(data stored in SCRATCH zone)

HOGENOMDNA: YERE8_2

ID   YERE8_2; SV 1; empty ; DNA; empty ; PRO; 4615899 BP.
XX
AC   NC_008800;
XX
PR   Project:57741;
XX
DE   Yersinia enterocolitica subsp. enterocolitica 8081, complete genome.
XX
OS   Yersinia enterocolitica subsp. enterocolitica 8081
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-4615899
RX   PUBMED; 17173484.
RA   Thomson,N.R., Howard,S., Wren,B.W., Holden,M.T., Crossman,L.,
RA   Challis,G.L., Churcher,C., Mungall,K., Brooks,K., Chillingworth,T.,
RA   Feltwell,T., Abdellah,Z., Hauser,H., Jagels,K., Maddison,M., Moule,S.,
RA   Sanders,M., Whitehead,S., Quail,M.A., Dougan,G., Parkhill,J. and
RA   Prentice,M.B.;
RT   "The complete genome sequence and comparative genome analysis of the high
RT   pathogenicity Yersinia enterocolitica strain 8081";
RL   PLoS Genet. 2 (12), E206 (2006)
XX
RN   [2]
RX   PUBMED; 12834539.
RA   Delihas,N.;
RT   "Annotation and evolutionary relationships of a small regulatory RNA gene
RT   micF and its target ompF in Yersinia species";
RL   BMC Microbiol. 3, 13 (2003)
XX
RN   [3]
RP   1-4615899
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (19-JAN-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-4615899
RA   Thomson,N.R.;
RT   "Direct Submission";
RL   Submitted (30-JUN-2006) Thomson N.R., Pathogen Sequencing Unit, The
RL   Wellcome Trust Sanger Institute, Genome Campus, Hinxton, Cambridge, CB10
RL   1SA, UNITED KINGDOM
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AM286415.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4615899
FT                   /strain="8081"
FT                   /sub_species="enterocolitica"
FT                   /mol_type="genomic DNA"
FT                   /organism="Yersinia enterocolitica subsp. enterocolitica
FT                   8081"
FT                   /db_xref="taxon:393305"
FT   gene            complement(270..710)
FT                   /db_xref="GeneID:4713445"
FT                   /locus_tag="YE0001"
FT   CDS_pept        complement(270..710)
FT                   /locus_tag="YE0001"
FT                   /gene_family="HOG000030545" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavodoxin"
FT                   /transl_table="11"
FT                   /note="An electron-transfer protein; flavodoxin binds one
FT                   FMN molecule, which serves as a redox-active prosthetic
FT                   group"
FT                   /db_xref="GI:123440404"
FT                   /db_xref="GeneID:4713445"
FT                   /translation="MADITLISGSTLGSAEYVAEHLAEKLEEAGFTTETLHGPELDELT
FT                   LDGMWLIITSTHGAGDLPDNLQPLLEQIEQQRPDLSQVRFGAVGLGSSEYDTFCGAVRK
FT                   LDQQLIIQGAIRVGDILEIDVIKHEIPEDPAEIWVKNWINLL"
FT                   /protein_id="YP_001004398.1"
FT   misc_feature    complement(273..704)
FT                   /note="Pfam match to entry PF00258 flavodoxin, Flavodoxin,
FT                   score 117.3, E-value 1.9e-32"
FT                   /locus_tag="YE0001"
FT                   /inference="protein motif:PFAM:PF00258"
FT   gene            complement(802..1263)
FT                   /db_xref="GeneID:4713281"
FT                   /locus_tag="YE0002"