(data stored in ACNUC16935 zone)

EMBL: X02650

ID   X02650; SV 1; linear; mRNA; STD; VRT; 598 BP.
XX
AC   X02650;
XX
DT   28-JAN-1986 (Rel. 08, Created)
DT   10-FEB-1999 (Rel. 58, Last updated, Version 5)
XX
DE   Chicken mRNA for ubiquitin
XX
KW   heat shock protein; ubiquitin.
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-598
RX   PUBMED; 2987683.
RA   Bond U., Schlesinger M.J.;
RT   "Ubiquitin is a heat shock protein in chicken embryo fibroblasts";
RL   Mol. Cell. Biol. 5(5):949-956(1985).
XX
RN   [2]
RP   1-598
RA   Bond U.;
RT   ;
RL   Submitted (14-MAR-1986) to the INSDC.
XX
DR   MD5; f1e9fc09f3880fd126ebd40c1273a9c5.
DR   Ensembl-Gn; ENSGALG00000004509; gallus_gallus.
DR   Ensembl-Tr; ENSGALT00000061244; gallus_gallus.
XX
CC   Data kindly reviewed (Bond U.) by 14-MAR-1986
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..598
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        1..474
FT                   /note="ubiquitin"
FT                   /db_xref="GOA:P0CG62"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG62"
FT                   /protein_id="CAA26488.1"
FT                   /translation="MRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
FT                   RLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
FT                   NVKAKIQDKEGIPPDQQRWIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGY"
FT   old_sequence    348..348
FT                   /note="U was C in [1]"
FT                   /citation=[1]
FT   old_sequence    357..357
FT                   /note="U was C in [1]"
FT                   /citation=[1]
FT   old_sequence    525..525
FT                   /note="G was A in [1]"
FT                   /citation=[1]
FT   old_sequence    527..527
FT                   /note="A was U in [1]"
FT                   /citation=[1]
FT   old_sequence    574..574
FT                   /note="A was U in [1]"
FT                   /citation=[1]
FT   old_sequence    577..577
FT                   /note="A was U in [1]"
FT                   /citation=[1]
FT   polyA_site      598..598
FT                   /note="polyA site"
XX
SQ   Sequence 598 BP; 152 A; 149 C; 159 G; 130 T; 8 other;
     ttgagaggtg ggatgcagat cttcgtgaaa acgttgactg gcaagaccat cacccttgag        60
     gttgagccca gtgacaccat tgaaaatgtg aaggccaaga tccaagacaa ggaaggcatc       120
     ccccctgacc aacaaaggtt gatctttgct ggcaagcagc tggaagatgg gcgcaccctg       180
     tctgactaca acatccagaa agagtccacc ctgcatctgg tgctgcgcct gaggggaggc       240
     atgcagatct ttgtgaagac cctgactggc aagaccatca ccctcgaggt tgagcccagt       300
     gacaccattg agaacgtgaa ggccaagatc caagacaaag aaggcattcc ccctgatcaa       360
     caaaggtgga tttttgctgg caagcagctg gaagatggtc gcaccctgtc tgactacaac       420
     atccaaaagg agtccaccct gcacttggtg ctgcgcctca ggggtggcta ttagttgttg       480
     tcagcagtct tgtcaagcaa gatgcacagc acattgtgtg ttgcgcagta gtctttctaa       540
     tgnnnnnncc gncggtccgg ttcgtggaat gncaataaag tttttccggt gccccttt         598
//

If you have problems or comments...

PBIL Back to PBIL home page