(data stored in ACNUC16935 zone)

EMBL: X13493.PE1

X13493.PE1           Location/Qualifiers
FT   CDS_pept        <1..210
FT                   /codon_start=1
FT                   /product="ubiquitin-fusion protein (69 AA)"
FT                   /db_xref="GOA:P62985"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62985"
FT                   /protein_id="CAA31848.1"
FT                   /translation="NIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
     aacatccaga aagagtccac cctgcacctg gtgctgcgtc tgcgcggggg tatcattgag        60
     ccctccctgc ggcagttggc ccagaagtac aactgcgata agatgatctg ccgcaagtgc       120
     tacgcccgcc tccatccccg tgccgtcaac tgccgcaaga agaagtgcgg ccacaccaac       180
     aacctgcgcc ccaagaagaa ggtcaaatag                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page