(data stored in SCRATCH zone)

HOGENOMDNA: YEPES1_4

ID   YEPES1_4; SV 1; empty ; DNA; empty ; PRO; 4653728 BP.
XX
AC   NC_003143;
XX
PR   Project: 57621;
XX
DE   Yersinia pestis CO92 chromosome, complete genome.
XX
OS   Yersinia pestis CO92
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-4653728
RX   PUBMED; 19055764.
RA   Rosso,M.L., Chauvaux,S., Dessein,R., Laurans,C., Frangeul,L., Lacroix,C.,
RA   Schiavo,A., Dillies,M.A., Foulon,J., Coppee,J.Y., Medigue,C., Carniel,E.,
RA   Simonet,M. and Marceau,M.;
RT   "Growth of Yersinia pseudotuberculosis in human plasma: impacts on
RT   virulence and metabolic gene expression";
RL   BMC Microbiol. 8, 211 (2008)
XX
RN   [2]
RP   1-4653728
RX   PUBMED; 12834539.
RA   Delihas,N.;
RT   "Annotation and evolutionary relationships of a small regulatory RNA gene
RT   micF and its target ompF in Yersinia species";
RL   BMC Microbiol. 3, 13 (2003)
XX
RN   [3]
RP   1-4653728
RX   PUBMED; 11586360.
RA   Parkhill,J., Wren,B.W., Thomson,N.R., Titball,R.W., Holden,M.T.,
RA   Prentice,M.B., Sebaihia,M., James,K.D., Churcher,C., Mungall,K.L.,
RA   Baker,S., Basham,D., Bentley,S.D., Brooks,K., Cerdeno-Tarraga,A.M.,
RA   Chillingworth,T., Cronin,A., Davies,R.M., Davis,P., Dougan,G.,
RA   Feltwell,T., Hamlin,N., Holroyd,S., Jagels,K., Karlyshev,A.V., Leather,S.,
RA   Moule,S., Oyston,P.C., Quail,M., Rutherford,K., Simmonds,M., Skelton,J.,
RA   Stevens,K., Whitehead,S. and Barrell,B.G.;
RT   "Genome sequence of Yersinia pestis, the causative agent of plague";
RL   Nature 413 (6855), 523-527 (2001)
XX
RN   [4]
RP   1-4653728
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (12-DEC-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [5]
RP   1-4653728
RA   Parkhill,J.;
RT   "Direct Submission";
RL   Submitted (04-OCT-2001) Submitted on behalf of the Yersinia sequencing
RL   team, Sanger Centre, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA E-mail: parkhill@sanger.ac.uk
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AL590842.
CC   Notes:
CC   Details of Y. pestis sequencing at the Sanger Centre are available
CC   on the World Wide Web.
CC   (URL, http://www.sanger.ac.uk/Projects/Y_pestis/)
CC   Original CON assembly
CC   join(AJ414141.1:1..288050,AJ414142.1:51..214050,
CC   AJ414143.1:51..201050,
CC   AJ414144.1:51..208050,AJ414145.1:51..208050,AJ414146.1:51..210050,
CC   AJ414147.1:51..199050,AJ414148.1:51..210050,AJ414149.1:51..193050,
CC   AJ414150.1:51..335050,AJ414151.1:51..334050,AJ414152.1:51..313050,
CC   AJ414153.1:51..258050,AJ414154.1:51..204050,AJ414155.1:51..205050,
CC   AJ414156.1:51..220050,AJ414157.1:51..216040,AJ414158.1:41..235050,
CC   AJ414159.1:51..199050,AJ414160.1:51..203728).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4653728
FT                   /strain="CO92"
FT                   /mol_type="genomic DNA"
FT                   /organism="Yersinia pestis CO92"
FT                   /biovar="Orientalis"
FT                   /db_xref="taxon:214092"
FT   gene            complement(271..711)
FT                   /db_xref="GeneID:1172846"
FT                   /locus_tag="YPO0001"
FT   CDS_pept        complement(271..711)
FT                   /locus_tag="YPO0001"
FT                   /gene_family="HOG000030545" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavodoxin"
FT                   /transl_table="11"
FT                   /note="An electron-transfer protein; flavodoxin binds one
FT                   FMN molecule, which serves as a redox-active prosthetic
FT                   group"
FT                   /db_xref="GI:218927222"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CLF0"
FT                   /db_xref="GeneID:1172846"
FT                   /translation="MADITLISGSTLGSAEYVAEHLADKLEEAGFSTEILHGPELDELT
FT                   LNGLWLIVTSTHGAGDLPDNLQPLLEQIEQQKPDLSQVRFGAVGLGSSEYDTFCGAIIK
FT                   LDQQLIAQGAQRLGEILEIDVIQHEIPEDPAEIWVKDWINLL"
FT                   /protein_id="YP_002345097.1"
FT   misc_feature    complement(274..711)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:185997"
FT                   /locus_tag="YPO0001"
FT   gene            complement(804..1265)
FT                   /db_xref="GeneID:1172849"
FT                   /locus_tag="YPO0002"