(data stored in ACNUC8465 zone)

HOGENOMDNA: YERE8_1

ID   YERE8_1; SV 1; empty ; DNA; empty ; PRO; 67721 BP.
XX
AC   NC_008791;
XX
PR   Project:57741;
XX
DE   Yersinia enterocolitica subsp. enterocolitica 8081 plasmid pYVe8081,
DE   complete sequence.
XX
OS   Yersinia enterocolitica subsp. enterocolitica 8081
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RX   PUBMED; 17173484.
RA   Thomson,N.R., Howard,S., Wren,B.W., Holden,M.T., Crossman,L.,
RA   Challis,G.L., Churcher,C., Mungall,K., Brooks,K., Chillingworth,T.,
RA   Feltwell,T., Abdellah,Z., Hauser,H., Jagels,K., Maddison,M., Moule,S.,
RA   Sanders,M., Whitehead,S., Quail,M.A., Dougan,G., Parkhill,J. and
RA   Prentice,M.B.;
RT   "The Complete Genome Sequence and Comparative Genome Analysis of the High
RT   Pathogenicity Yersinia enterocolitica Strain 8081";
RL   PLoS Genet. 2 (12), E206 (2006)
XX
RN   [2]
RP   1-67721
RA   Thomson,N.R.;
RT   "Direct Submission";
RL   Submitted (30-JUN-2006) Thomson N.R., Pathogen Sequencing Unit, The
RL   Wellcome Trust Sanger Institute, Genome Campus, Hinxton, Cambridge, CB10
RL   1SA, UNITED KINGDOM
XX
RN   [3]
RP   1-67721
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (13-JAN-2004) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AM286416.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..67721
FT                   /sub_species="enterocolitica"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:393305"
FT                   /strain="8081"
FT                   /plasmid="pYVe8081"
FT                   /organism="Yersinia enterocolitica subsp. enterocolitica
FT                   8081"
FT   rep_origin      1..650
FT                   /note="oriR; putative"
FT   gene            628..1287
FT                   /db_xref="GeneID:4711897"
FT                   /locus_tag="YEP0001"
FT   CDS_pept        628..1287
FT                   /locus_tag="YEP0001"
FT                   /gene_family="HOG000219593" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative transposase"
FT                   /transl_table="11"
FT                   /note="Similar to several putative transposases including:
FT                   Agrobacterium tumefaciens IS3 family transposase
FT                   SWALL:Q8UDL7 (EMBL:AE009161) (512 aa) fasta scores: E():
FT                   3.8e-24, 37.56 38d in 197 aa and to Escherichia coli, and
FT                   Shigella flexneri possible transposase of IS1353 YahA
FT                   SWALL:Q9WTH9 (EMBL:AP000342) (514 aa) fasta scores: E():
FT                   9.4e-21, 36.5 38d in 200 aa"
FT                   /db_xref="GI:122815791"
FT                   /db_xref="GeneID:4711897"
FT                   /translation="MFTEAERIRAIELYFKYGRKLAPVVLELGYPTKRNLRRWIRLWEA
FT                   SDDATKSIRRKPRYSNGQKQAAVEHYLNHGCCLAFTSRTLGYPCCDVLARWVNERHPDR
FT                   RLIFTSTINQNAPFEPEVKRQAVMALCTRHVPAREIAMNVGISRTVLYKWKDEIIGDEA
FT                   YQSMRKHEKPSLTEERDTLREEVNRLNQEIRPACLAYAHRKLRGQIVDELTLYRWF"
FT                   /protein_id="YP_001004057.1"
FT   repeat_region   complement(1206..1649)
FT                   /note="label:IS1400'; partial insertion sequence element
FT                   IS1400"
FT   gene            complement(1284..1571)
FT                   /db_xref="GeneID:4711880"
FT                   /locus_tag="YEP0002"