTAGRPLTEGQNLVGRDGDFTPYGQFWHRRDYDLIAIHNEAVA
FT                   QVEYFLALGLNLSHIDSHHHAHTHPQFEPVIYDIARTYQVPLRSTGLAGEEEFGCRYHF
FT                   TDHFYDKRVGHDSLIQHLLKLKEHYDVVEVMCHPAIVDTALEACSGYAKQRELELAILT
FT                   SDELKLSLRKHDIEVTDYSELIFAPLHSCV"
FT                   /protein_id="YP_004187639.1"
FT   gene            467168..468163
FT                   /db_xref="GeneID:10165155"
FT                   /locus_tag="VVM_00800"
FT   CDS_pept        467168..468163
FT                   /locus_tag="VVM_00800"
FT                   /gene_family="HOG000220179" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155261"
FT                   /db_xref="GeneID:10165155"
FT                   /translation="MARIKDVAELAGVNRSTVSRIINGEGKFKEETKKKVEWAMAQLNY
FT                   RPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMDRVQTELDQHNKFLITAQGHHSAQGE
FT                   RDAIQRFHDLRCDGYVLHSRYLSDDDLRELAQQTTPFVLLDRYVEGLEERCITFDHRAA
FT                   SLIAVNHLIHQGHRQIGCITGPSQRYNSQLRKQGYLDAMKQIENQGGRALCIEGDYGRK
FT                   SGYRAMQILLEREPTLTAVFSCSEEMTIGALQYLHEKKIAVPEQISIVSFDSVDLCESL
FT                   YPTVTAVHFPISEMAEVAVQTLIHLIKDQPLTPIDGFQPILKRRNADRTI"
FT                   /protein_id="YP_004187640.1"
FT   gene            468233..468640
FT                   /db_xref="GeneID:10165156"
FT                   /locus_tag="VVM_00801"
FT   CDS_pept        468233..468640
FT                   /locus_tag="VVM_00801"
FT                   /gene_family="HOG000232027" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PhnB protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155262"
FT                   /db_xref="GeneID:10165156"
FT                   /translation="MFQLTPYLYFAGRCAEALEFYHHCFGGRVTNIRLFKDAPQYIESV
FT                   EPDWIMHAEFEVNGIHLMLSDGVVAKELAGNNMALSLCVDDLDIQLKLFDQLADGGRVM
FT                   MPLTDTFIGSRLGKVEDKFGIRWMIHCKFTN"
FT                   /protein_id="YP_004187641.1"
FT   gene            468855..469991
FT                   /db_xref="GeneID:10165157"
FT                   /locus_tag="VVM_00802"
FT   CDS_pept        468855..469991
FT                   /locus_tag="VVM_00802"
FT                   /gene_family="HOG000271002" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HD-GYP domain"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155263"
FT                   /db_xref="GeneID:10165157"
FT                   /translation="MEMIRHLGVKWVFLNVNQSDTQPLPANQQNLSESEQQSEKLDGET
FT                   KKLWDEKQKRIEKLSSYRRRVIQCEKEFERSLARMRSVMTKIRNRPTDAVDEAKQLIDD
FT                   IVEKLMSDDNVTLHLMNGKSEFEDIYFHSLNVSVIAMMIGRAKGFSAAQLKELSFAALF
FT                   HDIGKIKIPSAIVRKQTPLTDPEFNYLKLHTKYGLDLANTVDGFPDSAKKVIAQHHELN
FT                   DGSGYPDGLKENEIDELTQVIAVANAFDNLCHHNIPAEQKIPYTALSHLYKNCKHLYSA
FT                   ENLNILIKFMGVFPPGTVVQLSNNMVGLVISVNAAHLLYPNVLMYDPAVPRTQAPIIDL
FT                   ADKDIKIVSAIHPNKLPDKVREYLNPRSRISYFFDSDD"
FT                   /protein_id="YP_004187642.1"
FT   gene            470461..471997
FT                   /db_xref="GeneID:10165158"
FT                   /locus_tag="VVM_r00016"
FT   rRNA            470461..471997
FT                   /db_xref="GeneID:10165158"
FT                   /locus_tag="VVM_r00016"
FT                   /product="16S ribosomal RNA"
FT   gene            472060..472136
FT                   /db_xref="GeneID:10165159"
FT                   /locus_tag="VVM_t00037"
FT   tRNA            472060..472136
FT                   /note="anticodon GAT"
FT                   /db_xref="GeneID:10165159"
FT                   /locus_tag="VVM_t00037"
FT                   /product="tRNA-Ile"
FT   gene            472147..472222
FT                   /db_xref="GeneID:10165160"
FT                   /locus_tag="VVM_t00038"
FT   tRNA            472147..472222
FT                   /note="anticodon TGC"
FT                   /db_xref="GeneID:10165160"
FT                   /locus_tag="VVM_t00038"
FT                   /product="tRNA-Ala"
FT   gene            472501..475387
FT                   /db_xref="GeneID:10165161"
FT                   /locus_tag="VVM_r00017"
FT   rRNA            472501..475387
FT                   /db_xref="GeneID:10165161"
FT                   /locus_tag="VVM_r00017"
FT                   /product="23S ribosomal RNA"
FT   gene            475509..475628
FT                   /db_xref="GeneID:10165162"
FT                   /locus_tag="VVM_r00018"
FT   rRNA            475509..475628
FT                   /db_xref="GeneID:10165162"
FT                   /locus_tag="VVM_r00018"
FT                   /product="5S ribosomal RNA"
FT   gene            475676..475751
FT                   /db_xref="GeneID:10165163"
FT                   /locus_tag="VVM_t00039"
FT   tRNA            475676..475751
FT                   /note="anticodon GGT"
FT                   /db_xref="GeneID:10165163"
FT                   /locus_tag="VVM_t00039"
FT                   /product="tRNA-Thr"
FT   gene            475758..475877
FT                   /db_xref="GeneID:10165164"
FT                   /locus_tag="VVM_r00019"
FT   rRNA            475758..475877
FT                   /db_xref="GeneID:10165164"
FT                   /locus_tag="VVM_r00019"
FT                   /product="5S ribosomal RNA"
FT   gene            475939..476015
FT                   /db_xref="GeneID:10165165"
FT                   /locus_tag="VVM_t00040"
FT   tRNA            475939..476015
FT                   /note="anticodon GTC"
FT                   /db_xref="GeneID:10165165"
FT                   /locus_tag="VVM_t00040"
FT                   /product="tRNA-Asp"
FT   gene            complement(476350..477081)
FT                   /db_xref="GeneID:10165166"
FT                   /locus_tag="VVM_00813"
FT   CDS_pept        complement(476350..477081)
FT                   /locus_tag="VVM_00813"
FT                   /gene_family="HOG000219833" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155264"
FT                   /db_xref="GeneID:10165166"
FT                   /translation="MRSEILYEEGSHRWLMFGRDPHKPDKIIDTNQYMLVHNGQAMLLD
FT                   PGGIELFSAMLSSVVKEISLEQITHLFASHQDPDIISSLGLWDKTLPSATLHSPWLWEG
FT                   FIRHFGMESITFAPIKDQGGTVSLAGLDIQFIPAHYMHSSGNFSVYDPEAKILMSGDIG
FT                   AALDRIDAPLFVEDFGSHIEKMAYFHQRWMPSEKAKSAWIDKVSQLDIEMMCPQHGGIF
FT                   RGDDVPRFLDWLDKLEVGIAV"
FT                   /protein_id="YP_004187643.1"
FT   gene            complement(477099..477710)
FT                   /db_xref="GeneID:10165167"
FT                   /locus_tag="VVM_00815"
FT   CDS_pept        complement(477099..477710)
FT                   /locus_tag="VVM_00815"
FT                   /gene_family="HOG000144801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155265"
FT                   /db_xref="GeneID:10165167"
FT                   /translation="MRDTIERKPLFVIAAEVSAELNRGVKIAKQLQLVASNARALALRA
FT                   GESAAGFRPVTDSIDELVLLTFHSSNTINLQAQQLSQIATERTRAQFVLKQLNRVEQSS
FT                   KEAIFLSSLNQAKQRANEDYQQLNTLFTLKAKSLKEALQELYDQLRIAQIISTMLSVEA
FT                   SKVDERYRIQLNAIADSVTEFSDAIRHHVSLSLKLFSLFL"
FT                   /protein_id="YP_004187644.1"
FT   gene            complement(477875..477950)
FT                   /db_xref="GeneID:10165168"
FT                   /locus_tag="VVM_t00041"
FT   tRNA            complement(477875..477950)
FT                   /note="anticodon GTT"
FT                   /db_xref="GeneID:10165168"
FT                   /locus_tag="VVM_t00041"
FT                   /product="tRNA-Asn"
FT   gene            complement(477991..478066)
FT                   /db_xref="GeneID:10165169"
FT                   /locus_tag="VVM_t00042"
FT   tRNA            complement(477991..478066)
FT                   /note="anticodon TGT"
FT                   /db_xref="GeneID:10165169"
FT                   /locus_tag="VVM_t00042"
FT                   /product="tRNA-Thr"
FT   gene            complement(478102..478177)
FT                   /db_xref="GeneID:10165170"
FT                   /locus_tag="VVM_t00043"
FT   tRNA            complement(478102..478177)
FT                   /note="anticodon GTT"
FT                   /db_xref="GeneID:10165170"
FT                   /locus_tag="VVM_t00043"
FT                   /product="tRNA-Asn"
FT   gene            complement(478217..478292)
FT                   /db_xref="GeneID:10165171"
FT                   /locus_tag="VVM_t00044"
FT   tRNA            complement(478217..478292)
FT                   /note="anticodon GAA"
FT                   /db_xref="GeneID:10165171"
FT                   /locus_tag="VVM_t00044"
FT                   /product="tRNA-Phe"
FT   gene            complement(478300..478375)
FT                   /db_xref="GeneID:10165172"
FT                   /locus_tag="VVM_t00045"
FT   tRNA            complement(478300..478375)
FT                   /note="anticodon TGT"
FT                   /db_xref="GeneID:10165172"
FT                   /locus_tag="VVM_t00045"
FT                   /product="tRNA-Thr"
FT   gene            complement(478434..478509)
FT                   /db_xref="GeneID:10165173"
FT                   /locus_tag="VVM_t00046"
FT   tRNA            complement(478434..478509)
FT                   /note="anticodon GAA"
FT                   /db_xref="GeneID:10165173"
FT                   /locus_tag="VVM_t00046"
FT                   /product="tRNA-Phe"
FT   gene            complement(478743..480368)
FT                   /db_xref="GeneID:10165174"
FT                   /locus_tag="VVM_00822"
FT   CDS_pept        complement(478743..480368)
FT                   /locus_tag="VVM_00822"
FT                   /gene_family="HOG000274339" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N-acetylglucosamine regulated methyl-accepting
FT                   chemotaxis protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155266"
FT                   /db_xref="GeneID:10165174"
FT                   /translation="MKLKTQAYLLSGIILIALLALTATGLWTLRVASNLDNKARVTELF
FT                   RSAYSILTEVEKMAVEGKMSEPEAKALATRLLRNNIYKDNEYVYVADEKMIFIATPLDP
FT                   QLHGTSFHDFRDGNGNSVGQLILDVLGRKTGQLVEYTWTQKLADGSIEEKLSIAERTPH
FT                   WGWVVGTGIGFNEVNARFWSTAQWQLVLCLVIAGTILGGLIVSINKMLNLLGGEPNDVR
FT                   NAVQDVAKGRIQTSFDNKAPQGSIYQAVQEMSLSLAEMISNLERSMHALRDELASVESR
FT                   SDTISNLTATQQQSTAMIATAMTEMASSANHVADSASDTANNTDEADKQSKHTQVLIHN
FT                   TVSNIQGLASQLGTASQAVADLDKDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGE
FT                   QGRGFAVVADEVRNLAGRTQSSTKEIQLMINNLQQGSRNAIQTMEICAETSQSTVVESQ
FT                   TASEALQQIVQALESISTMSQQIATAAAEQTQVSDDIAQRINMIEDSGNQLTSVVTESH
FT                   NSTRSLATLANQLENWVNKFSVKH"
FT                   /protein_id="YP_004187645.1"
FT   gene            complement(480603..480678)
FT                   /db_xref="GeneID:10165175"
FT                   /locus_tag="VVM_t00047"
FT   tRNA            complement(480603..480678)
FT                   /note="anticodon GTT"
FT                   /db_xref="GeneID:10165175"
FT                   /locus_tag="VVM_t00047"
FT                   /product="tRNA-Asn"
FT   gene            complement(480693..480768)
FT                   /db_xref="GeneID:10165176"
FT                   /locus_tag="VVM_t00048"
FT   tRNA            complement(480693..480768)
FT                   /note="anticodon TGT"
FT                   /db_xref="GeneID:10165176"
FT                   /locus_tag="VVM_t00048"
FT                   /product="tRNA-Thr"
FT   gene            complement(480823..480898)
FT                   /db_xref="GeneID:10165177"
FT                   /locus_tag="VVM_t00049"
FT   tRNA            complement(480823..480898)
FT                   /note="anticodon GAA"
FT                   /db_xref="GeneID:10165177"
FT                   /locus_tag="VVM_t00049"
FT                   /product="tRNA-Phe"
FT   gene            complement(480999..482138)
FT                   /db_xref="GeneID:10165178"
FT                   /locus_tag="VVM_00825"
FT   CDS_pept        complement(480999..482138)
FT                   /product="membrane-bound lytic murein transglycosylase C"
FT                   /gene_family="HOG000283572" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00825"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="GI:320155267"
FT                   /db_xref="GeneID:10165178"
FT                   /translation="MKKFGYFLAALLLTGCSREFIENIYDVNYQPTNRFAKNLAELPGQ
FT                   FEKDTAALDALINSFSGNIEKRWGSREIKMAGKSNYVKYIDNYLSRADVNFSNGTILIE
FT                   TVSPTEPKQHLKNAIITTLLTPDDPANVDLFSSKEIRLEGQPFLYNQVLDQDKQAIQWS
FT                   WRANRFADYLIANKLKTRTVDFKKAYYVEIPMVADHVDKRSYKYADIVRRASRKYDIPE
FT                   DLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFNLVKNRSGEPSPEYLFNPEN
FT                   NIDTGTAYFYLLKNRYLKEVNHPTSLEYSMISAYNGGTGGVLNTFNRNDRKRAMRDLNA
FT                   LQPNQVYWALTKKHPNAEARRYLEKVTKFKQDFNQGHSL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187646.1"
FT   gene            complement(482218..482490)
FT                   /db_xref="GeneID:10165179"
FT                   /locus_tag="VVM_00826"
FT   CDS_pept        complement(482218..482490)
FT                   /locus_tag="VVM_00826"
FT                   /gene_family="HOG000137239" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative Fe(2+)-trafficking protein YggX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155268"
FT                   /db_xref="GeneID:10165179"
FT                   /translation="MSRTVFCARLNKEADGLDFQLYPGELGKRIFDNISKEAWGQWQHK
FT                   QTMLINEKKLNMMDPEHRKLLETEMVNFLFEGKEVHIEGYTPPSK"
FT                   /protein_id="YP_004187647.1"
FT   gene            complement(482512..483564)
FT                   /db_xref="GeneID:10165180"
FT                   /locus_tag="VVM_00828"
FT   CDS_pept        complement(482512..483564)
FT                   /product="A/G-specific adenine glycosylase"
FT                   /gene_family="HOG000028744" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00828"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="GI:320155269"
FT                   /db_xref="GeneID:10165180"
FT                   /translation="MTPFASAILKWYDAYGRKNLPWQHNKSAYSVWLSEIMLQQTQVAT
FT                   VIPYYQRFLQRFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAKMVAEQYHGEFPL
FT                   ELEQMNALPGIGRSTAAAVLSSVHKQPHAILDGNVKRTLSRAFAVEGWPGQKTVENQLW
FT                   QLAEAHTPNTDVDKYNQAMMDMGAMVCTRSKPKCTLCPVAELCQANKQGNPLDYPGKKP
FT                   KKEKPVKETWFAMLHYNNQVWLEQRPQSGIWGGLFCFPQNEHAQLEALLEKRGIKEGDI
FT                   RTQKTLIAFRHTFSHYHLDITPILLDLSKQPDMVMEASNGLWYNLANPEEVGLAAPVKQ
FT                   LLESLPHELR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187648.1"
FT   gene            483734..484453
FT                   /db_xref="GeneID:10165181"
FT                   /locus_tag="VVM_00829"
FT   CDS_pept        483734..484453
FT                   /product="tRNA (guanine46-N7-)-methyltransferase"
FT                   /gene_family="HOG000073968" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00829"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="GI:320155270"
FT                   /db_xref="GeneID:10165181"
FT                   /translation="MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQENAMKECWPTMG
FT                   IDYQKQLLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFFGIEVHSPGVGACLS
FT                   DAREAGITNLRVMCHDAVEVFEHMIPNDSLATLQLFFPDPWHKKRHHKRRIVQLEFAEM
FT                   VRQKLIPNEGIFHMATDWENYAEHMIEIMNQAPGYRNIAEAGDYIPRPEERPLTKFEAR
FT                   GHRLGHGVWDIKFKRVS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187649.1"
FT   gene            484580..485500
FT                   /db_xref="GeneID:10165182"
FT                   /locus_tag="VVM_00832"
FT   CDS_pept        484580..485500
FT                   /product="glutaminase"
FT                   /gene_family="HOG000216890" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00832"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="GI:320155271"
FT                   /db_xref="GeneID:10165182"
FT                   /translation="MKPTKELLNEILHEVRPLIGRGKVANYIPALARVPAHKLAIAVYT
FT                   NQGEVIKAGDADEAFSIQSISKALSLTLAMGLYQPDEIWRRVGKEPSGQAFNSLIQLEM
FT                   EQGIPRNPFINAGAIVVADLLASRLSAPRQRLLEFVRQLSGETHICYDKVVAASEMMHS
FT                   DRNAAIAYLMRSFGNFENEVIPVLNNYFHACALKMSCVDLAKTFSYLANKGVSVHTDQR
FT                   VISPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAIVPGEMTIAVWSPEL
FT                   DPSGNSLAGTKALELLSERIGRSIF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187650.1"
FT   gene            485554..486180
FT                   /db_xref="GeneID:10165183"
FT                   /locus_tag="VVM_00834"
FT   CDS_pept        485554..486180
FT                   /locus_tag="VVM_00834"
FT                   /gene_family="HOG000261908" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155272"
FT                   /db_xref="GeneID:10165183"
FT                   /translation="MPHQTSQQIHQALLMQCQSFPFLCSVLERNGPRTLERQPTSSFLP
FT                   YLSRAVAGQQLSVNAAKTIWRRVESLSAEKGSLQQTFVDEHYQALRDCGLSNAKVKTIL
FT                   GINQALMEGALDSAFLASNDPQTIVKQLTGLWGIGPWTAEMALMFFFGMPDVWSAGDAA
FT                   LMRGLSSLAEKEGVDAEAILSAATPYRTYLALHIWEMLDAELLSE"
FT                   /protein_id="YP_004187651.1"
FT   gene            complement(486182..487351)
FT                   /db_xref="GeneID:10165184"
FT                   /locus_tag="VVM_00836"
FT   CDS_pept        complement(486182..487351)
FT                   /locus_tag="VVM_00836"
FT                   /gene_family="HOG000015379" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="radical SAM family enzyme, coproporphyrinogen III
FT                   oxidase oxygen-independent-like protein clustered with
FT                   nucleoside-triphosphatase RdgB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155273"
FT                   /db_xref="GeneID:10165184"
FT                   /translation="MLTPPALSLYVHIPWCVQKCPYCDFNSHALKEQIPEQMYINALLE
FT                   DLDRDIEKYQLHRAPRPLHSIFIGGGTPSLISAEGIRDLLQGIEKRIPFTPSIEITMEA
FT                   NPGTIEAERFAGYRKAGVTRISIGVQSFEQQKLERLGRIHGQDEAVNAAKLAHQIGLNS
FT                   FNLDLMHGLPDQSIEQALADLDKAIELNPPHLSWYQLTIEPNTMFYYKPPALPDDDQLW
FT                   DIFEQGHQKLTQAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFADGR
FT                   IIRTTKIKHPKGYLAAHQNMVKPYLDSEQLVEEIDRPFEFFMNRFRLMEACPKQDFIDT
FT                   TGLPLSFIETTIQWAVEMGYLNDNETSWQITEKGKLFLNDLLEAFMAEE"
FT                   /protein_id="YP_004187652.1"
FT   gene            complement(487361..487963)
FT                   /db_xref="GeneID:10165185"
FT                   /locus_tag="VVM_00837"
FT   CDS_pept        complement(487361..487963)
FT                   /product="nucleoside 5-triphosphatase RdgB"
FT                   /gene_family="HOG000293319" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00837"
FT                   /EC_number="3.6.1.15"
FT                   /db_xref="GI:320155274"
FT                   /db_xref="GeneID:10165185"
FT                   /translation="MKKIVLATGNQGKVREMADLLADFGFDVVAQSEFNVSEVAETGTT
FT                   FIENAIIKARHAAKETGLAAIADDSGLEVDFLQGAPGIYSARYAGEKASDQENLEKLLT
FT                   AMEGVPEAQRTARFHCVLVLMRHENDPTPIVCHGKWEGRILMQAHGDNGFGYDPIFFVP
FT                   EDNCASAELEPARKKQLSHRGKALKQLFATLREQPLV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187653.1"
FT   gene            complement(487974..488405)
FT                   /db_xref="GeneID:10165186"
FT                   /locus_tag="VVM_00838"
FT   CDS_pept        complement(487974..488405)
FT                   /locus_tag="VVM_00838"
FT                   /gene_family="HOG000283136" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155275"
FT                   /db_xref="GeneID:10165186"
FT                   /translation="MNKWMVALLSCLMALPTWAEQFKTIKDAEVHYIAFNSTFLTAKVA
FT                   RSYGLKRNEYSAIINISVLDKSRVGKPALDATISGQAKNLLGQIRTLEFKRVQEGSAIY
FT                   YLAELPISHEETLTFDLDVNAGIKGAGKLKFTQKFYVEE"
FT                   /protein_id="YP_004187654.1"
FT   gene            complement(488448..488738)
FT                   /db_xref="GeneID:10165187"
FT                   /locus_tag="VVM_00839"
FT   CDS_pept        complement(488448..488738)
FT                   /locus_tag="VVM_00839"
FT                   /gene_family="HOG000019208" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="osmotic shock response integral membrane protein
FT                   YggT"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155276"
FT                   /db_xref="GeneID:10165187"
FT                   /translation="MSQAVWLDGEDVVLRLYIQPKASRDKILGLHGDELKIAITAPPVD
FT                   GKANGHLTKLLGKWFKVAKSLVTIEKGELGRHKQVRVHAPQQIPDEVKAIL"
FT                   /protein_id="YP_004187655.1"
FT   gene            complement(488738..489295)
FT                   /db_xref="GeneID:10165188"
FT                   /locus_tag="VVM_00842"
FT   CDS_pept        complement(488738..489295)
FT                   /locus_tag="VVM_00842"
FT                   /gene_family="HOG000257384" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="osmotic shock response integral membrane protein
FT                   YggT"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155277"
FT                   /db_xref="GeneID:10165188"
FT                   /translation="MNAMSFLISTLFDLYIMVVILRIWLQAARADFYNPFSQFIVKATQ
FT                   PVIGPLRRVIPSIGSLDLATVLFAYVLCVLKFVALILIASGGSVTFSADFLYLGLLSLV
FT                   KAAGGLLFWVLLIRAILSWVSQGRSPIEYVFHQLTEPMLAPIRRILPAMGGFDLSVLVL
FT                   FIALQFANFLMGDVIGPIWYQL"
FT                   /protein_id="YP_004187656.1"
FT   gene            complement(489337..490155)
FT                   /db_xref="GeneID:10165189"
FT                   /locus_tag="VVM_00843"
FT   CDS_pept        complement(489337..490155)
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /gene_family="HOG000230246" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00843"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="GI:320155278"
FT                   /db_xref="GeneID:10165189"
FT                   /translation="MEHKNIAFIGAGNMVRAIVSGLVADGYPADKITATAPSETRRLPL
FT                   EQQFGIQTTSDNFMAATQADVIVLSVKPQMMEEVCKPLQSVDFSNKLVISIAAGINCAR
FT                   LNDMLATQLNLVRVMPNTPSQLGLGMSGLYAPASVAEQDRHFAEQLMQAVGKTCWVDEE
FT                   SGINHVIAAAGSAPAYFFLFMEAMQAEAMAQGFDKQTARLLVQQSALGAASMVVENPDT
FT                   ELATLRENVTSKGGTTAEALRTFNEHQLSDIVAKAMQAAVARAQEMEKLF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187657.1"
FT   gene            complement(490190..490816)
FT                   /db_xref="GeneID:10165190"
FT                   /locus_tag="VVM_00844"
FT   CDS_pept        complement(490190..490816)
FT                   /locus_tag="VVM_00844"
FT                   /gene_family="HOG000048983" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155279"
FT                   /db_xref="GeneID:10165190"
FT                   /translation="MQLLAVSKTKPVEAILEAYHAGQRAFGENYVQEGVEKVRFFAEQH
FT                   PEKSIEWHFIGPIQSNKSRLVAEHFAWVHTIDRDKIAQRLNDQRPAELPPLQVLIQVNT
FT                   SGEASKSGVSGEEIFALAELISTLPNLTLRGLMSIPENVDDHASQLAAFQPLAELQQRL
FT                   VQRYPSVDTLSMGMSGDMDAAIESGSTMVRIGTAIFGHRDYSNKA"
FT                   /protein_id="YP_004187658.1"
FT   gene            490925..491962
FT                   /db_xref="GeneID:10165191"
FT                   /locus_tag="VVM_00845"
FT   CDS_pept        490925..491962
FT                   /locus_tag="VVM_00845"
FT                   /gene_family="HOG000008425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="twitching motility protein PilT"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155280"
FT                   /db_xref="GeneID:10165191"
FT                   /translation="MDITELLDFSVKHNASDLHLSAGVPPMVRIDGDVRKLGVPAFNHA
FT                   DVHRLVFEIMNDSQRSEFEEKLEVDFSFELPNVGRFRVNAFNQSRGCSAVFRTIPTNIP
FT                   TLEELECPQIFEKIAKCEKGLVLVTGPTGSGKSTTLAAMVDYINRNYNKHILTIEDPIE
FT                   FVHQNQKCLINQREVHRDTHSFKNALRSALREDPDVILVGELRDQETISLALTAAETGH
FT                   LVFGTLHTSSAAKTIDRIIDVFPGSDKDMVRSMLSESLRAVIAQKLLKRIGGGRVACHE
FT                   IMMATPAIRNLIREDKVAQMYSIIQTGAAHGMQTMEQNARQLIAQGKVAKEEVDAKIEI
FT                   ETIQF"
FT                   /protein_id="YP_004187659.1"
FT   gene            491975..493087
FT                   /db_xref="GeneID:10165192"
FT                   /locus_tag="VVM_00848"
FT   CDS_pept        491975..493087
FT                   /locus_tag="VVM_00848"
FT                   /gene_family="HOG000008425" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="twitching motility protein PilT"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155281"
FT                   /db_xref="GeneID:10165192"
FT                   /translation="MSMDLNKILEGMITLKASDLYITVGAPVLFRVDGELRPQGEKLSQ
FT                   IEVAQLLDGAMDEERRADFRKSRESNFAIVRDSGRFRVSAFYQRELPGAVIRRIETNIP
FT                   TFEELKLPHVLQDLAIAKRGLVLVVGATGSGKSTTMAAMTGYRNTHRSGHILTVEDPIE
FT                   FVHEHKRCIVTQREVGLDTESYEVALKNSLRQAPDMILIGEIRSRETMEYAMTFAETGH
FT                   LCMATLHANNANQALERILHLVPKEQKEQFLFDLSMNLKGVVGQQLIRDKNGKGRHGVF
FT                   EVLLNSPRVSDLIRRGDLHELKMTMAKSKEVGMQTFDQSLYTLVVEGKISEEDAMHSAD
FT                   SANDLRLMLKTQRGDISSPGSLANVKIDMD"
FT                   /protein_id="YP_004187660.1"
FT   gene            complement(493180..493602)
FT                   /db_xref="GeneID:10165193"
FT                   /locus_tag="VVM_00850"
FT   CDS_pept        complement(493180..493602)
FT                   /product="putative Holliday junction resolvase"
FT                   /gene_family="HOG000016954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00850"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="GI:320155282"
FT                   /db_xref="GeneID:10165193"
FT                   /translation="MSRTIMAFDFGTKSIGSAIGQEITGTASPLKAFKANDGIPNWDEI
FT                   EKQIKEWQPNLLVVGLPTDLHGKALETITPRAKKFAQRLQGRFGLPVELHDERLSTTEA
FT                   RSELFSMGGYKALSKGNVDCQSAVIILESWFEAQWG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187661.1"
FT   gene            complement(493624..494187)
FT                   /db_xref="GeneID:10165194"
FT                   /locus_tag="VVM_00851"
FT   CDS_pept        complement(493624..494187)
FT                   /locus_tag="VVM_00851"
FT                   /gene_family="HOG000281193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155283"
FT                   /db_xref="GeneID:10165194"
FT                   /translation="MNLTNHFLVAMPGMKDPYFQHSVIYICEHNEEGAMGLMINAPIDI
FT                   TVGKMLEQVDVQPVHPQLNTSSLTKPVYNGGPVAEDRGFILHRPKDFYESSLQMTEQIS
FT                   VTTSKDILTVLGTEAEPSSYIVALGYSGWSAGQLEAELAENSWLTVEANPDIIFDTPIA
FT                   MRWQKAVQMLGIHASQLSDQAGHA"
FT                   /protein_id="YP_004187662.1"
FT   gene            complement(494242..495195)
FT                   /db_xref="GeneID:10165195"
FT                   /locus_tag="VVM_00852"
FT   CDS_pept        complement(494242..495195)
FT                   /product="glutathione synthetase"
FT                   /gene_family="HOG000265022" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00852"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="GI:320155284"
FT                   /db_xref="GeneID:10165195"
FT                   /translation="MIKLGIVMDPISSINIKKDSSFAMMLEAQRRGWEIHYMEMNDLHL
FT                   DQGVAIADTKVVQLKEDPNGWYEFTSEQTIELAELDAVLMRKDPPFDTEYIYATYILER
FT                   AEEQGTLIVNKPQSLRDCNEKLFTAWFPELTPTTIVTRKAEKIKAFRQEHGDIILKPLD
FT                   GMGGASIFRVKENDPNVSVIIETLTNHGQNYAMAQTFVPDISNGDKRILVVDGEPMPYC
FT                   LARIPAKGETRGNLAAGGSGEPRPLSETDLKIANAVAPTLKEKGLIFVGLDVIGDKLTE
FT                   INVTSPTCIREIEAAFDISITGKLMDAIERRLQAQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187663.1"
FT   gene            complement(495210..495941)
FT                   /db_xref="GeneID:10165196"
FT                   /locus_tag="VVM_00854"
FT   CDS_pept        complement(495210..495941)
FT                   /product="ribosomal RNA small subunit methyltransferase E"
FT                   /gene_family="HOG000015265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00854"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320155285"
FT                   /db_xref="GeneID:10165196"
FT                   /translation="MRIPRIYHPETIQHLGVIALSDDAAGHIGRVLRMKEGQEVLLFDG
FT                   SGAEFPAVISEVGKKSVMVELSERVERSSESPLDLHLGQVISRGEKMEFTIQKSVELGV
FT                   NTITPLISDRCGVKLDEKRFEKKLAQWQKIAISACEQCGRNTIPEIRPIMSLEAWCAEE
FT                   YDGLKLNLHPRAKYSINTLPEPVTKVRLLIGPEGGLSSEEIDMTQQYQFEETLLGPRVL
FT                   RTETAALTAITALQVRFGDLG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187664.1"
FT   gene            496178..497512
FT                   /db_xref="GeneID:10165197"
FT                   /locus_tag="VVM_00855"
FT   CDS_pept        496178..497512
FT                   /locus_tag="VVM_00855"
FT                   /gene_family="HOG000147972" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155286"
FT                   /db_xref="GeneID:10165197"
FT                   /translation="MNKTKLAMVCALLTTMAGCNSGSSSDGPGELGSPNIKGDPSLDKI
FT                   YSYQESDLSTTAIECAKIYKQNLSCSLEKIRPIGANRTEDITLEEIQSRLLVSHQWMAE
FT                   SFIAALKAINDQDLLNLFKPLNTIVLSYDIRPSFYHSRTASMYIDARYLWRDYSDWRTI
FT                   HQQDDYRKEFAREFTYENASRYVYGQTLNYVTVSNQYDSKRNSTRSAEKIAPGLFRLLA
FT                   HELAHANDLLPPNDLLQLASRGTILNEIEDANHIYSQLSSAHGLTSQLLLEAAATSFHG
FT                   KPMTDLVRNSTGEQAGGEFETDGAAAFYGYSTEREDVATLFESYMMHKKYGAIDEVAFV
FT                   SVPQTEAYTCDDWKILWGQRDRLSDKNVRSRALFVAQQILDQTPQVIEENLPPVSSVPT
FT                   AMPIGKGWCETLGANYDSAAGARFAAPFSKAGERFGYLEDIGAKE"
FT                   /protein_id="YP_004187665.1"
FT   gene            complement(497558..498253)
FT                   /db_xref="GeneID:10165198"
FT                   /locus_tag="VVM_00860"
FT   CDS_pept        complement(497558..498253)
FT                   /product="extracellular deoxyribonuclease Dns"
FT                   /gene_family="HOG000281182" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00860"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="GI:320155287"
FT                   /db_xref="GeneID:10165198"
FT                   /translation="MKRLFIFIASFTAFAIQAAPPSSFSAAKQQAVKIYQDHPISFYCG
FT                   CDIEWQGKKGIPNLETCGYQVRKQQTRASRIEWEHVVPAWQFGHQRQCWQKGGRKNCSK
FT                   NDQQFRLMEADLHNLTPAIGEVNGDRSNFNFSQWNGMDGVSYGRCEMQVNFKQRKVMPP
FT                   DRARGSIARTYLYMSQEYGFQLSKQQQQLMQAWNKSYPVDEWECTRDDRIAKIQGNHNP
FT                   FVQQSCTVR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187666.1"
FT   gene            complement(498355..498861)
FT                   /db_xref="GeneID:10165199"
FT                   /locus_tag="VVM_00861"
FT   CDS_pept        complement(498355..498861)
FT                   /locus_tag="VVM_00861"
FT                   /gene_family="HOG000281171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein sprT"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155288"
FT                   /db_xref="GeneID:10165199"
FT                   /translation="MKKIEFELHYQAQKALHACIDKANRYFQRQFPMPLLSYQLRGKAA
FT                   GKAYLQLNQIRLNPILFKENKTAFLEEVIPHEVAHLLTYQLYGRVKPHGAEWQSIMQGV
FT                   FLLPANTTHQFAVASVQGKTFQYRCQCREFPLTIRRHNKVLRNEASYTCQKCRQTLIFT
FT                   GIQLS"
FT                   /protein_id="YP_004187667.1"
FT   gene            complement(498935..499729)
FT                   /db_xref="GeneID:10165200"
FT                   /locus_tag="VVM_00862"
FT   CDS_pept        complement(498935..499729)
FT                   /locus_tag="VVM_00862"
FT                   /gene_family="HOG000145085" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative cytochrome c oxidase subunit I"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155289"
FT                   /db_xref="GeneID:10165200"
FT                   /translation="MPRTVDPSDLEQKRKDVPDHEYARTIPCNQLSVSAPFHWLALGLH
FT                   DFIRMPLISAFYGLCFMAAAIGIVLLVEWQGTHLVVMPSLVVYMLIGPFLALGLYDASW
FT                   ERERGHSASLLHSMKAIGRNSSSQWAFAVLLAVCMIFWMRIAALLHALYPSVQGAPLTE
FT                   FLPFLVIGSLVGFVLASIVFSISAFSIPMMMERRVDMMTAVFSSFNAVKSNIPAMIVWA
FT                   AIICGGILIGFATYGIGMLFTMPILGYATWHAYHETIKKKHH"
FT                   /protein_id="YP_004187668.1"
FT   gene            complement(499982..501136)
FT                   /db_xref="GeneID:10165201"
FT                   /locus_tag="VVM_00865"
FT   CDS_pept        complement(499982..501136)
FT                   /product="S-adenosylmethionine synthetase"
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00865"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="GI:320155290"
FT                   /db_xref="GeneID:10165201"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVMVGGEITTSAWVDIEELTRETVREIGYVHSDMGFDANSCAVLNTIGKQSPDIN
FT                   QGVDKADPKEQGAGDQGIMFGYACNETEVLMPAPITYAHRLMERQAKVRKDGTLPWLRP
FT                   DAKSQVTFQYEQGKIVGIDAVVLSTQHCDSISTPDLREAVMEEIIKPVLPSEWLNKETK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGMADRCEIQLSYAIGVADPTSIMVETFGTEKVSHDIIIEAVRQFFDLRPYG
FT                   LQEMLNLLQPIYKKTAAYGHFGREEFPWEATDKAALLREFAGIK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187669.1"
FT   gene            501466..503460
FT                   /db_xref="GeneID:10165202"
FT                   /locus_tag="VVM_00867"
FT   CDS_pept        501466..503460
FT                   /product="transketolase"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00867"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="GI:320155291"
FT                   /db_xref="GeneID:10165202"
FT                   /translation="MPSRKHLANAIRALSMDGVQKANSGHPGAPMGMADIAEVLWRGHL
FT                   NHNPSNPEWADRDRFVLSNGHGSMLIYSLLHLSGYELSIDDLKNFRQLHSKTPGHPEYG
FT                   YAPGIETTTGPLGQGITNAVGMAMAEKALAAQFNKEGHDIVDHFTYVFMGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIAFWDDNGISIDGHVEGWFSDDTPKRFEAYGWHVIPAVDGHNAE
FT                   AINAAIEAAKADPRPTLICTKTIIGFGSPNKSGSHDCHGAPLGAEEIAAAREFLGWEHP
FT                   AFEIPADVYAEWDAKAAGAAKEAAWNAKFDAYAAAYPAEAAEFKRRVNGELPAQWEEKA
FT                   NQIIADLQANPANIASRKASQNALEAFGKMLPEFMGGSADLAPSNLTMWSGSKSLEAND
FT                   FSGNYIHYGVREFGMTAIMNGIALHGGFVPYGATFLMFMEYARNAMRMAALMKVQNIQV
FT                   YTHDSIGLGEDGPTHQPVEQIASLRLTPNMSTWRPCDQVESAVAWKLAIERKDGPSALI
FT                   FSRQNLAQQPRSAEQVADIAKGGYILKDSDGKPELILIATGSEVELAVKAAEQLTAEGK
FT                   KVRVVSMPATDTFDKQDAAYREAVLPSDVTARIAIEAGIADFWYKYVGFDGRIIGMTTF
FT                   GESAPADQLFEMFGFTVENVVNTAKELLA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187670.1"
FT   gene            complement(503512..503748)
FT                   /db_xref="GeneID:10165203"
FT                   /locus_tag="VVM_00871"
FT   CDS_pept        complement(503512..503748)
FT                   /locus_tag="VVM_00871"
FT                   /gene_family="HOG000218002" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155292"
FT                   /db_xref="GeneID:10165203"
FT                   /translation="MSGFPAAHFCKRCNKETPHSEVLVRKPSRYDTDKTILGTLKLWAH
FT                   TLINGGHYYDMDRYVTCKECGHKEKDNWGKEFE"
FT                   /protein_id="YP_004187671.1"
FT   gene            503949..504989
FT                   /db_xref="GeneID:10165204"
FT                   /locus_tag="VVM_00872"
FT   CDS_pept        503949..504989
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /gene_family="HOG000071679" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00872"
FT                   /EC_number="1.2.1.72"
FT                   /db_xref="GI:320155293"
FT                   /db_xref="GeneID:10165204"
FT                   /translation="MLKVAINGFGRIGRNVLRAVYESGKHQQIKVVAVNELAQPEAMAH
FT                   LLQYDTSHGRFGKRISHDQEHLYVHHDACPQGKGEFDSIRILHLSEINLLPWRDLEVDL
FT                   VLDCTGVFGCQADGLEHIKAGAKKVLFSHPGASDLDNTIIYGVNHETLKAEHNVVSNGS
FT                   CTTNCIVPIIKVLDEAFGIESGTITTIHSSMNDQQVIDAYHSDLRRTRAASQSIIPVDT
FT                   KLHKGIERIFPKFSNKFEAISVRVPTVNVTAMDLSVTINTNVKVNDVNQTIVNASQCTL
FT                   RGIVDYTEAPLVSIDFNHDPHSAIVDGSQTRVSNGHLVKMLVWCDNEWGFANRMLDTAL
FT                   AMQAAQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187672.1"
FT   gene            505140..506300
FT                   /db_xref="GeneID:10165205"
FT                   /locus_tag="VVM_00876"
FT   CDS_pept        505140..506300
FT                   /product="phosphoglycerate kinase"
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00876"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="GI:320155294"
FT                   /db_xref="GeneID:10165205"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIIASLPTIK
FT                   LCLEAGAKVMVTSHLGRPTEGEYAEEFSLQPVVNYLNDALDCEVKLAKDYLDGLELNAG
FT                   ELVVLENVRFNKGEKKNDEELSKKYAALCDVFVMDAFGTAHRAQASTHGVGMFAEVACA
FT                   GPLLAAELEALGKAMSNPERPLVAIVGGSKVSTKLTVLESLSKIADQLVVGGGIANTFI
FT                   AAEGHNVGKSLYEADLVETAQKLMKECAIPVATDVACAKAFDENAEAEIKHVSEVQDDD
FT                   MIFDLGPDSTAALAEIIANAKTILWNGPVGVFEFKNFEAGTKGISEAIAQSPAFSVAGG
FT                   GDTLAAIDKFGIKADVSYISTGGGAFLEFVEGKVLPAVEMLEARAK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187673.1"
FT   gene            506450..507526
FT                   /db_xref="GeneID:10165206"
FT                   /locus_tag="VVM_00877"
FT   CDS_pept        506450..507526
FT                   /product="fructose-bisphosphate aldolase class II"
FT                   /gene_family="HOG000227794" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00877"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="GI:320155295"
FT                   /db_xref="GeneID:10165206"
FT                   /translation="MSKIFDFVKPGVISGDDVQKVFEVAKENNFALPAVNVVNTDSING
FT                   VLEAASKVKAPVVVQFSNGGAAFFAGKGVKLEGQGAQILGAIAGAKYVHAVAEAYGVPV
FT                   ILHTDHAAKKLLPWIDGLLDAGEEFFAQTGKPLFSSHMIDLSEESLEENIEICAKYLAR
FT                   MEKMGMTLEFELGCTGGEEDGVDNSHMDQSELYTSPEDVAYAYEKLIPISHRFTIAASF
FT                   GNVHGVYQAGNVVLTPTILRDSQAYCSEKFGIAPNALNFVFHGGSGSSEAEIKESISYG
FT                   VIKMNIDTDTQWATWDGIRQYEAKNHDYLQGQIGNPTGESAPNKKYYDPRVWLRAGQES
FT                   MVARLEKAFADLNAVDVL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187674.1"
FT   gene            507822..508685
FT                   /db_xref="GeneID:10165207"
FT                   /locus_tag="VVM_00879"
FT   CDS_pept        507822..508685
FT                   /locus_tag="VVM_00879"
FT                   /gene_family="HOG000110050" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MscS mechanosensitive channel stability protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155296"
FT                   /db_xref="GeneID:10165207"
FT                   /translation="MAGETVGIDTSLVDGLNQAETWLTNNSDLLIQYGVNIISAIVILF
FT                   IGNIIVKAVANSVSKVLNKKEMDKAVVEFIHGLVRYLLFVIVLIAALGRVGVETASVVA
FT                   VIGAAGLAVGLALQGSLSNFAAGVLIVAFRPFKSGDYVEIGGVAGSVEAIQIFQTVLKT
FT                   PDNKMVVVPNSGVIGGAITNYSRHATRRVDLMIGVSYKSDLKKTKQVIRETLEKDARIL
FT                   KDPDMTIGVVALADSSVNFVVRPWCKTEDYWNVYFDSMQAIKEALDANGIEIPFPQMDV
FT                   HLNKVD"
FT                   /protein_id="YP_004187675.1"
FT   gene            complement(508754..509374)
FT                   /db_xref="GeneID:10165208"
FT                   /locus_tag="VVM_00882"
FT   CDS_pept        complement(508754..509374)
FT                   /locus_tag="VVM_00882"
FT                   /gene_family="HOG000122948" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lysine efflux permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155297"
FT                   /db_xref="GeneID:10165208"
FT                   /translation="MNFWVLLQGFGLGATMIIPIGAQNAFVLNQGIKRNHHLTTAAVCS
FT                   VLDMVFISLGIFGGGAILSQNELLLTVVTLGGIAFLSVYGLMSLKSAFKPIEQVEKHHE
FT                   VIARGRRTVILGALAVTVLNPHLYLDTVVILGSIGGQFEGHDRIAFAIGTTLASFTWFY
FT                   ALSMGAAKLGPTLSKPKVKRGIDIAVAAMMFTIAALLTKSLLA"
FT                   /protein_id="YP_004187676.1"
FT   gene            509502..510398
FT                   /db_xref="GeneID:10165209"
FT                   /locus_tag="VVM_00883"
FT   CDS_pept        509502..510398
FT                   /locus_tag="VVM_00883"
FT                   /gene_family="HOG000219802" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome initiation inhibitor"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155298"
FT                   /db_xref="GeneID:10165209"
FT                   /translation="MRGLDYKWIEALDAVVAQGGFERAAEELYISQSAVSQRIKQLERF
FT                   LAQPVLIREQPPKPTPVGKKLLGLYRRVRILEHELIPELMNDDTAKPIQLALATNADSL
FT                   ATWLLPALKEVMTLRQVELNLAIYGESRSIEKLKSGEVAGAISLESQPIAGCKADYLGR
FT                   MDYVCVASPDFYQRYFAAGVNYQTLRKAPAVSYDQYDDLHNRFLHDHFNISRDSIINHN
FT                   VGSSEAFVRLAVSGIAYCLIPKLQIEQELASGVLMDITPGFLLSYRIYWHHWQLESGVL
FT                   KEISQAIVQYAQAHLPQ"
FT                   /protein_id="YP_004187677.1"
FT   gene            510527..511219
FT                   /db_xref="GeneID:10165210"
FT                   /locus_tag="VVM_00884"
FT   CDS_pept        510527..511219
FT                   /locus_tag="VVM_00884"
FT                   /gene_family="HOG000279581" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155299"
FT                   /db_xref="GeneID:10165210"
FT                   /translation="MKWFPTSVVLSASLVAGYAMAEAPNFAHLSTTGYGEVVAKPDMAI
FT                   FTVKVVDSTMTAESAKQSVDTTVDAFLAALTKAGVDKQQITSTNLYLAPQYHYPKNEKP
FT                   DLVGYRASRSVTVKVANLANLNAYLDLALNAGINQVDNIQLLVSNEAEYQQQARLEAIK
FT                   DAQQKAGFLAKGFGKSLGEVWQINYNQPNVQPVLMRTMMMDAKSESNSYQDSSLIIRDQ
FT                   VDVTYKLD"
FT                   /protein_id="YP_004187678.1"
FT   gene            complement(511279..512508)
FT                   /db_xref="GeneID:10165211"
FT                   /locus_tag="VVM_00886"
FT   CDS_pept        complement(511279..512508)
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /gene_family="HOG000136696" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00886"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="GI:320155300"
FT                   /db_xref="GeneID:10165211"
FT                   /translation="MAKVSLEKEKIKILLLEGLHPSSVEVLQAAGYTNIEYHKGSLSDD
FT                   ALLEAVKDAHFIGIRSRTNLTEEVINAAQKLVAIGCFCIGTNQVDLNAASKRGIPVFNA
FT                   PFSNTRSVAELVLGQILLLLRGIPEKNALAHRGIWKKSADNSYEARGKRLGIIGYGHIG
FT                   TQLGIIAENLGMRVYFYDIENKLSLGNATQIPTMSELLNKCDVISLHVPETPETKNMMG
FT                   AEEFARMKPGSIFINAARGTVVDIEALCHSLESGHIAGAAIDVFPVEPATNAEPFESPL
FT                   QKFDNVILTPHVGGSTQEAQENIGVEVAGKLAKYSDNGSTLSSVNFPEVSLPEHRSCSR
FT                   LLHIHQNRPGILTQINTIFAEEGINIAGQYLQTSADIGYVVIDVETERSEEALVKLKEI
FT                   EGTIRARILH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187679.1"
FT   gene            complement(512581..512703)
FT                   /db_xref="GeneID:10165212"
FT                   /locus_tag="VVM_00887"
FT   CDS_pept        complement(512581..512703)
FT                   /locus_tag="VVM_00887"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155301"
FT                   /db_xref="GeneID:10165212"
FT                   /translation="MTFLKKIISYSVIFLPKTKIFCYFIEQKTHKETFVLRQNC"
FT                   /protein_id="YP_004187680.1"
FT   gene            complement(512768..513424)
FT                   /db_xref="GeneID:10165213"
FT                   /locus_tag="VVM_00888"
FT   CDS_pept        complement(512768..513424)
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /gene_family="HOG000276368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00888"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="GI:320155302"
FT                   /db_xref="GeneID:10165213"
FT                   /translation="MTQDEMKKAAGWAALKYVEKGSIVGVGTGSTVNHFIDALGTMSEE
FT                   IKGAVSSSIASTEKLEALGIKIFDCNEVASLDIYVDGADEINADREMIKGGGAALTREK
FT                   IVAAIADKFICIVDGTKAVDVLGTFPLPVEVIPMARSYVARQLVKLGGDPCYREGVITD
FT                   NGNVILDVYGMKITNPKQLEDQINGIPGVVTVGLFAHRGADVVITGTPEGAKIEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187681.1"
FT   gene            complement(513477..514076)
FT                   /db_xref="GeneID:10165214"
FT                   /locus_tag="VVM_00891"
FT   CDS_pept        complement(513477..514076)
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /gene_family="HOG000007300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00891"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="GI:320155303"
FT                   /db_xref="GeneID:10165214"
FT                   /translation="MQNLSRQDIRTLIRQRRNQLCSDTQYQAALDLTAHFAQLDELTDA
FT                   QHIALYLSADGELDTKPLIEWLWELGKQVYLPVIHPFSKGQLLFLHYHRHTDLIYNRYG
FT                   ILEPKLDKRHIIPLAELDLICTPLVAFDSTGQRLGMGGGYYDRTLERWFRTGLGAKPIG
FT                   IAHDCQHVEQLPCEVWDIPLPKIVTPSQIWQWENDV"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187682.1"
FT   gene            complement(514271..514582)
FT                   /db_xref="GeneID:10165215"
FT                   /locus_tag="VVM_00892"
FT   CDS_pept        complement(514271..514582)
FT                   /locus_tag="VVM_00892"
FT                   /gene_family="HOG000263522" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Z-ring-associated protein ZapA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155304"
FT                   /db_xref="GeneID:10165215"
FT                   /translation="MSNQAVDVEILGKITRVNCPPGQEEALVAAAQDLDARLKEMSERT
FT                   KVTNEIQLLTFAALNICYELNSKSSASNEQQQLMVERMEQLTDSLDKALMKVTQGSAQ"
FT                   /protein_id="YP_004187683.1"
FT   gene            514829..515404
FT                   /db_xref="GeneID:10165216"
FT                   /locus_tag="VVM_00893"
FT   CDS_pept        514829..515404
FT                   /locus_tag="VVM_00893"
FT                   /gene_family="HOG000276031" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative conserved hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155305"
FT                   /db_xref="GeneID:10165216"
FT                   /translation="MSKNQLPSYQVVADEMKMATLAVTPAELHGLLAGMISGGLSQQDQ
FT                   SWQPMLFDYTNDGMGWPSAALEQAQALFNVTSAQLTSDEMVLNLLLPNAEGEEAIFALA
FT                   DALSDWVNHYISGLGLAGAALNEASEEAKEALADLEEMARLGVDEDDDLQEQAELLEQV
FT                   IEHVKACALLIHAEFGAKTSSSETPTIH"
FT                   /protein_id="YP_004187684.1"
FT   gene            515419..516594
FT                   /db_xref="GeneID:10165217"
FT                   /locus_tag="VVM_00894"
FT   CDS_pept        515419..516594
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /gene_family="HOG000255770" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00894"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="GI:320155306"
FT                   /db_xref="GeneID:10165217"
FT                   /translation="MTQYDVVIAGGAMAGATLALALSHLTDNKLNVAVVEPYQVDTSHP
FT                   GFDSRSIALSYGTVDILRRFQLWSSIAPCATPITDIHVSDRSHLAMTDISAQQVGVDAL
FT                   GYVVELADVGSIYQSLLQRCESISLYTPAAVERVERFTDSVAVHLNNGETLQAKLLVAA
FT                   DGAVSNCCQQLGMPLAQHDFAQTAVIANVVTEQAHRGRAFERFTEHGPVALLPMSDNRM
FT                   SLVWCLPPDLAEQVMLLSEEQFLARLQQEFGWRLGQMQKVGMRASYPLILRHREQNISH
FT                   RFAVVGNAAQTLHPIAGQGFNLGIRDVASLAEEITKQLDDVGAYSSLMRFKQRRCGDRQ
FT                   NTIWMTTSLVHLFSNDYLALRVARNLGLVMMDNLSGLKQPLLRQTLGLVSR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187685.1"
FT   gene            516608..517840
FT                   /db_xref="GeneID:10165218"
FT                   /locus_tag="VVM_00896"
FT   CDS_pept        516608..517840
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   /gene_family="HOG000255771" [ FAMILY / ALN / TREE ]
FT                   hydroxylase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00896"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="GI:320155307"
FT                   /db_xref="GeneID:10165218"
FT                   /translation="MIQSVDVAIVGGGMVGLALAAAFKDSDLRVAVIEGQAPNLQMNEL
FT                   PDVRVSALSRSSEHILKNLGAWQSIVEKRASPYVAMEVWDQDSFGHIDFSADAMAQPDL
FT                   GHIVENRVIQLALLEQVNKLDNVMVLMPCQCQSMSVGESEVWLSLDNGQALTAKLVVGA
FT                   DGANSWVRRQQDIPLTHWDYGHSAIVANVRTVDPHCSVARQIFTPQGPLAFLPMSEENM
FT                   TSIVWSTESLRATSLMAMSDSEFNKALSAEFDMRLGLCEVVGERFSVPLKMRFARDFVK
FT                   ERVALIGDAAHTIHPLAGQGVNLGLLDAASLAQEILALWQRGEDIGAKRNLRRFERWRK
FT                   AEAAQMIAAMQGFRELFAGSNPLKKFLRGVGLTMAGHLPGAKEQIMRRALGLDGELPEL
FT                   AKRRQPELIRS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187686.1"
FT   gene            complement(517922..518128)
FT                   /db_xref="GeneID:10165219"
FT                   /locus_tag="VVM_00900"
FT   CDS_pept        complement(517922..518128)
FT                   /locus_tag="VVM_00900"
FT                   /gene_family="HOG000276941" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155308"
FT                   /db_xref="GeneID:10165219"
FT                   /translation="MRLFKRYTPGMIAKHVSRLFKGRIYIYGVGKFEFDNGKLILPAKA
FT                   EQKHFQTVKEVNQEIMKLRCAYA"
FT                   /protein_id="YP_004187687.1"
FT   gene            complement(518717..519229)
FT                   /db_xref="GeneID:10165220"
FT                   /locus_tag="VVM_00902"
FT   CDS_pept        complement(518717..519229)
FT                   /locus_tag="VVM_00902"
FT                   /gene_family="HOG000131780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155309"
FT                   /db_xref="GeneID:10165220"
FT                   /translation="MTNSDLSTALTRYLDEQQVPYRLLPHQTPATTIEDAAKQRGIRPA
FT                   QMVKCILLRDMSDRYVLACAPGDRAVDPKKVRALMDYRRMTCVDSSQIYAITGYQLGTV
FT                   TPLLLKTPMPIVFDHALQAESMVTISSGDNMAGVALSLTSLAQLSSPIWADICRSSELG
FT                   TFPTHQK"
FT                   /protein_id="YP_004187688.1"
FT   gene            complement(519219..520193)
FT                   /db_xref="GeneID:10165221"
FT                   /locus_tag="VVM_00904"
FT   CDS_pept        complement(519219..520193)
FT                   /locus_tag="VVM_00904"
FT                   /gene_family="HOG000261300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fe/S cluster synthesis/repair in oxidative stress
FT                   protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155310"
FT                   /db_xref="GeneID:10165221"
FT                   /translation="MQLTQPIQRCALGSQQTLPELAVSLLDNLGLITMTGNDKKSYLQG
FT                   QVTCDVVSLEADQVTWGGHCDAKGKLWSAFRLFHYADGYAMLQDKSAIDVELRELKKYA
FT                   VFAKVEINVSDAILLGVCGVQAEQAIAKLTNNAEAAVVTFAQGTAVKISPQRWLLVVDA
FT                   NQQDEVLAMLATAPLCDHALWDLYDILEVAPRIPAFAQNEHIPQAVNLQAVNGISFKKG
FT                   CYTGQETVARAKYRGINKRALYRLSGAIAPSTTETTISLERSVGDNWRAAGEALVSYHF
FT                   DDGRATGLFVLPNDLEPETQFRLAGQSEQLWQREPLPYSLDDE"
FT                   /protein_id="YP_004187689.1"
FT   gene            520390..520650
FT                   /db_xref="GeneID:10165222"
FT                   /locus_tag="VVM_00905"
FT   CDS_pept        520390..520650
FT                   /locus_tag="VVM_00905"
FT                   /gene_family="HOG000160701" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="YgfY"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155311"
FT                   /db_xref="GeneID:10165222"
FT                   /translation="MYTTEEKARIRWACRRGMLELDVVVMPFFEECFEKLSEQEQRDFV
FT                   SLLECDDPDLFTWVMGHGRSENLGHASMVDKIVAHNLSKVR"
FT                   /protein_id="YP_004187690.1"
FT   gene            520682..521050
FT                   /db_xref="GeneID:10165223"
FT                   /locus_tag="VVM_00908"
FT   CDS_pept        520682..521050
FT                   /locus_tag="VVM_00908"
FT                   /gene_family="HOG000144802" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155312"
FT                   /db_xref="GeneID:10165223"
FT                   /translation="MVDSLIAICIIWALLFSPFPLVVVVALLYPLYQFQTIHGFCYPAW
FT                   QGAVSVNASGAIKYQQQVEHIHSLSLLFYWWFVSIKLANGRRYLIWRDSCQDSDYRQLM
FT                   IVLKQWQQKGELNSFPKS"
FT                   /protein_id="YP_004187691.1"
FT   gene            complement(521077..522684)
FT                   /db_xref="GeneID:10165224"
FT                   /locus_tag="VVM_00912"
FT   CDS_pept        complement(521077..522684)
FT                   /product="L-aspartate oxidase"
FT                   /gene_family="HOG000160476" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00912"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="GI:320155313"
FT                   /db_xref="GeneID:10165224"
FT                   /translation="MNANREHECDVLVVGSGAAGLSLALRVANHCKVIVLSKGPRSEGA
FT                   TYYAQGGIAAVFDESDSIESHVQDTLIAGDGICEEATVKFIAENAKECVQWLIDGGVPF
FT                   DREEDDSDDEPRYHLTREGGHSHRRILHAADATGMAMQTSLQDNAHNHPNIHVLERHNA
FT                   LDLITEDKIGGDKNKVIGAYVWNRNQEHVETVKAKFVVLATGGASKVYQYTSNPDVSSG
FT                   DGIAIAWRAGCRVANMEFNQFHPTCLYHPEARNFLLTEALRGEGAYLRRPDGSRFMPDF
FT                   DPREELAPRDVVARAIDFEMKRLGADCMYLDISHKPAEFITKHFPMIHSRLMDLGIDMT
FT                   KEPIPIVPAAHYTCGGVMVDTNGQTDLHNLYAIGEVSYTGLHGANRMASNSLLECVVYA
FT                   WAAAKDILKKHKQVDLASSLPSWDESQVTCSDEEVIIQHNWHELRLFMWDYMGIVRTDK
FT                   RLERALRRIQMLQQETHEYYSNFRVSNNLLELRNLLQVAELMVRCAMQRKESRGLHYTL
FT                   DYPEQLENSGPTILRPEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187692.1"
FT   gene            523035..523613
FT                   /db_xref="GeneID:10165225"
FT                   /locus_tag="VVM_00913"
FT   CDS_pept        523035..523613
FT                   /locus_tag="VVM_00913"
FT                   /gene_family="HOG000094755" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor RpoE"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155314"
FT                   /db_xref="GeneID:10165225"
FT                   /translation="MNEQLTDQVLIERVQSGDKQAFNLLVVKYQNKVCNLISRYVSNPG
FT                   DVPDVAQEAFIKAYRAIPSFRGESAFYTWLYRIAVNTAKNHIVAQSRRPPASDVDADEA
FT                   ELYETGNALKEISNPENLTLSNELKQVVFSAINALPEDLKTAMTLRELDGLSYEEIAEV
FT                   MDCPVGTVRSRIFRAREAVEKKIQPLLQR"
FT                   /protein_id="YP_004187693.1"
FT   gene            523641..524261
FT                   /db_xref="GeneID:10165226"
FT                   /locus_tag="VVM_00914"
FT   CDS_pept        523641..524261
FT                   /locus_tag="VVM_00914"
FT                   /gene_family="HOG000272262" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma factor RpoE negative regulatory protein
FT                   RseA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155315"
FT                   /db_xref="GeneID:10165226"
FT                   /translation="MADKEKLSALMDGEIVDKALIKEIAQDDDVLASWRNYHLIGDVMR
FT                   GEAPQQPEWNIAESVALALENEPAHSLHQQKVIELTQMPPESQPLPQQARRQLPAWLSQ
FT                   FGQVAVAACVSLAVILGVQQYGGSDPAAPQADQLPVLQTIPFAGSAEPVSLTRESVEKS
FT                   MSESSIQEQRKRVHAMLRDYELQLRLNSDSSHIAGEQSTSEIE"
FT                   /protein_id="YP_004187694.1"
FT   gene            524258..525235
FT                   /db_xref="GeneID:10165227"
FT                   /locus_tag="VVM_00915"
FT   CDS_pept        524258..525235
FT                   /locus_tag="VVM_00915"
FT                   /gene_family="HOG000272273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma factor RpoE negative regulatory protein
FT                   RseB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155316"
FT                   /db_xref="GeneID:10165227"
FT                   /translation="MKKFLFSVCALFSVMTPQAFASDKPAEALLHQMSEASQNLSYELA
FT                   YILIKKNSIEPLLYRHASKEAQQYAHLIYLSGPVREVIKRGHEVSYIEPGVEPFTIQAG
FT                   EMVAPVMPMLGSDIDQLHKFYDYVQVGRAREAGSPTQVIRIVPKDGLRYSYVVWIDEQS
FT                   KLPLRADLVDRDGEVIEQYRAITYTVNQKIADLMSGLEDVQLPAVLTLPKGEVEKSNWR
FT                   VSWTPEGFVANDLSRYRLALTDQLVESQLFTDGLFSFSVYVAEKDDHSLKGQLVRQGRR
FT                   TLHSVVVGEHEISVVGDIPPATAQRIAQSVTFTAELNQNKAKPQ"
FT                   /protein_id="YP_004187695.1"
FT   gene            525232..525702
FT                   /db_xref="GeneID:10165228"
FT                   /locus_tag="VVM_00917"
FT   CDS_pept        525232..525702
FT                   /locus_tag="VVM_00917"
FT                   /gene_family="HOG000272284" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma factor RpoE regulatory protein RseC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155317"
FT                   /db_xref="GeneID:10165228"
FT                   /translation="MMTALATVTQVTPNDHGFEVALSCEQQTSCSSCSSQKSCGTGVVS
FT                   KAFGNKSLLWHLETQRRLHVGQVVEIGIPEQSLLQSAMLVYLLPIVAMLLGALFGHLVL
FT                   SPWLEMGEGAVVLTSMLFAFIGILLAKKLAQPLEQKSAAQVELMRVFGEPIA"
FT                   /protein_id="YP_004187696.1"
FT   gene            525816..527609
FT                   /db_xref="GeneID:10165229"
FT                   /locus_tag="VVM_00920"
FT   CDS_pept        525816..527609
FT                   /locus_tag="VVM_00920"
FT                   /gene_family="HOG000020624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor LepA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155318"
FT                   /db_xref="GeneID:10165229"
FT                   /translation="MKHIRNFSIIAHIDHGKSTLSDRLIQVCGGLSDREMAEQVLDSME
FT                   LERERGITIKAQSVTLDYKAQDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAIEMDLEVVPILNKIDLPAAEPERVAEEIEDIVGIDAIDAVRCSA
FT                   KTGLGVDDVLEKIVSAIPAPEGDPDAPLQALIIDSWFDNYLGVVSLVRIKHGKLKKNDK
FT                   IKVMSTGQVWGVDRLGIFTPKQIDTTELNTGEVGWVVCGIKDILGAPVGDTLTLAKNGA
FT                   EKALPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPENSAALGFGFRC
FT                   GFLGMLHMEIIQERLEREYDLDLITTAPTVVYEVLTTSKQTIYVDSPAKLPAVNDVAEI
FT                   REPIARCNILVPADYLGNVITLCIEKRGTQVDMVYHGNQVALTYDIPMAEVVLDFFDRL
FT                   KSTSRGYASLDYGFQRFEESNMVRVDVLLNGDKVDALAIITHKDQSQTRGRQLVEKMKE
FT                   FIPRQMFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLKKQKEGKKRMK
FT                   QIGNVELPQEAFLAILHVGKD"
FT                   /protein_id="YP_004187697.1"
FT   gene            527716..528615
FT                   /db_xref="GeneID:10165230"
FT                   /locus_tag="VVM_00922"
FT   CDS_pept        527716..528615
FT                   /product="signal peptidase I"
FT                   /gene_family="HOG000003674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00922"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="GI:320155319"
FT                   /db_xref="GeneID:10165230"
FT                   /translation="MANTFSLILVIVTLITGVVWLLEKLVWAKKRQQKVAEIESQTVNG
FT                   LDAQTLAKAKMQPWWVENSVSIFPVIAFVLVLRSFIYEPFQIPSGSMMPTLLVGDFILV
FT                   EKYAYGLKDPVWRTQLVETGKPERGDIVVFKYPPSPNIDYIKRVVGLPGDTVRYNRQKE
FT                   ICIQPKGESVCHMAIRNNVVESEFIQDGINLTQTDEQLGEVKHQILVNPLRQDRVEAYA
FT                   PRAGVSEWVVPQGQYFVMGDNRDNSADSRYWGFVPEANLVGKAVAIWISFEFDRGSDSV
FT                   LPSWIPTGVRFNRIGGIH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187698.1"
FT   gene            528638..529315
FT                   /db_xref="GeneID:10165231"
FT                   /locus_tag="VVM_00923"
FT   CDS_pept        528638..529315
FT                   /product="ribonuclease III"
FT                   /gene_family="HOG000246809" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00923"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="GI:320155320"
FT                   /db_xref="GeneID:10165231"
FT                   /translation="MNSPIEKLTRQLGYQFQDDELLNLALTHRSANSKHNERLEFLGDS
FT                   ILSFVIADELYHRFPKVNEGDMSRMRATLVRGNTLAELGREFGLGDYLKLGPGELKSGG
FT                   FRRDSILADAVEAIIGAVYLDSDLEVVRGIVLNWYASRLEAIKPGVSQKDPKTRLQEFL
FT                   QGRRKPLPVYTVTNIKGEAHNQEFTVECDIAGMDKPVVGRGTSRRKAEQAAAELALEQL
FT                   TNG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187699.1"
FT   gene            529308..530270
FT                   /db_xref="GeneID:10165232"
FT                   /locus_tag="VVM_00925"
FT   CDS_pept        529308..530270
FT                   /locus_tag="VVM_00925"
FT                   /gene_family="HOG000245597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTP-binding protein Era"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155321"
FT                   /db_xref="GeneID:10165232"
FT                   /translation="MADNEFDIDAFFSTEKKSTSSENQHCGFIAIVGRPNVGKSTLLNK
FT                   ILGQKISITSRKPQTTRHRIMGVDTDGDYQAIYVDTPGLHIEEKRAINRLMNRAANSSL
FT                   SDVNLVFFLVDGTHWTNDDEMVLNKLQKANFPVVLCVNKVDNVQDRNEVMQHMMEMSKK
FT                   MNFVDVVPISAKQGKNIDVLRKHVRDHLPKAVHHFPEEYVTDRSQRFMASEIVREKLMR
FT                   FTGDELPYSVTVEIERFDYNPETDGFHINALILVERSGQKKMVIGKGGEKIKTIGREAR
FT                   LDMEELFGRKVYLETWVKVKSGWADDERALRSLGYIDDL"
FT                   /protein_id="YP_004187700.1"
FT   gene            530356..531087
FT                   /db_xref="GeneID:10165233"
FT                   /locus_tag="VVM_00928"
FT   CDS_pept        530356..531087
FT                   /locus_tag="VVM_00928"
FT                   /gene_family="HOG000245560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA recombination and repair protein RecO"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155322"
FT                   /db_xref="GeneID:10165233"
FT                   /translation="MNAPDGLQRCFVLHRRPYSESSLILDVFSEEFGRITLMSKGARSK
FT                   RSNLKGALQPFTPLLLKWSGKGAMKTLRQAEPISLGLPLTGIYLYSAMYVNELVGRVLM
FT                   QEVPMPGLFHDYLFALTELAQADNPEPALRRFELALLAAMGYGVDFLHCAGTGEPIDPQ
FT                   MTYRYREQKGFIASVRRDNLTFLGNELIAISERRFLTKEQLQAAKRFTRIALKPYLGGK
FT                   PLKSRELFIQMRIPRTRSMEK"
FT                   /protein_id="YP_004187701.1"
FT   gene            531084..531815
FT                   /db_xref="GeneID:10165234"
FT                   /locus_tag="VVM_00929"
FT   CDS_pept        531084..531815
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /gene_family="HOG000258094" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00929"
FT                   /EC_number="2.6.99.2"
FT                   /db_xref="GI:320155323"
FT                   /db_xref="GeneID:10165234"
FT                   /translation="MSSIYLGVNIDHVATLRNARGTKYPDPVHAAEVAERAGADGITIH
FT                   LREDRRHITDRDVRILRETLQTRMNLEMAVTDEMIEIALKTQPEYVCLVPEKREELTTE
FT                   GGLDVAGHLDKIKAATEKLTAAGIKVSLFIDADREQIDAAKACGAPFIELHTGHYADAA
FT                   TEADQLDELKKIAAGASYAADLGITVNAGHGLTYHNVAPIAALPEIYELNIGHAIIGRA
FT                   VFDGLHKAVADMKAIMVAARQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187702.1"
FT   gene            531816..532196
FT                   /db_xref="GeneID:10165235"
FT                   /locus_tag="VVM_00931"
FT   CDS_pept        531816..532196
FT                   /product="holo-(acyl-carrier protein) synthase"
FT                   /gene_family="HOG000014316" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00931"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="GI:320155324"
FT                   /db_xref="GeneID:10165235"
FT                   /translation="MAIVGLGTDIAEIERVEKALARSGVAFAERILSAQEMETFVSLKQ
FT                   QGRFLAKRFAAKEAASKALGTGIAHGVSFQDFTIKNDGNGKPYLQLAGRAAELAHQMGV
FT                   CHTHLSLSDERHYAVATVIFES"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187703.1"
FT   gene            532488..533768
FT                   /db_xref="GeneID:10165236"
FT                   /locus_tag="VVM_00933"
FT   CDS_pept        532488..533768
FT                   /locus_tag="VVM_00933"
FT                   /gene_family="HOG000218401" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155325"
FT                   /db_xref="GeneID:10165236"
FT                   /translation="MLSVAFWPFRLSFLTLLGLLLSSSCTASANEVAFSGFGSVGYSYE
FT                   NEPDIGYLRNISQPPDVERNGSFLPDSNFGVQVDWALNYQWSLTAQWVLEDRVEQDFNN
FT                   VTELSFIRYLPDANWDLRIGRVGLNAYTAADSRRIDYAHLWVRPPQELYGSIFYDSIDG
FT                   LDVTYRSSINEVNWSASLQYGAISQVIEDERTKDHSEASSDHTLAIALTFDYHEWSGRF
FT                   SFVDVADLTVSLGPNSQQAQLGIAQLAQAGLGAASLEAAEIYAQSNINGESVKYWQVGL
FT                   GYFDGEWQMQSELFYVAGMKQAIPQGSGGYLMLGRSIHRFTPYVTVSFFEPTRDIVKAQ
FT                   SDWGLISPQLGQFQQLIISGINSTYIDQNTYSLGIRWDIHPQVAIKGQFDYIQIHDVGY
FT                   GLWAADGRSSTQGRDVQLYTLSVNFIF"
FT                   /protein_id="YP_004187704.1"
FT   gene            533820..534188
FT                   /db_xref="GeneID:10165237"
FT                   /locus_tag="VVM_00935"
FT   CDS_pept        533820..534188
FT                   /locus_tag="VVM_00935"
FT                   /gene_family="HOG000218400" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155326"
FT                   /db_xref="GeneID:10165237"
FT                   /translation="MPVYGEIFVVVSHESAIHQMNESEVADVYLGRKRSFGRVDITQVF
FT                   DRSDEVRARFFGKVANMRTSQINAYWAKLKFSGRMRAPDVIETDIELVEHLLANPNAIG
FT                   YMQTSPPEELKVVATIYE"
FT                   /protein_id="YP_004187705.1"
FT   gene            534169..535440
FT                   /db_xref="GeneID:10165238"
FT                   /locus_tag="VVM_00936"
FT   CDS_pept        534169..535440
FT                   /locus_tag="VVM_00936"
FT                   /gene_family="HOG000218399" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GGDEF domain-containing protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155327"
FT                   /db_xref="GeneID:10165238"
FT                   /translation="MPQFMNNLPRHSLANRLLRFVSICAIVYLVLLLALMIPFGFKNAQ
FT                   QAHTELEQKLVLSLSNSAAIALYVNNHEIAEEVIDSLLLHDEINAVRLESLEGVTFDKI
FT                   KPGQFEKDMWLHANQYPLLSPVDAKPLGILYVHDNHLVIQRKTLDKVLYQILFVLLQFL
FT                   MTFVVIALVVKRIIGKPLRALSIAVSRATPGQVKTVEVDDINRNNEIGLVASSINTFIE
FT                   NSHQALIREKELRSQIERWEIYYRGMAEQDTLTGLKNRLGCEKHFSHMKHSEAYLSLLL
FT                   IDLDGFKAVNDSHGHAVGDAVLSTIANRYLHLTQEHFNQSVVGRIGGDEFVIYLPHRDG
FT                   PEKMEAFLLAFAEQLIESSNTPIEVKQLQVHVGCSIGIATATAAKADMEKLLLQADNAM
FT                   YLAKQDGKNTARFFRRPVSQSVGN"
FT                   /protein_id="YP_004187706.1"
FT   gene            complement(535418..535543)
FT                   /db_xref="GeneID:10165239"
FT                   /locus_tag="VVM_00938"
FT   CDS_pept        complement(535418..535543)
FT                   /locus_tag="VVM_00938"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="BarA sensory histidine kinase ( VarS GacS)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155328"
FT                   /db_xref="GeneID:10165239"
FT                   /translation="MPLKENRRHGGFLSQQFSFSTNSLFTALRQPIERISYLPTG"
FT                   /protein_id="YP_004187707.1"
FT   gene            complement(535543..538329)
FT                   /db_xref="GeneID:10165240"
FT                   /locus_tag="VVM_00941"
FT   CDS_pept        complement(535543..538329)
FT                   /locus_tag="VVM_00941"
FT                   /gene_family="HOG000272329" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="BarA sensory histidine kinase ( VarS GacS)"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155329"
FT                   /db_xref="GeneID:10165240"
FT                   /translation="MTRYGLRARVITLTLAPTLIIGLLLSSFFSFNRYQDLERQVITTG
FT                   NSIIEPIAIASEPHLLSESREAVRRLVSYAHRKNSNLVRSIAVFDSKHELFVTSNFHPN
FT                   FESLTYPKDQPIPLLGNAEIRSDTMILRVPVLSEGHYLSDLAEPGEATRAIGYIAVELD
FT                   LSSLRLQQYQEVFSAFLVLILGLGLASVFASRLMQDVTQPITHMKNVVDRIRRGQLDVR
FT                   IEGKMHGELDSLKNGINAMAISLSEYHVEMQHSIDQATSDLRETLEQLEIQNVELDIAK
FT                   KRAQEAARVKSEFLANMSHELRTPLNGVIGFTRQMLKTQLTNSQTDYLQTIEKSANNLL
FT                   NIINDILDFSKLEAGKLALENIPFDFRESLEEVISLQATSAHEKGLEITLKIDPRIPEG
FT                   VVGDPLRIQQVLTNLVGNSIKFTERGNIDVSVEMRAQSGDSLDLQFMVKDTGIGISERQ
FT                   QAQLFQAFSQADASISRRYGGTGLGLVITQKLVSQMGGEISLTSRLHQGSTFWFTLRLH
FT                   STQMPMSDSIEAEYLQGKELLLVEPNMQAAAVTQQVLTQEGINVTYRSLLPDNAKGYDF
FT                   VLLSLAVNQVYELETIENWLSRALHISANTILAIPSTELALADQLTERFGIQCLTKPLG
FT                   RRKLLQSLAAKQTLQPLLPAPENAQAERSSLSVLAVDDNPANLKLITALLAERVVSVTS
FT                   CSSGQDAVDIATSRQFDLIFMDIQMPKMDGVTACKLIKQTELNANTPVIAVTAHAMSGE
FT                   RDRLLKAGMDDYLTKPIEEHILQQVLIHWNPNTCDSQVEKISPSYIATEESSVQQNIAR
FT                   SSDIIIDWQAALKQSANKEDLAKDMLRMLVEFIPEVESVVELALEQEDYPRDELIHVIH
FT                   KLHGSSSYCGVPRLKALCATIEQSLRSDADLMDVEPELFELQDEMLKVSTTAQLYLA"
FT                   /protein_id="YP_004187708.1"
FT   gene            538502..539818
FT                   /db_xref="GeneID:10165241"
FT                   /locus_tag="VVM_00942"
FT   CDS_pept        538502..539818
FT                   /product="23S rRNA (Uracil-5-) -methyltransferase RumA"
FT                   /gene_family="HOG000029868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00942"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320155330"
FT                   /db_xref="GeneID:10165241"
FT                   /translation="MARFFQPKKKLQPESKHQQVLVEKLDHQGAGIAYLNKKPLFIDGT
FT                   LPGEEVVTQLTESKSKFARGKLIKLLKPAAERVEPFCSHFNQCGGCDMQHMDYQAQLAY
FT                   KQRTLLQLMKKFSGSEILLSPPVTGLEKAYRRRARVSLMWDKKSRQLQFGFRRKQSKQI
FT                   ENVTQCPVLVAELECLLPELKAILSHFQHPEHLGHVELVAADNGAVITLRHTGPLLDED
FT                   VAKLRQCAEQHQATLYLMPASDQLERISGEAPYYQEIGFKVPFEPNNFIQVNQKVNQQM
FT                   VVQALEWLDPQSSDRVLDLFCGLGNFSLPIASKAKSVTGVEGVDEMVQKAAINASLNQI
FT                   NNAQFFHANLEQDFVGQPWASEKFDKILLDPARAGASGIIEQVSALGAKRVVYVSCNPA
FT                   TLARDSQSLLEQGYRLTKLGMLDMFPYTSHLESMALFEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187709.1"
FT   gene            539914..542139
FT                   /db_xref="GeneID:10165242"
FT                   /locus_tag="VVM_00945"
FT   CDS_pept        539914..542139
FT                   /product="GTP pyrophosphokinase , (p)ppGpp synthetase I"
FT                   /gene_family="HOG000018300" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00945"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="GI:320155331"
FT                   /db_xref="GeneID:10165242"
FT                   /translation="MVAVRSAHLNQNEQFELESWVASLKQDAGVSKRLIEVYRHCQTIL
FT                   QGHEHAELLLWRGREMIEILVTLSMDKATLVAAQLFPLVSSGAFAREPLEEHYSKEIIK
FT                   LIDGVDEMAAIGQLNITLEGSAASAQVDNVRRMLLAMVDDFRCVVIKLAERICNLIEVK
FT                   KAPDEVRRAAAKECANIYAPLANRLGIGQLKWEIEDYAFRYQQPDTYKQIAKQLSERRI
FT                   VREQYIKDFVDDLSEEMKECGINAEVSGRPKHIYSIWRKMQKKSLAFDELFDVRAVRII
FT                   ADKLQDCYAALGVVHTKYKHLPSEFDDYVANPKPNGYQSIHTVVLGPEGKTIEIQIRTK
FT                   QMHEDSELGVAAHWKYKEGSSSGRSGYDEKITWLRKLLDWQEEMSDSGEMLDELRSQVF
FT                   DDRVYAFTPRGDVVDLPMGATPLDFAYHIHSEVGHRCIGAKVAGRIVPFTHKLNMGDQV
FT                   EIITQKEPNPSRDWLNPSLGFVTSGRARAKINAWFRKQSREKNLEAGREILENELAKIG
FT                   ATLKDAEQYAVKRFNVKSADELYVGVGSGDLRINQILNHINALVNKPTAEEEDRQALER
FT                   LQEAGNKAAGSPTRPRKDAVVVQGVDNLMSHLARCCQPIPGDEICGYITQGRGISVHRA
FT                   DCEQLEELRHHAPERIIDTVWGSDVVGSYMLTVRVEAMERSGLLKDITTMLANEKIKVI
FT                   SMKSRLDYRTHLNVMDFELEVTNIEVLTRIMKRVEQIKDVMLVKRLG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187710.1"
FT   gene            542372..543181
FT                   /db_xref="GeneID:10165243"
FT                   /locus_tag="VVM_00948"
FT   CDS_pept        542372..543181
FT                   /locus_tag="VVM_00948"
FT                   /gene_family="HOG000272340" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside triphosphate pyrophosphohydrolase
FT                   MazG"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155332"
FT                   /db_xref="GeneID:10165243"
FT                   /translation="MSHPIEQLEQIMAKLRDPHSGCPWDLKQSFDTIVPHTIEETYEVV
FT                   DAIHNRDWLNLQEELGDLLFQVIFYSQLAKEQGLFDFSAVVETVNEKLTRRHPHVFGQV
FT                   EFETEAQIKANWEAEKAKEKAQIGKNEQSILDSIPNSLPALMRATKIQKKCAHYGFDWD
FT                   SLGPVVDKVKEEIEEVVEEALQVDVDDEKVELELGDLLFATVNLARHLQVNPEAALSKA
FT                   NLKFSNRFKQVEQGVHAKGKKLEECDLAELDAIWDQVKRAERSQAAE"
FT                   /protein_id="YP_004187711.1"
FT   gene            543373..545010
FT                   /db_xref="GeneID:10165244"
FT                   /locus_tag="VVM_00949"
FT   CDS_pept        543373..545010
FT                   /product="CTP synthase"
FT                   /gene_family="HOG000077515" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00949"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="GI:320155333"
FT                   /db_xref="GeneID:10165244"
FT                   /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLKVTMMKLDPYI
FT                   NVDPGTMSPTQHGEVFVTEDGAETDLDLGHYERFIRTKMTKRNNFTAGRVYSDVLAKER
FT                   RGDYLGATIQVIPHITNDIKDRVINGSQGHDVAIVEVGGTVGDIESLPFMEAIRQLAVE
FT                   IGRERAMFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILVCRSDRMIPANERK
FT                   KIALFCNVPEKAVISMKDVDSIYKIPQLIKSQGLDDLVCARFGINAPEADLSEWEQVIY
FT                   EEANPTGEVTIGMVGKYIELPDAYKSVNEALKHAGLKNRLSVNIKYVDSQDVETKGVEV
FT                   LQGLDAILVPGGFGDRGIEGKILAAKYARENKVPYLGICLGMQVALIEYARNVAGMEGA
FT                   HSTEFNKDTKYPVVGLITEWVDSEGNVEERTESSNLGGTMRLGSQLCHLAKGTKARELY
FT                   GSDTIHERHRHRYEVNNNLRPQIEKAGLKVSGLSADKKLVEMIENPNHPWFVAAQFHPE
FT                   FTSTPRDGHPLFSGFIKAAGENARGELK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187712.1"
FT   gene            545088..546389
FT                   /db_xref="GeneID:10165245"
FT                   /locus_tag="VVM_00953"
FT   CDS_pept        545088..546389
FT                   /product="enolase"
FT                   /gene_family="HOG000072173" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00953"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="GI:320155334"
FT                   /db_xref="GeneID:10165245"
FT                   /translation="MSKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGS
FT                   REALELRDGDKARFLGKGVLKAIEAVNGAIADALVGKDAKDQAAIDAIMIELDGTENKS
FT                   KFGANAILAVSLANAKAAAASKGMPLYEHIAELNGTAGQFSMPLPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTLKEAVRMGAEVFHNLAKVLKSKGYNTAVGDEGGFAPNLKSNAEA
FT                   LEVIAEAVAAAGYVLGKDVTLAMDCAASEFFDKEAGIYNMKGEGKTFTSEEFNHYLAGL
FT                   VEQFPIVSIEDGLDESDWAGFAHQTQLLGDKIQLVGDDLFVTNTKILAEGIEKGIANSI
FT                   LIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMS
FT                   RSDRVAKYNQLIRIEEALGERAPFNGLKEVKGQA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187713.1"
FT   gene            complement(546539..546670)
FT                   /db_xref="GeneID:10165246"
FT                   /locus_tag="VVM_00955"
FT   CDS_pept        complement(546539..546670)
FT                   /locus_tag="VVM_00955"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155335"
FT                   /db_xref="GeneID:10165246"
FT                   /translation="MTEPYTRSLFYLSVIGGLAEILAIKNTLKKQFFKSFNLSEQFN"
FT                   /protein_id="YP_004187714.1"
FT   gene            546777..547058
FT                   /db_xref="GeneID:10165247"
FT                   /locus_tag="VVM_00956"
FT   CDS_pept        546777..547058
FT                   /locus_tag="VVM_00956"
FT                   /gene_family="HOG000262021" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cell division protein FtsB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155336"
FT                   /db_xref="GeneID:10165247"
FT                   /translation="MRLFILVLTLLFGWLQYTLWFGKNGVSDYYTIESDIEAQQLVNTK
FT                   LQARNSEMYAEIDDLKQGLDAIEERARHELGMLKEGETFYRIVGEENQ"
FT                   /protein_id="YP_004187715.1"
FT   gene            547058..547771
FT                   /db_xref="GeneID:10165248"
FT                   /locus_tag="VVM_00958"
FT   CDS_pept        547058..547771
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   /gene_family="HOG000218564" [ FAMILY / ALN / TREE ]
FT                   cytidylyltransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00958"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="GI:320155337"
FT                   /db_xref="GeneID:10165248"
FT                   /translation="MARSMTSLVAVVPAAGVGSRMKADRPKQYLQIHGKTILEHTIERL
FT                   LSHPAITQVVVAVSEDDPYYLELAIAQHPDIIRVAGGKERADSVLSALRFLSQQPQKTD
FT                   WVLVHDAARPCVAHQDIDALIERCSSHETGGILATPVRDTMKRANAQQMIDHTVDRNAL
FT                   WHALTPQMFKAEVLTDALSDALAQGVAITDEASALEWRGELPALVQGCSSNIKVTQPED
FT                   LALAEFYLSREKDRK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187716.1"
FT   gene            547768..548244
FT                   /db_xref="GeneID:10165249"
FT                   /locus_tag="VVM_00959"
FT   CDS_pept        547768..548244
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   /gene_family="HOG000239175" [ FAMILY / ALN / TREE ]
FT                   synthase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00959"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="GI:320155338"
FT                   /db_xref="GeneID:10165249"
FT                   /translation="MIRIGHGFDVHKFGGEGPVIIGGVAVPYEQGLIAHSDGDVALHAL
FT                   SDALLGAIAAGDIGRHFPDTDDKWKGADSRELLKDVYRRVKEQGYKLGNADVTIIAQAP
FT                   KMAPYIDAMREAIAHDLETDIRNINVKATTTERLGFTGRKEGIATEAVVLLIKQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187717.1"
FT   gene            548280..549323
FT                   /db_xref="GeneID:10165250"
FT                   /locus_tag="VVM_00960"
FT   CDS_pept        548280..549323
FT                   /product="tRNA pseudouridine 13 synthase"
FT                   /gene_family="HOG000224848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00960"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="GI:320155339"
FT                   /db_xref="GeneID:10165250"
FT                   /translation="MTDTLASLAYLAGKPTAQAKIKAKPEHFQVREDLGFEFTGSGEHL
FT                   MVRIRKTGENTSFVANELAKACGVKSKDVSWAGLKDRHAVTEQWLSVHLPKAETPDFSA
FT                   FLAQYPSIEILTTARHNKKLRPGDLVGNDFVVTLSEVSDVDDVLKRLETVAKLGVPNYF
FT                   GNQRFGNNGNNLQEAKRWGRDNVRSRNQNQRSLYLSAARSWIFNLIVSARLEQSLFDKV
FT                   LLGDILFKGDEQLLVSAENHADLQSQYDAGDLVISGALAGDNALPTQDDALALEQVFLD
FT                   AEPDLMALIRGNRMRHDRRAIALKPANLSWQVDGNSIILTFSLDAGSFATSIIRELVQE
FT                   IAFEREF"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187718.1"
FT   gene            549329..550096
FT                   /db_xref="GeneID:10165251"
FT                   /locus_tag="VVM_00961"
FT   CDS_pept        549329..550096
FT                   /product="5-nucleotidase SurE"
FT                   /gene_family="HOG000122501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00961"
FT                   /EC_number="3.1.3.5"
FT                   /db_xref="GI:320155340"
FT                   /db_xref="GeneID:10165251"
FT                   /translation="MEDKQAKPLRILLSNDDGVFAEGIRTLASELRTLAEVIIVAPDRN
FT                   RSGASNSLTLEQPLRVTCVEENMYSVQGTPTDCVHFALNELLKNDLPDLVLSGINHGAN
FT                   LGDDVLYSGTVAAAMEGHFLGVQSIAFSLVGKNHFKTAATIAKRIVEQHLAKPIPTNRL
FT                   LNINIPDLPLEQLKEIRVTRLGARHHAENMIKQLDPRGHEIYWLGPPGKEQDAGEGTDF
FT                   HAIEQGYVSITPLQVDLTAHESLRAMDTWLKEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187719.1"
FT   gene            550099..550725
FT                   /db_xref="GeneID:10165252"
FT                   /locus_tag="VVM_00962"
FT   CDS_pept        550099..550725
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /gene_family="HOG000257189" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00962"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="GI:320155341"
FT                   /db_xref="GeneID:10165252"
FT                   /translation="MSNPQAERLVHFLAVNGIRDSEVLSAIARVPRECFLSQAMMHQAY
FT                   DNNALPIGQGQTISQPYIVAKMTELLRLKRDSKVLEIGTGSGYQTAVLALLVEHVYSVE
FT                   RIKSLQWDAKRRLKQLDIYNVSTKHGDGWLGWENKGPFDAIIVTAAAESVPPVLLQQLN
FT                   DGGRMVLPVGTDEQQLILIERQKDQFVSQVIEAVNFVPLIAGDLA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187720.1"
FT   gene            550769..551665
FT                   /db_xref="GeneID:10165253"
FT                   /locus_tag="VVM_00964"
FT   CDS_pept        550769..551665
FT                   /locus_tag="VVM_00964"
FT                   /gene_family="HOG000159026" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipoprotein NlpD"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155342"
FT                   /db_xref="GeneID:10165253"
FT                   /translation="MILSTALLVGCAAHIPAPVTGLSKDYNAVDRGSYRGSYYEVEKGD
FT                   TLYFISYVTDKDVNELIRFNNLTEPYTIYPGQKLKLWAPAYVAPKYGQTVEAPVTTVVA
FT                   ASTVAVVTPKPTPTTPKKSNNNSTQKPAKPAPQVVKKDPVKGIDQSKPKEYVGSKGKEN
FT                   VKPITSPPPANNQKIAKWQWPTKGRVIKNFSAGEQGNKGIDIAGQRGQPIVSTAGGTVV
FT                   YSGNALRGYGNLIIVKHNDNYLSAYAHNDRLLVSEGQSVKAGQQIATMGSSGAKTVMLH
FT                   FEIRYQGKSVNPKRYLP"
FT                   /protein_id="YP_004187721.1"
FT   gene            551746..552738
FT                   /db_xref="GeneID:10165254"
FT                   /locus_tag="VVM_00967"
FT   CDS_pept        551746..552738
FT                   /locus_tag="VVM_00967"
FT                   /gene_family="HOG000270273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA polymerase sigma factor RpoS"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155343"
FT                   /db_xref="GeneID:10165254"
FT                   /translation="MSISNTVTKVKDFDVNQMDDDFNDDIEINEKEDLTEEKVKLREEF
FT                   DASNKSLDATQLYLGEIGFSPLLTAEEEVLYARRALRGDEAARKRMIESNLRLVVKISR
FT                   RYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERALMNQTRTIR
FT                   LPIHVVKELNIYLRTARELSQKLDHEPTAEEIAAQLDIPVDDVSKMLRLNERISSVDTP
FT                   IGGDGEKALLDIIPDANNSDPEVSTQDEDMRVSLIHWLEELNPKQKEVLARRFGLLGYE
FT                   PSTLEEVGQEIGLTRERVRQIQVEGLRRLREVLIKQGLNMENLFDIDMD"
FT                   /protein_id="YP_004187722.1"
FT   gene            complement(552814..555375)
FT                   /db_xref="GeneID:10165255"
FT                   /locus_tag="VVM_00972"
FT   CDS_pept        complement(552814..555375)
FT                   /locus_tag="VVM_00972"
FT                   /gene_family="HOG000221407" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155344"
FT                   /db_xref="GeneID:10165255"
FT                   /translation="MKAEQQHTPMMQQYLRLKAENPDILLFYRMGDFYELFYDDAKKAS
FT                   QLLDISLTKRGASAGEPIPMAGVPFHAVEGYLAKLVQLGESVAICEQVGDPATSKGPVE
FT                   RKVVRIVTPGTVTDEALLSERLDNLIAAIYHHNGKFGYATLDVTSGRFQLVEPQSEEAM
FT                   AAELQRTSPRELLFPEDFEPVHLMTGRNGNRRRPVWEFELETAKQQLNQQFGTKDLVGF
FT                   GVENAVLGLCAAGCLIQYVKDTQRTALPHIRALTYDRQDDSVILDAATRRNLELTQNLA
FT                   GGSDNTLAAVLDRCATPMGSRMLKRWIHQPMRCITTREHRLDAIAELKEQALFSDIHPV
FT                   VKQIGDIERILARLALRSARPRDLARLRHAMQQLPELAQTLSSLGNSHLKSLATAAAPM
FT                   DDVCELLERAIKENPPVVIRDGGVIAEGYSADLDEWRDLADGATGYLEKLEEEERDRHG
FT                   IDTLKVGYNNVHGFYIQVSRGQSHLVPPHYVRRQTLKNAERYIIPELKEHEDKVLNSKS
FT                   KALAIEKQLWEELFDLLLPHLARLQELASAVAQLDVLQNLAERADTLDYCRPNLTKDPV
FT                   VHITAGRHPVVEQVTSDPFIANPIELNSQRKMLIITGPNMGGKSTYMRQTALIALMAHI
FT                   GSYVPAESATIGSIDRIFTRIGASDDLASGRSTFMVEMTETANILHNATANSLVLMDEI
FT                   GRGTSTYDGLSLAWASAHWLATQIGAMTLFATHYFELTELPNQLPHLANVHLDAVEHGD
FT                   SIAFMHAVQEGAASKSYGLAVAGLAGVPKTVIKNARQKLSQLELLSAEGSQPKARTVDI
FT                   ANQLSLIPEPSEVEQALASIDPDDLTPRQALEALYRLKKML"
FT                   /protein_id="YP_004187723.1"
FT   gene            555459..555962
FT                   /db_xref="GeneID:10165256"
FT                   /locus_tag="VVM_00973"
FT   CDS_pept        555459..555962
FT                   /locus_tag="VVM_00973"
FT                   /gene_family="HOG000242527" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA repair function protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155345"
FT                   /db_xref="GeneID:10165256"
FT                   /translation="MQSLIQLSEQLGERLLQQGEVLATAESCTGGGVANMVTEVAGSSA
FT                   WFDRAFVTYSNEAKQEMLGVAEKTLADFGAVSEAVVKEMVLGTLAHSNATIAVSISGIA
FT                   GPSGGSPEKPVGTVCFGFADKHGWLRCETCYFAGDRAKVRIQAIEYSLKVLCDALLKND
FT                   SERQ"
FT                   /protein_id="YP_004187724.1"
FT   gene            556096..557145
FT                   /db_xref="GeneID:10165257"
FT                   /locus_tag="VVM_00974"
FT   CDS_pept        556096..557145
FT                   /locus_tag="VVM_00974"
FT                   /gene_family="HOG000264120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RecA protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155346"
FT                   /db_xref="GeneID:10165257"
FT                   /translation="MDENKQKALAAALGQIEKQFGKGSIMRLGDNRAMDVETISTGSLS
FT                   LDIALGAGGLPMGRIVEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAK
FT                   KLGVNIDQLLVSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEMGDSHM
FT                   GLQARMLSQAMRKLTGNLKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRL
FT                   DIRRTGAIKEGDEVVGNETRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKCK
FT                   LIEKSGAWYSYNGDKIGQGKANACKYLKENVDVAKVLDTKLREMLLSPANINDESAELV
FT                   EEMPEQEEF"
FT                   /protein_id="YP_004187725.1"
FT   gene            557249..557710
FT                   /db_xref="GeneID:10165258"
FT                   /locus_tag="VVM_00976"
FT   CDS_pept        557249..557710
FT                   /locus_tag="VVM_00976"
FT                   /gene_family="HOG000242561" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="regulatory protein RecX"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155347"
FT                   /db_xref="GeneID:10165258"
FT                   /translation="MHHRFTPPMMSCKDTAIQLLSRRDHGQYELRQKLTVKGYTSQDIE
FT                   SAMHFCLEHGYLDDLRYAKSQIRQHVGKGHGERRIRQELSLKQVSDSVVENAFAEEPQD
FT                   WFELAKSVAMKKFNGVKAKEQKEYAKQVRFLQYRGFSFEQIRYALSDEA"
FT                   /protein_id="YP_004187726.1"
FT   gene            557890..560472
FT                   /db_xref="GeneID:10165259"
FT                   /locus_tag="VVM_00977"
FT   CDS_pept        557890..560472
FT                   /product="alanyl-tRNA synthetase"
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00977"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="GI:320155348"
FT                   /db_xref="GeneID:10165259"
FT                   /translation="MYMSTDEVRNAFLKFFESKGHQIVDSSSLVPHNDPTLLFTNAGMN
FT                   QFKDCFLGAEKRAYTRATTAQRCVRAGGKHNDLENVGFTARHHTFFEMLGNFSFGDYFK
FT                   EDAIAFAWEFLTETLKLPKDRLLVTVYETDDEAFDIWNQKVGVPADRIIRIGDKKGGKQ
FT                   YESDNFWTMGDTGPCGPCTEIFYDHGEHIWGGRPGTPEEDGDRFIEIWNNVFMQFNRHA
FT                   DGTMEPLPKPSVDTGMGIERISAIMQGVHSNYEIDVFQKLIKATAEIVGCEDLSNQSLR
FT                   VIADHIRSCSFLIADGVMPSNEGRGYVLRRIIRRAVRHGNKLGAQGVFFHKLVGVLAEV
FT                   MGSAADELKKQQAVVEKVLRIEEENFGRTLERGMVILNEALDALEGKELDGETVFKLYD
FT                   TYGFPADLTNDVARERDFTIDEAGFEKAMEEQRQRAREAGQFGTDYNAKIKTESETEFC
FT                   GYTGTQGNSVVAEIFVEGEAADSLSAGDKAIIILGETPFYAESGGQCGDSGVLKTESGL
FT                   FQVEDTQKLGNAIAHHGVLVEGVLAKGDQVSAIVDAERRAAISLNHSATHLLHAALRQV
FT                   LGEHVAQKGSLVKAENLRFDFSHLEAVTAAELKEVERLVNAQIRRNHAIETNIMDIESA
FT                   KQKGAMALFGEKYDDEVRVLSMGDFSTELCGGIHASNTGDIGLFKITSEGGIAAGIRRI
FT                   EAVTGEAALEAIDAQARKFEEKLQDAANKAKSLEKEIQQLKDKLASQASANLIDQVKEI
FT                   AGVKVLVAKLDGADNKALRGMVDELKNQMGSGIIMLGNVADDKVGLIAGVTQDLTSKVK
FT                   AGELVNMVAQQVGGKGGGRPDMAQAGGTDSSALPSALASVDAWIAERL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187727.1"
FT   gene            560711..561856
FT                   /db_xref="GeneID:10165260"
FT                   /locus_tag="VVM_00981"
FT   CDS_pept        560711..561856
FT                   /product="aspartokinase"
FT                   /gene_family="HOG000293093" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00981"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="GI:320155349"
FT                   /db_xref="GeneID:10165260"
FT                   /translation="MGSIERIHTVAEHIIKAKNDGNQVVVVVSAMAGETNRLLDLAKQV
FT                   DSVPTARELDVLLSAGEQVSMALLAMTLNKLGYAARSLTGAQANIVTDTQHNDATIKHI
FT                   DTTPINELLEQDQIVIVAGFQGVNENGDITTLGRGGSDTSAVTLAGALAADECQIFTDV
FT                   DGIYTCDPRVVKTAQKLDIIDFPSMEEMARKGAKVLHLPCVQFAWENEVPLRVLSTFEI
FT                   NEGSLVKGETGTQAVCGIALQRDLAMIKVSKESLSSLTKQCQMLGIEIWNVIEEADWAG
FT                   IMIKQDACAKLDLVFSDKIRNSEAVSLLTVVGLEANSLMQHACDALTTQGIAIRHQCVT
FT                   PLSSMLVVSPESVDQAANILHDAYISSNEALNIQQKQAFLG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187728.1"
FT   gene            561948..562139
FT                   /db_xref="GeneID:10165261"
FT                   /locus_tag="VVM_00982"
FT   CDS_pept        561948..562139
FT                   /locus_tag="VVM_00982"
FT                   /gene_family="HOG000020767" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="carbon storage regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155350"
FT                   /db_xref="GeneID:10165261"
FT                   /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKDVSVHRE
FT                   EIYMRIQAEKGNVTPGNY"
FT                   /protein_id="YP_004187729.1"
FT   gene            562520..562611
FT                   /db_xref="GeneID:10165262"
FT                   /locus_tag="VVM_t00051"
FT   tRNA            562520..562611
FT                   /note="anticodon GCT"
FT                   /db_xref="GeneID:10165262"
FT                   /locus_tag="VVM_t00051"
FT                   /product="tRNA-Ser"
FT   gene            562641..562717
FT                   /db_xref="GeneID:10165263"
FT                   /locus_tag="VVM_t00052"
FT   tRNA            562641..562717
FT                   /note="anticodon ACG"
FT                   /db_xref="GeneID:10165263"
FT                   /locus_tag="VVM_t00052"
FT                   /product="tRNA-Arg"
FT   gene            562741..562832
FT                   /db_xref="GeneID:10165264"
FT                   /locus_tag="VVM_t00053"
FT   tRNA            562741..562832
FT                   /note="anticodon GCT"
FT                   /db_xref="GeneID:10165264"
FT                   /locus_tag="VVM_t00053"
FT                   /product="tRNA-Ser"
FT   gene            562917..562993
FT                   /db_xref="GeneID:10165265"
FT                   /locus_tag="VVM_t00054"
FT   tRNA            562917..562993
FT                   /note="anticodon ACG"
FT                   /db_xref="GeneID:10165265"
FT                   /locus_tag="VVM_t00054"
FT                   /product="tRNA-Arg"
FT   gene            563084..563160
FT                   /db_xref="GeneID:10165266"
FT                   /locus_tag="VVM_t00055"
FT   tRNA            563084..563160
FT                   /note="anticodon ACG"
FT                   /db_xref="GeneID:10165266"
FT                   /locus_tag="VVM_t00055"
FT                   /product="tRNA-Arg"
FT   gene            563205..563281
FT                   /db_xref="GeneID:10165267"
FT                   /locus_tag="VVM_t00056"
FT   tRNA            563205..563281
FT                   /note="anticodon ACG"
FT                   /db_xref="GeneID:10165267"
FT                   /locus_tag="VVM_t00056"
FT                   /product="tRNA-Arg"
FT   gene            563371..563447
FT                   /db_xref="GeneID:10165268"
FT                   /locus_tag="VVM_t00057"
FT   tRNA            563371..563447
FT                   /note="anticodon ACG"
FT                   /db_xref="GeneID:10165268"
FT                   /locus_tag="VVM_t00057"
FT                   /product="tRNA-Arg"
FT   gene            563490..563566
FT                   /db_xref="GeneID:10165269"
FT                   /locus_tag="VVM_t00058"
FT   tRNA            563490..563566
FT                   /note="anticodon ACG"
FT                   /db_xref="GeneID:10165269"
FT                   /locus_tag="VVM_t00058"
FT                   /product="tRNA-Arg"
FT   gene            564124..564327
FT                   /db_xref="GeneID:10165270"
FT                   /locus_tag="VVM_00985"
FT   CDS_pept        564124..564327
FT                   /product="oxaloacetate decarboxylase subunit gamma"
FT                   /gene_family="HOG000295695" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00985"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="GI:320155351"
FT                   /db_xref="GeneID:10165270"
FT                   /translation="MGVVFIFLTILIFLVRLMSKLVPQEVPPPIAAPKAAKNQANHTST
FT                   VSPQVVAAISAAIHQHRASVAK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187730.1"
FT   gene            564359..566143
FT                   /db_xref="GeneID:10165271"
FT                   /locus_tag="VVM_00987"
FT   CDS_pept        564359..566143
FT                   /product="oxaloacetate decarboxylase subunit alpha"
FT                   /gene_family="HOG000231389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00987"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="GI:320155352"
FT                   /db_xref="GeneID:10165271"
FT                   /translation="MSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKVGYWSLE
FT                   TWGGATFDACIRFLGEDPWERLRELKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVE
FT                   RAHANGMDVFRIFDAMNDVRNFQKAVKATVDVGAHAQGTLSYTTSPVHNTDTWVDLAKR
FT                   LEDLGCHSLCIKDMSGLLKPYEAQELITRIKASCDIPLALHCHATTGLSTATAIKAVEA
FT                   GIDILDTAISSMSCTYGHTPTETVVAMLQGTERDTNLDLAQIEPIAAYFREVRKKYAKF
FT                   EGQLKGVDSRILIAQVPGGMLTNMESQLKEQGAADRIDEVLEEIPRVREDLGFIPLVTP
FT                   TSQIVGTQAVINVLTGERYKSITKETAGVLKGEYGAAPAPVNAQLQARVLNGAEAVTCR
FT                   PADLLEAELHTLTDELLAKAQSEGIQLANESVDDVLTYALFPQVGLKFLKNRGNPDAFE
FT                   PAPTLEVAQPAATKAVSGAVEAYSVRVDGQVFHVEVGPEGQLTSVTPAAAPASTPIAAP
FT                   VAAVPSDAEAVSAPLAGNIFKVHVQAGSSVEEGDILLILEAMKMETEVRAARSGVVHEL
FT                   NVKEGDAVTVGSPLLSLA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187731.1"
FT   gene            566153..567283
FT                   /db_xref="GeneID:10165272"
FT                   /locus_tag="VVM_00988"
FT   CDS_pept        566153..567283
FT                   /product="oxaloacetate decarboxylase subunit beta"
FT                   /gene_family="HOG000295684" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00988"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="GI:320155353"
FT                   /db_xref="GeneID:10165272"
FT                   /translation="MDGLITLWSETGIAHFELGQICMIAVGCVLLFLAISKGFEPLLLL
FT                   PIGFGAILANIPNAGFTEPGGLLYYVYYIGIESGVFPLLIFMGVGAMTDFGALIANPKT
FT                   LWLGAAAQFGIFATLFGAILLNYVPGMEFSMEDASSIAIIGGADGPTAIFLASRLSPDL
FT                   LGAIAVAAYSYMALVPIIQPPIMKALTTPEERKIKMAQLRHVGKVEKVLFPLAVLVMTI
FT                   LFLPSATPLVGMFCLGNLMREAGVVERLSKTAQNELINIVTIFLGLGVGSKLQAEHFLN
FT                   VETLGILALGAAAFSIGTGAGVLMAKLLNKFSEEDINPLIGAAGVSAVPMAARVVNKVG
FT                   LEANSQNFLLMHAMGPNVAGVLGSAVAAGVLLALVG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187732.1"
FT   gene            567403..568353
FT                   /db_xref="GeneID:10165273"
FT                   /locus_tag="VVM_00991"
FT   CDS_pept        567403..568353
FT                   /locus_tag="VVM_00991"
FT                   /gene_family="HOG000294678" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="NADPH:quinone reductase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155354"
FT                   /db_xref="GeneID:10165273"
FT                   /translation="MENKQIVITEFGGPDVLAIRSSQMPEPKPGQVVIKVYFSGINPID
FT                   VKTRAGLGWAAAQNKDKLPWVPGYDISGKVVSCGENAERFVIGDTVAGFVGFPLEGGGY
FT                   SQYLCVDEDALSLVPGSVTLEGAAVLPLAGQTAAQALNKAQVKEGERVLILAGAGGVGH
FT                   LAVQIAVAAKAEVYTTCSERNLDYMATLGAHAINYQFAPASERLSDVDVLIDLVGGDVA
FT                   LDALKCLKDNARVVTVPTLSAEMICEKAKLLGFEATGMLVEPDPQQLDTLLYMVGVGLL
FT                   KTEIQRIYPMHEVSDAHKQIETGHTRGKVLLDMQC"
FT                   /protein_id="YP_004187733.1"
FT   gene            568347..568808
FT                   /db_xref="GeneID:10165274"
FT                   /locus_tag="VVM_00993"
FT   CDS_pept        568347..568808
FT                   /locus_tag="VVM_00993"
FT                   /gene_family="HOG000183101" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155355"
FT                   /db_xref="GeneID:10165274"
FT                   /translation="MLETFNGWFAEAALWFSDSALWVLFFTGFLSATLLPGGSEASLIA
FT                   TLSLNQFPISHIIIVATLGNTLGGLTNYWLGLLLPNRTQQEKHGHTALRWLAKYGYWGL
FT                   FFSWLPVIGDPLCLAAGWLRMKFLPCLVLIALGKAVRYSVLAMLYIGLF"
FT                   /protein_id="YP_004187734.1"
FT   gene            568818..571676
FT                   /db_xref="GeneID:10165275"
FT                   /locus_tag="VVM_00994"
FT   CDS_pept        568818..571676
FT                   /locus_tag="VVM_00994"
FT                   /gene_family="HOG000271996" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protease, insulinase family/protease, insulinase
FT                   family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155356"
FT                   /db_xref="GeneID:10165275"
FT                   /translation="MKKLMLSACSLFVLAGCSSVKSVSVPFFSSLPEGVTLIEESSAQA
FT                   GKVKIPYEKYRLENGLTVILSPDHSDPLVHVDVTYHVGSAREEIGKSGFAHFFEHMMFQ
FT                   GSENVGDQQHFKIITEAGGTLNGTTNRDRTNYFETVPANQLEKMLWLESDRMGFLLDAV
FT                   SQRKFEVQRDTVKNERAQRYDNRPYGLIWEKMAEAIYPEGHPYSWQTIGYVDDLDRVDV
FT                   NDLKAFFLRWYGPNNAVLTIGGDIDTDQTLEWVNKYFGSIPRGPEVDNAPKQPATLKEN
FT                   RFITLEDRIRQPMVMMAWPTTYNGEEHQASLDALASLLGEGNNSLLYQNLVKTQKAVDA
FT                   GAFQDCAELACTFYVYAMGDSGDKGDLASLYQELMQTLDEFKQKGADGKRLEQIIGKAE
FT                   ADAVFSLQSVSGKVSQLAANETFFATPDRIEYQLDQLRAVTADSVNQAYQQFIDGKNKV
FT                   TLSVVPTGKTDMAVQKANFVTPARTLPEYQKITDDQLAYRKAEDSFDRSQMPSAGEPVK
FT                   AEMPDLYKVHFDNGSELLGAVSDETPTVLMQFRFPAGSRFDPVGKEGLAKLTAAMMEEG
FT                   TTSRSAEELQAELDKLGSNISVSAERYSTTVTLSALEKNLPATLEIFQQMIRSPAFDED
FT                   DFARAKKQMIEGAVYEQQQPSWMASQATRQVIYGDTLFARSSDGTMASLQALTLADVKA
FT                   FYQSHYTPQSTQIVVVGDLNRREMASQLAFWKAWQGEAAPLYRPQVVKPLSDSKIYLVD
FT                   KPGAPQSVIRMVRLGLPYDATGEMFLSQLANFNLAGNFNSRLNQNLREDKGYTYGAQGY
FT                   FASNLETGVVVFDAQVRADATIPALMEMENELNEFSQSGMTDDELHFMRQAVGQQDALK
FT                   YETPGQKAQLIGNILRYSLDEDYLKQRNAIVESIDKAPLNDLAKKWFDPNDYQMIVVGD
FT                   AKTLRPQLEKLNKAVEELEIIR"
FT                   /protein_id="YP_004187735.1"
FT   gene            571835..573400
FT                   /db_xref="GeneID:10165276"
FT                   /locus_tag="VVM_00997"
FT   CDS_pept        571835..573400
FT                   /product="glutamate--cysteine ligase"
FT                   /gene_family="HOG000266224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_00997"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="GI:320155357"
FT                   /db_xref="GeneID:10165276"
FT                   /translation="MTDFAARLELVARNPEVFKQFGRGVERETLRYSQNGRIATTMHPQ
FT                   GLGSAFTNQWITTDFAESLLEFITPVSHDIDVLLGQLDDIHHFTQTQLGEEKMWPMSMP
FT                   CYVETEDQITLAQYGSSNSAKMKTLYREGLKRRYGSLMQIISGVHFNFSFPESFWDALH
FT                   GEQTAEERQATKSEAYFGLIRNYYRFGWLIPYFFGASPAMCSSFLQGRETSLPFEALGK
FT                   TLYLPKATSLRLSDLGYTNSAQSVLTIGFNSIDEYLEGLSKAIRTPSAEFAKLGVKENG
FT                   EYRQLNSNVLQIENELYAPIRPKRVAKNGEKPSEALARGGVEYIEVRSLDVNPFTPVGI
FT                   TETQVRFLDLFLTWAALSESQPMDQCELACWRENWNKVVVSGREYGLELQIGCKGEKLS
FT                   LQAWAHRVFAELRQLAEVMDSAHGDNQYSLACSELEQWIDHPEKTLSAQLLTLIQQNGS
FT                   LGATGCELGRAYREQNLAHHYRHFSLQQMEQEVALSLIKQSQIEQADEVDFDTYLADYF
FT                   AYLK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187736.1"
FT   gene            573411..574043
FT                   /db_xref="GeneID:10165277"
FT                   /locus_tag="VVM_01000"
FT   CDS_pept        573411..574043
FT                   /locus_tag="VVM_01000"
FT                   /gene_family="HOG000271906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155358"
FT                   /db_xref="GeneID:10165277"
FT                   /translation="MTGASAERGMSKIARRVLLLGLVGLSGCATTPPAQQNNLCDIFRE
FT                   KPRWYKDALAMEKEWGTPIQVAMAFVKQESSFRHDARPPKDYILGFIPWGHVSSAYGYA
FT                   QAQDPAWEDFQRATGHGGSRTNFDDSLMFIGWYTSETRKQLGVSLWDPYNQYLAYHEGR
FT                   GGYQRKSYQRKPSLIKVARKVEQQTKDYGWQLKQCRQELEDNRSWFF"
FT                   /protein_id="YP_004187737.1"
FT   gene            574094..574612
FT                   /db_xref="GeneID:10165278"
FT                   /locus_tag="VVM_01002"
FT   CDS_pept        574094..574612
FT                   /product="S-ribosylhomocysteine lyase/autoinducer-2
FT                   /gene_family="HOG000040371" [ FAMILY / ALN / TREE ]
FT                   production protein LuxS"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01002"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="GI:320155359"
FT                   /db_xref="GeneID:10165278"
FT                   /translation="MPLLDSFTVDHTRMHAPAVRVAKTMQTPKGDTITVFDLRFTAPNK
FT                   DILSEKGIHTLEHLYAGFMRKHLNGASVEIIDISPMGCRTGFYMSLIGAPSEQDVASAW
FT                   TASMEDVLKVESQNKIPELNEYQCGTAAMHSLDEAKQIAQNILAAGISVNKNDELALPE
FT                   AMLKELKVD"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187738.1"
FT   gene            complement(574702..575979)
FT                   /db_xref="GeneID:10165279"
FT                   /locus_tag="VVM_01004"
FT   CDS_pept        complement(574702..575979)
FT                   /locus_tag="VVM_01004"
FT                   /gene_family="HOG000062298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hemolysins-like protein containing CBS domains"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155360"
FT                   /db_xref="GeneID:10165279"
FT                   /translation="MDDISTGILFALLACLIVISGYFSGSETGMMSLNRYRLKHLANSG
FT                   HKGAKRVEKLLSRPDRLIGLILIGNNLVNILASAIATILGMRLYGDLGVAIATGALTLV
FT                   VLVFAEVTPKTVAALYPERVSYASSILLVVLMKLLSPLVMLVNFITNGFIRLLGLKAQH
FT                   NGEDNLSSEELRTVVNEAGSLIPQRHQDMLVSILDLEHVTVNDIMIPRNEITGIDINDD
FT                   WKSIVRQLTHSPHGRIVLYRDKIDEAVGMLRLREAYRLMLEKNEFNKETLLRAADEVYF
FT                   IPESTPLNVQLLKFQRNKQRIGLIVDEYGDIIGLVTLEDILEEIVGEFTTSIAPSLSDE
FT                   ITPQGDGSFLIEGSTNIRDINKGLKWKLPTDGPRTLNGLILEHLEDIPESHLSVKVAGH
FT                   AMEIVELEENRIKSVKVFPKRKRKTT"
FT                   /protein_id="YP_004187739.1"
FT   gene            complement(576066..576860)
FT                   /db_xref="GeneID:10165280"
FT                   /locus_tag="VVM_01006"
FT   CDS_pept        complement(576066..576860)
FT                   /locus_tag="VVM_01006"
FT                   /gene_family="HOG000255940" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ccsA-related protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155361"
FT                   /db_xref="GeneID:10165280"
FT                   /translation="MDSIIAIGATILYGLAIATIVPGLAHQTGIKAKTVLISASLALVF
FT                   HAWLLSDLIFEGYGQNLSILNVASLISFIISLVMSAAMLKNRLWFLLPVVYSFAAINLS
FT                   AATFLPSTFIKHLENDPKLLIHISLALFSYATLTIGALYALQLAWLDHKLKAKKSLVIN
FT                   PNLPPLLMVERQLFKIIMIGNLLLTATLATGFVFVHDMFAEGKAHKAVLSFIAWLVYST
FT                   LLWGHYQKGWRGKKVTWFAVAGATLLTLAYFGSRFVKEIILS"
FT                   /protein_id="YP_004187740.1"
FT   gene            577074..578450
FT                   /db_xref="GeneID:10165281"
FT                   /locus_tag="VVM_01007"
FT   CDS_pept        577074..578450
FT                   /locus_tag="VVM_01007"
FT                   /gene_family="HOG000036164" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal recognition particle, subunit Ffh SRP54"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155362"
FT                   /db_xref="GeneID:10165281"
FT                   /translation="MFENLTDRLSKTLKNISGKGRLTEDNIKDTLREVRMALLEADVAL
FT                   PVVREFVARVKEKAVGVEVSKSLTPGQEFIKIVQGELEAVMGESNEALNLAAQPPAVIL
FT                   MAGLQGAGKTTSVGKLSKLLKERDKKKVLVVSADVYRPAAIKQLETLASDIGVDFFPSS
FT                   ADQKPIDIANAAIDHAKKKFFDVLIVDTAGRLAIDEAMMGEIQQLHSAINPVETLFVVD
FT                   AMTGQDAANTAKAFGDALPLTGVILTKVDGDARGGAALSVRHITGKPIKFLGVGEKTDA
FT                   LEPFHPDRVASRILGMGDVLSLIEDLQRNVDTEKAQKLAQKFKEKKGFDLEDFREQLGQ
FT                   MQNMGGMMGMLDKLPGMSQLPSDIKDKVDDKMFKQMEAIINSMTMKERQNPDLIKGSRK
FT                   KRIAAGSGTQVQDVNRLLKQFTQMQKMMKKMQKGGIKGMMRNMQGMMGGMGGGFNPFGR
FT                   "
FT                   /protein_id="YP_004187741.1"
FT   gene            578725..578973
FT                   /db_xref="GeneID:10165282"
FT                   /locus_tag="VVM_01010"
FT   CDS_pept        578725..578973
FT                   /locus_tag="VVM_01010"
FT                   /gene_family="HOG000246720" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="30S ribosomal protein S16p"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155363"
FT                   /db_xref="GeneID:10165282"
FT                   /translation="MVTIRLARHGAKKRPFYQIVVADSRNVATGRFIEKVGFFNPTAQG
FT                   QEEGLRIDLDRVNHWVGQGASLSDRVAKLVKDAQKAA"
FT                   /protein_id="YP_004187742.1"
FT   gene            578989..579537
FT                   /db_xref="GeneID:10165283"
FT                   /locus_tag="VVM_01011"
FT   CDS_pept        578989..579537
FT                   /locus_tag="VVM_01011"
FT                   /gene_family="HOG000220989" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="16S rRNA processing protein RimM"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155364"
FT                   /db_xref="GeneID:10165283"
FT                   /translation="MSMKGKETMSDERIVVGKFGSTYGIRGWLKVFSYTDNAESLFDYS
FT                   PWYVNQKGEWVEFKVESWKRHNKGMVAKLEGLDVREDAHLLTNLEIAIDPAVLPELSED
FT                   EFYWRELFGMQVVTTNGYDLGVVTDMLETGSNDVLVVKANLKDAFGQKERLIPFLEEQV
FT                   IIKVDREAQRIEVDWDPGF"
FT                   /protein_id="YP_004187743.1"
FT   gene            579565..580314
FT                   /db_xref="GeneID:10165284"
FT                   /locus_tag="VVM_01012"
FT   CDS_pept        579565..580314
FT                   /product="tRNA (Guanine37-N1) -methyltransferase"
FT                   /gene_family="HOG000016242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01012"
FT                   /EC_number="2.1.1.31"
FT                   /db_xref="GI:320155365"
FT                   /db_xref="GeneID:10165284"
FT                   /translation="MWVGVISLFPEMFRSVTDFGVTGQAVKKGLLSIETWNPRDFTHDK
FT                   HRTVDDRPYGGGPGMLMMVQPLRDAIHAAKQASPGKTKVIYLSPQGRKLDQQGVEELAT
FT                   NENLLLICGRYEGVDERIIQSEVDEEWSIGDFVMTGGEIPAMTLIDSVSRFVPGVLGDF
FT                   ASAEEDSFANGLLDCPHYTRPEVLDGKEVPEVLMSGNHKEIRRWRLKQSLGRTWQRRPE
FT                   LLENLALTDEQEQLLAEFIQETHHKRK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187744.1"
FT   gene            580356..580709
FT                   /db_xref="GeneID:10165285"
FT                   /locus_tag="VVM_01015"
FT   CDS_pept        580356..580709
FT                   /locus_tag="VVM_01015"
FT                   /gene_family="HOG000016264" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="50S ribosomal protein L19p"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155366"
FT                   /db_xref="GeneID:10165285"
FT                   /translation="MSNIIKALEQEQMKQDLPKFAPGDTVVVQVKVKEGNRERLQAYEG
FT                   VVIAIRNRGLHSAFTVRKISNGEGVERTFQTHSPVVDSIEVKRRGAVRRAKLYYLRERS
FT                   GKSARIKEKLAKK"
FT                   /protein_id="YP_004187745.1"
FT   gene            complement(580943..581092)
FT                   /db_xref="GeneID:10165286"
FT                   /locus_tag="VVM_01017"
FT   CDS_pept        complement(580943..581092)
FT                   /locus_tag="VVM_01017"
FT                   /gene_family="HOG000255917" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="zinc-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155367"
FT                   /db_xref="GeneID:10165286"
FT                   /translation="MEWGEQSPHRPFCSKKCQMIDFGEWADEENAIPGAPDMSDSDGWS
FT                   EEQY"
FT                   /protein_id="YP_004187746.1"
FT   gene            complement(581200..581940)
FT                   /db_xref="GeneID:10165287"
FT                   /locus_tag="VVM_01020"
FT   CDS_pept        complement(581200..581940)
FT                   /locus_tag="VVM_01020"
FT                   /gene_family="HOG000283874" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155368"
FT                   /db_xref="GeneID:10165287"
FT                   /translation="MTTHNFEHPLNEKTRIYLRVESLLRQAHTAASFSEPHQHQLFFRS
FT                   IFDLIEIFEQIQLKSELAKDIEKQRLLYRSWLNVEGVDQATLRSLLDEADRTHAALMQA
FT                   PRFGQSLKEDRFLSSIRQRFSLPGGSCCFDLPALHYWLNLPIERKIEDARQWLDSLKPL
FT                   SDALNLWLKLAREAGHFRSQTALNGFFQSDAEEANILRLHIPMEYGVYPMISGHKNRFA
FT                   IKFINFETGQACSQDVHFELAVCS"
FT                   /protein_id="YP_004187747.1"
FT   gene            complement(581973..582581)
FT                   /db_xref="GeneID:10165288"
FT                   /locus_tag="VVM_01021"
FT   CDS_pept        complement(581973..582581)
FT                   /product="dephospho-CoA kinase"
FT                   /gene_family="HOG000020769" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01021"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="GI:320155369"
FT                   /db_xref="GeneID:10165288"
FT                   /translation="MALVIGLTGGIASGKTTVANLFQQHFAIDIVDADIVARQVVAPGS
FT                   AGLAAIVDHFGADILTREGELDRGQLRQRIFAHAEEKQWLNALLHPMIRRKMIEDLAQV
FT                   SSPYALLVVPLLVENQLQTLCDRVLVVDVEEKTQLQRTMDRDGVDEQQVRAILKAQASR
FT                   HERLALADDVIKNESKDQDLLQQITDLHQKYLAMSKQNR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187748.1"
FT   gene            complement(582583..583452)
FT                   /db_xref="GeneID:10165289"
FT                   /locus_tag="VVM_01024"
FT   CDS_pept        complement(582583..583452)
FT                   /product="leader peptidase (Prepilin
FT                   /gene_family="HOG000248584" [ FAMILY / ALN / TREE ]
FT                   peptidase)/N-methyltransferase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01024"
FT                   /EC_number="3.4.23.43"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GI:320155370"
FT                   /db_xref="GeneID:10165289"
FT                   /translation="MDALQYYPWLYIGLASLFGLLVGSFLNVVIYRLPKIMELEWRQEC
FT                   AESFPEYNITPPTETLTLSTPRSSCPSCHTPIRVRDNIPVFSWLALRGKCHHCQTKISA
FT                   RYPFVEALSAFLCGLVAWKFGYAPITVALIGFTLVLIAATFIDLDTMLLPDQLTLPLTW
FT                   AGIALALLEISPVSLQDSVIGAMAGYLCLWSVYHLFRLLTGKEGMGYGDFKLLAALGAW
FT                   LGWQYLPMIILLSSVVGLIFGLIQLRLQKQGIEMAFPFGPYLAIAGWVALMWGDSLMSW
FT                   YLNYLMGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187749.1"
FT   gene            complement(583546..584772)
FT                   /db_xref="GeneID:10165290"
FT                   /locus_tag="VVM_01026"
FT   CDS_pept        complement(583546..584772)
FT                   /locus_tag="VVM_01026"
FT                   /gene_family="HOG000253740" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV fimbrial assembly protein PilC"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155371"
FT                   /db_xref="GeneID:10165290"
FT                   /translation="MKLKTHSQIKNYQWKGINGAGKKVSGNTLALTELEVRDKLKMQHI
FT                   QIKKIKKSSVSVFTRLSHKVKGKDITLLTRQLSTMLTTGVPILQSLKLVADNHRKAEMK
FT                   SILANVSKAVEAGTPLSKALRSASPQFDGIYVDLVATGEQSGNLDQVFERLAFYREKNE
FT                   QLRAKVIKALIYPCMVVLVALGVSYLMLTQVIPEFRKMFTGFGAELPWFTQKVLDLSDF
FT                   VQAYSSWFFITLFSAIYLLRGLSKKSPAFRLKMSRLSLKIPVIGGVLSKAAIAKFSRTL
FT                   ATSFSAGIPILTSLKTTSKTAGNLHYQYAIEDVYRDTAAGMPMYIAMRNSLAFPELVLQ
FT                   MVMIGEESGQMDDMLNKIATIYEFEVDNTVDNLGKILEPLIIVFLGVVVGGLVAAMYLP
FT                   IFNLMSVLG"
FT                   /protein_id="YP_004187750.1"
FT   gene            complement(584820..586508)
FT                   /db_xref="GeneID:10165291"
FT                   /locus_tag="VVM_01027"
FT   CDS_pept        complement(584820..586508)
FT                   /locus_tag="VVM_01027"
FT                   /gene_family="HOG000008427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilin PilA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155372"
FT                   /db_xref="GeneID:10165291"
FT                   /translation="MMSNLSTILRQANQLSLTQEQACRETIQASGVTAPEALLQLGFFQ
FT                   PDELTEQLSAIFGLPRTDLNQYDYQDLCNQLGLRELITRHQALPLQKSNAGLILAVADP
FT                   TNIQAEDDFRFATGVQVEIVLADCQELQAAIRRLYGKSIKQSQGSGLKEIHQDELANLV
FT                   EVSDDEVESIEDLSQDESPVSRFINQILLDAVRKGASDIHFEPYENQYRVRLRCDGILV
FT                   EVQQPPSHLSRRLSARIKILSKLDIAERRLPQDGRIKLRLNQETAIDMRVSTLPTLFGE
FT                   KIVLRLLDSSSSSLDIDKLGYNPQQKQLYLDALRKPQGMILMTGPTGSGKTVSLYTGLS
FT                   LLNRPEVNISTAEDPVEINLPGINQVQVKPKIGFGFAEALRSFLRQDPDIVMVGEIRDL
FT                   ETAEIAVKAAQTGHLVLSTLHTNSAAETIVRLSNMGIASFNLASSLSLIIAQRLARRLC
FT                   SHCKQPHPYNATFELLGLKADDLIYQADRQGCHHCTHGYSGRVGIYEVMPFDEQLAEAI
FT                   VKGASVQSLEMLARQKGMMTLKDSGLEKLKQGITSLEELQRVLYL"
FT                   /protein_id="YP_004187751.1"
FT   gene            complement(586508..586951)
FT                   /db_xref="GeneID:10165292"
FT                   /locus_tag="VVM_01028"
FT   CDS_pept        complement(586508..586951)
FT                   /locus_tag="VVM_01028"
FT                   /gene_family="HOG000008197" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type IV pilin PilA"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155373"
FT                   /db_xref="GeneID:10165292"
FT                   /translation="MKKLNKTKKQQGFTLIELMIVVAIIGVLAAVAIPAYQNYVQKTEV
FT                   ASASATVRGLLTNIDMYQQENGGTFPNNANLVGGTSTMNALGTITLLPVGTSGGTATFA
FT                   FTEGTLKGKTASVQYSKNNTTGWSCATKNVPADSRPNSCTATY"
FT                   /protein_id="YP_004187752.1"
FT   gene            complement(587174..588061)
FT                   /db_xref="GeneID:10165293"
FT                   /locus_tag="VVM_01030"
FT   CDS_pept        complement(587174..588061)
FT                   /product="quinolinate phosphoribosyltransferase
FT                   /gene_family="HOG000224022" [ FAMILY / ALN / TREE ]
FT                   (decarboxylating)"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01030"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="GI:320155374"
FT                   /db_xref="GeneID:10165293"
FT                   /translation="MKNTHNSQERLDYLKQQLPIEITRAVADTLKEDLGGSLNADNDVT
FT                   AALIPAEAINTATIITREHGVFCGQAWADEVFKQLGGKVTIEWHVKDGDKVEPNQTLCT
FT                   LTGPARDLLTGERNAMNFIQTLSGCATITAQYAAKIAHTECRLLDTRKTIPGLRSALKY
FT                   AVACGGGYNHRIGVFDAYLIKENHIIACGGITQAITKAKELQPGKPVEVETENLDELRE
FT                   AIHAGADIIMLDNFTTEMMRQAVEINAGRAALENSGNVTLETIAEYAETGVDYISVGAL
FT                   TKHVKAMDLSMRFK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187753.1"
FT   gene            588154..588726
FT                   /db_xref="GeneID:10165294"
FT                   /locus_tag="VVM_01031"
FT   CDS_pept        588154..588726
FT                   /product="N-acetylmuramoyl-L-alanine amidase AmpD"
FT                   /gene_family="HOG000255963" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01031"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="GI:320155375"
FT                   /db_xref="GeneID:10165294"
FT                   /translation="MQAVITQGWLEGVKRVSSPFFDARPQGKPISLLVVHNISLPPGQF
FT                   GGRYIEDFFQGQLDPREHPFFQVIHQMHVSAHCLIKRDGEVVQFVSFDDRAWHAGASSF
FT                   AGVERCNDYSIGIELEGSDFVAYTEAQYQALSELSKTLMRQYPHITLPRITGHQYIAPL
FT                   RKTDPGLSFDWRYYRTLLSQDGSVAKM"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187754.1"
FT   gene            588982..589152
FT                   /db_xref="GeneID:10165295"
FT                   /locus_tag="VVM_01032"
FT   CDS_pept        588982..589152
FT                   /locus_tag="VVM_01032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155376"
FT                   /db_xref="GeneID:10165295"
FT                   /translation="MLKRELFYDLGQFLAGQLRFNYVNFCTNLELVLPINSKEKKNNKY
FT                   GLSKDSSAETF"
FT                   /protein_id="YP_004187755.1"
FT   gene            589115..589882
FT                   /db_xref="GeneID:10165296"
FT                   /locus_tag="VVM_01033"
FT   CDS_pept        589115..589882
FT                   /locus_tag="VVM_01033"
FT                   /gene_family="HOG000273991" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional repressor for pyruvate
FT                   dehydrogenase complex"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155377"
FT                   /db_xref="GeneID:10165296"
FT                   /translation="MAYQRIRQPKLSDVIEQELERLIVEGILAPGQQLPPERELAKQFE
FT                   VSRPSVREAIQRLEAKRLLTRRQGGGTFVSENIWKSFSDPLLNLLSSHSETQLDLLESR
FT                   HAMEGISAYFAALRGTEQDFARIQACLEKISAEQTKQNVEAEAAAVMAFLVALTEASHN
FT                   VVLLHIVRSLSPLLEQNVLQNLKLLHRRAEVVEKVSKHRANIVDAIVSGQPEKAREMSH
FT                   SHLAYIEETLLDLTREESRRERSLRRIQRGNES"
FT                   /protein_id="YP_004187756.1"
FT   gene            589936..592596
FT                   /db_xref="GeneID:10165297"
FT                   /locus_tag="VVM_01034"
FT   CDS_pept        589936..592596
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /gene_family="HOG000115215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01034"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="GI:320155378"
FT                   /db_xref="GeneID:10165297"
FT                   /translation="MSDMKHDVDALETQEWLQALESVVREEGVERAQYLLEQVLDKARL
FT                   DGVDMPTGITTNYINTIPANQEPAYPGDTTLERRIRSIIRWNAIMIVLRASKKDLELGG
FT                   HMASFQSSAAFYETCFNHFFRAPNEKDGGDLVYYQGHISPGIYARAFVEGRLTAEQLDN
FT                   FRQEVDGKGIPSYPHPKLMPEFWQFPTVSMGLGPISAIYQARFLKYLEGRGMKDTSEQR
FT                   VYAFLGDGEMDEPESRGAISFAAREKLDNLCFLINCNLQRLDGPVMGNGKIIQELEGLF
FT                   KGAGWNVVKVIWGNNWDSLLAKDTTGKLLQLMNETIDGDYQTFKSKDGAYVREHFFGKY
FT                   PETAALVADMTDDEIFALKRGGHESSKLYAAFKNAQDTKGRPTVILAKTVKGYGMGEAA
FT                   EGKNIAHQVKKMDMTHVLHLRDRLGLQDILTDEAVKELPYLTLEEGSKEYEYLHARRKA
FT                   LKGYTPQRLPNFTQELVIPAVEEFQPLLEEQKRDISTTMAFVRTLNVLLKDKNIGKNIV
FT                   PIIADEARTFGMEGLFRQIGIYNPHGQNYTPQDRDIVSYYKEATSGQVLQEGINELGAM
FT                   SSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTLN
FT                   GEGLQHEDGHSHIMAGTVPNCISYDPTFAYEVAVILQDGIRRMYGDQENVFYYLTLMNE
FT                   NYAMPAMPEGAEEGIRKGIYKLETYTGSKGKVQLLSSGTIMNEVRKAAQILSDEYGIAS
FT                   DVYSVTSFNEVTRDGQACERYNMLHPEAEAQVPYIQTVMGTEPAIAATDYMKNYAEQVR
FT                   AFIPAESYKVLGTDGFGRSDSRENLRRHFEVNAGYVVVAALTELAKRGDVEKSVIAEAI
FT                   KKFDIDTEKTNPLYA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187757.1"
FT   gene            592616..594508
FT                   /db_xref="GeneID:10165298"
FT                   /locus_tag="VVM_01037"
FT   CDS_pept        592616..594508
FT                   /product="dihydrolipoamide acetyltransferase component of
FT                   /gene_family="HOG000281562" [ FAMILY / ALN / TREE ]
FT                   pyruvate dehydrogenase complex"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01037"
FT                   /EC_number="2.3.1.12"
FT                   /db_xref="GI:320155379"
FT                   /db_xref="GeneID:10165298"
FT                   /translation="MAIEINVPDIGADEVEVTEILVSVGDKVEEEQSLITVEGDKASME
FT                   VPASQAGIVKEIKVVAGDKVTTGSLIMVFEAEAAGAPGAAAAAPVPAVAPVAAPAAASE
FT                   LKEVCVPDIGGDEVEVTEILVAVGDSIAEEQSLLTVEGDKASMEVPAPFAGTLKEIKVA
FT                   AGDKVSTGSLVMVFEVAGSGAAAPAPVAAAAPAAAPAAVSGVKEVNVPDIGGDEVEVTE
FT                   IMVAVGDTVSEEQSLITVEGDKASMEVPAPFAGTVKEIKVAAGDKVSTGSLIMVFEVAG
FT                   AAPVAAAAPAQAAAPAPAVAPVAKAEAQATTSDFKENDEYAHASPVVRRLAREFGVNLS
FT                   KVKGSGRKSRILKEDVQAYVKDALKRLESGAVAAASGKGDGAALGLLPWPKVDFSKFGE
FT                   TEVQPLSRIKKISGANLHRNWVMIPHVTQWDNADITELENFRKEQNAIEAKKDSGMKIT
FT                   PLVFIMKAAAKALEAFPAFNSSLSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKK
FT                   GIYELSEELMVVSKKARAGKLTAADMQGGCFTISSLGGIGGTAFTPIVNAPEVGILGVS
FT                   KSEIKPVWNGKEFAPRLQLPLSLSYDHRVIDGAEGARFITYLNECLSDIRRLVL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187758.1"
FT   gene            594766..596193
FT                   /db_xref="GeneID:10165299"
FT                   /locus_tag="VVM_01041"
FT   CDS_pept        594766..596193
FT                   /product="dihydrolipoamide dehydrogenase of pyruvate
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   dehydrogenase complex"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01041"
FT                   /EC_number="1.8.1.4"
FT                   /db_xref="GI:320155380"
FT                   /db_xref="GeneID:10165299"
FT                   /translation="MSKEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLIERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPQTDIDKIRLWKEKVINQLTGGLGGM
FT                   AKMRKVNVVNGFGKFTGPNTIEVEGEDGKTVVNFDNAIVAAGSRPIKLPFIPHEDPRIW
FT                   DSTDALELKEVPGKLLIMGGGIIGLEMGTVYHSLGSQIDVVEMFDQVIPAADKDIVKVY
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGKLID
FT                   GEKAGLEIDERGFINVDKQMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGKTEKEAKAEGINYEVATFPWAASGRAIASDCADGMTKL
FT                   IFDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGTITDLPNAKAKKKK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187759.1"
FT   gene            complement(596326..596943)
FT                   /db_xref="GeneID:10165300"
FT                   /locus_tag="VVM_01046"
FT   CDS_pept        complement(596326..596943)
FT                   /locus_tag="VVM_01046"
FT                   /gene_family="HOG000282746" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="quorum-sensing regulator of virulence HapR"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155381"
FT                   /db_xref="GeneID:10165300"
FT                   /translation="MDSIAKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEI
FT                   AQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELV
FT                   VQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLA
FT                   NLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE"
FT                   /protein_id="YP_004187760.1"
FT   gene            597356..597865
FT                   /db_xref="GeneID:10165301"
FT                   /locus_tag="VVM_01048"
FT   CDS_pept        597356..597865
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /gene_family="HOG000236520" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01048"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="GI:320155382"
FT                   /db_xref="GeneID:10165301"
FT                   /translation="MISEQTVQERVRELGKQITAHYQGSEDLVLVGLLRGSFVFMADLA
FT                   RAIELTHQVDFMTASSYGNTMESSRDVRILKDLDDDIKGKDVLIVEDIIDTGNTLNKIK
FT                   EILSLREPKSIEICTLLDKPSRREVPVPVKWIGFEIPDEFVVGVGIDYAQKYRHLPFIG
FT                   KVVPQE"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187761.1"
FT   gene            complement(597960..598628)
FT                   /db_xref="GeneID:10165302"
FT                   /locus_tag="VVM_01049"
FT   CDS_pept        complement(597960..598628)
FT                   /product="carbonic anhydrase"
FT                   /gene_family="HOG000125184" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01049"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="GI:320155383"
FT                   /db_xref="GeneID:10165302"
FT                   /translation="MPEIKQLFENNSKWSEEIKSHQPEYFSKLEEGQNPGFLWIGCSDS
FT                   RVPAERLTGLYSGELFVHRNVANQVIHTDLNCLSVVQYAVDVLKVKHIIICGHYGCGGV
FT                   NAAIENPRLGLINNWLLHIRDLYLKHRNWLGELPKEKWGDKLCEINVAEQVYNLGNSTI
FT                   MESAWERGQDVEIHGVVYGIGDGRLQDIGVRCYSRESLEVNYQAAMAKILNSDVMKFHE
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_004187762.1"
FT   gene            598870..600540
FT                   /db_xref="GeneID:10165303"
FT                   /locus_tag="VVM_01050"
FT   CDS_pept        598870..600540
FT                   /locus_tag="VVM_01050"
FT                   /gene_family="HOG000236213" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sulfate permease family protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155384"
FT                   /db_xref="GeneID:10165303"
FT                   /translation="MFGDRFNDINLKGDLFGGVTTAIISLPLALAFGVASGAGAEAGLW
FT                   GAILVGLFAALFGGSSTLISEPTGPMTVIMTAVLTSMVAKYPESGIAISFTIVMMAGAF
FT                   QVLIGTLKLGKYITLMPYSVVSGFMSGIGVILIILQLSPLLGHAAPAGGVLGTLSALPE
FT                   TISNMKFSEFFLGLLTLGILFFFPKQYRKYVPAQLVALVAVTLLSVIIFDFDDVRRIGE
FT                   IPTGLPSLVVPVINGEIFTAMVIDALVLGTLGCIDTLLTAVIGDSLTRKEHDSDKELRG
FT                   QGFANMISGLFGALPGAGATMGTVTNIQVGARSPLSGVIRALILALVVLVASGLTEPIP
FT                   MAVLAGIAVYVGFGILDWSFIQRAHRVSVQGMAIMYGVMLLTVFVDLIVAVGLGVFISN
FT                   ILIIERLSREQAKQVKAISDADENDVPLTDSERGLLDRANGKVLFFYLSGPMIFSVSKA
FT                   ISRQHSSISDYEAMILDLTDVPMIDVTVGLALENAIKDAQEAQCDVYLLCPNERVREQL
FT                   EKFHVLDLVPDENTFKFRYEALNAAVNKVEQDEHQGAFV"
FT                   /protein_id="YP_004187763.1"
FT   gene            600707..601630
FT                   /db_xref="GeneID:10165304"
FT                   /locus_tag="VVM_01052"
FT   CDS_pept        600707..601630
FT                   /locus_tag="VVM_01052"
FT                   /codon_start="1"
FT                   /product="multidrug ABC transporter ATPase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155385"
FT                   /db_xref="GeneID:10165304"
FT                   /translation="MYALQIEQLRKTYAGGFEALKGISLGVQEGDFYALLGPNGAGKST
FT                   TIGVISSLVNKTSGNVKVFGYDIDRDLELAKQHLGLVPQEFNFNQFETVEQIVLQQAGY
FT                   YGVPRELAKQRAEKYLTKLDLWEKRKERARNLSGGMKRRLMIARALMHEPKLLILDEPT
FT                   AGVDIELRRSMWEFLKEINQKQGITIILTTHYLEEAEMLCRNIGIINRGELIENTTMKS
FT                   LLAKLDVETFILDLAPNSPMPCLEGVVSSRVENDSLEIEVEKTQPLNHVFSQLSEQGVM
FT                   VMSMRNKANRLEELFVNIVREQAKEK"
FT                   /protein_id="YP_004187764.1"
FT   gene            601632..602402
FT                   /db_xref="GeneID:10165305"
FT                   /locus_tag="VVM_01053"
FT   CDS_pept        601632..602402
FT                   /locus_tag="VVM_01053"
FT                   /gene_family="HOG000252768" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multidrug ABC transporter permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155386"
FT                   /db_xref="GeneID:10165305"
FT                   /translation="MYRLYWTAFCSLLTKEINRFTRIWVQTLVPPAITMTLYFIIFGSL
FT                   IGSRIGEMNGFSYMEYIVPGLIMMSVITNSYSNVASSFFSAKFQRNIEELLVAPVPNYV
FT                   IIFGFVMGGVARGLLVGAMVTMVSLLFVDLQVEHWGIIIATVFLTSVVFSLGGLINAVF
FT                   ARTFDDISIIPTFVLTPLTYLGGVFYSIQLLPEFWQGVSQINPIVYMVNAFRYGFLGVS
FT                   DVGIATSFTVLSAFVVLLYGVAHYLVTRGIGLRS"
FT                   /protein_id="YP_004187765.1"
FT   gene            complement(602500..603405)
FT                   /db_xref="GeneID:10165306"
FT                   /locus_tag="VVM_01056"
FT   CDS_pept        complement(602500..603405)
FT                   /product="pantoate--beta-alanine ligase"
FT                   /gene_family="HOG000175516" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01056"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="GI:320155387"
FT                   /db_xref="GeneID:10165306"
FT                   /translation="MQTFAEISALREQIKTFKREGRRIAFVPTMGNLHEGHLTLVRKAR
FT                   EHADIVVVSIFVNPMQFDRADDLNNYPRTLEDDLSKLNGEAVELVFTPTPEMIYPEGLD
FT                   KQTLVEVPGLSTMLEGASRPGHFRGVATVVTKLFNIVQPDVACFGEKDFQQLAIIRKMT
FT                   TDLAMDIEIIGVPTVREMDGLAMSSRNGLLTIDERQRAPVLARTMRWISSAIRGGRDDF
FT                   ASIIEDASDQLRAAGLHPDEIFIRDARTLQVVNAESTQAVILMSAFLGKARLIDNQVVE
FT                   LVKDSKEEVDSAESESENSH"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187766.1"
FT   gene            complement(603418..604212)
FT                   /db_xref="GeneID:10165307"
FT                   /locus_tag="VVM_01057"
FT   CDS_pept        complement(603418..604212)
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /gene_family="HOG000078427" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01057"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="GI:320155388"
FT                   /db_xref="GeneID:10165307"
FT                   /translation="MKKITINDLIKWKQEGRKFATSTAYDASFAQLFESQEMPVLLVGD
FT                   SLGMVLQGKNDTLPVTVEDIAYHTRCVRAGSPNCLLMADMPFMSYATPEQACENAAQLM
FT                   RAGANMVKIEGGDWLVDTVKMLTERAVPVCAHLGLTPQSVNIFGGYKVQGRDQEKADRM
FT                   VKDALALQAAGAQIVLLECVPAELAARITQVLDVPVIGIGAGNVTDGQILVMHDMFGIS
FT                   ANYMPKFSKNFLAETGDMRKAVALYMEQVQAGTFPDEAHTIA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187767.1"
FT   gene            complement(604236..604721)
FT                   /db_xref="GeneID:10165308"
FT                   /locus_tag="VVM_01060"
FT   CDS_pept        complement(604236..604721)
FT                   /product="2-amino-4-hydroxy-6-
FT                   /gene_family="HOG000217741" [ FAMILY / ALN / TREE ]
FT                   hydroxymethyldihydropteridine pyrophosphokinase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01060"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="GI:320155389"
FT                   /db_xref="GeneID:10165308"
FT                   /translation="MITAYIAIGSNLADPVSQAKSAIDALKTLPKSRLLVASQLYSSSP
FT                   MGPQDQPDYINAVAAIETELTPLELLDCTQAIELEQGRVRKEERWGPRTLDLDIILYGD
FT                   EVIDSERLTIPHYGMKEREFVLYPLAEIAPNLTLPDGTELSQLLTIVDKNGLGIWHS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187768.1"
FT   gene            complement(604718..606079)
FT                   /db_xref="GeneID:10165309"
FT                   /locus_tag="VVM_01062"
FT   CDS_pept        complement(604718..606079)
FT                   /product="poly(A) polymerase"
FT                   /gene_family="HOG000256527" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01062"
FT                   /EC_number="2.7.7.19"
FT                   /db_xref="GI:320155390"
FT                   /db_xref="GeneID:10165309"
FT                   /translation="MNKNEYTTCDSTTCPELALNVITRQEHNISRKQISDHALKVLYRL
FT                   HGAGFDAFLVGGGVRDLLLGQSPKDFDIATNATPEQLKQLFRNCRLIGRRFRLAHIMFG
FT                   REIIEVATFRGHHQDANSQISQQSKEGMLLRDNVYGTIDEDAERRDFTINAMYYNIADY
FT                   SIHDYAGGVEDLEDRLVRLIGDPETRYREDPVRMLRAIRFAAKLDFDIEEDTAAPIEEM
FT                   AYLLRDIPAARLYEESLKLLQSGHGLETYHLMREYNLFQQMFPAISAYFTEDYSSKAEQ
FT                   MLDLVLDSTDIRVEEGKRINPAYMFAAMLWYPLLELADKLMDSHNLCHYDAVMEASNLI
FT                   LDEQVRSIAIPRRHTATIREIWQLQLRLPRRNGKRAFRLMELNKFRAGFDFLEMRGEIE
FT                   GGETATLAKWWGTFQNAGREMRLAMVNDLEGPAGSSKSGRKRRSFNKKKSKAKS"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187769.1"
FT   gene            complement(606166..607077)
FT                   /db_xref="GeneID:10165310"
FT                   /locus_tag="VVM_01064"
FT   CDS_pept        complement(606166..607077)
FT                   /locus_tag="VVM_01064"
FT                   /gene_family="HOG000252723" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamyl-Q-tRNA synthetase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155391"
FT                   /db_xref="GeneID:10165310"
FT                   /translation="MLPFCFEMTSMSYIGRFAPSPSGPLHFGSLIAALGSYFQAKSQHG
FT                   QWLVRIEDLDPPREMPGAADLILKTLETYHLFWDGEVVYQSQRHHLYQAQIDHWLQSGQ
FT                   AYYCQCSRKQIKEMGGYYNGHCQELHLDAGAIRLKMTQPITHFDDLRHGQMHIPLELAQ
FT                   EDFIIKRRDGLFAYNLAVVLDDIDQGVTEVVRGADLIEPTGRQISLYRMLGQVPVRYLH
FT                   LPLAMDKNGNKLSKQNHATGIDLTHPTSMILEAMAFLGFAIPKELHQANLDEILRWGVQ
FT                   NWRLNQLPESLEITARFSNGTA"
FT                   /protein_id="YP_004187770.1"
FT   gene            complement(607110..607556)
FT                   /db_xref="GeneID:10165311"
FT                   /locus_tag="VVM_01065"
FT   CDS_pept        complement(607110..607556)
FT                   /locus_tag="VVM_01065"
FT                   /gene_family="HOG000178407" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C4-type zinc finger protein DksA/TraR family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155392"
FT                   /db_xref="GeneID:10165311"
FT                   /translation="MPESKKKTLGILAIAGVEPYQEKAGEEYMSPDQVAHFRKILEAWR
FT                   NQLREEVDRTVHHMQDEAANFPDPVDRASQEEEFSLELRNRDRERRLIKKIEKTLDKIK
FT                   DDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIKEKQMQG"
FT                   /protein_id="YP_004187771.1"
FT   gene            complement(607689..608405)
FT                   /db_xref="GeneID:10165312"
FT                   /locus_tag="VVM_01066"
FT   CDS_pept        complement(607689..608405)
FT                   /locus_tag="VVM_01066"
FT                   /gene_family="HOG000218438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar/maltose fermentation stimulation
FT                   protein-like protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155393"
FT                   /db_xref="GeneID:10165312"
FT                   /translation="MHFEPALDCALLQKRYKRFLADVTYQSGDTGTIHCANTGAMTGCA
FT                   TPGDKVWYSTSNNTKRKYPHSWEITETQQGHLICVNTIRANQLTVEAIEQGWIKELSGY
FT                   EQLQTEVKYGHENSRIDILLSASDRPACYIEVKSVTLLDDTEPGQGFFPDAVTTRGQKH
FT                   LRELTEMAQNGSRAILLFAVLHSGIEKVAAALHIDAKYSQLLKQAQKAGVEVLCYKAEI
FT                   SNTEIKLNSAIAFNNS"
FT                   /protein_id="YP_004187772.1"
FT   gene            608472..610934
FT                   /db_xref="GeneID:10165313"
FT                   /locus_tag="VVM_01067"
FT   CDS_pept        608472..610934
FT                   /locus_tag="VVM_01067"
FT                   /gene_family="HOG000244609" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155394"
FT                   /db_xref="GeneID:10165313"
FT                   /translation="MSQLPIHAVMPQLLQAVSQHSQVILKAAPGAGKSTYFPLQLLLSN
FT                   EFSGKIVMLEPRRLAARNIARYLAQQLGEKVGERVGYRVRGESKVSHVTQLEIVTEGIM
FT                   TRMIQSDPELNGIDVLIFDEFHERSLHADIALALALEVQEALRDDLKLVVMSATLEQHA
FT                   LQSLMPQASFIESQGRSYLVEQRYQPLKTNDFLPNVMAKTIEHLLATESGSLLAFLPGV
FT                   AAIKQVAERLEHLSEQVVICLLYGQLSFSEQQKAIEPAKTGERKVVLATNIAETSLTIE
FT                   GIRLVVDSGLERVAKFDLKTGITKLEQVRIAQSSAIQRAGRAGRVEEGICVRLYSESQY
FT                   QQMASVPLPEIMQADLAPLMMELAQWGVSEPEQVKLLDIPSSAAVRQAKQLLQQLGLIS
FT                   GHQLTSEGQLAQRLGVEPRIAAMLIGAQQRDETLFASALAVAVMLEEPERNISNVCHSL
FT                   HRWQQSKHGKTTLLTQRANALANKLNGTFSLKRVTESACAIAASLAFPDRIAQKRGQQF
FT                   GRYLMANGHGAELREDDPLGGEEYLVVLDLMRGQKNASQIQLAIPLDLSALQQSNPSCL
FT                   VNHEHIDWDETKGRLLAEKQRRIGELVVSRETLAQPGKEKMTQALLSYVRRKGLAVLDW
FT                   SEKSQSLLERIRCAIEWLPEQAWPAMDDASLLSELEQWLEPYMAHVTTVKDLAKINLCE
FT                   ALNARLGWPLNQQLDEWLPKYYTLPTGTQQMIRYQQGANPVLSARMQEMFGEQSSPTVA
FT                   QGRVKLTLELLSPARRPLQVTQDLAGFWAGAYKEVQKEMKGRYPKHVWPDDPATHQATN
FT                   KTKRQLHS"
FT                   /protein_id="YP_004187773.1"
FT   gene            610931..613300
FT                   /db_xref="GeneID:10165314"
FT                   /locus_tag="VVM_01071"
FT   CDS_pept        610931..613300
FT                   /product="multimodular transpeptidase-transglycosylase"
FT                   /gene_family="HOG000282711" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01071"
FT                   /EC_number="2.4.1.129"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="GI:320155395"
FT                   /db_xref="GeneID:10165314"
FT                   /translation="MTQEKKSNDSKKTTTRKRTANRTPRKTTKKRSAVKTAKRQWLKTL
FT                   WSLSWKAGLALVAVLIFVGIYLDSVVKQRFEGQLFQLPTVVYARIQTLYAGENVSRPEL
FT                   QKELDILNYRKVSQPRYPGEYSSSSSKIELIRRPFEFVDGPEADRHVMLHFDASSLTRI
FT                   QSLESKGDLGYLRLEPKMLGMLEKDTDEQRLFLRREQFPEIMVDALLVTEDRDFYQHDG
FT                   VSPLAIARAMFVNLKAGRTVQGGSTLTQQLAKNLFLTQDRTLWRKVREAYIALILDYRY
FT                   SKDRILEAYLNEVYLGQSGKQAIHGFGLASRYYFGQPIQELRIDQLAMLVGMVKGPSYY
FT                   NPVRFPERTKERRDLVLRLMMQQNMLTASEYDQAASRPLDIQDVPRIASRQPAYFQQLS
FT                   MELREKVGEAFQGETGLRVFTSLDPISQDKLEKAISKKVPELGKVAGNELEAAAVAVDR
FT                   TSGEIRAMVGGKRTGYDGFNRAINASRPIGSLVKPAVYLTALEQPEKYTLATTLQDTPL
FT                   SLKGSKGSVWEPRNFDRQFRGDVPLYQALAKSLNVPTVRLGMQLGIDQVSDTLARLGVN
FT                   RNEIRPVPSMFLGAFSLTPLEVAQMYQTLTNSGRKAPLTALRSVVDLEGHVLYQSLPKS
FT                   SPAVNEQAAWLTTYAMKQGVAQGTGRYLQNQFAWAALAGKTGTSNDSRDSWFVGVDGRE
FT                   VTTIWLGRDDNQPTKLTGASGALRVYAEYLKQRTPEKLILPWPKEITTLGYQQKSDGEL
FT                   SLDCSSQFTLPVWDKQGELKAQCEKSSNWLNKLLSW"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187774.1"
FT   gene            613368..615707
FT                   /db_xref="GeneID:10165315"
FT                   /locus_tag="VVM_01075"
FT   CDS_pept        613368..615707
FT                   /locus_tag="VVM_01075"
FT                   /gene_family="HOG000216868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative patatin-like phospholipase"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155396"
FT                   /db_xref="GeneID:10165315"
FT                   /translation="MLKVDKGWTNGLALWSTLAFLVLLTPFYTIKKAAAQEAAVAKDDD
FT                   RPKVAVVLAGGGAKGAAHIGVLKALEEMQIPVDYITGTSMGAYVGGLYATGMSADEIES
FT                   FIYSIDWNSGYRDRVDRSQRRVRDKEAEDRYQLRTDIGLRFGEVHAPRGFVQGQNMLRI
FT                   LRETTGNLNEFDSFDDLAIPYRSVATDIVELQEVVIDKGQLVDAMMASMSVPGALPPYE
FT                   LNGRMLVDGGVVNNMPVDIARAMGADIVIAVDISTDYKQKEDFTSMLVVADQLSNYLVR
FT                   RSTQQQAESLGGQDVYLRPDVGQMETTEFAKMPDAYQAGYKATYQMKEKLQALRLNGSQ
FT                   YQHYIDGKQQARKRLNYGDQTRVDQIVVINNTHYSDGLLTRRLDLETGRVLKTGEIEAA
FT                   IENLYALDRFELISYHYEEVDGINQLVVVVDEKSWGPNYVNFRFFLEDDFTTDSQYGVG
FT                   LSTNFTDLNSQGGELTINLEMGTDKLAEAEFYSPILFGQELFATAKTTYSSDKRSIPFS
FT                   DFDEPPLESAYDYFPITYSQFIGELALGYQPTLWQELKLGTRYAKGDIELSTIQSAGSS
FT                   NFERLGAFVQYRLDTLDNYALPTRGAYLDIEYLVSHDESPEIFESDFTGQSQSDTVHEL
FT                   SVAGRFATTYKRHTLVGSADYEIVQSKNNYIPLDPKSIGGFLNLSGIPRNSLIGQNKFF
FT                   TSLVYRYRWFDNDFGMFEAPVYLGASLEHGGVWSDTTLTLSQAPLYNAASVFAGIDSPI
FT                   GPIIFGYGRTESDLDAFYLIIGTSFR"
FT                   /protein_id="YP_004187775.1"
FT   gene            615978..618575
FT                   /db_xref="GeneID:10165316"
FT                   /locus_tag="VVM_01078"
FT   CDS_pept        615978..618575
FT                   /product="aconitate hydratase 2/2-methylisocitrate
FT                   /gene_family="HOG000205991" [ FAMILY / ALN / TREE ]
FT                   dehydratase"
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01078"
FT                   /EC_number="4.2.1.3"
FT                   /EC_number="4.2.1.99"
FT                   /db_xref="GI:320155397"
FT                   /db_xref="GeneID:10165316"
FT                   /translation="MLEAYRKHVEERAAEGVVPKPLDAEQVAGLVELLKNPPQGEEEFL
FT                   LDLLENRIPPGVDEAAYVKAGFLAAVIRGEASSPLVSREHAAKLLGTMQGGYNIEPLVA
FT                   LLDDEALAPIAVEALSHTLLMFDVFYDVEEKAKAGNQYAQQVLQSWADAEWFLSKPELA
FT                   EKITLTVFKVTGETNTDDLSPAPDAWSRPDIPVHALAMLKNEREGIVPDQPGSIGPIKQ
FT                   IEALKEQGHQLVYVGDVVGTGSSRKSATNSVLWFMGDDIPYVPNKRAGGYVLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSKLNMGDVIDVYPYQGKVANHATGDVLAEFSLKTDVLIDEVR
FT                   AGGRIPLIIGRGLTEKARQSLGLAPSDVFRKPADVADSGKGYTLAQKMVGKACGVTGIR
FT                   PGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTSAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAF
FT                   AAATGVMPLDMPESILVRFKGEMQPGITLRDLVHAIPYYGIKQGLLTVEKAGKINEFSG
FT                   RILEIEGVEHLTVEQAFELSDASAERSAAGCTVKLSQASIEEYLNSNIVMLKWMISEGY
FT                   GDRRTIERRIVAMQEWLASPELMSADRDAEYAHVIEIDLAEIKEPILCAPNDPDDARLL
FT                   SDVQGTQIDEVFIGSCMTNIGHFRAAGKLLEKFKGQLDTRLWIAPPTKMDRDQLTEEGY
FT                   YGIYGRAGVRIETPGCSLCMGNQARVADKTTVMSTSTRNFPNRLGTGANVYLSSAELAA
FT                   VGAILGRIPTVEEYMEYAKQLDATAADTYRYLNFHLMGQYTKKADTVIFQQPA"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187776.1"
FT   gene            complement(618638..619726)
FT                   /db_xref="GeneID:10165317"
FT                   /locus_tag="VVM_01084"
FT   CDS_pept        complement(618638..619726)
FT                   /product="glycerate kinase"
FT                   /gene_family="HOG000089298" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01084"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="GI:320155398"
FT                   /db_xref="GeneID:10165317"
FT                   /translation="MDVAIAIEKGFKQVLPDAHYVKLPMADGGEGTVQSMVDATGGIII
FT                   EHTVTGPLGQRVDGFFGLLGEGKTAVIEMAAASGLHLVSPELRNPLITTTLGTGELIKA
FT                   ALDHGVKHIIVGIGGSATNDGGIGMAQALGIKLLDAQGNALGHGGGELAKLATIDCSQL
FT                   DPRLAQVRLEVACDVDNPLCGTKGASAVFGPQKGATPEMVTILDKNLAHYAAIIKQQLG
FT                   VDVRDMAGAGAAGGMGAALLGLLNAELRPGIEIVMDAVRLDEIVADADLVITGEGRIDS
FT                   QTIHGKTPIGVARTAKKHSLPVIGIAGCLSADCGVVHEHGLDAVFAVVNRSVDLPTALA
FT                   EAAENVELTARNVAAAFCMTRR"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187777.1"
FT   gene            complement(619789..621054)
FT                   /db_xref="GeneID:10165318"
FT                   /locus_tag="VVM_01086"
FT   CDS_pept        complement(619789..621054)
FT                   /locus_tag="VVM_01086"
FT                   /gene_family="HOG000271806" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="D-glycerate transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155399"
FT                   /db_xref="GeneID:10165318"
FT                   /translation="MIEVSTLGALAALVVAIALILKKVPPAYGMIIGALIGGVIGGVSL
FT                   TDTVSLMIGGAQGIVTAVLRILAAGVLAGVLIESGAATSIAETIVKKVGETRALLALAL
FT                   ATMILTAVGVFVDVAVITVSPIALAIARRADISKTAILLAMVGGGKAGNVMSPNPNAIA
FT                   AADAFNVPLTSVMAAGVIPGLCGLVLAYFIAKRLVNKGSKVAASEVIAVDHSKLPKFGA
FT                   AIVAPLVAIALLALRPIAGINVDPLIALPLGGLLGAVVMGRFADTNHFAVSGLSRMAPV
FT                   AVMLLGTGTLAGIIANSGLKNGLIDILTASGLPSYLLAPISGAMMSLATASTTAGTAVA
FT                   SNVFSHTILELGVPALAGAAMIHSGATVLDHMPHGSFFHATGGAVHMDIRERLKLIPYE
FT                   SAVGLMIAFVSVMMFGVFGLFV"
FT                   /protein_id="YP_004187778.1"
FT   gene            complement(621142..622338)
FT                   /db_xref="GeneID:10165319"
FT                   /locus_tag="VVM_01088"
FT   CDS_pept        complement(621142..622338)
FT                   /locus_tag="VVM_01088"
FT                   /gene_family="HOG000271795" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar diacid utilization regulator SdaR"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155400"
FT                   /db_xref="GeneID:10165319"
FT                   /translation="MKLNETIARQIVERTMKIIPYSVNVMDDQGRIIGSGDPSRLQQKH
FT                   EGAVLAITECRVVEIDKATASHLKGVKPGINLPILFLEQVIGVIGVSGAPDEVKHYGEL
FT                   VKMTAELIVEQAALMSQVQWNKRHREELVLQLISGATLNDNQLNSIAERLGLNLSEPRI
FT                   AAVVKVFPDKQTSLSLEHLQQIVHLLEYPERDNLVGILSVSNNEVVVLKPISLTDNGWS
FT                   KEVETKRINQLLKRVSKEGNFSIKIALGDYFEGLAGLAQSFETAKLTMQLMAEQSGTVF
FT                   FYQDHKLPVLMSDLLSQPWKAEQLQAPLLKLQKKDSKGVLLKTLTAYFAQNCDACRTCQ
FT                   ALHIHRNTLRYRIEKIEDITSLNFNNLNNTFQLYIALELFSSKQRNCADAQKTKQSAG"
FT                   /protein_id="YP_004187779.1"
FT   gene            622409..622777
FT                   /db_xref="GeneID:10165320"
FT                   /locus_tag="VVM_01089"
FT   CDS_pept        622409..622777
FT                   /locus_tag="VVM_01089"
FT                   /gene_family="HOG000271784" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155401"
FT                   /db_xref="GeneID:10165320"
FT                   /translation="MDYEFKKNILDGNYYCHCSMDHEIVGRWVQEEIGKESTKIAQVLA
FT                   LIAAARSNPTEELCLNGTEISLMICGDEVTVQDNALLHSYELEAESEFELYDCESVACC
FT                   GLEDFEQLIQQWQLFVRR"
FT                   /protein_id="YP_004187780.1"
FT   gene            622969..623307
FT                   /db_xref="GeneID:10165321"
FT                   /locus_tag="VVM_01091"
FT   CDS_pept        622969..623307
FT                   /locus_tag="VVM_01091"
FT                   /gene_family="HOG000017847" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155402"
FT                   /db_xref="GeneID:10165321"
FT                   /translation="MKLINAIIKPFKLDDVREALADVGIEGMTVSEVKGFGRQKGHTEL
FT                   YRGAEYQVDFLPKVKLEIATQAENVDRVIEAITKAAHTGKIGDGKIFVYDLSHAVRIRT
FT                   GETDVEAL"
FT                   /protein_id="YP_004187781.1"
FT   gene            623335..624564
FT                   /db_xref="GeneID:10165322"
FT                   /locus_tag="VVM_01092"
FT   CDS_pept        623335..624564
FT                   /locus_tag="VVM_01092"
FT                   /gene_family="HOG000017735" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ammonium transporter"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155403"
FT                   /db_xref="GeneID:10165322"
FT                   /translation="MELTTTVSELRYALDTFFFLISGALVMWMAAGFAMLEAGLVRSKN
FT                   TTEILTKNFCLYAIACTTYLVVGYNIMYVDNSEGGWLPSIGALIGSQAEGADHSLESDF
FT                   FFQVVFVATAMSVVSGAVAERMKLWSFLLFSAILTAFIYPVEGYWTWGGGFLSAAGFSD
FT                   FAGSGIVHMAGASAALAGVLLLGARKGKYGKNGEVYPIPGSNMPLATLGTFILWFGWFG
FT                   FNGGSQLMVSDFENATAVGQIFLNTNAAAAAGAITALFVCKTTWGKADLTMILNGALAG
FT                   LVAITADPLSPSPLYSVAIGAVAGALVVFSIVGLDKLKIDDPVGAISVHGVCGFFGLMV
FT                   VPISNGDASFLSQLFGAAVIFAWVFGASLAVWAVLKATIGIRVSEEEEMEGMDMHDCGV
FT                   GAYPEFVTVK"
FT                   /protein_id="YP_004187782.1"
FT   gene            624718..625731
FT                   /db_xref="GeneID:10165323"
FT                   /locus_tag="VVM_01095"
FT   CDS_pept        624718..625731
FT                   /locus_tag="VVM_01095"
FT                   /gene_family="HOG000238624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferric iron ABC transporteriron-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155404"
FT                   /db_xref="GeneID:10165323"
FT                   /translation="MKKLLTLSALACATLAPTAMAAEEVNVYSYRQPFLVEPMFNEFTK
FT                   ETGIKVNVMFAKTGIAEKLAQEGEYSPADVILTVDISRLAELTDKGLVQPVNSEIIEAN
FT                   VPAQYQDKENEWFALTTRTRSVYSSRDRVGKLGDSFTYEDLAKPEFKGKICTRSGKHPY
FT                   NISLVSAMIAHHGEAETKKWLEGVKANLARKPQGNDRGQVKAIKEGLCDVSLGNSYYLG
FT                   AMVNDKEQKAWADAVYINFPNQQTTGTHVNISGMAMAKYAPNKANAQKLMEFLTGDKAQ
FT                   HMYAEVNYEYPVKAGVERSELVASWGDFKADTISLDDIASHHAAAIKLIDEVKFDL"
FT                   /protein_id="YP_004187783.1"
FT   gene            625831..627456
FT                   /db_xref="GeneID:10165324"
FT                   /locus_tag="VVM_01096"
FT   CDS_pept        625831..627456
FT                   /locus_tag="VVM_01096"
FT                   /gene_family="HOG000238613" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferric iron ABC transporterpermease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155405"
FT                   /db_xref="GeneID:10165324"
FT                   /translation="MKEKKYTWKTSSGALALLLVLPILAIFYTAVGYSDELFAHLMSTV
FT                   MPSYILNTILLTTGVLVVSLILGIPSAWFMAMCKLPTEKWLQWALVLPLAMPGYIIGYI
FT                   FTDWFDFAGPVQILLRDLTGWGPGDYWFPDIRTVAGATFVLSLVLYPYVYLLCRAAFME
FT                   QNVSLLQSARLLKCSAWESFWRISMPLARPSIAVGLSLVAMETIGDFGTVSYFAVNTLT
FT                   TAVYDTWLGYSNLNAAAKISALMLLIVILLLSAERYSRRKQKLFQAQFNSHEDFRYELK
FT                   GWKMWAALIWCWGLVAIAFIFPLLQLVDYSITYFEQSWTNEFRRFAMNSLKVSIAAAIV
FT                   AVIVALIVNFNHRLHNQKTSLACIRLSSLGYAVPGTVLAIGIMVPVLSMDHLVNDVAKY
FT                   MGWGRPGLIFSGTIFAIIFAMVVRFSAVAIGSIESSLNKISPSLDMASRTMGCHANAML
FT                   WRVHFPLIKRGMLIAGLLVFIESMKELNAALLLRPFNFETLATYVYNYASDERLELAAL
FT                   PAVLLVLVGLIPLVIVNRSLEQSH"
FT                   /protein_id="YP_004187784.1"
FT   gene            627456..628484
FT                   /db_xref="GeneID:10165325"
FT                   /locus_tag="VVM_01099"
FT   CDS_pept        627456..628484
FT                   /locus_tag="VVM_01099"
FT                   /codon_start="1"
FT                   /product="ferric iron ABC transporterATP-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155406"
FT                   /db_xref="GeneID:10165325"
FT                   /translation="MSCALSIKNLTCQYDAQTVLESLSLEVEQGQIVCLLGASGCGKTT
FT                   LLKAIAGLLPLSSGEMSLNCMMIDNGEHWVPPEQRNIGMIFQDYALFPHLTVAENVAFG
FT                   LRGWSSEARQSKVKEMLELVHLSPFADRYPHQLSGGQQQRVAIARSLAYKPDLLLLDEP
FT                   FSNIDTQVRHELIAEIRKIFKQQGVTAIFVTHSREEAFAFADKMAVMNHGVIEQYGTAS
FT                   ELYYKPSSKFVADFLGGGSYLPAKRLSESEFETHLGVVEATAQQSILINDPCELLLRPQ
FT                   HIQISAAEESSIRIMEQQFMGDHCRYVIEANGNKLLASSAEALNIGQMVSVKVDTQGIL
FT                   AF"
FT                   /protein_id="YP_004187785.1"
FT   gene            complement(628552..629964)
FT                   /db_xref="GeneID:10165326"
FT                   /locus_tag="VVM_01101"
FT   CDS_pept        complement(628552..629964)
FT                   /product="glcNAc phosphomutase"
FT                   /gene_family="HOG000268681" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01101"
FT                   /EC_number="5.4.2.3"
FT                   /db_xref="GI:320155407"
FT                   /db_xref="GeneID:10165326"
FT                   /translation="MIKFGTGGWRAFIGEEFTKDNVRLVAQAVANIINNEQVAERGFVI
FT                   GYDRRFLSDKAGAWFAEVLAANGIVVSFINKFVPTPIVMFKAKEMGCAYSACITASHNP
FT                   ADYNGVKVFIEGGRDADEVITQKIEAQIAHLTLDQVQSVDFEQAVEDKQIVIINPMNEF
FT                   VDSIINFIDIEAIKKANLRVLIDPMFGVAKNALQTVLINGRCDVDVINDGKNPDFGGLM
FT                   PSPSAATLYRLKHLVAAQGYDIGIGTDGDADRLGIIDEKGNFIHPNEVLILLYYYLLKY
FT                   KGWTGSVVRNIATTHLLDKIAADHGEKCFEVPVGFKHISSQMEADDSLIGGESSGGLTI
FT                   RGHIKGKDGVFASSLLVEMISVTGKKLSELLEEIYSKYGYAYMAEGDCKFKPAAKQSLY
FT                   DKIYIKKQLPEFGFEIEKVSYDDGAKVYFKNGGWVIARFSGTEPLLRIFAEMQDKETAE
FT                   LVVNQFKEFLAL"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187786.1"
FT   gene            complement(630036..632441)
FT                   /db_xref="GeneID:10165327"
FT                   /locus_tag="VVM_01107"
FT   CDS_pept        complement(630036..632441)
FT                   /product="chitobiose phosphorylase"
FT                   /gene_family="HOG000218307" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01107"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="GI:320155408"
FT                   /db_xref="GeneID:10165327"
FT                   /translation="MKYGYFDNDNREYVITRPDVPAPWTNYLGTEKFCTVISHNAGGYS
FT                   FYHSPEYNRVTKFRPNFTQDRPGHYVYLRDDATGDYWSISWQPVAKSLEQAKYEVRHGL
FT                   SYSKFKCEYNGIVANKTLFVPKGEDAEVWDVEIENTSDEVRTISAFNYVEFSFSHIKSD
FT                   NQNHQMSLYSAGTEYKDGVIEYDLYYNTDDFLGFYYLTATFDADSYDGQRDVFLGMYRD
FT                   EANPIAVAQGKCSNTAQTCYNHCGALHKQFVLQPGEKVRFAVILGVGKGNGAKLREKYQ
FT                   DLAKVDQAFAGIKAHWDERCEKFQVKSPNAGLDTMINAWTLYQAETCVVWSRFASFIEV
FT                   GGRTGLGYRDTAQDAISVPHTNPAMTRKRLVDLLRGQVKAGYGLHLFDPDWFDPEKADV
FT                   KPSKSPTVVPTPSDDDKIHGIKDTCSDDHLWIVPTILNYVKETGDIGFIDEVIPYADGG
FT                   NATVYEHMMAALDFSAEYVGQTGICKGLRADWNDCLNLGGGESSMVSFLHFWALEAFLE
FT                   LSRFRNDEAATDKYQAMASGVREACETHLWDEKGEWYIRGLTKDGDKIGTFDQVEGKVH
FT                   LESNSLAVLSGAVSHERGIKAMDAVYEYLFSKYGLHLNAPSFATPNDDIGFVTRVYQGV
FT                   KENGAIFSHPNPWAWVAEAKLGRGDRAMELYDSLNPYNQNDIIETRMAEPYSYVQFIMG
FT                   RDHQDHGRANHPWLTGTSGWAYYATTNFILGVRTGFDSLEIDPCIPTAWPGFEVTRQWR
FT                   GATYQIKVENPQGVSKGVKSIILNGQAIEGAVPAQAEGTVNEVVVVLG"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187787.1"
FT   gene            complement(632532..634451)
FT                   /db_xref="GeneID:10165328"
FT                   /locus_tag="VVM_01109"
FT   CDS_pept        complement(632532..634451)
FT                   /locus_tag="VVM_01109"
FT                   /gene_family="HOG000281068" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="beta-N-acetylhexosaminidase (GlcNAc)2 catabolism"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155409"
FT                   /db_xref="GeneID:10165328"
FT                   /translation="MEYRIDLVVLSEQKQNCRFGMTLHNLSDQDLPNWSLTFAFTRFIQ
FT                   PGSISHGTLTQIGSFCQLTPDSLVLPANHHFYCEFTVLTNPFRFYSDGLNEAFVEYHHE
FT                   GERVRSNVDVTPIVLASPYRERETIAPTLASAYSLLPKANALHVDAGHFSLTPSSAITC
FT                   QSALADSAVTWLMDEMARLHQFKLATSEVGEIIYRSNPTLDEGAYQLKISQEQVRVEAG
FT                   SSSGFVHATASLLQLLDYNSLTQEAQLACCSISDSPRFRYRGMMLDCSRHFHSVEQVKR
FT                   LINLLAHYKFNTFHWHLTDDEGWRVEIKAFPALTEVGAWRGVDEAIEPQYTHISQRYGG
FT                   FYSQEEIKEVVAYAAQRSIMVIPEIDVPGHCRAAIKSLPEMLVEVEDDTVYRSIQNYSD
FT                   NVLNPGLSTTYQFLDGVLEEIAQLFPAPYVHIGADEVPHGVWSNSPSCQALMKQHGYQD
FT                   YKELQGHLLRHAEQKLRSLGKRMLGWEEAQHGDKVSKDTVIYSWLSEEAAVNCARQGFD
FT                   VVLQPAQTTYLDMTQDYAPEEPGVDWANPLPLEKAYNYEPLANIPADDPIHKRIWGIQT
FT                   ALWCEIINNPERMDYMVFPRIIALAEACWTQKEHRDWNDFLSRLKGHLPLLDKQGIKYR
FT                   QPWK"
FT                   /protein_id="YP_004187788.1"
FT   gene            complement(634461..635351)
FT                   /db_xref="GeneID:10165329"
FT                   /locus_tag="VVM_01110"
FT   CDS_pept        complement(634461..635351)
FT                   /product="glucosamine kinase GpsK"
FT                   /gene_family="HOG000254665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01110"
FT                   /EC_number="2.7.1.8"
FT                   /db_xref="GI:320155410"
FT                   /db_xref="GeneID:10165329"
FT                   /translation="MTHLYVGIDGGGTSCRARIKDAQGHFIGEAKSGSANIMLGASVAM
FT                   ESILSAIQDAATQGGLSTQDFSRMHVGLALAGAEHKASWQSFMQQAHPFASMTLNTDAY
FT                   GACIGAHNGQDGAIMIAGTGSCGIFLQGTTQHVVGGREFPISDQGGGAVMGLRLVQQVL
FT                   LAQDGIRENTPLCEHVMTHFHHDVDAIVEWSKTALPRDYGQFSPAIFQHAEQGDALAIE
FT                   MLKQTAQDIEMFLIALNKRGATRICLMGSIAERIVKWLSPPVQQWIVEAQYDAIEGALM
FT                   FAGKSEHNLYAVATN"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187789.1"
FT   gene            complement(635353..637074)
FT                   /db_xref="GeneID:10165330"
FT                   /locus_tag="VVM_01112"
FT   CDS_pept        complement(635353..637074)
FT                   /product="glucosamine-link cellobiase"
FT                   /gene_family="HOG000281047" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01112"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="GI:320155411"
FT                   /db_xref="GeneID:10165330"
FT                   /translation="MLLLTNHLGYELSGPKHAVIQSNKSRLSSYAALLVCANGHQTVAS
FT                   LEIEKVGKVANWHQGYFYTIDFSDFDQVGEFYIRFDNHRSANFTIGQSLLMQQTFSDVL
FT                   HYFKSQRCGGIFDLQDRNAPLLNSNKTVDVHGGWYDASGDVSKYLSHLSYANYLNPQQT
FT                   PMVVWNMLKGLELLSGHEILPAFSQVRLKEEALHGADFLVRMQDSQGFFYTTVFDKWSK
FT                   DIKQREICSYETQQGHKSDDYQAGFRQGGGVSIAALAAASRLDVHGEFDQQKYLNAAEN
FT                   GYWHLKEYNPQYLNDGQENIIDEYCALLAVVELYRATQEERYLAESRIWASRLCARQQS
FT                   DEQFAYYWSANLDGSRPYFHAAEAGLPVIALCEYLSIEHNSDLLEQAREVVHRACEFEL
FT                   NITHKVNNPFSYPRQYVKGVNENKRDAFFVAQNNESGYWWQGENARLGSIASMAYLVQP
FT                   HLQDARLSHEMAVLAQRSLDWVLGLNPYDMCMLDGHGRNNPDYLPQFGFFNAKGGVCNG
FT                   ITSGFDDENDIAFNPDKQKDDLLQNWRWGEQWIPHGAWYLLAIMSQTHYNSATLGK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187790.1"
FT   gene            complement(637150..638145)
FT                   /db_xref="GeneID:10165331"
FT                   /locus_tag="VVM_01115"
FT   CDS_pept        complement(637150..638145)
FT                   /locus_tag="VVM_01115"
FT                   /codon_start="1"
FT                   /product="(GlcNAc)2 ABC transporter ATP-binding protein 2"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155412"
FT                   /db_xref="GeneID:10165331"
FT                   /translation="MSKEYGELLIEGKNVVKDFPLNSNALKQTKMRAINDVSFKMYKAR
FT                   GLSVVGESGSGKSTTAKMIAKMYAPTNGVIEYKGRDIQEITSKKDLMTYREGIQMVWQD
FT                   PFGSLNPTHNIFHHIARPLLIHKKVAPGNKKELEERVYDLLEQVGLIPPKATAEKFPHQ
FT                   LSGGQRQRVNLARNIAVGAEVVLADEPTSMLDVSIRAGVLNLMEEMKFEKQMSLLYITH
FT                   DIATARYIAEDLAVMYVGHMVEWGDTDEIIHDPQHPYTQLLVSAVPDPSKSIHEKLKGN
FT                   KGEIPLWTPDSVGCPFAGRCEHATEKCREKLPEVTQLSENHFVRCYLFEN"
FT                   /protein_id="YP_004187791.1"
FT   gene            complement(638183..639166)
FT                   /db_xref="GeneID:10165332"
FT                   /locus_tag="VVM_01117"
FT   CDS_pept        complement(638183..639166)
FT                   /locus_tag="VVM_01117"
FT                   /codon_start="1"
FT                   /product="(GlcNAc)2 ABC transporter ATP-binding protein 1"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155413"
FT                   /db_xref="GeneID:10165332"
FT                   /translation="MTEPLISIRNLCVDYITDAGDVRACNNVSFDIAPGEVFGLAGESG
FT                   CGKSTVAFSLMRLHKPPAFITGGEVIFNGENILQYSDDRMQAFRWSEMSMVFQSAMNAL
FT                   NPVLTMEDQFCDVIMRHTNMTREQAKRRAEGLLEIVDIHPSRLHDYPHQFSGGMRQRLV
FT                   IAIALALNPKMIIMDEPTTALDVVVQREILQKIYALKEEFGFSILFITHDLSLMVEFSD
FT                   RIGIMYSGELIEVAPAKQILESPYHPYTKGLGSSFPPLTGPKTKLTGIPGNPLNLLEVP
FT                   QGCRFQARCDRVHDTCTKVATSLRQIEPGRFSNCHLYGEPIAQNKL"
FT                   /protein_id="YP_004187792.1"
FT   gene            complement(639169..640194)
FT                   /db_xref="GeneID:10165333"
FT                   /locus_tag="VVM_01118"
FT   CDS_pept        complement(639169..640194)
FT                   /locus_tag="VVM_01118"
FT                   /gene_family="HOG000171368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="(GlcNAc)2 ABC transporter permease 2"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155414"
FT                   /db_xref="GeneID:10165333"
FT                   /translation="MNNLFKLILGNAIARVGLVIVCLFIFMAVAAPLITKHAPDKRTGN
FT                   PHEYPSFVVKAAQADPNGWIATNLADDRRTLLLSKKADHVLGTSRMGRDVWSQLAYGAR
FT                   VSLAVGFGAGITVCFLATVIGISAGYFGGRVDDILTAAMNIMLVIPQYPLLFVLAAFIG
FT                   EAGPMTIAIIIGCTSWAWGARVVRSQTLALREKEFVKAAEVLGESSWRIIFVEILPNLI
FT                   PIVGASFIGSVMYAITMESIISFLGLGDPNTISWGIMLYNVQTSSSMLIGAWWELLAPC
FT                   IALTLLVTGLALLNFAVDEIANPQLRSHKGMKRWQKLAKEDKKEREPEMAPQNALWSGD
FT                   K"
FT                   /protein_id="YP_004187793.1"
FT   gene            complement(640197..641183)
FT                   /db_xref="GeneID:10165334"
FT                   /locus_tag="VVM_01119"
FT   CDS_pept        complement(640197..641183)
FT                   /locus_tag="VVM_01119"
FT                   /gene_family="HOG000170250" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="(GlcNAc)2 ABC transporter permease 1"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155415"
FT                   /db_xref="GeneID:10165334"
FT                   /translation="MGYFLRRLSFYMVALLVAATLNFIIPRAMPGDPVTMMFANATTQV
FT                   TPERIEAMKKLLGFVDGPLYVQYFTYIKSILSWELGTSIKFYPLSVNDLLGSAFGWSLF
FT                   LAGTAVILSFSIGSILGIFAAWRRGSKYDAFITPGMLIIQAVPQVVIAMLALFIFAIGL
FT                   GWFPTGYAYTPGTIPDWTSWAYFKDVAYHAVLPLFCASIVQIGGFLVNMRNNMINLLAE
FT                   DYITMAKGKGLSENRVVFNYAARNALLPSVTALSMSLGMAIGGQLIVEIIFNYPGLGKV
FT                   LLDAINARDYQVLQGQLLIMTLFMLSFNLIADMLYVVLDPRLRKGGK"
FT                   /protein_id="YP_004187794.1"
FT   gene            complement(641352..643025)
FT                   /db_xref="GeneID:10165335"
FT                   /locus_tag="VVM_01121"
FT   CDS_pept        complement(641352..643025)
FT                   /locus_tag="VVM_01121"
FT                   /gene_family="HOG000237772" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="(GlcNAc)2 ABC transporter periplasmic
FT                   substrate-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155416"
FT                   /db_xref="GeneID:10165335"
FT                   /translation="MLANIKKTALATAVIAAAATSISAPAAARSELTIVPDFYPTMVRN
FT                   FNPYLATNLRTTTDFIYEPLVVFNEMHGNTPVMRLAEDFRMSDDLMSVTFDIRKGVKWS
FT                   DGQAFNADDVVFSYALLKNKPELDQRGINKWVTSVEKLNDYQVRFRLSEANSNVPYEIS
FT                   LVPIVAEHVWKEVKDPTTFTNENPVGTGPFTVIDTFTPQLYIQCRNPNYWDSANLEVDC
FT                   LRVPQIANNDQLLGKIVNSELDWTSSFIPDIDRTYAAASPNHQYWYPPSGTQAFVVNFK
FT                   NPDAAKNEALTNVDFRRAFSMALDRQTIIDIAFYGGGTVNDFASGLGYAFEAWSDEKTH
FT                   NKYKGYNTYNVEGAKKLLAKAGFKDVNKDGFVDTPSGKPFELLIQSPNGWTDFNNTVQL
FT                   AVEQLAEVGIKARARTPEFAVYNQAMLDGTYDVAYTNYFHGADPHLYWNSAYNSALQKG
FT                   EGMPRFAMHFYTNDKLDNLLDSFYKTADKKEQLSIAHGIQQIIAADQVTIPVMSGAYMY
FT                   QYNTKRFTGWWTEENPKGRPNIWAGIPERLLHVLDLKPVK"
FT                   /protein_id="YP_004187795.1"
FT   gene            complement(643966..647355)
FT                   /db_xref="GeneID:10165336"
FT                   /locus_tag="VVM_01123"
FT   CDS_pept        complement(643966..647355)
FT                   /locus_tag="VVM_01123"
FT                   /gene_family="HOG000281036" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chitin catabolic cascade sensor histidine kinase
FT                   ChiS"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155417"
FT                   /db_xref="GeneID:10165336"
FT                   /translation="MFKFYRKQKFKRLQSTLMTAFLVLSITPLTITAIFFLQSHSKDLQ
FT                   EQSTSHLLSVRDTKQQQILDYFQAQETEVMGFVRSELAYASGGRFYGLVNAFKSLGVDM
FT                   EQARENAQQRYIQGSGDQIKTSILPESSSFVGSERYRLLHKRYHWAYLELLKRSDFDDI
FT                   LLVDLDGNVTYSIYKNENFGTNLIEGPFKESMLGKSFRQLANDVSEKRKQNEDYTPVYI
FT                   SDFSVEDGKQVAWLGAPIIQQGYLHSYAMFRLPNNGITKLIADINKDAAIHTLLVGSDH
FT                   LPRTMTTKQTDIESSIEVVDKALAGLTDVGTYINSSGEATIAAYAPISFKGQTWALVVQ
FT                   LPEKEAFARIHQLEKLFVIAMLIAIVLVFISSHYLSNFITSPLLKLTWAAERVSAGDLD
FT                   ENMINTERKDEIGRLAISFERMQRSIRDKIQLIKTQNAELEKNLQLIQKQNDELQLADK
FT                   LKDEFLATTSHELRTPLHGMIGIAETLISGANGPLPSNQRYQLDIIIKSGQRLATLVDD
FT                   LLDYHKMRYGSLDIQKSAVNLASATRLVLELSHHLLGNKTLRIINQVSNDVAPVSADPQ
FT                   RLEQVLYNLIGNAIKYTTEGKIVISANVVDDKVRVQVVDTGQGIPAEQLEHIFEPLIQA
FT                   GRDSGRYRQGAGLGLSISRQLIELMGGSLYVSSQPMVGTTFSFTLPLASADEISATEVM
FT                   QNQHHFQAPDSNELISLDNSSLPENPNGPLLIVADDEPVNLRVLESFLRIEGYRVQTAS
FT                   DGPDTLELIEHEKPALLLLDIMMPGMSGYQVCHQLRQQYDMAELPIIMLTALSQSEDRV
FT                   RGFEAGANDYLTKPFNKQELAARIKAHLMASKAEARRLENNRLEAELRQRAMVEASLLE
FT                   TQGRLLEQLESAPEAIICIREDKRIRFANDAACKLFKRSLEQLKRSNAEELIAPKYLTV
FT                   KQQHYCGNIDIYVDDVRQHIETDILKLPEGSGLDAMFIFNVGGGAAASRVHNLETAVEV
FT                   LSSYAFDGDKERLQSLKELGGEFTRLADKALGTNKNKQELMREVLVDLMTHALDYWESV
FT                   TGENKFTFAEQSGLWRVYLDRSTLQTRTLDKYMRIETLPKTPRWRTVLSSIEYILDHCK
FT                   EQSPERTYIEMQRDKLQRLLTS"
FT                   /protein_id="YP_004187796.1"
FT   gene            complement(647602..648624)
FT                   /db_xref="GeneID:10165337"
FT                   /locus_tag="VVM_01127"
FT   CDS_pept        complement(647602..648624)
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /gene_family="HOG000218308" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01127"
FT                   /EC_number="2.1.1.52"
FT                   /db_xref="GI:320155418"
FT                   /db_xref="GeneID:10165337"
FT                   /translation="MSAYTAPSQIAQRQLDYFNGKHVLVAGEVEDLFPLELAEHCESVS
FT                   VFTSNYSYFRQIRAHSTITSYFGSQLEADSQADLLLLYWPKAKAEAEYLLAMLLAKLGS
FT                   GCEIVVVGENRSGVKSIEKMFQAYGPVNKYDSARRCSFYWGQCNTQPNAFNQADWFRHY
FT                   SINIHGQQLEIQSLPGVFSHGEFDLGSQLLLETLPSLSGKVLDFGCGAGVIGAFMAKRN
FT                   PTIELEMCDINAYALASSEATLAANGLQGRVFASDIYSDTADDYRFIISNPPFHSGLDT
FT                   NYNAAETLLGQAPQHLNNQGELIIVANSFLKYPPIIEQAFSNCATLNKTNKFSIYHASK
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_004187797.1"
FT   gene            complement(648698..649783)
FT                   /db_xref="GeneID:10165338"
FT                   /locus_tag="VVM_01129"
FT   CDS_pept        complement(648698..649783)
FT                   /locus_tag="VVM_01129"
FT                   /gene_family="HOG000010621" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative permease"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155419"
FT                   /db_xref="GeneID:10165338"
FT                   /translation="MPEKIKISSSHWVLIVALLAAGTACYLLVEPYINSIIMAFIISLL
FT                   MFPIHDWFESKMPKHRNMASLLSCVVLTFIIVVPLLFVFAAIVQQGSVFSQNTYQWVTH
FT                   GGIQQVLGHPWIVKGLKLVNEYLPFDNIDAKSIAEKIGQLATSFGSNLVAISAKILGDA
FT                   TNFLMDFFLMLFVLFFLLRDHDKIISAIRHILPLSRSQEDKLLSEIENVSKSAVMGSFL
FT                   TAIAQGIAGGLGMWLAGFPGLFWGTMMGFASFIPVVGTALIWIPATIYLFLTGDTGWAI
FT                   FLAIWSIAIVGSIDNLLRPFLMQGSAGMNTLLIFFSLLGGIQLFGLIGLIYGPLIFAIT
FT                   MVLFNIYEEEFKGFLDQQDNS"
FT                   /protein_id="YP_004187798.1"
FT   gene            649860..649976
FT                   /db_xref="GeneID:10165339"
FT                   /locus_tag="VVM_01130"
FT   CDS_pept        649860..649976
FT                   /locus_tag="VVM_01130"
FT                   /gene_family="HOG000005247" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155420"
FT                   /db_xref="GeneID:10165339"
FT                   /translation="MGCCNNEKGCEARKTARRIPWFAVTIGVLALLVIFNWQ"
FT                   /protein_id="YP_004187799.1"
FT   gene            complement(650033..651328)
FT                   /db_xref="GeneID:10165340"
FT                   /locus_tag="VVM_01133"
FT   CDS_pept        complement(650033..651328)
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /gene_family="HOG000020210" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01133"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="GI:320155421"
FT                   /db_xref="GeneID:10165340"
FT                   /translation="MTKSAELYQKAQQTIPGGVNSPVRAFNGVGGSPIFVERADGAFIF
FT                   DADGKAYIDYVGSWGPMILGHNHAVIREAVIEAAQRGLSFGAPTEMEIKMAELVSELVP
FT                   SMEQLRMVSSGTEATMSAIRLARGFTGRDKILKFEGCYHGHADSLLVKAGSGALTLGQP
FT                   SSPGVPADFAKHTLTATFNDLDSVRELFAANKGEIACIIVEPVAGNMNCIPPVEGFHEG
FT                   LREICDQEGALLIFDEVMTGFRVALGGAQAHYNIKPDLTTLGKVIGGGMPVGAFGGRKE
FT                   VMQFIAPTGPVYQAGTLSGNPVAMAAGYACLTLLREEGNEKRLASKTKHLADGFKSLAA
FT                   QHGIPLVVNQVGGMFGFFFTEQEQITCYEDVTKCDIERFKRFFHLMIDHGVYLAPSAFE
FT                   ASFTSLAHGSKEIEATLEAADRCFAILAAESK"
FT                   /transl_table="11"
FT                   /protein_id="YP_004187800.1"
FT   gene            651672..651956
FT                   /db_xref="GeneID:10165341"
FT                   /locus_tag="VVM_01134"
FT   CDS_pept        651672..651956
FT                   /locus_tag="VVM_01134"
FT                   /gene_family="HOG000228313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative iron binding protein from the
FT                   HesB_IscA_SufA family"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155422"
FT                   /db_xref="GeneID:10165341"
FT                   /translation="MLIAEEENPALKLRVYITGGGCSGFQYGFTFDESVNEGDTTIENS
FT                   GVTLVVDPMSLQYLIGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSV"
FT                   /protein_id="YP_004187801.1"
FT   gene            652082..653176
FT                   /db_xref="GeneID:10165342"
FT                   /locus_tag="VVM_01136"
FT   CDS_pept        652082..653176
FT                   /locus_tag="VVM_01136"
FT                   /gene_family="HOG000008281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-fusion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155423"
FT                   /db_xref="GeneID:10165342"
FT                   /translation="MSIKQQGRQFIQRPWLVSLLIILILGAWLGFGSSKADETSSTKAA
FT                   QEIPLAKVVYQTFLAQPTARSIDLYGRTAPNRQARLGAEIAGKIVRLEVEKGQAVRKGQ
FT                   VIAIIDKRDLDYRLQRAKAMLEVKLKEFKAAQSLKSRGLQGEVAFATAEAALVDAKANL
FT                   NNVETELSNTEVRAPFDGILDSRFVEVGDFVGIGDPVATVIDLQKLVIEADVSERHVQH
FT                   LAAKQMAQVRLIGGQLLQGTIRYVGQVSSPSTNTFPIEIEVDNSQHRIPAGVSAEVQLT
FT                   LDQTSAIKVTPAMLALDERGNLGVKTVQNQHVRFVPIQLVKAEQDGVWLSGLGEQVDII
FT                   VLGQGFVRDGDLVDATPQTELVTN"
FT                   /protein_id="YP_004187802.1"
FT   gene            653187..656369
FT                   /db_xref="GeneID:10165343"
FT                   /locus_tag="VVM_01138"
FT   CDS_pept        653187..656369
FT                   /locus_tag="VVM_01138"
FT                   /gene_family="HOG000158135" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative multidrug resistance protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155424"
FT                   /db_xref="GeneID:10165343"
FT                   /translation="MLSVIDAVLSRSRTMMTLLVMILLAGIGTYMTIPKESSPDITIPI
FT                   IYVSVGHQGISPTDAERLLVRPIEQELRSIEGVKEMTSTASEGHASVMLEFTVGVDLAK
FT                   AMADVRDAVDLAKPKLPADSDEPTVNEVTLASEEPVLSVVLYGTLPERTIVQVARQLRD
FT                   KLESYRQVLEVDIAGDREDIVEIIVDPLLMESYGLDQGDIYNLIALNNRVVAAGFVDTG
FT                   YGRFSVKVPSVFDSLKDVLELPIKVDGKQVITFADVATVRRAFRDPESFARLDGKPAVV
FT                   LDVKKRAGENIIETVELVKRVIEEGQKRADWPDNLLVKYTWDQSEDVELMLNDLQNNIL
FT                   SAIILVVIVIIAILGVRTALLVGISIPGSFLTGLLVLAVFGLTVNIVVLFSLIMAVGML
FT                   VDGAIVVTEFADRRMQEGVERKQAYRDAAKRMAWPITASTATTLAAFAPLLFWPDITGE
FT                   FMKYLPLTLIATLAASLIMALLFVPVLGGLIGKPQNVSSENQRRMVALHNGEFDKATGI
FT                   TKLYYHTLAIAVRHPLKILLSAILMAGGVGFAYNKAGLGAEFFPEVDPPFFTVKVRSYG
FT                   DLSIFEKDVVMRNIEQVMLGHDEFESVYTRTGGDDEIGQIQITPVDWQYRRKVKEIIDE
FT                   LKQTTSTFSGVEIEYKFPDAGPPVEHDLVIEMSSRIPENLDDAAKVVRHWADNNPALTN
FT                   LSDTSSKEGIDWQIDIRRDDASRFAADATLVGNTVQFVTNGLKIGDYLPDDANEEVDIL
FT                   VRYPEEKRDIGRFDQLRVKTPAGLVPITNFAQIKPEPKQDTIKRIDGQRVINVMADMVE
FT                   GYNLALELPKIEQALSELGLPEGVEFRIRGQNEEQEHSSAFLQNAFMIALAVMALILIT
FT                   QFNSFYQAFLILSAVLFSTVGVFAGLLIFQKPFGVIMSGIGVIALAGIVVNNNIVLIDT
FT                   YNQLRQRGLDKEEAILRTGVQRLRPVMLTTVTTILGLLPMVLEMNIDLINQKIEFGAPS
FT                   TQWWSQLATAVAGGLAFATVLTLVLTPCLLMLGREHRSVKEDDGVEEELIDDVHTDIPP
FT                   AASSESGKVVGL"
FT                   /protein_id="YP_004187803.1"
FT   gene            complement(656443..657735)
FT                   /db_xref="GeneID:10165344"
FT                   /locus_tag="VVM_01144"
FT   CDS_pept        complement(656443..657735)
FT                   /locus_tag="VVM_01144"
FT                   /gene_family="HOG000281148" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:320155425"
FT                   /db_xref="GeneID:10165344"
FT                   /translation="MLSIFARLPILHKVLIGFFSAMIFVALFLLPDANELRPKENRLEV
FT                   GRHYPIGIEMQRLSINPVLSAESSVHRWERYRVKDGESAAILFQRIGLSASLLHQLITT
FT                   NDDIKTQLSRLKPGDMLQFGFDAQDQLVKLKRQVNAFETFEITRSDTGYRSQLNNKEVN
FT                   YQYAYAEASITSNFWNAAISAGLTANQIMELAGIFGWDIDFAQDIRERDSFRVLYQEQV
FT                   VEGEVIGRGRIIAAIFRNQGDTFTAIYDDKTGNYYDENGRAMKKAFLRAPIDFRRVSSN
FT                   FNPRRLHPVTGQVKAHRGTDYVAPVGTPIWAAGDGVVQQAGYNQFNGNYVFIRHSNTYL
FT                   TKYLHLQKKLVKTGQRVKQGQSIGTLGGTGRVTGPHLHYEFLVNGVHKNPRTVSLPQAQ
FT                   SLSGQAKETFIANSKLRLDKLERYSKLLAMN"
FT                   /protein_id="YP_004187804.1"
FT   gene            657863..659050
FT                   /db_xref="GeneID:10165345"
FT                   /locus_tag="VVM_01145"
FT   CDS_pept        657863..659050
FT                   /product="tyrosyl-tRNA synthetase, cluster 1"
FT                   /gene_family="HOG000242791" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="VVM_01145"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="GI: