(data stored in SCRATCH zone)

HOGENOMDNA: YERPP_1

ID   YERPP_1; SV 1; empty ; DNA; empty ; PRO; 71507 BP.
XX
AC   NC_009377;
XX
PR   Project: 58619;
XX
DE   Yersinia pestis Pestoides F plasmid CD, complete sequence.
XX
OS   Yersinia pestis Pestoides F
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-71507
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Di
RA   Bartolo,G., Chain,P., Malfatti,S., Shin,M., Vergez,L., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Worsham,P., Chu,M., Bearden,S., Garcia,E.
RA   and Richardson,P.;
RT   "Complete sequence of plasmid CD of Yersinia pestis Pestoides F";
RL   Unpublished
XX
RN   [2]
RP   1-71507
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-APR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-71507
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Dalin,E., Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Worsham,P., Chu,M.,
RA   Bearden,S., Garcia,E. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (05-FEB-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000669.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773191
CC   Source DNA and bacteria available from Emilio Garcia
CC   (garcia12@llnl.gov)
CC   Contacts: Emilio Garcia (garcia12@llnl.gov)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..71507
FT                   /strain="Pestoides F"
FT                   /mol_type="genomic DNA"
FT                   /organism="Yersinia pestis Pestoides F"
FT                   /plasmid="CD"
FT                   /db_xref="taxon:386656"
FT   gene            15..368
FT                   /db_xref="GeneID:5061563"
FT                   /locus_tag="YPDSF_3936"
FT                   /pseudo
FT   gene            630..725
FT                   /db_xref="GeneID:5061553"
FT                   /locus_tag="YPDSF_3937"
FT                   /pseudo
FT   gene            785..1033
FT                   /db_xref="GeneID:5061622"
FT                   /locus_tag="YPDSF_3938"
FT   CDS_pept        785..1033
FT                   /locus_tag="YPDSF_3938"
FT                   /gene_family="HOG000266869" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phospholipase D/transphosphatidylase"
FT                   /transl_table="11"
FT                   /note="SMART: Phospholipase D/Transphosphatidylase:
FT                   (5.5e-06)"
FT                   /db_xref="GI:145597104"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="GeneID:5061622"
FT                   /translation="MDLLVNAGIPVRTVNSFKALHDKVIIVDGKNTQMGSFNFSQAAVQ
FT                   SNSENVLIIWGDFTVVQAYLQYWQSRWNKGTDWRSSY"
FT                   /protein_id="YP_001154568.1"
FT   misc_feature    <800..1009
FT                   /note="Phospholipase D. Active site motifs; The PLD
FT                   superfamily includes enzymes involved in signal
FT                   transduction, lipid biosynthesis, endonucleases and open
FT                   reading frames in pathogenic viruses and bacteria.  PLD
FT                   hydrolyzes the terminal phosphodiester bond of...; Region:
FT                   PLDc; cd00138"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="YPDSF_3938"
FT   misc_feature    order(845..847,851..853,890..892,896..898,929..931)
FT                   /note="active site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="YPDSF_3938"
FT   misc_feature    order(845..847,851..853,866..868,887..892,896..898)
FT                   /note="signature motif; other site"
FT                   /db_xref="CDD:29051"
FT                   /locus_tag="YPDSF_3938"
FT   gene            1171..1425
FT                   /db_xref="GeneID:5061586"
FT                   /locus_tag="YPDSF_3939"
FT   CDS_pept        1171..1425
FT                   /locus_tag="YPDSF_3939"
FT                   /gene_family="HOG000266870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597105"
FT                   /db_xref="GeneID:5061586"
FT                   /translation="MSQIENAVTSSSKRAYRKGNPLTGAEKQRMSVSRKKETHKAINVF
FT                   IQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
FT                   /protein_id="YP_001154569.1"
FT   misc_feature    1171..1416
FT                   /note="Replication regulatory protein RepB; Region:
FT                   RepB-RCR_reg; cl11673"
FT                   /db_xref="CDD:175350"
FT                   /locus_tag="YPDSF_3939"
FT   gene            complement(1468..1620)
FT                   /db_xref="GeneID:5061569"
FT                   /locus_tag="YPDSF_3940"
FT   CDS_pept        complement(1468..1620)
FT                   /locus_tag="YPDSF_3940"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597106"
FT                   /db_xref="GeneID:5061569"
FT                   /translation="MGPGNLLASPKMRKFIGVFAFLVPSKHLSRTSSLPPYGVASQKFF
FT                   KQSVI"
FT                   /protein_id="YP_001154570.1"
FT   gene            1734..2600
FT                   /db_xref="GeneID:5061594"
FT                   /locus_tag="YPDSF_3941"
FT   CDS_pept        1734..2600
FT                   /locus_tag="YPDSF_3941"
FT                   /gene_family="HOG000266871" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein"
FT                   /transl_table="11"
FT                   /note="RepA"
FT                   /db_xref="GI:145597107"
FT                   /db_xref="GeneID:5061594"
FT                   /translation="MTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGFT
FT                   SRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNLAIEC
FT                   GLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSALDV
FT                   SDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAHGLKR
FT                   ARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSRNNNYT
FT                   RLATGAT"
FT                   /protein_id="YP_001154571.1"
FT   misc_feature    1743..2597
FT                   /note="IncFII RepA protein family; Region: IncFII_repA;
FT                   cl11495"
FT                   /db_xref="CDD:175290"
FT                   /locus_tag="YPDSF_3941"
FT   gene            3773..4012
FT                   /db_xref="GeneID:5061581"
FT                   /locus_tag="YPDSF_3942"
FT   CDS_pept        3773..4012
FT                   /locus_tag="YPDSF_3942"
FT                   /gene_family="HOG000266872" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597108"
FT                   /db_xref="GeneID:5061581"
FT                   /translation="MSKKHYCRLHDLNIATFYYWLKHHQDDTTVAIPPAFIPARRVIPD
FT                   NNGTEAVTLNLPNGCSVSCLPAQLRAVMQALSLC"
FT                   /protein_id="YP_001154572.1"
FT   gene            4184..4462
FT                   /db_xref="GeneID:5061552"
FT                   /locus_tag="YPDSF_3943"
FT                   /pseudo
FT   gene            5204..7402
FT                   /db_xref="GeneID:5061590"
FT                   /locus_tag="YPDSF_3944"
FT   CDS_pept        5204..7402
FT                   /locus_tag="YPDSF_3944"
FT                   /gene_family="HOG000219636" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="targeted effector protein kinase"
FT                   /transl_table="11"
FT                   /note="SMART: Serine/threonine protein kinase: (3.3e-08)"
FT                   /db_xref="GI:145597109"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003547"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="GeneID:5061590"
FT                   /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRIID
FT                   NQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPNAL
FT                   SNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRLVAK
FT                   IERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVDGWRC
FT                   SDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNVVFDRA
FT                   SGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLHCIEGFE
FT                   KNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVSADSRPDS
FT                   NEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSDLLRTHLSS
FT                   AATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGREG
FT                   DTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVL
FT                   VTLSQQGQPVSSETYGFLNRLTEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADV
FT                   ARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDDMRNFTVDSIPLL
FT                   IQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
FT                   /protein_id="YP_001154573.1"
FT   misc_feature    5297..>5695
FT                   /note="effector protein; Provisional; Region: PRK14052"
FT                   /db_xref="CDD:172544"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    5666..6427
FT                   /note="Protein kinase domain; Region: Pkinase; pfam00069"
FT                   /db_xref="CDD:143851"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    5666..6247
FT                   /note="Catalytic domain of Protein Kinases; Region: PKc;
FT                   cd00180"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    order(5684..5686,5690..5692,5783..5785,5843..5854,
FT                   5876..5878,5882..5884,6011..6013,6017..6019,6023..6028,
FT                   6032..6034,6068..6070,6077..6079,6110..6121)
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    order(5684..5686,5690..5692,5783..5785,5843..5854,
FT                   5876..5878,6011..6013,6017..6019,6023..6028,6032..6034,
FT                   6068..6070)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    order(5876..5878,5882..5884,6011..6013,6017..6019,
FT                   6023..6025,6077..6079,6110..6121)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    order(6065..6079,6110..6121)
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="YPDSF_3944"
FT   misc_feature    6509..7399
FT                   /note="Rac1-binding domain; Region: Rac1; pfam09632"
FT                   /db_xref="CDD:118166"
FT                   /locus_tag="YPDSF_3944"
FT   gene            7798..8664
FT                   /db_xref="GeneID:5061550"
FT                   /locus_tag="YPDSF_3945"
FT   CDS_pept        7798..8664
FT                   /locus_tag="YPDSF_3945"
FT                   /gene_family="HOG000219637" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="targeted effector protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597110"
FT                   /db_xref="GeneID:5061550"
FT                   /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWF
FT                   HKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMG
FT                   EGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGKNPLPHDKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAE
FT                   YKTLLKV"
FT                   /protein_id="YP_001154574.1"
FT   misc_feature    7870..8397
FT                   /note="YopJ Serine/Threonine acetyltransferase; Region:
FT                   YopJ; pfam03421"
FT                   /db_xref="CDD:112246"
FT                   /locus_tag="YPDSF_3945"
FT   gene            8945..9037
FT                   /db_xref="GeneID:5061588"
FT                   /locus_tag="YPDSF_3946"
FT   CDS_pept        8945..9037
FT                   /locus_tag="YPDSF_3946"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597111"
FT                   /db_xref="GeneID:5061588"
FT                   /translation="MQNAQIRLLDIIAYERVVFSEIQLLNNCAK"
FT                   /protein_id="YP_001154575.1"
FT   gene            complement(9250..9897)
FT                   /db_xref="GeneID:5061542"
FT                   /locus_tag="YPDSF_3947"
FT   CDS_pept        complement(9250..9897)
FT                   /locus_tag="YPDSF_3947"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597112"
FT                   /db_xref="GeneID:5061542"
FT                   /translation="MTLRTTSSCGLRPPDGCSFPCDYLEGLNLRSKRPRRHVTTRHRHA
FT                   RPEVTALDQCWSMDFVADNLFNGHRVRALTIVDNFSRECLALEVGQGLRGDDVVAVMDR
FT                   LKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMDCSRPGKPTDNAFIESFNGSLRD
FT                   ECLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
FT                   /protein_id="YP_001154576.1"
FT   misc_feature    complement(9403..9732)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_3947"
FT   gene            9858..10064
FT                   /db_xref="GeneID:5061583"
FT                   /locus_tag="YPDSF_3948"
FT   CDS_pept        9858..10064
FT                   /locus_tag="YPDSF_3948"
FT                   /gene_family="HOG000222395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597113"
FT                   /db_xref="GeneID:5061583"
FT                   /translation="MAVGRKNWLFAGSLRAGQRMASILSLLETAKLNGHDPYVWLRDVL
FT                   TRLPTWPNSQLNALLPYAENRFS"
FT                   /protein_id="YP_001154577.1"
FT   gene            10347..11753
FT                   /db_xref="GeneID:5061628"
FT                   /locus_tag="YPDSF_3949"
FT   CDS_pept        10347..11753
FT                   /locus_tag="YPDSF_3949"
FT                   /gene_family="HOG000219626" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein-tyrosine phosphatase Yop effector"
FT                   /transl_table="11"
FT                   /note="SMART: Tyrosine specific protein phosphatase:
FT                   (1.7e-49) Protein tyrosine phosphatase, catalytic region:
FT                   (5.2e-20)"
FT                   /db_xref="GI:145597114"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003546"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="GeneID:5061628"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANVFLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGFPVREGLRSHLDPRTPPLPP
FT                   RERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
FT                   /protein_id="YP_001154578.1"
FT   misc_feature    10353..10715
FT                   /note="YopH, N-terminal; Region: YopH_N; pfam09013"
FT                   /db_xref="CDD:117579"
FT                   /locus_tag="YPDSF_3949"
FT   misc_feature    11019..11723
FT                   /note="Protein tyrosine phosphatases (PTP) catalyze the
FT                   dephosphorylation of phosphotyrosine peptides; they
FT                   regulate phosphotyrosine levels in signal transduction
FT                   pathways. The depth of the active site cleft renders the
FT                   enzyme specific for phosphorylated Tyr (; Region: PTPc;
FT                   cd00047"
FT                   /db_xref="CDD:28929"
FT                   /locus_tag="YPDSF_3949"
FT   misc_feature    11019..11717
FT                   /note="Protein-tyrosine phosphatase; Region: Y_phosphatase;
FT                   pfam00102"
FT                   /db_xref="CDD:143879"
FT                   /locus_tag="YPDSF_3949"
FT   misc_feature    order(11412..11414,11550..11555,11562..11564,11571..11576)
FT                   /note="active site"
FT                   /db_xref="CDD:28929"
FT                   /locus_tag="YPDSF_3949"
FT   gene            complement(11974..12153)
FT                   /db_xref="GeneID:5061629"
FT                   /locus_tag="YPDSF_3950"
FT   CDS_pept        complement(11974..12153)
FT                   /locus_tag="YPDSF_3950"
FT                   /gene_family="HOG000103025" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597115"
FT                   /db_xref="GeneID:5061629"
FT                   /translation="MIRQAIKKCKVFPTDDSVRKVIYLAIRDASKKWSMPIQNWRLAMS
FT                   RFIIEFGDRLNDHL"
FT                   /protein_id="YP_001154579.1"
FT   misc_feature    complement(11998..>12150)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3328"
FT                   /db_xref="CDD:33137"
FT                   /locus_tag="YPDSF_3950"
FT   gene            complement(12265..12429)
FT                   /db_xref="GeneID:5061607"
FT                   /locus_tag="YPDSF_3951"
FT   CDS_pept        complement(12265..12429)
FT                   /locus_tag="YPDSF_3951"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597116"
FT                   /db_xref="GeneID:5061607"
FT                   /translation="MDHFSSVVDTEVRTLTEDWRTEYNEERPHSSLGNMPPVIYARQKL
FT                   DGDPHWRWY"
FT                   /protein_id="YP_001154580.1"
FT   gene            complement(12468..13247)
FT                   /db_xref="GeneID:5061616"
FT                   /locus_tag="YPDSF_3952"
FT   CDS_pept        complement(12468..13247)
FT                   /locus_tag="YPDSF_3952"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase/IS protein"
FT                   /transl_table="11"
FT                   /note="SMART: ATPase (1.7e-13)"
FT                   /db_xref="GI:145597117"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:5061616"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT                   /protein_id="YP_001154581.1"
FT   misc_feature    complement(12471..13244)
FT                   /note="transposase/IS protein; Provisional; Region:
FT                   PRK09183"
FT                   /db_xref="CDD:169696"
FT                   /locus_tag="YPDSF_3952"
FT   misc_feature    complement(<12687..12989)
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_3952"
FT   misc_feature    complement(12900..12923)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_3952"
FT   misc_feature    complement(order(12735..12737,12897..12920))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_3952"
FT   misc_feature    complement(12732..12749)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_3952"
FT   gene            complement(13247..14269)
FT                   /db_xref="GeneID:5061570"
FT                   /locus_tag="YPDSF_3953"
FT   CDS_pept        complement(13247..14269)
FT                   /locus_tag="YPDSF_3953"
FT                   /gene_family="HOG000010171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597118"
FT                   /db_xref="InterPro:IPR007101"
FT                   /db_xref="GeneID:5061570"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT                   /protein_id="YP_001154582.1"
FT   misc_feature    complement(13397..14269)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="YPDSF_3953"
FT   misc_feature    complement(14147..>14245)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_3953"
FT   misc_feature    complement(13544..13918)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_3953"
FT   gene            complement(14351..14533)
FT                   /db_xref="GeneID:5061564"
FT                   /locus_tag="YPDSF_3954"
FT   CDS_pept        complement(14351..14533)
FT                   /locus_tag="YPDSF_3954"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597119"
FT                   /db_xref="GeneID:5061564"
FT                   /translation="MNIPVHRVVRILERLSTERGYPAFIRSDNGPEFIAAALVEWAEHH
FT                   GVILDMYLFRSLSEV"
FT                   /protein_id="YP_001154583.1"
FT   misc_feature    complement(14381..>14521)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_3954"
FT   gene            complement(14530..14964)
FT                   /db_xref="GeneID:5061608"
FT                   /locus_tag="YPDSF_3955"
FT   CDS_pept        complement(14530..14964)
FT                   /locus_tag="YPDSF_3955"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597120"
FT                   /db_xref="GeneID:5061608"
FT                   /translation="MRYVMTEYQASERRGCRIMGISRSLLHYCPNTARDIPVVEVLQKL
FT                   AHQYPAYGFGLMFNKLRQSGLPWNVKRVYRVYRLLKLNFRRKGKKRLPNRHPQPLAIPL
FT                   KMNHCWSVDFMSDALTDGRRFRLFNVVEILTGKHWQLKLT"
FT                   /protein_id="YP_001154584.1"
FT   gene            complement(14988..15254)
FT                   /db_xref="GeneID:5061591"
FT                   /locus_tag="YPDSF_3956"
FT   CDS_pept        complement(14988..15254)
FT                   /locus_tag="YPDSF_3956"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase ORFA"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597121"
FT                   /db_xref="GeneID:5061591"
FT                   /translation="MKKARFTETQILRVLKEVEGGRHVKDVCRENGGSEASYYNWKSKY
FT                   GGMESSDIKRMKEREEENRRLKQMYASLSLDHEILKDVVAKKL"
FT                   /protein_id="YP_001154585.1"
FT   misc_feature    complement(<15096..15251)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_3956"
FT   gene            complement(15802..16149)
FT                   /db_xref="GeneID:5061549"
FT                   /locus_tag="YPDSF_3957"
FT   CDS_pept        complement(15802..16149)
FT                   /locus_tag="YPDSF_3957"
FT                   /gene_family="HOG000219625" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion regulatory protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597122"
FT                   /db_xref="GeneID:5061549"
FT                   /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEKA
FT                   FANEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLLLE
FT                   AAMRQDTAADG"
FT                   /protein_id="YP_001154586.1"
FT   misc_feature    complement(15823..16149)
FT                   /note="YopH, N-terminal; Region: YopH_N; pfam09013"
FT                   /db_xref="CDD:117579"
FT                   /locus_tag="YPDSF_3957"
FT   gene            complement(16374..17006)
FT                   /db_xref="GeneID:5061556"
FT                   /locus_tag="YPDSF_3958"
FT   CDS_pept        complement(16374..17006)
FT                   /locus_tag="YPDSF_3958"
FT                   /gene_family="HOG000219624" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion system protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597123"
FT                   /db_xref="GeneID:5061556"
FT                   /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEK
FT                   ILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVR
FT                   KILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEISYLE
FT                   VTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
FT                   /protein_id="YP_001154587.1"
FT   misc_feature    complement(16395..17006)
FT                   /note="type III secretion system protein; Reviewed; Region:
FT                   PRK06937"
FT                   /db_xref="CDD:168739"
FT                   /locus_tag="YPDSF_3958"
FT   misc_feature    complement(16422..16754)
FT                   /note="Flagellar assembly protein FliH; Region: FliH;
FT                   pfam02108"
FT                   /db_xref="CDD:111047"
FT                   /locus_tag="YPDSF_3958"
FT   gene            complement(16985..17614)
FT                   /db_xref="GeneID:5061543"
FT                   /locus_tag="YPDSF_3959"
FT   CDS_pept        complement(16985..17614)
FT                   /locus_tag="YPDSF_3959"
FT                   /gene_family="HOG000219621" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597124"
FT                   /db_xref="GeneID:5061543"
FT                   /translation="MMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLN
FT                   AALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQLL
FT                   TLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQAWC
FT                   KRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
FT                   /protein_id="YP_001154588.1"
FT   misc_feature    complement(16988..17605)
FT                   /note="YOP proteins translocation protein K (YscK); Region:
FT                   YscK; pfam06578"
FT                   /db_xref="CDD:115248"
FT                   /locus_tag="YPDSF_3959"
FT   gene            complement(17614..18348)
FT                   /db_xref="GeneID:5061555"
FT                   /locus_tag="YPDSF_3960"
FT   CDS_pept        complement(17614..18348)
FT                   /locus_tag="YPDSF_3960"
FT                   /gene_family="HOG000214127" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion lipoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597125"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="GeneID:5061555"
FT                   /translation="MKVKTSLSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGLS
FT                   ADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEELAR
FT                   LNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQFDTY
FT                   IPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGHLIGLL
FT                   SLLILLLPVTNLAQYFWLQRKK"
FT                   /protein_id="YP_001154589.1"
FT   sig_peptide     complement(18283..18348)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.651) with cleavage site probability 0.316 at
FT                   residue 22"
FT                   /locus_tag="YPDSF_3960"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(17617..18297)
FT                   /note="Secretory protein of YscJ/FliF family; Region:
FT                   YscJ_FliF; cl01907"
FT                   /db_xref="CDD:164004"
FT                   /locus_tag="YPDSF_3960"
FT   gene            complement(18355..18702)
FT                   /db_xref="GeneID:5061547"
FT                   /locus_tag="YPDSF_3961"
FT   CDS_pept        complement(18355..18702)
FT                   /locus_tag="YPDSF_3961"
FT                   /gene_family="HOG000219620" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion system YscI/HrpB,
FT                   C-terminal: (5.9e-15)"
FT                   /db_xref="GI:145597126"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="GeneID:5061547"
FT                   /translation="MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGLG
FT                   HSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRM
FT                   SQNVETLSKGG"
FT                   /protein_id="YP_001154590.1"
FT   misc_feature    complement(18364..18615)
FT                   /note="Type III secretion needle MxiH like; Region: MxiH;
FT                   cl09641"
FT                   /db_xref="CDD:158601"
FT                   /locus_tag="YPDSF_3961"
FT   gene            complement(18703..19200)
FT                   /db_xref="GeneID:5061537"
FT                   /locus_tag="YPDSF_3962"
FT   CDS_pept        complement(18703..19200)
FT                   /locus_tag="YPDSF_3962"
FT                   /gene_family="HOG000219619" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597127"
FT                   /db_xref="GeneID:5061537"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLATPVREALLARFGQHQGSVVPAIDLPELRSVLQQFD
FT                   SFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQIDM
FT                   DT"
FT                   /protein_id="YP_001154591.1"
FT   sig_peptide     complement(19141..19200)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.591 at
FT                   residue 20"
FT                   /locus_tag="YPDSF_3962"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(18712..19101)
FT                   /note="YopR Core; Region: YopR_core; cl07585"
FT                   /db_xref="CDD:157974"
FT                   /locus_tag="YPDSF_3962"
FT   gene            complement(19197..19544)
FT                   /db_xref="GeneID:5061562"
FT                   /locus_tag="YPDSF_3963"
FT   CDS_pept        complement(19197..19544)
FT                   /locus_tag="YPDSF_3963"
FT                   /gene_family="HOG000219618" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597128"
FT                   /db_xref="GeneID:5061562"
FT                   /translation="MKYKLNVLLAEIALIGAGNHYHEEANCIAEWLHLKGEEEAVQLIR
FT                   LSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQT
FT                   FVNGMREQLKT"
FT                   /protein_id="YP_001154592.1"
FT   misc_feature    complement(19200..19541)
FT                   /note="Bacterial type II secretion system chaperone protein
FT                   (type_III_yscG); Region: Type_III_YscG; cl09712"
FT                   /db_xref="CDD:158650"
FT                   /locus_tag="YPDSF_3963"
FT   gene            complement(19546..19809)
FT                   /db_xref="GeneID:5061595"
FT                   /locus_tag="YPDSF_3964"
FT   CDS_pept        complement(19546..19809)
FT                   /locus_tag="YPDSF_3964"
FT                   /gene_family="HOG000219617" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion system needle protein:
FT                   (3.5e-39)"
FT                   /db_xref="GI:145597129"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="GeneID:5061595"
FT                   /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKP
FT                   DNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
FT                   /protein_id="YP_001154593.1"
FT   misc_feature    complement(19552..19770)
FT                   /note="Type III secretion needle MxiH like; Region: MxiH;
FT                   cl09641"
FT                   /db_xref="CDD:158601"
FT                   /locus_tag="YPDSF_3964"
FT   gene            complement(19810..20010)
FT                   /db_xref="GeneID:5061559"
FT                   /locus_tag="YPDSF_3965"
FT   CDS_pept        complement(19810..20010)
FT                   /locus_tag="YPDSF_3965"
FT                   /gene_family="HOG000219616" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597130"
FT                   /db_xref="GeneID:5061559"
FT                   /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVWQ
FT                   RESKALESAIAIIHYVAGDLK"
FT                   /protein_id="YP_001154594.1"
FT   misc_feature    complement(19813..20010)
FT                   /note="Protein of unknown function (DUF1895); Region:
FT                   DUF1895; cl07553"
FT                   /db_xref="CDD:164100"
FT                   /locus_tag="YPDSF_3965"
FT   gene            complement(20007..21266)
FT                   /db_xref="GeneID:5061566"
FT                   /locus_tag="YPDSF_3966"
FT   CDS_pept        complement(20007..21266)
FT                   /locus_tag="YPDSF_3966"
FT                   /gene_family="HOG000219615" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597131"
FT                   /db_xref="GeneID:5061566"
FT                   /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAPV
FT                   HLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPETL
FT                   QVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEVRRL
FT                   LATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQ
FT                   GAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVESKVR
FT                   IAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFRQEFGNR
FT                   PKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDA
FT                   VIVSKGKREFVIQLNGGKPR"
FT                   /protein_id="YP_001154595.1"
FT   misc_feature    complement(20028..21260)
FT                   /note="type III secretion apparatus protein, YscD/HrpQ
FT                   family; Region: type_III_yscD; TIGR02500"
FT                   /db_xref="CDD:162890"
FT                   /locus_tag="YPDSF_3966"
FT   gene            complement(21263..23086)
FT                   /db_xref="GeneID:5061575"
FT                   /locus_tag="YPDSF_3967"
FT   CDS_pept        complement(21263..23086)
FT                   /locus_tag="YPDSF_3967"
FT                   /gene_family="HOG000219614" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597132"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="GeneID:5061575"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGRDLRTGILAVDEISNQSTTLNKLLGGFQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
FT                   /protein_id="YP_001154596.1"
FT   sig_peptide     complement(23006..23086)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT                   /locus_tag="YPDSF_3967"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(21554..22984)
FT                   /note="type III secretion outer membrane pore, YscC/HrcC
FT                   family; Region: type_III_yscC; TIGR02516"
FT                   /db_xref="CDD:162899"
FT                   /locus_tag="YPDSF_3967"
FT   misc_feature    complement(<22616..22756)
FT                   /note="Bacterial type II/III secretion system short domain;
FT                   Region: Secretin_N; pfam03958"
FT                   /db_xref="CDD:146539"
FT                   /locus_tag="YPDSF_3967"
FT   misc_feature    complement(22244..22537)
FT                   /note="Bacterial type II/III secretion system short domain;
FT                   Region: Secretin_N; pfam03958"
FT                   /db_xref="CDD:146539"
FT                   /locus_tag="YPDSF_3967"
FT   misc_feature    complement(21557..22039)
FT                   /note="Bacterial type II and III secretion system protein;
FT                   Region: Secretin; cl02829"
FT                   /db_xref="CDD:164025"
FT                   /locus_tag="YPDSF_3967"
FT   gene            complement(23092..23505)
FT                   /db_xref="GeneID:5061580"
FT                   /locus_tag="YPDSF_3968"
FT   CDS_pept        complement(23092..23505)
FT                   /locus_tag="YPDSF_3968"
FT                   /gene_family="HOG000247733" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597133"
FT                   /db_xref="GeneID:5061580"
FT                   /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
FT                   /protein_id="YP_001154597.1"
FT   misc_feature    complement(23095..23502)
FT                   /note="Tir chaperone protein (CesT); Region: CesT; cl08444"
FT                   /db_xref="CDD:158335"
FT                   /locus_tag="YPDSF_3968"
FT   gene            complement(23908..24723)
FT                   /db_xref="GeneID:5061565"
FT                   /locus_tag="YPDSF_3969"
FT   CDS_pept        complement(23908..24723)
FT                   /locus_tag="YPDSF_3969"
FT                   /gene_family="HOG000247159" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thermoregulatory protein"
FT                   /transl_table="11"
FT                   /note="SMART: Helix-turn-helix, AraC type: (1.9e-33)"
FT                   /db_xref="GI:145597134"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="GeneID:5061565"
FT                   /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYDL
FT                   DEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPKPL
FT                   LIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRHLGN
FT                   RPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAH
FT                   QLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
FT                   /protein_id="YP_001154598.1"
FT   misc_feature    complement(24085..24207)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="YPDSF_3969"
FT   misc_feature    complement(23935..24186)
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="YPDSF_3969"
FT   misc_feature    complement(23932..24039)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="YPDSF_3969"
FT   gene            complement(25817..26881)
FT                   /db_xref="GeneID:5061576"
FT                   /locus_tag="YPDSF_3970"
FT   CDS_pept        complement(25817..26881)
FT                   /locus_tag="YPDSF_3970"
FT                   /gene_family="HOG000253898" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion protein HrpY/HrcU:
FT                   (1.1e-210)"
FT                   /db_xref="GI:145597135"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="GeneID:5061576"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSNEVVSTALIVALSAMLMGL
FT                   SDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
FT                   /protein_id="YP_001154599.1"
FT   misc_feature    complement(25835..26881)
FT                   /note="Type III secretory pathway, component EscU
FT                   [Intracellular trafficking and secretion]; Region: EscU;
FT                   COG4792"
FT                   /db_xref="CDD:34402"
FT                   /locus_tag="YPDSF_3970"
FT   misc_feature    complement(25850..26875)
FT                   /note="Flagellar biosynthesis pathway, component FlhB [Cell
FT                   motility and secretion / Intracellular trafficking and
FT                   secretion]; Region: FlhB; cl12017"
FT                   /db_xref="CDD:175382"
FT                   /locus_tag="YPDSF_3970"
FT   gene            complement(26881..27666)
FT                   /db_xref="GeneID:5061567"
FT                   /locus_tag="YPDSF_3971"
FT   CDS_pept        complement(26881..27666)
FT                   /locus_tag="YPDSF_3971"
FT                   /gene_family="HOG000213680" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion protein SpaR/YscT:
FT                   (2.3e-95)"
FT                   /db_xref="GI:145597136"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="GeneID:5061567"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFP
FT                   AVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
FT                   /protein_id="YP_001154600.1"
FT   misc_feature    complement(26884..27609)
FT                   /note="Bacterial export proteins, family 1; Region:
FT                   Bac_export_1; cl00734"
FT                   /db_xref="CDD:174367"
FT                   /locus_tag="YPDSF_3971"
FT   gene            complement(27663..27929)
FT                   /db_xref="GeneID:5061623"
FT                   /locus_tag="YPDSF_3972"
FT   CDS_pept        complement(27663..27929)
FT                   /locus_tag="YPDSF_3972"
FT                   /gene_family="HOG000253671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion protein HrpO: (2.1e-47)"
FT                   /db_xref="GI:145597137"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="GeneID:5061623"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
FT                   /protein_id="YP_001154601.1"
FT   misc_feature    complement(27666..27929)
FT                   /note="Bacterial export proteins, family 3; Region:
FT                   Bac_export_3; cl00867"
FT                   /db_xref="CDD:174429"
FT                   /locus_tag="YPDSF_3972"
FT   sig_peptide     complement(27843..27929)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.753 at
FT                   residue 29"
FT                   /locus_tag="YPDSF_3972"
FT                   /product="hypothetical protein"
FT   gene            complement(27931..28584)
FT                   /db_xref="GeneID:5061577"
FT                   /locus_tag="YPDSF_3973"
FT   CDS_pept        complement(27931..28584)
FT                   /locus_tag="YPDSF_3973"
FT                   /gene_family="HOG000253557" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion system protein"
FT                   /transl_table="11"
FT                   /note="part of a set of proteins involved in the infection
FT                   of eukaryotic cells; in plant pathogens involved in the
FT                   hypersensitivity response"
FT                   /db_xref="GI:145597138"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="GeneID:5061577"
FT                   /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
FT                   /protein_id="YP_001154602.1"
FT   misc_feature    complement(27937..28512)
FT                   /note="FliP family; Region: FliP; cl00593"
FT                   /db_xref="CDD:174299"
FT                   /locus_tag="YPDSF_3973"
FT   gene            complement(28581..29504)
FT                   /db_xref="GeneID:5061613"
FT                   /locus_tag="YPDSF_3974"
FT   CDS_pept        complement(28581..29504)
FT                   /locus_tag="YPDSF_3974"
FT                   /gene_family="HOG000219612" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion system protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597139"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR003283"
FT                   /db_xref="GeneID:5061613"
FT                   /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSSL
FT                   NCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKLVC
FT                   NDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILISLRW
FT                   HKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHES
FT                   DELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRL
FT                   LGHGRLVEIQGRLGVRIERLTEVTIS"
FT                   /protein_id="YP_001154603.1"
FT   misc_feature    complement(28584..29504)
FT                   /note="type III secretion system protein; Validated;
FT                   Region: PRK06933"
FT                   /db_xref="CDD:168736"
FT                   /locus_tag="YPDSF_3974"
FT   misc_feature    complement(28602..29096)
FT                   /note="Surface presentation of antigens (SPOA); Region:
FT                   SpoA; cl00819"
FT                   /db_xref="CDD:174406"
FT                   /locus_tag="YPDSF_3974"
FT   gene            complement(29501..30868)
FT                   /db_xref="GeneID:5061557"
FT                   /locus_tag="YPDSF_3975"
FT   CDS_pept        complement(29501..30868)
FT                   /locus_tag="YPDSF_3975"
FT                   /gene_family="HOG000219607" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597140"
FT                   /db_xref="GeneID:5061557"
FT                   /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHPK
FT                   EESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLSPL
FT                   AEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHDELF
FT                   VQQSPIDSAQPVQLNSKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQKCLAE
FT                   EPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSEQLDMT
FT                   ELADRSQHLTDGVDSSKDTIEPPRPEKLLLPREETLPEMYSLSFTAPVVTPGDHLLATM
FT                   RATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVE
FT                   LIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEEWEAEE"
FT                   /protein_id="YP_001154604.1"
FT   misc_feature    complement(29504..29878)
FT                   /note="type III secretion system needle length determinant;
FT                   Region: type_III_yscP; TIGR02514"
FT                   /db_xref="CDD:162897"
FT                   /locus_tag="YPDSF_3975"
FT   gene            complement(30868..31332)
FT                   /db_xref="GeneID:5061597"
FT                   /locus_tag="YPDSF_3976"
FT   CDS_pept        complement(30868..31332)
FT                   /locus_tag="YPDSF_3976"
FT                   /gene_family="HOG000219606" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597141"
FT                   /db_xref="GeneID:5061597"
FT                   /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDYH
FT                   LWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERL
FT                   TLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
FT                   /protein_id="YP_001154605.1"
FT   misc_feature    complement(<30970..31332)
FT                   /note="Type III secretion protein YscO; Region: YscO;
FT                   pfam07321"
FT                   /db_xref="CDD:148750"
FT                   /locus_tag="YPDSF_3976"
FT   gene            complement(31329..32648)
FT                   /db_xref="GeneID:5061568"
FT                   /locus_tag="YPDSF_3977"
FT   CDS_pept        complement(31329..32648)
FT                   /locus_tag="YPDSF_3977"
FT                   /gene_family="HOG000257876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion system ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATPase FliI/YscN: (4.1e-213); SMART: ATPase
FT                   (9.2e-10)"
FT                   /db_xref="GI:145597142"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="GeneID:5061568"
FT                   /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIG
FT                   ELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLL
FT                   GQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQ
FT                   RMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLV
FT                   VATSDRPSLERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTR
FT                   RGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSR
FT                   KLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQ
FT                   DKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_001154606.1"
FT   misc_feature    complement(31368..32648)
FT                   /note="type III secretion system ATPase; Provisional;
FT                   Region: PRK06936"
FT                   /db_xref="CDD:168738"
FT                   /locus_tag="YPDSF_3977"
FT   misc_feature    complement(32373..32570)
FT                   /note="ATP synthase alpha/beta family, beta-barrel domain;
FT                   Region: ATP-synt_ab_N; pfam02874"
FT                   /db_xref="CDD:145823"
FT                   /locus_tag="YPDSF_3977"
FT   misc_feature    complement(31392..32366)
FT                   /note="Flagellum-specific ATPase/type III secretory pathway
FT                   virulence-related protein. This group of ATPases are
FT                   responsible for the export of flagellum and
FT                   virulence-related proteins. The bacterial flagellar motor
FT                   is similar to the F0F1-ATPase, in that they...; Region:
FT                   ATPase_flagellum-secretory_path_III; cd01136"
FT                   /db_xref="CDD:30002"
FT                   /locus_tag="YPDSF_3977"
FT   misc_feature    complement(32121..32141)
FT                   /note="Walker A motif/ATP binding site; other site"
FT                   /db_xref="CDD:30002"
FT                   /locus_tag="YPDSF_3977"
FT   misc_feature    complement(31872..31886)
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:30002"
FT                   /locus_tag="YPDSF_3977"
FT   gene            32846..33727
FT                   /db_xref="GeneID:5061548"
FT                   /locus_tag="YPDSF_3978"
FT   CDS_pept        32846..33727
FT                   /locus_tag="YPDSF_3978"
FT                   /gene_family="HOG000219605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-bound Yop targeting protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597143"
FT                   /db_xref="GeneID:5061548"
FT                   /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSGT
FT                   LQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQNVS
FT                   ELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVEQAL
FT                   VSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSDLQKR
FT                   FPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVISDLQKLKEFGSVSDQVKGFWQF
FT                   FSEGKTNGVRPF"
FT                   /protein_id="YP_001154607.1"
FT   misc_feature    32948..33685
FT                   /note="HrpJ-like domain; Region: HrpJ; cl06298"
FT                   /db_xref="CDD:164083"
FT                   /locus_tag="YPDSF_3978"
FT   gene            33708..33986
FT                   /db_xref="GeneID:5061596"
FT                   /locus_tag="YPDSF_3979"
FT   CDS_pept        33708..33986
FT                   /locus_tag="YPDSF_3979"
FT                   /gene_family="HOG000219604" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Yop secretion and targeting protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597144"
FT                   /db_xref="GeneID:5061596"
FT                   /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRFY
FT                   QDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
FT                   /protein_id="YP_001154608.1"
FT   misc_feature    33708..33950
FT                   /note="TyeA; Region: TyeA; cl07611"
FT                   /db_xref="CDD:141982"
FT                   /locus_tag="YPDSF_3979"
FT   gene            33973..34344
FT                   /db_xref="GeneID:5061539"
FT                   /locus_tag="YPDSF_3980"
FT   CDS_pept        33973..34344
FT                   /locus_tag="YPDSF_3980"
FT                   /gene_family="HOG000247152" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion system chaperone SycN:
FT                   (4.6e-66)"
FT                   /db_xref="GI:145597145"
FT                   /db_xref="InterPro:IPR012673"
FT                   /db_xref="GeneID:5061539"
FT                   /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGAT
FT                   LTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLTLP
FT                   LLHQAFEQLLRLQQEVLAP"
FT                   /protein_id="YP_001154609.1"
FT   misc_feature    33982..34338
FT                   /note="type III secretion chaperone SycN; Region:
FT                   type_III_SycN; TIGR02503"
FT                   /db_xref="CDD:131555"
FT                   /locus_tag="YPDSF_3980"
FT   gene            34341..34709
FT                   /db_xref="GeneID:5061554"
FT                   /locus_tag="YPDSF_3981"
FT   CDS_pept        34341..34709
FT                   /locus_tag="YPDSF_3981"
FT                   /gene_family="HOG000247155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion system YscX: (1.2e-90)"
FT                   /db_xref="GI:145597146"
FT                   /db_xref="InterPro:IPR012672"
FT                   /db_xref="GeneID:5061554"
FT                   /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHLE
FT                   RLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALLKC
FT                   QQDDDRLLQIILNLLHKV"
FT                   /protein_id="YP_001154610.1"
FT   misc_feature    34341..34706
FT                   /note="Type III secretion system YscX (type_III_YscX);
FT                   Region: Type_III_YscX; cl09710"
FT                   /db_xref="CDD:142225"
FT                   /locus_tag="YPDSF_3981"
FT   gene            34706..35050
FT                   /db_xref="GeneID:5061602"
FT                   /locus_tag="YPDSF_3982"
FT   CDS_pept        34706..35050
FT                   /locus_tag="YPDSF_3982"
FT                   /gene_family="HOG000247156" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type III secretion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597147"
FT                   /db_xref="GeneID:5061602"
FT                   /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHLA
FT                   GRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
FT                   LELKDHNESP"
FT                   /protein_id="YP_001154611.1"
FT   misc_feature    <34712..35026
FT                   /note="Putative Zn-dependent protease, contains TPR repeats
FT                   [General function prediction only]; Region: COG4783"
FT                   /db_xref="CDD:34394"
FT                   /locus_tag="YPDSF_3982"
FT   gene            35037..37151
FT                   /db_xref="GeneID:5061572"
FT                   /locus_tag="YPDSF_3983"
FT   CDS_pept        35037..37151
FT                   /locus_tag="YPDSF_3983"
FT                   /gene_family="HOG000254015" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-bound Yop protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Type III secretion protein HrcV: (0)"
FT                   /db_xref="GI:145597148"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="GeneID:5061572"
FT                   /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILIA
FT                   VNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIVYT
FT                   FGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDGDMR
FT                   AGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIGVTQK
FT                   GLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGKQVVAQ
FT                   PKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDLQSILTS
FT                   GSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALNDELVRVRR
FT                   ALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESVSQLELLGI
FT                   PYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREYAEDFIGIQE
FT                   TRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSILEAMVEWGQKE
FT                   KDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQTSAGSYLALEP
FT                   AVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGLPVLSYQELTQQI
FT                   NIQPLGRICL"
FT                   /protein_id="YP_001154612.1"
FT   misc_feature    35175..37148
FT                   /note="Type III secretory pathway, component EscV
FT                   [Intracellular trafficking and secretion]; Region: EscV;
FT                   COG4789"
FT                   /db_xref="CDD:34399"
FT                   /locus_tag="YPDSF_3983"
FT   misc_feature    35175..37142
FT                   /note="FHIPEP family; Region: FHIPEP; cl07980"
FT                   /db_xref="CDD:176604"
FT                   /locus_tag="YPDSF_3983"
FT   gene            37148..37588
FT                   /db_xref="GeneID:5061614"
FT                   /locus_tag="YPDSF_3984"
FT   CDS_pept        37148..37588
FT                   /locus_tag="YPDSF_3984"
FT                   /gene_family="HOG000247157" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597149"
FT                   /db_xref="GeneID:5061614"
FT                   /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRVE
FT                   IEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLSTQ
FT                   RLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
FT                   /protein_id="YP_001154613.1"
FT   misc_feature    37151..37573
FT                   /note="Type III secretion system regulator (LcrR); Region:
FT                   LcrR; cl09838"
FT                   /db_xref="CDD:142284"
FT                   /locus_tag="YPDSF_3984"
FT   gene            37630..37917
FT                   /db_xref="GeneID:5061626"
FT                   /locus_tag="YPDSF_3985"
FT   CDS_pept        37630..37917
FT                   /locus_tag="YPDSF_3985"
FT                   /gene_family="HOG000219603" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Yop regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597150"
FT                   /db_xref="GeneID:5061626"
FT                   /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAVM
FT                   KIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII"
FT                   /protein_id="YP_001154614.1"
FT   misc_feature    37645..37914
FT                   /note="LcrG protein; Region: LcrG; cl06311"
FT                   /db_xref="CDD:141922"
FT                   /locus_tag="YPDSF_3985"
FT   gene            37919..38893
FT                   /db_xref="GeneID:5061585"
FT                   /locus_tag="YPDSF_3986"
FT   CDS_pept        37919..38893
FT                   /locus_tag="YPDSF_3986"
FT                   /gene_family="HOG000219602" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="V antigen, antihost protein/regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597151"
FT                   /db_xref="InterPro:IPR005413"
FT                   /db_xref="GeneID:5061585"
FT                   /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNID
FT                   ISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVKEF
FT                   LESSPNTQWELRAFMAVMHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAELTAE
FT                   LKIYSVIQAEINKHLSSSGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEKMPQT
FT                   TIQVDGSEKKIVSIKDFLGSENKRTGALGNLKNSYSYNKDNNELSHFATTCSDKSRPLN
FT                   DLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTR"
FT                   /protein_id="YP_001154615.1"
FT   misc_feature    37919..38887
FT                   /note="V antigen (LcrV) protein; Region: LcrV; pfam04792"
FT                   /db_xref="CDD:113558"
FT                   /locus_tag="YPDSF_3986"
FT   gene            38896..39402
FT                   /db_xref="GeneID:5061545"
FT                   /locus_tag="YPDSF_3987"
FT   CDS_pept        38896..39402
FT                   /locus_tag="YPDSF_3987"
FT                   /gene_family="HOG000219601" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="yopB/yopD chaperone"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597152"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR005415"
FT                   /db_xref="GeneID:5061545"
FT                   /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAFN
FT                   QYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIKEP
FT                   RFPFHAAECLLQKGELAEAESGLFLAQELIADKTEFKELSTRVSSMLEAIKLKKEMEHE
FT                   CVDNP"
FT                   /protein_id="YP_001154616.1"
FT   misc_feature    38956..39357
FT                   /note="type III secretion low calcium response chaperone
FT                   LcrH/SycD; Region: LcrH_SycD; TIGR02552"
FT                   /db_xref="CDD:162919"
FT                   /locus_tag="YPDSF_3987"
FT   misc_feature    39001..39102
FT                   /note="Tetratricopeptide repeat; Region: TPR_3; pfam07720"
FT                   /db_xref="CDD:116334"
FT                   /locus_tag="YPDSF_3987"
FT   gene            39380..40585
FT                   /db_xref="GeneID:5061587"
FT                   /locus_tag="YPDSF_3988"
FT   CDS_pept        39380..40585
FT                   /locus_tag="YPDSF_3988"
FT                   /gene_family="HOG000219600" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Yop targeting protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597153"
FT                   /db_xref="GeneID:5061587"
FT                   /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGV
FT                   SSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPD
FT                   TFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIA
FT                   SKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAM
FT                   KILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLVAKGAEFSAKVAQI
FT                   STGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQH
FT                   NNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPH
FT                   TV"
FT                   /protein_id="YP_001154617.1"
FT   misc_feature    39383..40582
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG5613"
FT                   /db_xref="CDD:35172"
FT                   /locus_tag="YPDSF_3988"
FT   misc_feature    39695..40573
FT                   /note="Secretion system effector C (SseC) like family;
FT                   Region: SseC; pfam04888"
FT                   /db_xref="CDD:147185"
FT                   /locus_tag="YPDSF_3988"
FT   gene            40604..41524
FT                   /db_xref="GeneID:5061579"
FT                   /locus_tag="YPDSF_3989"
FT   CDS_pept        40604..41524
FT                   /locus_tag="YPDSF_3989"
FT                   /gene_family="HOG000219599" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Yop negative regulation/targeting component"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597154"
FT                   /db_xref="GeneID:5061579"
FT                   /translation="MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQAI
FT                   KSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQQR
FT                   DIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQEQI
FT                   LNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKLALLDKEFRMTDS
FT                   KANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNYNDNFM
FT                   KDVLRLIEQYVSSHTHAMKAAFGVV"
FT                   /protein_id="YP_001154618.1"
FT   misc_feature    40646..41521
FT                   /note="YopD protein; Region: YopD; pfam05844"
FT                   /db_xref="CDD:147802"
FT                   /locus_tag="YPDSF_3989"
FT   gene            42067..43275
FT                   /db_xref="GeneID:5061558"
FT                   /locus_tag="YPDSF_3990"
FT   CDS_pept        42067..43275
FT                   /locus_tag="YPDSF_3990"
FT                   /gene_family="HOG000103025" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597155"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="GeneID:5061558"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT                   /protein_id="YP_001154619.1"
FT   misc_feature    42130..43251
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3328"
FT                   /db_xref="CDD:33137"
FT                   /locus_tag="YPDSF_3990"
FT   misc_feature    42607..42846
FT                   /note="MULE transposase domain; Region: MULE; pfam10551"
FT                   /db_xref="CDD:151094"
FT                   /locus_tag="YPDSF_3990"
FT   gene            complement(43315..43446)
FT                   /db_xref="GeneID:5061541"
FT                   /locus_tag="YPDSF_3991"
FT                   /pseudo
FT   gene            complement(43481..43804)
FT                   /db_xref="GeneID:5061584"
FT                   /locus_tag="YPDSF_3992"
FT                   /pseudo
FT   gene            complement(43830..43952)
FT                   /db_xref="GeneID:5061627"
FT                   /locus_tag="YPDSF_3993"
FT   CDS_pept        complement(43830..43952)
FT                   /locus_tag="YPDSF_3993"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597156"
FT                   /db_xref="GeneID:5061627"
FT                   /translation="MAPGDFKWEHFAPDELCQCQRYAVRAWDFRLSLYHLPLVY"
FT                   /protein_id="YP_001154620.1"
FT   gene            43973..44182
FT                   /db_xref="GeneID:5061615"
FT                   /locus_tag="YPDSF_3994"
FT   CDS_pept        43973..44182
FT                   /locus_tag="YPDSF_3994"
FT                   /gene_family="HOG000266861" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597157"
FT                   /db_xref="GeneID:5061615"
FT                   /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDTA
FT                   KQYTNTVSSNTLDSANTYTNNKAD"
FT                   /protein_id="YP_001154621.1"
FT   gene            44293..44388
FT                   /db_xref="GeneID:5061625"
FT                   /locus_tag="YPDSF_3995"
FT   CDS_pept        44293..44388
FT                   /locus_tag="YPDSF_3995"
FT                   /gene_family="HOG000266862" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597158"
FT                   /db_xref="GeneID:5061625"
FT                   /translation="MAGIETTAPKYTDLKFNDISGKVDSAAIQYF"
FT                   /protein_id="YP_001154622.1"
FT   gene            44753..45805
FT                   /db_xref="GeneID:5061561"
FT                   /locus_tag="YPDSF_3996"
FT   CDS_pept        44753..45805
FT                   /locus_tag="YPDSF_3996"
FT                   /gene_family="HOG000219598" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="targeted effector protein"
FT                   /transl_table="11"
FT                   /note="SMART: Leucine-rich repeat, bacterial type:
FT                   (3.5e-06)"
FT                   /db_xref="GI:145597159"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR007088"
FT                   /db_xref="GeneID:5061561"
FT                   /translation="MAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLT
FT                   ELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNN
FT                   SLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVA
FT                   GNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTF
FT                   LDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLE
FT                   RLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHET
FT                   TDKLEDDVFE"
FT                   /protein_id="YP_001154623.1"
FT   gene            complement(45848..46147)
FT                   /db_xref="GeneID:5061601"
FT                   /locus_tag="YPDSF_3997"
FT   CDS_pept        complement(45848..46147)
FT                   /locus_tag="YPDSF_3997"
FT                   /gene_family="HOG000103025" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597160"
FT                   /db_xref="GeneID:5061601"
FT                   /translation="MVLQSWRKKWANLSCYFRYPTTIRKVIYMTNAIESVHRLFRKLTK
FT                   TKGIFPNENSLLKSLYLGLMNAQERWTMPIQSWNLALSQLAIYFEGRLDKVITL"
FT                   /protein_id="YP_001154624.1"
FT   misc_feature    complement(45863..>46144)
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG3328"
FT                   /db_xref="CDD:33137"
FT                   /locus_tag="YPDSF_3997"
FT   gene            46322..46513
FT                   /db_xref="GeneID:5061560"
FT                   /locus_tag="YPDSF_3998"
FT   CDS_pept        46322..46513
FT                   /locus_tag="YPDSF_3998"
FT                   /gene_family="HOG000266863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597161"
FT                   /db_xref="GeneID:5061560"
FT                   /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYRV
FT                   REGSTFMNRLFNIEVVLA"
FT                   /protein_id="YP_001154625.1"
FT   gene            complement(47478..47600)
FT                   /db_xref="GeneID:5061592"
FT                   /locus_tag="YPDSF_3999"
FT   CDS_pept        complement(47478..47600)
FT                   /locus_tag="YPDSF_3999"
FT                   /gene_family="HOG000266864" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597162"
FT                   /db_xref="GeneID:5061592"
FT                   /translation="MRRLNKGQFDIWLRRDEPKYRVREGSTFMNRLFNIEVVLA"
FT                   /protein_id="YP_001154626.1"
FT   gene            complement(48165..48539)
FT                   /db_xref="GeneID:5061603"
FT                   /locus_tag="YPDSF_4000"
FT   CDS_pept        complement(48165..48539)
FT                   /locus_tag="YPDSF_4000"
FT                   /gene_family="HOG000266865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="yopT chaperone"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597163"
FT                   /db_xref="GeneID:5061603"
FT                   /translation="MQQLFLKLGLNHQVNENDVYTFTFEVDGHIQVLIACYHQQWVQLF
FT                   SELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERFIDDIEQ
FT                   RKEPQNTKFQPNSTSPILFI"
FT                   /protein_id="YP_001154627.1"
FT   misc_feature    complement(48222..48539)
FT                   /note="Tir chaperone protein (CesT); Region: CesT; cl08444"
FT                   /db_xref="CDD:158335"
FT                   /locus_tag="YPDSF_4000"
FT   gene            complement(48563..49342)
FT                   /db_xref="GeneID:5061582"
FT                   /locus_tag="YPDSF_4001"
FT   CDS_pept        complement(48563..49342)
FT                   /locus_tag="YPDSF_4001"
FT                   /gene_family="HOG000266867" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytotoxic effector protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Peptidase C58, yopT: (2.1e-55)"
FT                   /db_xref="GI:145597164"
FT                   /db_xref="InterPro:IPR003951"
FT                   /db_xref="InterPro:IPR006473"
FT                   /db_xref="GeneID:5061582"
FT                   /translation="MLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAVRESVAN
FT                   YGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRNHAQGQSLFDQLYVGGRKG
FT                   KFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPVDVTGTTES
FT                   EGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPNFGEFHFSDK
FT                   EKFRKWFTNSFWGNSMYHYPLGVGQRFRVLTFDSKEV"
FT                   /protein_id="YP_001154628.1"
FT   misc_feature    complement(48572..49219)
FT                   /note="Yersinia/Haemophilus virulence surface antigen;
FT                   Region: Peptidase_C58; cl04145"
FT                   /db_xref="CDD:164050"
FT                   /locus_tag="YPDSF_4001"
FT   gene            50722..50961
FT                   /db_xref="GeneID:5061621"
FT                   /locus_tag="YPDSF_4002"
FT   CDS_pept        50722..50961
FT                   /locus_tag="YPDSF_4002"
FT                   /gene_family="HOG000266868" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597165"
FT                   /db_xref="GeneID:5061621"
FT                   /translation="MKEIAKRVHRIYCLLKLNIRRKGKQRLPACNPSPLAVPERLNLSG
FT                   SVDFMHNAQCTERWVSFQYVIMSWMITIVKHWRL"
FT                   /protein_id="YP_001154629.1"
FT   misc_feature    <50722..>50802
FT                   /note="glycine dehydrogenase; Provisional; Region:
FT                   PRK12566"
FT                   /db_xref="CDD:171585"
FT                   /locus_tag="YPDSF_4002"
FT   gene            51188..51805
FT                   /db_xref="GeneID:5061606"
FT                   /locus_tag="YPDSF_4003"
FT   CDS_pept        51188..51805
FT                   /locus_tag="YPDSF_4003"
FT                   /gene_family="HOG000061962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conjugative transfer surface exclusion protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597166"
FT                   /db_xref="GeneID:5061606"
FT                   /translation="MSETIWLEPSSQKTVYLQIKNISDKNMLGLAPQITKAVQDKGYTV
FT                   TSSPEDAHYWIQANVLKADKMDLREAEGFLSQGYQGAALGAALGAGITGYNSNSAGATL
FT                   GIGLAAGLVGMAANAMVEDINYTMVTDVQISEKTDTTLQTDNVAALKQGTSGYKVQTST
FT                   QTGNKHQYQTRVVSSANKVNLKFEEARPVLEDQLAKSIANIL"
FT                   /protein_id="YP_001154630.1"
FT   misc_feature    51188..51802
FT                   /note="Enterobacterial TraT complement resistance protein;
FT                   Region: TraT; cl05410"
FT                   /db_xref="CDD:174840"
FT                   /locus_tag="YPDSF_4003"
FT   gene            51912..52229
FT                   /db_xref="GeneID:5061620"
FT                   /locus_tag="YPDSF_4004"
FT   CDS_pept        51912..52229
FT                   /locus_tag="YPDSF_4004"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Helix-turn-helix, Fis-type: (0.0021)"
FT                   /db_xref="GI:145597167"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:5061620"
FT                   /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLR
FT                   KWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSL
FT                   R"
FT                   /protein_id="YP_001154631.1"
FT   misc_feature    51924..52154
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_4004"
FT   gene            52253..52711
FT                   /db_xref="GeneID:5061617"
FT                   /locus_tag="YPDSF_4005"
FT   CDS_pept        52253..52711
FT                   /locus_tag="YPDSF_4005"
FT                   /gene_family="HOG000023132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597168"
FT                   /db_xref="GeneID:5061617"
FT                   /translation="MVELCRLLKITRSVYSASLNFRVDVKRLQLRELHQQSRGAAGSRT
FT                   LSLLMRQSGYNVVRWLARRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEP
FT                   NRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA"
FT                   /protein_id="YP_001154632.1"
FT   misc_feature    52316..>52708
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="YPDSF_4005"
FT   misc_feature    52550..>52708
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_4005"
FT   gene            52823..53017
FT                   /db_xref="GeneID:5061593"
FT                   /locus_tag="YPDSF_4006"
FT   CDS_pept        52823..53017
FT                   /locus_tag="YPDSF_4006"
FT                   /gene_family="HOG000023133" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597169"
FT                   /db_xref="GeneID:5061593"
FT                   /translation="MQSMSRRGNCLDNSPMERVFRSLKSEWLLVGGYMDVHHAVRDIGE
FT                   WIQSYYNTPPSAQWWITAL"
FT                   /protein_id="YP_001154633.1"
FT   misc_feature    <52826..52978
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="YPDSF_4006"
FT   gene            complement(53155..53268)
FT                   /db_xref="GeneID:5061604"
FT                   /locus_tag="YPDSF_4007"
FT   CDS_pept        complement(53155..53268)
FT                   /locus_tag="YPDSF_4007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597170"
FT                   /db_xref="GeneID:5061604"
FT                   /translation="MPKSLNAAKWVSIARIMAEGTAYEVEPDLCFTALGTV"
FT                   /protein_id="YP_001154634.1"
FT   gene            53775..54983
FT                   /db_xref="GeneID:5061546"
FT                   /locus_tag="YPDSF_4008"
FT   CDS_pept        53775..54983
FT                   /locus_tag="YPDSF_4008"
FT                   /gene_family="HOG000219629" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid-partitioning protein SopA"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597171"
FT                   /db_xref="GeneID:5061546"
FT                   /translation="MFYYKDANFIEIIHMDLKSTLDRCIERGQFMTQEIAKSQFGNDSP
FT                   AARTITRRWRITEAAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDM
FT                   RDVFKTRLSKPKGENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQAT
FT                   ASLYHGYVPDLHIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIY
FT                   GLHDQGKLPVAPHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAE
FT                   LYDYVSTLQFFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGM
FT                   VLKEVVRVTDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRW
FT                   ENA"
FT                   /protein_id="YP_001154635.1"
FT   misc_feature    53817..54980
FT                   /note="plasmid-partitioning protein SopA; Provisional;
FT                   Region: PRK13705"
FT                   /db_xref="CDD:172249"
FT                   /locus_tag="YPDSF_4008"
FT   misc_feature    53955..54041
FT                   /note="Helix-Turn-Helix DNA binding domain of transcription
FT                   regulators from the MerR superfamily; Region: HTH_MerR-SF;
FT                   cl02600"
FT                   /db_xref="CDD:155005"
FT                   /locus_tag="YPDSF_4008"
FT   misc_feature    54138..>54257
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="YPDSF_4008"
FT   misc_feature    54159..54179
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="YPDSF_4008"
FT   misc_feature    54177..54179
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="YPDSF_4008"
FT   misc_feature    <54519..54722
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="YPDSF_4008"
FT   misc_feature    54537..54539
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="YPDSF_4008"
FT   gene            54980..55945
FT                   /db_xref="GeneID:5061571"
FT                   /locus_tag="YPDSF_4009"
FT   CDS_pept        54980..55945
FT                   /locus_tag="YPDSF_4009"
FT                   /gene_family="HOG000218491" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="plasmid-partitioning protein"
FT                   /transl_table="11"
FT                   /note="SopB"
FT                   /db_xref="GI:145597172"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:5061571"
FT                   /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
FT                   KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTSG
FT                   QQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRPTS
FT                   AYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPNELSA
FT                   RSGEALSKAYENNVDTLKRVTHKIMKQKQEGRQFTTEELIVLLMPERKQPENIHKKSFG
FT                   KNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
FT                   /protein_id="YP_001154636.1"
FT   misc_feature    54983..55939
FT                   /note="plasmid-partitioning protein; Provisional; Region:
FT                   PRK13698"
FT                   /db_xref="CDD:172242"
FT                   /locus_tag="YPDSF_4009"
FT   misc_feature    55217..55450
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="YPDSF_4009"
FT   gene            complement(56400..56573)
FT                   /db_xref="GeneID:5061618"
FT                   /locus_tag="YPDSF_4010"
FT   CDS_pept        complement(56400..56573)
FT                   /locus_tag="YPDSF_4010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597173"
FT                   /db_xref="GeneID:5061618"
FT                   /translation="MKSPYPTWRDGYRYQKADIMLNDVGSRPGQIDMFDETPPHANSKH
FT                   LMQVVDASIALG"
FT                   /protein_id="YP_001154637.1"
FT   misc_feature    complement(56421..>56552)
FT                   /note="DNA polymerase V subunit UmuC; Reviewed; Region:
FT                   umuC; PRK03609"
FT                   /db_xref="CDD:167559"
FT                   /locus_tag="YPDSF_4010"
FT   gene            57118..57360
FT                   /db_xref="GeneID:5061551"
FT                   /locus_tag="YPDSF_4011"
FT   CDS_pept        57118..57360
FT                   /locus_tag="YPDSF_4011"
FT                   /gene_family="HOG000260299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597174"
FT                   /db_xref="InterPro:IPR011570"
FT                   /db_xref="GeneID:5061551"
FT                   /translation="MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQ
FT                   RVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSV"
FT                   /protein_id="YP_001154638.1"
FT   misc_feature    57130..57333
FT                   /note="Uncharacterized protein family (UPF0156); Region:
FT                   RHH_2; cl01448"
FT                   /db_xref="CDD:163980"
FT                   /locus_tag="YPDSF_4011"
FT   gene            57353..57652
FT                   /db_xref="GeneID:5061624"
FT                   /locus_tag="YPDSF_4012"
FT   CDS_pept        57353..57652
FT                   /locus_tag="YPDSF_4012"
FT                   /gene_family="HOG000138821" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597175"
FT                   /db_xref="GeneID:5061624"
FT                   /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKN
FT                   PELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
FT                   /protein_id="YP_001154639.1"
FT   misc_feature    57353..57640
FT                   /note="Plasmid stabilisation system protein; Region:
FT                   Plasmid_stabil; cl11422"
FT                   /db_xref="CDD:164217"
FT                   /locus_tag="YPDSF_4012"
FT   gene            complement(57792..58451)
FT                   /db_xref="GeneID:5061573"
FT                   /locus_tag="YPDSF_4013"
FT   CDS_pept        complement(57792..58451)
FT                   /locus_tag="YPDSF_4013"
FT                   /gene_family="HOG000219628" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="outer membrane virulence protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597176"
FT                   /db_xref="InterPro:IPR003537"
FT                   /db_xref="GeneID:5061573"
FT                   /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLAG
FT                   RTESPQGSSLASRIIERLSSVAHSVIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSD
FT                   SIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQA
FT                   EASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM"
FT                   /protein_id="YP_001154640.1"
FT   misc_feature    complement(58074..58451)
FT                   /note="YopE, N terminal; Region: YopE_N; pfam09020"
FT                   /db_xref="CDD:117586"
FT                   /locus_tag="YPDSF_4013"
FT   sig_peptide     complement(58380..58451)
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.396 at
FT                   residue 24"
FT                   /locus_tag="YPDSF_4013"
FT                   /product="hypothetical protein"
FT   misc_feature    complement(57798..58148)
FT                   /note="SptP, and YopE. Part of protein secretion system;
FT                   stimulates Rac1- dependent cytoskeletal changes that
FT                   promote bacterial internalization; Region: ToxGAP; cd00219"
FT                   /db_xref="CDD:119405"
FT                   /locus_tag="YPDSF_4013"
FT   misc_feature    complement(order(58008..58010,58017..58019,58032..58040,
FT                   58104..58106))
FT                   /note="switch II binding region; other site"
FT                   /db_xref="CDD:119405"
FT                   /locus_tag="YPDSF_4013"
FT   misc_feature    complement(order(58020..58022,58035..58037))
FT                   /note="Rac1 P-loop interaction site; other site"
FT                   /db_xref="CDD:119405"
FT                   /locus_tag="YPDSF_4013"
FT   misc_feature    complement(order(57897..57905,58020..58022))
FT                   /note="GTP binding residues; other site"
FT                   /db_xref="CDD:119405"
FT                   /locus_tag="YPDSF_4013"
FT   misc_feature    complement(order(57912..57914,58008..58010,58020..58022))
FT                   /note="switch I binding region; other site"
FT                   /db_xref="CDD:119405"
FT                   /locus_tag="YPDSF_4013"
FT   gene            58645..59037
FT                   /db_xref="GeneID:5061619"
FT                   /locus_tag="YPDSF_4014"
FT   CDS_pept        58645..59037
FT                   /locus_tag="YPDSF_4014"
FT                   /gene_family="HOG000247416" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="yopE chaperone"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597177"
FT                   /db_xref="InterPro:IPR005416"
FT                   /db_xref="GeneID:5061619"
FT                   /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQ
FT                   ILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLY
FT                   TQLEMLVQGAERLQTSSLISPPRSFS"
FT                   /protein_id="YP_001154641.1"
FT   misc_feature    58654..58998
FT                   /note="Tir chaperone protein (CesT); Region: CesT; cl08444"
FT                   /db_xref="CDD:158335"
FT                   /locus_tag="YPDSF_4014"
FT   gene            complement(59100..59714)
FT                   /db_xref="GeneID:5061612"
FT                   /locus_tag="YPDSF_4015"
FT   CDS_pept        complement(59100..59714)
FT                   /locus_tag="YPDSF_4015"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597178"
FT                   /db_xref="GeneID:5061612"
FT                   /translation="MYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMD
FT                   ALATGRRIKCLTCVDDYTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPE
FT                   FTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDVSHARKTIS
FT                   EWRQDYNECRPHSTLNYQTPSEFAAAWRKGNSDSEGSDITK"
FT                   /protein_id="YP_001154642.1"
FT   misc_feature    complement(59277..59603)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_4015"
FT   gene            59847..61019
FT                   /db_xref="GeneID:5061605"
FT                   /locus_tag="YPDSF_4016"
FT   CDS_pept        59847..61019
FT                   /locus_tag="YPDSF_4016"
FT                   /gene_family="HOG000010171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597179"
FT                   /db_xref="InterPro:IPR007101"
FT                   /db_xref="GeneID:5061605"
FT                   /translation="MLSREDFYMIKQMRQQGAYIIDIATQVGCSERTVRRYLKYPEPPA
FT                   RKTRHKMVKLKPFMDYIDMRLAENVWNSEVILAEIKAMGYTGGRSMLRYYIQPKRKMRP
FT                   SKRTVRVETQPGYQLQHDWGEVELEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDAEHT
FT                   YESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLAEHYDFLPRACRPRR
FT                   ARTKGKVERMVKYLKDNVFVRYRRFDSFTHVNQQLEQWMADVADKRELRQFRQTPEQRF
FT                   ALEQEHLQPLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRISLDDEL
FT                   RSYSNEQQVASHRLCSASSGWQTVPEHHAPLWQQVSMVEHRPLSAYEELL"
FT                   /protein_id="YP_001154643.1"
FT   misc_feature    59847..60686
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="YPDSF_4016"
FT   misc_feature    60183..60560
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_4016"
FT   gene            61019..61450
FT                   /db_xref="GeneID:5061599"
FT                   /locus_tag="YPDSF_4017"
FT   CDS_pept        61019..61450
FT                   /locus_tag="YPDSF_4017"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597180"
FT                   /db_xref="GeneID:5061599"
FT                   /translation="MHELEALLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQE
FT                   WNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERCENVILLG
FT                   PPGVGKTHLAVALGVKAADAGHRVLFMPLYEDITNIGVY"
FT                   /protein_id="YP_001154644.1"
FT   misc_feature    61169..>61417
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="YPDSF_4017"
FT   gene            61794..62219
FT                   /db_xref="GeneID:5061600"
FT                   /locus_tag="YPDSF_4018"
FT   CDS_pept        61794..62219
FT                   /locus_tag="YPDSF_4018"
FT                   /gene_family="HOG000219627" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="yopH targeting protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597181"
FT                   /db_xref="GeneID:5061600"
FT                   /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINE
FT                   KELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQ
FT                   LASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
FT                   /protein_id="YP_001154645.1"
FT   misc_feature    61803..62153
FT                   /note="Tir chaperone protein (CesT); Region: CesT; cl08444"
FT                   /db_xref="CDD:158335"
FT                   /locus_tag="YPDSF_4018"
FT   gene            complement(62367..63122)
FT                   /db_xref="GeneID:5061544"
FT                   /locus_tag="YPDSF_4019"
FT   CDS_pept        complement(62367..63122)
FT                   /locus_tag="YPDSF_4019"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597182"
FT                   /db_xref="GeneID:5061544"
FT                   /translation="MMQSRTVYNYRSHRDDRAITQRIREIAETRIRYGCPRIHILLRRE
FT                   GWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPEVTALEQCWSMDFVADNLFNG
FT                   RRVRALTIVDNFSRECLAIEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEFISK
FT                   SMDRWAYENRVTMDCSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIEQWRQ
FT                   EYNHFHPHSSLNNLTPAEFARSHQKGPDL"
FT                   /protein_id="YP_001154646.1"
FT   misc_feature    complement(62403..63083)
FT                   /note="putative transposase OrfB; Reviewed; Region:
FT                   PHA02517"
FT                   /db_xref="CDD:164923"
FT                   /locus_tag="YPDSF_4019"
FT   misc_feature    complement(62520..62849)
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_4019"
FT   gene            complement(63200..63466)
FT                   /db_xref="GeneID:5061538"
FT                   /locus_tag="YPDSF_4020"
FT   CDS_pept        complement(63200..63466)
FT                   /locus_tag="YPDSF_4020"
FT                   /gene_family="HOG000266653" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Helix-turn-helix, Fis-type: (0.0093)"
FT                   /db_xref="GI:145597183"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:5061538"
FT                   /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKKF
FT                   GGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
FT                   /protein_id="YP_001154647.1"
FT   misc_feature    complement(63251..63463)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_4020"
FT   gene            complement(64517..65068)
FT                   /db_xref="GeneID:5061574"
FT                   /locus_tag="YPDSF_4021"
FT   CDS_pept        complement(64517..65068)
FT                   /locus_tag="YPDSF_4021"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="resolvase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597184"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="GeneID:5061574"
FT                   /translation="MRLFGYARVSTSQQSLDIQIKTLKDAGVKANRIFTDKASGSSADR
FT                   EGLDLLRMKVEEGDVILVKKLDRLGRDTVDMIQLIKEFDAQGVSIQFIDDGISTDGEMG
FT                   KMVVTILSAVAQAERQRILERTNEGREEAKLKGVKFGRKRRINRKELLELHEQGMGATE
FT                   IAKKMNIARSTIYKVINESQ"
FT                   /protein_id="YP_001154648.1"
FT   misc_feature    complement(64523..65068)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(64682..65062)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(order(64856..64858,64865..64870,65039..65041,
FT                   65045..65047))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(65039..65041)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(order(64715..64717,64727..64732,64736..64741,
FT                   64871..64873))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(order(64709..64711,64718..64720,64727..64732,
FT                   64739..64744,64751..64753,64835..64840,64853..64855))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(order(64694..64696,64706..64708,64715..64717,
FT                   64727..64729,64736..64741,64748..64753,64778..64786))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(order(64694..64696,64706..64708,64715..64717,
FT                   64727..64729,64736..64738,64784..64786))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(order(64691..64696,64712..64714))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="YPDSF_4021"
FT   misc_feature    complement(64523..64648)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_4021"
FT   gene            65232..67547
FT                   /db_xref="GeneID:5061589"
FT                   /locus_tag="YPDSF_4022"
FT   CDS_pept        65232..67547
FT                   /locus_tag="YPDSF_4022"
FT                   /gene_family="HOG000221546" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597185"
FT                   /db_xref="GeneID:5061589"
FT                   /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRRG
FT                   KHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTRRE
FT                   HTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILLPGA
FT                   TTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLVYDAE
FT                   GRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVCRALGH
FT                   PTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEEPLSLLR
FT                   LNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVLMAEACNI
FT                   GLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRWGGGEVASV
FT                   DGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLRDSIFVLEGL
FT                   LEQQTGLNPVEIMTDTGGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRVDKSANYGALD
FT                   ELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSGLAQAIMAVGRV
FT                   NKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKRYREGQEDQLGAL
FT                   GLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHINMLGHYTFTLSDDI
FT                   LNGELRALNFNLNNELSP"
FT                   /protein_id="YP_001154649.1"
FT   misc_feature    65304..66047
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="YPDSF_4022"
FT   misc_feature    66438..67418
FT                   /note="Transposase and inactivated derivatives, TnpA family
FT                   [DNA replication, recombination, and repair]; Region:
FT                   COG4644"
FT                   /db_xref="CDD:34263"
FT                   /locus_tag="YPDSF_4022"
FT   gene            complement(67544..67924)
FT                   /db_xref="GeneID:5061610"
FT                   /locus_tag="YPDSF_4023"
FT   CDS_pept        complement(67544..67924)
FT                   /locus_tag="YPDSF_4023"
FT                   /gene_family="HOG000118481" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597186"
FT                   /db_xref="GeneID:5061610"
FT                   /translation="MVERYPRDGFFKVFQILRRWGYVWNHKRVHRIYCLLKLNIRRKGK
FT                   QRLPARTPSPLAVPERLNLSGAVDFMHDALICVDDYNREKLAIEIDLNLPTQHVIRVLD
FT                   RIVVNRGYPVMGFEVQWDENVR"
FT                   /protein_id="YP_001154650.1"
FT   gene            68913..69833
FT                   /db_xref="GeneID:5061540"
FT                   /locus_tag="YPDSF_4024"
FT   CDS_pept        68913..69833
FT                   /locus_tag="YPDSF_4024"
FT                   /gene_family="HOG000266859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597187"
FT                   /db_xref="InterPro:IPR008126"
FT                   /db_xref="InterPro:IPR008378"
FT                   /db_xref="GeneID:5061540"
FT                   /translation="MATGVDSVAIGPLSKALGDSAVTYGVSSTAQKDGVAIGAKASASD
FT                   TGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDHSKTDRENSVSIGHESLNRQLT
FT                   HLAAGTEDTDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKHSNSVARTTLETAE
FT                   EHANKKSAETLVSAKVYADSNSSQTLKTANSYTDVTVSNSTKKATRESNQYTDHKFSQL
FT                   DNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRSSQALAIGSGYRVNES
FT                   VAFKAGVAYAGSSNVMYNASFNIEW"
FT                   /protein_id="YP_001154651.1"
FT   misc_feature    69597..69830
FT                   /note="YadA-like C-terminal region; Region: YadA;
FT                   pfam03895"
FT                   /db_xref="CDD:146496"
FT                   /locus_tag="YPDSF_4024"
FT   gene            69956..70162
FT                   /db_xref="GeneID:5061578"
FT                   /locus_tag="YPDSF_4025"
FT   CDS_pept        69956..70162
FT                   /locus_tag="YPDSF_4025"
FT                   /gene_family="HOG000266860" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597188"
FT                   /db_xref="GeneID:5061578"
FT                   /translation="MGNYMVSDEINRRNNLSDICYGHPIYVGCACINPNYINPQIQRSR
FT                   VNTARYFEQAAQFDHWPFCFQPC"
FT                   /protein_id="YP_001154652.1"
FT   gene            complement(70159..70347)
FT                   /db_xref="GeneID:5061598"
FT                   /locus_tag="YPDSF_4026"
FT   CDS_pept        complement(70159..70347)
FT                   /locus_tag="YPDSF_4026"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597189"
FT                   /db_xref="GeneID:5061598"
FT                   /translation="MRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEI
FT                   LKQAAVLMSEFPIKSLR"
FT                   /protein_id="YP_001154653.1"
FT   misc_feature    complement(70210..>70344)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:141105"
FT                   /locus_tag="YPDSF_4026"
FT   gene            70497..70955
FT                   /db_xref="GeneID:5061611"
FT                   /locus_tag="YPDSF_4027"
FT   CDS_pept        70497..70955
FT                   /locus_tag="YPDSF_4027"
FT                   /gene_family="HOG000266858" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597190"
FT                   /db_xref="GeneID:5061611"
FT                   /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTAQ
FT                   DISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIVDP
FT                   QKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
FT                   /protein_id="YP_001154654.1"
FT   misc_feature    <70566..70940
FT                   /note="conjugal transfer nickase/helicase TraI;
FT                   Provisional; Region: PRK13709"
FT                   /db_xref="CDD:172253"
FT                   /locus_tag="YPDSF_4027"
FT   gene            71127..71444
FT                   /db_xref="GeneID:5061609"
FT                   /locus_tag="YPDSF_4028"
FT   CDS_pept        71127..71444
FT                   /locus_tag="YPDSF_4028"
FT                   /gene_family="HOG000266649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Helix-turn-helix, Fis-type: (0.0021)"
FT                   /db_xref="GI:145597191"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="GeneID:5061609"
FT                   /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLR
FT                   KWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSL
FT                   R"
FT                   /protein_id="YP_001154655.1"
FT   misc_feature    71139..71369
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_4028"
SQ   Sequence 71507 BP; 20005 A; 15940 C; 16159 G; 19403 T; 0 other;
     TTTACTCTGC TTCGCTGAAT TTTCGGGTTG ATGTAAAACG TCTGCAACTG CGTGAATTGC        60
     ATCAACAGAG CCGGGGAGCA GCCGGCAGCA GAACACTGAG TCTGCTGATG CGTCAGTCGG       120
     GTTATAACGT GGTGCGCTGG CTGGCCCGCA GGCTGATGCG GGAATGTGGT CTGGCGAGTC       180
     GCCAACCCGG AAAACCTCGT TACCGTGGCG AACGGGAGGT GTCACTGGCA TCGCCAGACT       240
     TACTGAAAAG GCAGTTTAAG CCGTCGGAGC CCAATCGTGT GTGGAGTGGA TATATCAGCT       300
     ATATCAAAGT CAATGGTGGC TGGTGCTACC TGGCACTGGT GATTGACCTT TACTCTTTCC       360
     ATTGGTGAGT TATCCAGGCA GTTACCCCTG CGGCTCATAC TCTGCATCAC TCCGTTCCTC       420
     CACAGTAACT GCCTGTATTT CTTACTCCTG TACTGCCCTC CTTGATCCGA ATGAAACAGC       480
     AGCCTCTTTT CCCTTGGGCG CGTCTCCAGT GCATTACGCC AGGCTCGACA CACCAGCTCA       540
     GCATCCGGGG ATGACGATAT GGCACTGCCC ACTATCCGAC GGGAGTAAAC CGAAGCCTGA       600
     AAAGTGAATG GCTGCCTGTA GGGGGCTATA TGGATGTCCA TCATGCGGTA CGAGATATCG       660
     GTGAATGGAT ACAAAGTTAT TACAACACAC CCCCATCGGC ACAATGGTGG ATTACCGCCC       720
     TGTGAATACG AAGAGCGGTG GAAAAAGGCT ACGAAGGTGT CCTGATTTTG TGATCCACTA       780
     CAGGATGGAT CTGTTGGTCA ATGCCGGCAT TCCTGTCCGA ACTGTCAACA GTTTCAAAGC       840
     GCTTCACGAC AAGGTGATTA TCGTTGATGG CAAGAATACG CAGATGGGGT CGTTCAATTT       900
     TAGCCAAGCA GCCGTACAGT CCAACTCGGA GAATGTGCTG ATTATATGGG GGGACTTCAC       960
     GGTGGTACAG GCGTATCTGC AGTATTGGCA GTCACGCTGG AATAAAGGAA CTGACTGGCG      1020
     TTCGTCGTAC TGATCTCACT CTTTTCGCTG AGTCATTAAT GTGATCCGTG CGCCAACACG      1080
     GGTTATGTCT GCAAAAGTTA AGTCGCTGAT TTCATAAATC TGTTGTATTC TCTGCGAAAC      1140
     GATCCTTGTT TGATCTTTGA GGGGGCTGAT ATGTCGCAGA TCGAAAATGC AGTAACTTCC      1200
     TCATCGAAAC GTGCCTACAG AAAGGGGAAC CCGTTAACTG GAGCCGAGAA ACAACGTATG      1260
     TCTGTTTCCC GGAAAAAAGA GACACATAAA GCTATAAATG TGTTCATTCA GAACGATCTC      1320
     AAAAACGAAC TTTTACAACT CTGTGAAGAT TCAGGTTTGA CTCAGACAGA AATGATTGAG      1380
     CGCTGGATTC AGAGAGAAAA GGCCGCTAGA ACTAATGCAG CTTGAATGGC AACTAAGTTA      1440
     CTTTCTTGAT CCTTCAGGCA GTGAGTGCTA GATTACCGAT TGTTTAAAGA ATTTTTGGCT      1500
     GGCCACGCCG TAAGGTGGCA GGGAACTGGT TCTGCTAAGG TGTTTACTTG GAACCAGAAA      1560
     AGCAAAAACC CCGATAAACT TCCTCATCTT TGGCGAGGCG AGAAGGTTAC CGGGGCCCAC      1620
     TTAAAACTGT ATAGAAGCTG TTGCTCTATA CAGGGAGTAT ATGTGCATGT TCAGAAAAGT      1680
     TCAATACCTT CTGCGCTTGT TACTCCTTCC GTGCAACATA AGTGCGGGAA GGTGTGACTA      1740
     ACCACCAGGC CCTGTTCACA CATCATTATC GACAGGTTAA AAACCCGAAT CCGGAATTTA      1800
     CGCCGCGAGA GGGTAAAAAA ACCCTGCCGT TCTGCCGTAA GCTGATGGCG AAAGCCGAAG      1860
     GCTTCACATC TCGTTTTGAT TTCTCCATGC ACGTCGCATT CGCGCGTTCT CTGAGTTTGC      1920
     GTCATCGTAT GCCGCCGTTA CTACGTCGGC GTGCTATCGA TGCATTACTG CAGGGTATGT      1980
     GTTTCCACTA CGACCCACTG GCCAACCGTA TCCAGCGCTC GATTACCAAT CTGGCCATTG      2040
     AGTGTGGTCT GGCGACAGAG TCAAAGAGTG GCAACCTTTC CATCACCCGC GCCACGCGTG      2100
     CGCTGCGCTT TTTATCTGAG CTGGGGCTGA TTACCTACCA GACCGAATAT GATCCACAGA      2160
     TTGGCTGTAA TATTCCGACT GATATCACGT TCACACCGGC GCTGTTTTCT GCGTTGGATG      2220
     TGTCGGACGT TGCTGTCGCA GCAGCCCGAC GCAGCCGCGT TGAATGGGAA AATCAGCAAA      2280
     GGGAGAAACA ACGTCTGCCT AGATTGGAGA TGGATGAGCT GATAGCAAAG GCATGGCGGT      2340
     TCGTCCGCGA GCGTTTCCGT AGCTATCAAA CTGAACGTAA GGCTCATGGA TTGAAACGTG      2400
     CCCGTGCGCG CCGTGATGTT GACCGTACGC GCCGTGACAT TGAAGCTATC GTTAACCGGC      2460
     AGCTGACGCG TGAGATAGCT GAGGGGCGGT TTGTCGGTAA TCTGGATGCG GTACGCAGGG      2520
     AGAAAGCCCG TCGCGTGAAG GAACGCATGC TGATGTCCAG GAACAATAAC TACACCCGGT      2580
     TGGCCACCGG CGCTACCTGA CGTCGTATTT ACTGAAAATC CGGTTAGCGC CGGAGGATTT      2640
     CGCTCGTCTG CCTCCTGTCA GTGCTTGTTA TTTGAGCGAT GTGACGGCCG CTACATGACC      2700
     TATCTTCTCT TTCCCGCCCT GAAAATGCCC TCGAATTCTC CCAATATCGT CGCTTGAATG      2760
     TACTGATTTA GGTTATCCAC AGTTAACTGC AAGGGAACTT CCCATAAAGT TACAACCGAT      2820
     ATGTTTTTTA AGCGCCAGCC GAACTTGTTT TAAAGTGCGT GGTTTCTTTT AAACCACTGA      2880
     TCAGCACTTC TTTTAAATAC CTTTTCTTTT ATTCCTATAA ATAAATAACC TATTCGTCGT      2940
     CTGCCTTTTG GACAGACTAT GATAATGCCC GCCCTTGCAG CGAACTTACG TTCGCGCCGG      3000
     TTCGGAAACA AAGAAATACC TCCTATCACG ATGCTACGAG CGCATAAACC CTTATTAGTT      3060
     ACAACATTCA CGATTCGACC AAAAAAATAC CAGACCGCAT ACATCTGAGA CCACTGCGCG      3120
     CACCCTTACC CACTAAAAAG CCGCCCCGCC CCGGGCCAAC GGCCCGGAAC AGAGTGGCTT      3180
     TACAATGAGT GTTGTAACTA AAATTTTCGA GTCGCTGCAA GTCATGTCGC TGGAAGTCAT      3240
     TCGAACACGC TCGTAAGCGG CCCTAATGGC CCGCTAACGC GGAGATACGC CCCGCCTGCG      3300
     GCAAAGCCTT GTCGGGACCA CTCCGACCGC GTAATGAAGC ACCTACGCTA CTTTTAGTGG      3360
     GTTTAGCTTT GCAGGGAGGA GATTGGGATT GGTGAAACCT ATCAAACCGG AACCGGCTAC      3420
     GCCGGGCTAT CGGCGCCAAT TGTCAACAGA GTTATAGTTA ATATCCGCTG GCGCCTTCAT      3480
     GCCGCGATGC GGCATTGAAA AGACCGGCTG CGCACTGCTC GCCTGTCCGG TAAGGACATG      3540
     ATATAAACGT TTGTGTTTAT AAGCACTTTT GTGGATATCG TTATGCAGCT GAGTGACTAC      3600
     ATTGACAGTG TATACGGAAC AGCCGTAAGC GAGCGGCGAT CTCATATTGT TAACTCACTT      3660
     CCGTTATCAC ACTCTGGTCT CAGTCAATAC AACGAACCTG AGGTGAAATA TGACGACACG      3720
     GTATTCTCGT AGTGAACGGC AGCACCATCT CGACGCCTGG CAATAGAGCT GAATGTCTAA      3780
     AAAACACTAC TGTCGGCTGC ATGACTTGAA CATCGCCACC TTTTATTACT GGCTCAAACA      3840
     TCATCAAGAT GACACCACCG TTGCCATTCC CCCTGCGTTT ATCCCCGCTC GCCGGGTAAT      3900
     ACCAGACAAT AACGGTACCG AGGCAGTGAC CCTCAACCTC CCCAATGGCT GTTCGGTCAG      3960
     TTGTCTTCCT GCTCAGTTAC GCGCTGTTAT GCAGGCCTTA TCCCTATGTT GACGCCACAA      4020
     CACATCTGGT TGGCACGCGA GCCGGTCGAT ATGCGTCGCG GTATCGCAAT ACATTACCGA      4080
     CCATCTGCAT CAGCCCTGGC AAGGCGAAGC CGCCTTTGTC TTTTGCAACA AAGGCGCGTT      4140
     CGCGTATCAA AGTTCTGCGT TGGAACAAAC ACGGGGTCTG GTTGTGAAGA GGCTGCTGTT      4200
     TCATTCGGAT CAGGGAGGGC AGTACAGGAG TAAGAAATCC AGGCAGTTAC TGTGGAGGAC      4260
     CGGAGTGATG CAGAGTATGA GCCGCAGGGG TAACTGCCTG GATAACTCAC CAATGGAAAG      4320
     AGTGTTCCGA AGCCTGAAAA GTGAATGGCT GCCTGTAGGG GGCTATATGG ATGTCCATCA      4380
     TGCGGTACGA GATATCGGTG AATGGATACA AAGTTATTAC AACACACCCC CATCGGCACA      4440
     ATGGTGGATT ACCGCCCTGT GAATACGAAG AGCAGGGGAA AAAGGCTACG AAGGTGTCCT      4500
     GATTTTGTGA TCCACTACAG CAACGGAATA GCTCCGCTCA GTTATCTGAC GGACAGCTTC      4560
     TTCCTTAAAT TCAGGGGTAA AACGTGGTGT GCCCATAGAC TCCTCCTATG CTTAAGATAT      4620
     AGGTCAGATT TGTCTACAGG TTCGGGGGCT CCCCAAATAT CTACAATAAC TAAAAATCAG      4680
     TGGCTGGAAG TGATATATTC TGGGACGGGT TTAATCAATG ATAGATATCA CCGTAAATCA      4740
     GATTAAAGAG CTTTTGTGTG ATTAACACCA CCTTTACTGA GTTACTCCCA AAAATAGCAA      4800
     GTCACTTTGG ATTAGATAAA TTGAGCCAAG ATGAATATGG CTTGTGTGAG CTTATCCTCA      4860
     ACGACCGAGT CGTTATTATG CTGAGGGCTG ATGAAATATT GAATCGATTG ACTCTGTTGG      4920
     GGCCAATCTT AGGATTTTCT GGACCAGAGG CGCGCAGCGC CGCTAGTCAG CTTTTTTTCT      4980
     GTTATAGCAT CAATGCCTTG AATAAGGACG GCCCTTGTTT CGCTTGGAGT GAAGAACTGG      5040
     GGCTGATCGC ATTCAAGCAC CTTTCTCTCG ACGAGCTGAA TGTTGAGAAC GTTAGCAAGG      5100
     AGATAGCGAA CTTTTACGAC TGGTTGAGCT TGGTCAGTTT ACCAGCAGAA ACTGCCCCTT      5160
     CATACTCAAT CTACTCAATC GGTTAAATGG GGATGAGTAA AGCATGAAAA GCGTGAAAAT      5220
     CATGGGAACT ATGCCACCGT CGATCTCCCT CGCCAAAGCT CATGAGCGCA TCAGCCAACA      5280
     TTGGCAAAAT CCTGTCGGTG AGCTCAATAT CGGAGGAAAA CGGTATAGAA TTATCGATAA      5340
     TCAAGTGTTG CGCTTGAACC CCCACAGTGG TTTTTCTCTC TTTCGAGAAG GGGTTGGTAA      5400
     GATCTTTTCG GGGAAGATGT TTAACTTTTC AATTGCTCGT AACCTTACTG ACACACTCCA      5460
     TGCGGCCCAG AAAACGACTT CGCAGGAGCT AAGGTCTGAT ATCCCCAATG CTCTCAGTAA      5520
     TCTCTTTGGA GCCAAGCCAC AGACCGAACT GCCGCTGGGT TGGAAAGGGG AGCCCTTGTC      5580
     AGGAGCTCCG GATCTTGAAG GGATGCGAGT GGCTGAAACC GATAAGTTTG CCGAGGGCGA      5640
     AAGCCATATT AGTATAATAG AAACTAAGGA TAAGCAGCGG TTGGTAGCTA AGATTGAACG      5700
     CTCCATTGCC GAGGGGCATT TGTTCGCAGA ACTGGAGGCT TATAAACACA TCTATAAAAC      5760
     CGCGGGCAAA CATCCTAATC TTGCCAATGT TCATGGCATG GCTGTGGTGC CATACGGTAA      5820
     CCGTAAGGAG GAAGCATTGC TGATGGATGA GGTGGATGGT TGGCGTTGTT CTGACACACT      5880
     AAGAACCCTC GCCGATAGCT GGAAGCAAGG AAAGATCAAT AGTGAAGCCT ACTGGGGAAC      5940
     GATCAAGTTT ATTGCCCATC GGCTATTAGA TGTAACCAAT CACCTTGCCA AGGCAGGGGT      6000
     AGTACATAAC GATATCAAAC CCGGTAATGT GGTATTTGAC CGCGCTAGCG GAGAGCCCGT      6060
     TGTTATTGAT CTAGGATTAC ACTCTCGTTC AGGGGAACAA CCTAAGGGGT TTACAGAATC      6120
     CTTCAAAGCG CCGGAGCTTG GAGTAGGAAA CCTAGGCGCA TCAGAAAAGA GCGATGTTTT      6180
     TCTCGTAGTG TCAACCCTTC TACATTGTAT CGAAGGTTTT GAGAAAAATC CGGAGATAAA      6240
     GCCTAATCAA GGACTGAGAT TCATTACCTC AGAACCAGCG CACGTAATGG ATGAGAATGG      6300
     TTATCCAATC CATCGACCTG GTATAGCTGG AGTCGAGACA GCCTATACAC GCTTCATCAC      6360
     AGACATCCTT GGCGTTTCCG CTGACTCAAG ACCTGATTCC AACGAAGCCA GACTCCACGA      6420
     GTTCTTGAGC GACGGAACTA TCGACGAGGA GTCGGCCAAG CAGATCCTAA AAGATACCCT      6480
     AACCGGAGAA ATGAGCCCAT TATCTACTGA TGTAAGGCGG ATAACACCCA AGAAGCTTCG      6540
     GGAGCTATCT GATTTGCTTA GGACGCATTT GAGCAGTGCA GCAACTAAGC AATTGGATAT      6600
     GGGGGGGGTT TTGTCGGATC TTGATACCAT GTTGGTGGCA CTCGACAAGG CCGAACGCGA      6660
     GGGGGGAGTA GACAAGGATC AGTTGAAGAG TTTTAACAGT TTGATTCTGA AGACTTACAG      6720
     AGTGATTGAA GACTATGTCA AAGGCAGAGA AGGGGATACC AAGAATTCCA GTACGGAAGT      6780
     ATCCCCCTAT CATCGCAGTA ACTTTATGCT ATCGATCGTC GAACCTTCAC TGCAGAGGAT      6840
     CCAGAAGCAT CTGGACCAGA CACACTCTTT TTCTGATATC GGTTCACTAG TGCGCGCACA      6900
     TAAGCACCTG GAAACGCTTT TAGAGGTCTT AGTCACCTTG TCACAGCAAG GGCAGCCCGT      6960
     GTCCTCTGAA ACCTACGGCT TCCTGAATCG ATTAACTGAG GCTAAGATCA CCTTGTCGCA      7020
     GCAATTGAAT ACTCTCCAGC AGCAGCAGGA GAGTGCGAAA GCGCAATTAT CTATTCTGAT      7080
     TAATCGTTCA GGTTCTTGGG CCGATGTTGC TCGTCAGTCC CTGCAGCGTT TTGACAGTAC      7140
     CCGGCCTGTA GTGAAATTCG GCACTGAGCA GTATACCGCA ATTCACCGTC AGATGATGGC      7200
     GGCCCATGCA GCTATTACGC TACAGGAGGT ATCGGAGTTT ACTGATGATA TGCGAAACTT      7260
     TACAGTGGAC TCTATTCCAC TACTGATTCA ACTTGGACGA AGCAGTTTAA TGGATGAGCA      7320
     TTTGGTTGAA CAGAGAGAAA AGTTGCGAGA GCTGACGACC ATCGCCGAGC GACTGAACCG      7380
     GTTGGAGCGG GAATGGATGT GACAAGTGCC CCCTAAGCCT TGAGTTGATA TATCCGAGAA      7440
     TAGGTTAAGA TTTGGCAATT GCTTAACAAT AATTATTTTC TTATTAAAAA TACCTAACAC      7500
     AAAAAATACG TTATATATAC AAATGAAAAT TTCCAGTATT AATCTCAACA AGTTTCTCTA      7560
     CCGGAGAATA TTAATCTGGA ATGTGTAATA GAGAAAATTT TTGATGCTAT CAAATTTTCC      7620
     TTTTTCGCAG AAATATCCAA TGTATAGGTA TGATAGGAGT TATTGGGAAT TTTTGTTCGA      7680
     GTGCTGCCCG TCTGTTCCGG GTTCACCCAT CAACGATTGA ACGTCTTATT GCAATGTACC      7740
     GTTTATCTGG AATATAAAAT TCATACCTCT GTTAATTCCC TGAATAAGGA TAAATAAATG      7800
     ATCGGACCAA TATCACAAAT AAATATCTCC GGTGGCTTAT CAGAAAAAGA GACCAGTTCT      7860
     TTAATCAGTA ATGAAGAGCT TAAAAATATC ATAACACAGT TGGAAACTGA TATATCGGAT      7920
     GGATCCTGGT TCCATAAAAA TTATTCACGT ATGGATGTAG AAGTCATGCC CGCATTGGTA      7980
     ATCCAGGCGA ACAATAAATA TCCGGAAATG AATCTTAATC TTGTTACATC TCCATTGGAC      8040
     CTTTCAATAG AAATAAAAAA CGTCATAGAA AATGGAGTTA GATCTTCCCG CTTCATAATT      8100
     AACATGGGGG AAGGTGGAAT ACATTTCAGT GTAATTGATT ACAAACATAT AAATGGGAAA      8160
     ACATCTCTGA TATTGTTTGA ACCAGCAAAC TTTAACAGTA TGGGGCCAGC GATGCTGGCA      8220
     ATAAGGACAA AAACGGCTAT TGAACGTTAT CAATTACCTG ATTGCCATTT CTCCATGGTG      8280
     GAAATGGATA TTCAGCGAAG CTCATCTGAA TGTGGTATTT TTAGTTTTGC ACTGGCAAAA      8340
     AAACTTTACA TCGAGAGAGA TAGCCTGTTG AAAATACATG AAGATAATAT AAAAGGTATA      8400
     TTAAGTGATG GTAAAAATCC TTTACCCCAC GATAAGTTGG ACCCGTATCT CCCGGTAACT      8460
     TTTTACAAAC ATACTCAAGG TAAAAAACGT CTTAATGAAT ATTTAAATAC TAACCCGCAG      8520
     GGAGTTGGTA CTGTTGTTAA CAAAAAAAAT GAAACCATCG TTAATAGATT TGATAACAAT      8580
     AAATCCATTG TAGATGGAAA GGAATTATCA GTTTCGGTAC ATAAAAAGAG AATAGCTGAA      8640
     TATAAAACAC TTCTCAAAGT ATAATGTATT TTGGAAATCT TGCTCCAGTA TGGGAATACG      8700
     GTTCAGTTCT TTCTGGCTCA TGGTCACCAA CATAGACGCT TCGGATTGCC TGCCTGTGAA      8760
     GAAACAGATT AACTGGGGTT CTACGCCGGA ATCCCAGATT TTTCCGTCAC CCCAGTTTCA      8820
     GCGCTGCTAG AGTACGGGTG GTATGAGCCG CTAGCAGAAG CTCTAAATAG TAACTTCTTC      8880
     CAATGGCCGA AAAAGAAAGC GTTAAAAAAT CACAGTACGG GCATTTCTCG GGTTTACGTT      8940
     ATTTGTGCAG AACGCACAAA TCAGGTTATT AGATATTATT GCTTATGAAC GGGTAGTATT      9000
     CAGCGAAATA CAGCTCCTAA ATAACTGCGC CAAATAGTAG ATCACTGAGG GAACTCAATC      9060
     CGGTTTAAGC GATCTGATCA ATCGCTGAAT ATCCCAAATC ACCACAACCG GACTGAGTTA      9120
     TGCCGATCAT AGCACCGATA CCCAGAAATA AACGACATCA GATGGAAAAA ATTGTCCATA      9180
     AAACAGCAGA CAAAAACCAT TCCAGACATC TCATCGCTGA TCCCTCCCCA ATATCCGTAC      9240
     CAGGCTAAAT CAGAGATCCG GACCTTTTTG ATGACTTCGG GCAAATTCTG CCGGAGTCAG      9300
     GTTATTTAAC GAAGAATGCG GACGAAAATG ATTATATTCT TGCCGCCATT GTTCAATTTT      9360
     CTCCTGAGCA TCTTCCAGAG AAAGGAACCC GTGCACGTTC AGACATTCAT CCCTCAGACT      9420
     GCCATTAAAT GACTCGATAA AGGCATTATC TGTAGGCTTT CCGGGGCGTG AACAGTCCAT      9480
     CGTGACCCTG TTTTCATACG CCCATCGGTC CATCGACTTC GAGATGAATT CGCTGCCGTT      9540
     ATCTGTCTGC AGCCTTTGTG GAATACGCCC CAGCGAATGT TTTAATCTGT CCATGACAGC      9600
     CACAACATCA TCTCCACGTA ACCCCTGACC GACCTCGAGC GCCAGACATT CACGACTAAA      9660
     ATTATCCACT ATAGTTAGCG CCCTGACCCG ATGCCCGTTG AACAGATTAT CAGCAACGAA      9720
     ATCCATGCTC CAGCACTGAT CTAACGCGGT CACTTCTGGA CGTGCGTGCC TGTGCCTCGT      9780
     TGTCACATGC CGCCGTGGAC GTTTCGAACG TAGATTGAGA CCCTCAAGAT AATCGCACGG      9840
     AAAACTGCAT CCGTCCGGTG GCCGTAGGCC GCAAGAACTG GTTGTTCGCA GGGTCATTGC      9900
     GTGCCGGGCA ACGGATGGCG TCCATCCTGA GTCTGCTGGA AACCGCCAAA CTCAACGGCC      9960
     ACGACCCTTA TGTCTGGCTG CGCGATGTAC TGACCCGCTT GCCGACCTGG CCCAACAGCC     10020
     AGCTCAACGC GCTGCTACCT TACGCCGAAA ACCGCTTCAG CTAATTACCC CGCCAGCTTA     10080
     TTGCATTATT TTAATCGAGC AACGCGAGTT CACCGTTCGG TTACAGTATT ACCATCTGTT     10140
     CCCGCTTAAT TTTTTAAAAA ATTTAAGGTA ACAATGAGTA TATATCTTAT GGGAAAAGCC     10200
     AAAAAACTAA CGAACACTAT AATAATTCGA TTAACATTAA TGAAAATACA CGGCTCACCT     10260
     ATTATTAAAA TAATACGACT AGCATTATAA GAAAAAATAT TTTTTATGTT TATAGTATAG     10320
     GCGTGTATTT AATTAAGGAG GGAAGCATGA ACTTATCATT AAGCGATCTT CATCGTCAGG     10380
     TATCTCGATT GGTGCAGCAA GAGAGCGGTG ATTGTACCGG GAAATTAAGA GGTAACGTTG     10440
     CTGCCAATAA AGAAACTACC TTTCAAGGTT TGACCATAGC CAGTGGAGCC AGAGAGTCAG     10500
     AAAAAGTATT TGCTCAAACT GTACTAAGCC ACGTAGCAAA TGTTTTTCTA ACTCAAGAAG     10560
     ATACCGCTAA GCTATTGCAA AGTACGGTAA AGCATAATTT GAATAATTAT GACTTAAGAA     10620
     GTGTCGGCAA TGGTAATAGT GTACTTGTCA GTTTACGTAG TGACCAAATG ACACTACAAG     10680
     ACGCCAAAGT GCTGTTGGAG GCCGCATTGC GACAAGAGTC GGGAGCGAGG GGGCATGTAT     10740
     CATCTCATTC ACATTCAGCC CTTCACGCAC CGGGGTTCCC GGTGCGTGAA GGACTGCGTT     10800
     CACATCTAGA CCCCAGAACT CCACCGTTGC CACCGCGTGA ACGACCACAC ACTTCTGGCC     10860
     ATCACGGGGC TGGCGAAGCC AGAGCCACCG CACCAAGCAC TGTTTCTCCT TATGGCCCAG     10920
     AAGCGCGCGC AGAACTCAGC AGCCGCCTCA CCACATTGCG CAATACGCTG GCGCCAGCAA     10980
     CGAATGATCC GCGTTACTTA CAAGCCTGCG GCGGTGAAAA GCTAAACCGA TTTAGAGATA     11040
     TTCAATGCTG TCGGCAAACC GCAGTACGCG CCGATCTTAA TGCCAATTAC ATCCAGGTCG     11100
     GTAACACTCG TACCATAGCG TGCCAGTATC CGCTACAATC TCAACTTGAA AGCCATTTCC     11160
     GTATGCTGGC AGAAAACCGA ACGCCAGTGT TGGCTGTTTT AGCGTCCAGT TCTGAGATAG     11220
     CCAATCAAAG ATTCGGTATG CCAGATTATT TCCGCCAGAG TGGTACCTAT GGCAGTATCA     11280
     CTGTAGAGTC TAAAATGACT CAGCAAGTTG GTCTCGGTGA CGGGATTATG GCAGATATGT     11340
     ATACTTTAAC GATTCGTGAA GCGGGTCAAA AAACAATCTC TGTTCCTGTG GTTCATGTTG     11400
     GCAATTGGCC CGATCAGACC GCAGTCAGCT CTGAAGTTAC CAAGGCACTC GCTTCACTGG     11460
     TAGATCAAAC AGCAGAAACA AAACGCAATA TGTATGAAAG CAAAGGAAGT TCAGCGGTAG     11520
     GAGATGACTC CAAATTACGG CCGGTAATAC ATTGCCGTGC GGGTGTTGGC CGTACTGCGC     11580
     AACTGATTGG CGCAATGTGC ATGAATGATA GTCGTAATAG TCAGTTAAGC GTAGAAGATA     11640
     TGGTCAGCCA AATGCGAGTA CAAAGAAATG GTATTATGGT ACAAAAAGAT GAGCAACTTG     11700
     ATGTTCTGAT TAAGTTGGCT GAAGGACAAG GGCGACCATT ATTAAATAGC TAATGTAAAT     11760
     ATTTATTCCT ATGAGTAAAT AAAATTACTA AGAGATATAC ACCACTTTGC CAATCAAAGA     11820
     AACTTTAAAC CTCAACTAAA GTAAGCAATT AGTTGAGGTT TATCTGCTGT AGAATAATTT     11880
     TTAACAAAAA TATAAACAAC AAAATTAAAA GTTATGTGTC TACTTTATGT AACCAAACGA     11940
     GCCTGTCCAT AATTCTGTGT AATCGCCACT GTATTAAAGG TGATCGTTTA GACGGTCACC     12000
     GAACTCGATA ATAAAACGAC TCATTGCCAA CCGCCAGTTT TGTATTGGCA TGCTCCATTT     12060
     TTTCGAAGCA TCCCGGATAG CCAGATAAAT AACCTTCCGC ACCGAGTCGT CCGTCGGGAA     12120
     TACTTTGCAT TTCTTTATCG CCTGCCGGAT CACACTGTTC AGTGACTCAA TGGCATTCGT     12180
     GGTGTAGATG GCCTTGCGGA TATCGGGCGG ATAGCCGAAG AAGGTATTGA GATTTTCCCA     12240
     GTGTGTATGT AGTCCCTCCT ATTTTTAGTA CCACCGCCAG TGAGGATCTC CATCCAGTTT     12300
     TTGTCTTGCA TAGATAACGG GTGGCATATT ACCCAGTGAG CTATGCGGGC GTTCTTCGTT     12360
     ATATTCCGTT CGCCAGTCTT CTGTAAGCGT ACGGACTTCG GTGTCAACGA CGGATGAAAA     12420
     GTGATCCACT TATATCTCCA CCAACGGCCC AATATTGATC CACCGTTTTA CTCAGGATTA     12480
     GCTTCTGCTA TAACCCCGGC CTTTCGTTTC TGTCTGAGTC GATAGCTTTC TCCTTTGATT     12540
     TGAACGACAT GTGAGTGGTG TAAGATACGG TCCAGCATCG CTGAGGTCAG TGCTGCATCA     12600
     CCGGCGAACG TTTGATCCCA CTGCCCGAAC GGCAGATTGG ATGTCAGGAT CATTGCGCTC     12660
     TTTTCGTAAC GTTTAGCGAT GACCTGGAAG AACAGCTTTG CTTCTTCCTG ACTGAACGGC     12720
     AGATAGCCTA TTTCATCAAT GATGAGCAGG CGGGGGGCCA TTACTCCACG CTGAAGCGTC     12780
     GTTTTATAAC GGCCCTGACG TTGTGCCGTA GATAACTGAA GTAACAGATC TGCTGCTGTT     12840
     GTGAAGCGAA CTTTGATACC TGCACGGACT GCTTCATAGC CCATCGCTAT TGCCAGATGG     12900
     GTTTTCCCCA CACCTGATGG CCCCAGTAAT ACGATATTTT CATTACGTTC TATGAAGCTG     12960
     AGTGAGCGTA ACGACTGGAG TTGCTTCTGC GGTGCTCCGG TGGCGAATGT GAAGTCATAC     13020
     TCTTCGAACG TTTTCACCGC CGGGAAGGCT GCCATTCGGG TATACATCGC CTGTTTACGT     13080
     TGATGACGTG CCAGTTTTTC TTCATGAAGC AGATGCTCCA GGAAGTCCAT ATAACTCCAT     13140
     TCCTGGTCTA CTGCCTGTTG TGACAGCGCA GGCGCTGCGC TTATAAGGCT TTCCAGTTGC     13200
     AACTGCCCGG CGAGCGCCAT CAGTCGTTGA TGTTGCAGTT CCATCATCAC GCCACTCCTC     13260
     TGCAGAATGA GTCGTAGATG GAGAGTGGAT GATGCAGGGG GTGTTTGTCG AAGTTCACCA     13320
     GATTTTCATC AAGATGCACG TCATACTCTT TTTTCTCCGG AGGCAGTGCC AGCATGGACT     13380
     GCTGCTCTTC GAGCCAGCGA TCGCAGGGAC GGGCCTGGAT TGTTTCATGC TTTCGTTGGT     13440
     TAGCGACATC GTGCAGCCAG CGCAGACCGT GGCGGTTGGC TGTTTCAACA TCGACAGTGA     13500
     TCCCCATCGG GCGCAGGCGA GTCATTAGTG GGATGTAAAA ACTGTTACGG GTGTACTGCA     13560
     CCATCCGTTC CACCTTACCT TTAGTCTGTG CCCTGAAGGG GCGACACAGT CGGGGAGAGA     13620
     AGCCCATCTC CTTGCCGAAC TGCCACAGCG AAGGATGGAA CCGGTGCTGA CCGGTCTGAT     13680
     ATGCGTCACG TTGCAGAACC ACAGTTTTCA TATTGTCATA CAACACTTCG CGCGGCACAC     13740
     CACCAAAGAA GCGGAACGCA TTACGATGGC AGGTCTCCAG CGTGTCATAA CGCATATTGT     13800
     CAGTGAATTC GATGTACAGC ATTCGGCTGT ATCCGAGAAC AGCAACGAAC ACGTGAAGCG     13860
     GTGAGCGACC ATTACGCATA GTGCCCCAGT CAACCTGCAT CTGTCGTCCG GGTTCAGTTT     13920
     CGAACCGAAC GGCAGGCTCC TGCTCCTGAG GAACCGAGAG AGAACGAATG AATGCCCTGA     13980
     GAATGGTCAT TCCGCCACGA TATCCCTGGT CTCTGATCTC GCGAGCGATT ACCGTTGCCG     14040
     GGATTTTGTA AGGATGAGCA TCGGCGATGC GTTGACGAAT ATAATCCCGG TATTCATCCA     14100
     GGAGTGAAGC AACAGCAGGT CGCGGCGTAT ATTTTGGCGG CTCAGATTTT GCCTGCAAAT     14160
     AACGTTTAAC GGTATTGCGG GAGATCCCCA GTTCTCTGGC AATCGCCCGG CTACTCATTC     14220
     CCTGCTTGTG CAGGATTTTA ATTTCCATAA CTGTCTCAAA AGTGACCATA AACTCTCCTG     14280
     AATCAGGAGA GCAGATTACC CCCTGGATCT GATTTCAGGC GTTGGGTGTG GATCACTATT     14340
     GCACCGTTCG TTACACTTCG GACAGTGAAC GGAACAAATA CATATCAAGT ATCACTCCGT     14400
     GATGTTCTGC CCATTCAACC AGTGCTGCAG CAATAAATTC TGGACCGTTA TCACTCCGTA     14460
     TAAAAGCAGG ATAGCCTCTT TCTGTACTTA ATCGCTCCAA AATACGGACC ACTCGGTGTA     14520
     CCGGTATATT CAAGTCAATT TCAATTGCCA GTGCTTCCCG GTTAAAATCT CCACTACATT     14580
     GAATAATCTG AACCTCCGAC CGTCTGTCAG GGCATCACTC ATAAAATCGA CTGACCAGCA     14640
     GTGGTTCATT TTAAGTGGAA TAGCCAAAGG TTGTGGATGC CGATTGGGCA GGCGCTTTTT     14700
     ACCTTTTCGC CGAAAGTTAA GCTTCAGTAA GCGATAAACG CGATATACCC GTTTTACATT     14760
     CCACGGTAAT CCAGACTGCC GTAACTTATT GAACATAAGA CCAAAGCCAT ATGCCGGATA     14820
     TTGATGTGCC AATTTTTGTA ATACCTCAAC AACCGGTATA TCCCTCGCGG TGTTAGGACA     14880
     ATAATGCAGC AAACTTCGAC TGATACCCAT AATCCGGCAC CCGCGCCGTT CACTGGCCTG     14940
     ATATTCCGTC ATCACGTAAC GCACCAGTTC GCGCTTTTCA GGTACCGTTA AAGTTTTTTT     15000
     GCCACGACAT CCTTAAGAAT TTCATGATCT AAACTCAGAG AGGCATACAT CTGCTTTAAT     15060
     CGTCGGTTTT CCTCTTCCCG CTCTTTCATT CGCTTTATAT CAGAGGACTC CATGCCACCA     15120
     TATTTGGATT TCCAGTTGTA GTAACTGGCT TCAGATCCGC CGTTCTCGCG ACAGACATCC     15180
     TTCACATGCC GGCCACCTTC AACTTCTTTT AGAACCCGCA GGATCTGAGT TTCAGTAAAA     15240
     CGTGCTTTCT TCATAATGAC CTCCGCTGAT TATATATTAA CCAGAGAACT CCATTAAACG     15300
     ATAAGACTAA ATTCAGGGGG GACTACAAGA TAACGGGGAG TGGACAATAC GTTAATAATG     15360
     CGTTATTCAT TTCAATACGC AAATGTAATT TAAACTAATT ATCATTTAGA TAAATACGTT     15420
     TTTAATTCCA ATGCCCCGCC GGCATGGCGT AAAAATATAA AGTATCCATC CCCCCAAACC     15480
     CTATTTATTA GCAATAAGGT CAGCTAGCCC ACTGGTAATG CAGGAATACC AGAGATAGCA     15540
     ACGAATATTG ACTGGGATGA CATCAAAATA ACCATAACCC GGCAGTCGCT ACAATGTGAT     15600
     CTTTCATCCT AATTCTCTCA ATTTATATGA GGAGCAGACT CTACTGATAA ATACCCCCAC     15660
     TTCAGGGGAT CACCGAAGGA GGCGTATTAT TATTCTAAAT TGGCTCAGGG GAAAGAATTG     15720
     ATACATGACT CCTTGAAAAA TGGTTACGTA AATCAACCTG GGGGATATTA TTGCCTCAAT     15780
     ATACAGTAGA TATATATTAT CTCAGCCGTC AGCCGCCGTA TCCTGGCGCA TGGCGGCTTC     15840
     TAGCAATAAT TTAGCATCGC TAAGCGAGAG TTGTTCAGTA CGCAAGCCGG TCACTATCAC     15900
     TTCCCCTGCC TTGCCCTGCT TTAGTTCCAA ATTAGAAACG CGTGGTAATA AGCAGGCAAT     15960
     ATCGTGACGA CTGAGAGCCG TATTTTTCAC ATGTTCCAGC ACCTCATTGG CAAAGGCTTT     16020
     TTCGGCGGTA GATATCTGAT GACTATTCTC TGTGAGTGGG TTAGTTTCAG TGAGACGACC     16080
     GGCCTGCCCC CCGTGTCCCA CTTGGGTAAT TTGTTGATTT ATTAACGATT GAAGAGTATT     16140
     GATTTTCATC GAGTCTCCTG TCGCTATAAT TGTCTCTACG ATATTCTAAG TTATTTATTT     16200
     TTGCTAAACT ACTGTCGTAG ACGATTTATT TTTTTAATCG GCTTTTAAAC AGAAAATCAC     16260
     AATAAAAAAT TATTTTTGGG AATCATTCTC ATAAAACGAG GATGAAAAAT CCAATTTAGG     16320
     TAGATAACTC AATCTTATAA TAGATAACAC TAAATATATA TCGATAGTTA TTCCTATTCT     16380
     GTAACTTTCA TTTGTCCTAA AGTGGTAGAT ATTGCCCGAG AAAGTGCTTC AATTTGCCCA     16440
     TCAATACTCG CGTCAATAAT ACCTACCTCA GTCTCTAATA TACAGCCCCC TTGATCCAAA     16500
     CGCGCATCGG CAGTCACCTC TAAATAGCTT ATTTCCGGGA AGTCTTTATG TACTTTAGCT     16560
     ATTTGTTCAC GAATAGCTCC TGCCTGATCA GGGTTGACCC TGACCACGAC TTGCTTCTGA     16620
     TTACTCACCA AGGCTAAAGC CTCCCGCACA ACTTGCAGTG TCATAGCCAC TTGATCATAG     16680
     TCATTGAGGA TTTTACGTAC CGCCAAAAGT ACAACTTCAC TCATCTGTTG TTCGACGTGG     16740
     CGATAAAATT GCTGACATTG TAACTGTGTT TCATGAATCA AAGTCGCCTG TAAGGTACGC     16800
     GCCTCATCCA TGCCAGCCTG CCATCCTAAC TGCTTTTGTT GCTCATAAAC CTCTTGGGCG     16860
     TCAGCCAGGA TCTTTTCAGC ATCCTGTTTT GCGGCACTAA TCAACTCTTC GGTTGTTAAA     16920
     CTGGATTGGT AATCTTCGGC GCGCAAAATA CGCAGACCGC AAGCGAGCGA GAGATTACTT     16980
     GGTATTATTT GAACAAATGG CTGCATGTAG GCGTAACCTG TTTGACAAGT TTGTGACATA     17040
     AAGTTTGGGC CAGTGGGCGT TGTGACTCGG CCACTAACCA AGGTTCTGAC GGCGTAGCTA     17100
     ATGGGAGGCG TAAACTGAGC CGTTTACACC ATGCCTGAGG TTGGGGTTCC ATTGCTGCTA     17160
     ACCAAAAAGC CAGCCCCGAC TGGATCATGG TACGGCTCTC TATTTCTGTC GGCAGCGGGC     17220
     GCTGCCAGTG AGTGGGCCAA GGCCCGATTA GCAGCTCATG CTGTACAATA ATTTGCCTTA     17280
     ATGTTTCTTG ATTAACCAAT GTCAATAATT GTTGTAATGG GGAGGCCAGT ACACAACGGC     17340
     GAATCGCCTC CCCATGCAGA ACTAATCCAA GGCGACAAAG TAACAGTTCG AGCTGTGATT     17400
     GAGGCTGCAA AGGCAGCGCC CCCAGCCCAT GGGGCTCTTC ATAGTCGGTA TCAAGAGAAA     17460
     ATTCATCCAA TAAAGCAGCA TTGAGATGAG CACTATCGCG CCACTGAGGT AAGTAGGGCA     17520
     ATATTGAACG CCATAATGAT GGTAACTGTT CCAAGTGCAA ATAAGCCGCG GGGCAGAAGC     17580
     GCAATTGAAA AGAGGTAATA TAATTTTCCA TCATCACTTC TTGCGTTGTA ACCAAAAATA     17640
     TTGAGCAAGA TTGGTCACTG GCAAAAGCAA AATAAGCAAC GACAACAAGC CAATAAGATG     17700
     CCCTTTTGAC TCTTCACTCA CTTGAATTGA CAGTATGCTC GTGTTACGAG GTAAATGAGA     17760
     GCTTTGACGA ACATCTACCG ATGGCACCAA AATGACACTG ATGCGATCAT AGGCCAGCCC     17820
     CTCAATACTA TTATTCACTA ATTGTTTAAT CTGAGGTATG TAGGTATCAA ACTGAATATC     17880
     TGCTGCATGC TTGATAAAAA CCGAAGCGGA TGCTGCTACA CCCTTCTTAC CTTTGTTATT     17940
     TTGCTCTTCA GGCAATACGA CATGCACTCG AGCCACTAAT ACCCCGTCAA TTTCAGATAA     18000
     AGTGCGGGAG ATCTCTTGCG CCTTGGCATA ATTAAGCCTC GCCAACTCTT CTATCGGTGA     18060
     AGATATCAAC CCATCTTTGG GGAACACATC CTGTAACGTG GAGAAACTCT CGTGTGGATA     18120
     GCCCTTCCGT TTGAGAATAT CAATAGCCTG AGCGACATCT GACTCCTCAA CCAAGAGCTT     18180
     AATCTTCCCA TCTTTGTCTG GCTCTTTGTC TGCGGAAAGG CCTTCTTGGC GCAACAGCGC     18240
     AAGCATTTCG TTCCCTTCCT TCTGACTAAT TCCGGTATAA AGATCAACTT TGCAACCAGT     18300
     TAAAAACAAG ATTAATATCA ATGTTGACAG TGAAGTCTTA ACTTTCACTA GTTTTCACCC     18360
     CCCCTTCGAC AAGGTTTCAA CATTTTGGCT CATTCGCCCG GCAGTCTTGG CGATAAGTTC     18420
     TTCTTGGATT GTTATACGGA TAAGTGACCA TTGCATTAGC ATCAGGTCGT TGGGATTATC     18480
     AACTGAAACA GCCAGCTTAG TGTGTAAGTC ACTTTTAACC GTCTTAAAAG ACTTCTGAAT     18540
     ATCACTAACC TCCTTGAGGA GTGAATGGCC CAGTCCCTGC GTATCTTCTG ACATTGCCGC     18600
     ATCAAAGCGC ATTATTTGGT CAGTTGTTGG CTCTGCCGGC CCTAATTCCT CCAGCGTGGT     18660
     TATGATCACC TCATCGGCCT GAGCTATTTC TATGTTCGGC ATTTATGTAT CCATATCAAT     18720
     TTGATGGCTG TTATGAAGTA GGCTATCTAC AATCGAGTTA GACGGTAATA GGATCATTAA     18780
     TTCTTTATTT ATTAACTCTG ATAAATAAGG TAATCCAACC TGGCTCTCAT TGGGTTTTAT     18840
     ACCCTCTAAT ACTTGGAGCA ATATTGCTTC CCACCGCTTA CCAAACGAGT CAAACTGCTG     18900
     CAATACACTA CGCAATTCAG GTAAATCTAT AGCCGGTACA ACAGACCCTT GATGTTGACC     18960
     GAAACGCGCC AGTAACGCCT CACGTACTGG CGTCGCCAAA ACCTCAAGAA CGGCATGGTC     19020
     AGGAGGGTTA CTGGCATAAT ATTGCTGCCA CAGAACTTCC CGTGTCTTTT CAGCGGATTC     19080
     ACTTTTTAGC TTATTCTCCA GTTGTGTTTT CAGCTCAGAT GCTACCGGTT GTAGCGTAGA     19140
     GACTGCCTGA GACGAAGACA TCAACGATGT AATGGAACCT CTATTAAGGG TAACCGTCAT     19200
     GTTTTTAGTT GCTCCCTCAT TCCATTCACA AATGTCTGTA TTCTAGGATC CTGACTCCTT     19260
     GCGAGACGAT TTAAACGTGA CTCTAAGGCG CTCCCCAACC CGAGGCGATA TTCACATAAG     19320
     GCTAACCAAG GTTCCAAATC AGGATAAGCT AATTTATTTC CTTGTTGCAA GGCGCTTGCG     19380
     TAGTCCCCAC GGTTCATCAA AGAGGAAAGG CGAATCAATT GAACCGCCTC TTCTTCACCT     19440
     TTCAAATGTA ACCATTCAGC AATGCAATTC GCTTCTTCGT GGTAGTGGTT GCCGGCTCCA     19500
     ATCAGAGCAA TCTCTGCTAA CAGTACGTTG AGTTTATATT TCATATTATG GGAACTTCTG     19560
     TAGGATGCCT TGCATTAAGT CTTTCATGCT ACGAACTATG GTTGAGTTTA TATTGTAAAT     19620
     TACCGACCAT TTATTAATTG AATGTTGTAA GTCAGCAAGT AGCGCCGGGT TGTCAGGCTT     19680
     ATCTTTCAAT GCTGCTATCG AGTCATTAAC CGCTTTGTTT GCATCGTCTG CTGGCTTCTT     19740
     GAGCGTTTGA GCCACCGCAT CTAAGTCTGC GATATCGGTT CCTTTCGTAA ATCCAGAGAA     19800
     GTTACTCATT TATTTTAGGT CTCCTGCTAC ATAATGAATA ATGGCTATAG CTGACTCAAG     19860
     AGCTTTAGAT TCTCTCTGCC AAACCTGATA CTGCTTGGCA TCACCACCGC GCATCATATC     19920
     TTTTTTGAGC TTAGTTAGTG CCATTTCTAG TTGCATGGTG ATAGAGCGCA CTGTCTCCAC     19980
     GTTATGCAGT TGCTCCTCTA ATTGTGTCAT CGAGGTTTAC CTCCATTGAG TTGGATCACA     20040
     AATTCCCGTT TTCCTTTACT CACAATCACC GCATCGCGTC GAATAGCCAG AATACGAACG     20100
     CCATTGTTAA GTATGGCACC TTCTGGATAG CGTTGATGAT TGTCGAGTAC CACATAAGGC     20160
     ACTTTCCCTA ACGAGATAGC TTGCACCTCG AAATTCAATT CATCATGCTG GGGTTGCCCC     20220
     CCGACATTGA CCAGTTCTAA TTTAGGTCGA TTGCCAAACT CTTGGCGAAA AGTTTGTTGT     20280
     AGTTGATTAA ATGAATTCAA TTTTTCATCA TTGACTTGCC CGCGTAATTC AATCAGCTCA     20340
     CCTTTAACAT TTACAGTGAA ATCTGAATCC AGACCAAATT GTTCAAGTAA TGCATCAAGC     20400
     CGCTTGCGTT GATTACCGGC AATCCGCACT TTACTTTCTA CACCGAGCAG CCCTGGCACT     20460
     TCAGCTTGCA GCAGGCTATC AATTTTTTGC TTTTGTATTT CCTCTGACAC TTCCCCATTC     20520
     AATTGTAGCC ATCCCGCTTG CGGTGCTAAA GAAACCTCAA TTCCATGGTA TCCCAACCGT     20580
     TGCAGGATGA ATTCTGCCCC CTGACGCAGT TCTTCCATGC TGCGCAGTTC AAGCCGGAAT     20640
     GGAATGCCAT GGCTCTCAAG AAAATTTTGC AGTGACAAGC GGGCATGATT ATCCTGGATA     20700
     TAACCAGTTA ATAACCAAGG TTCACCCTCT TTTTTGGGCG ATGTTAAAAC GACATCCTTG     20760
     TAAGCAGCAG TTGCCAGCAA GCGCCGTACT TCTTGCTCAA CAAGTTGTCC ATCCTGGTTA     20820
     TACTCGCGCC ACAATCCGTG CCCTAGCAGC CCCAAAAAAG TCAAAAGCAA CAATAAAGAA     20880
     AGAACTCCAA GCCCAATCCC AAGTCGTGAA CGAGGTAACC TGTCGGTTGG CTCTTTTCTC     20940
     TGCGTGGGAA CCTGTAACGT CTCTGGCAAA GGTTGCCCTA CGGCGACAAA TGTCCACAGT     21000
     AAAAAACCTA CTTCCAGACA AGAGCCCGCG CGAAGAAGAG TCCCCAACGG CACGGGAAGC     21060
     CCTTCTTGTA GTAGAGGTTC TGCAGAATCA GTTAGGCGAA TACCTTCTTC ATCGACCATC     21120
     AGCACTAAAT GCACGGGTGC TATTTCGCTG TCAGAAAGAA CAATATCTGA CTGCAACGGG     21180
     TCTGAACCAA AAACACAGCG CCCATGAGGA AGCTCAACTT CAACACCACG GTGCTTCCCT     21240
     TGATAAAAAC GACAGACCCA ACTCACAATA CGCCACGCTT AGGCGCTGAA ACACACCATG     21300
     ATTCCGCGGG AGTACAAGCA CCTTCAACCA CGCGCCATCC CAAACTTTTG TCCATCTTGC     21360
     ACTGAGTAAG ATAGGATGAT TTATTGTTTT GACTCAGCCA TTTCTGCACT TCTTGCGCTT     21420
     TGTTTAAAGG CTGACACTGG AAGCCACCTA ATAACTTATT CAAGGTAGTG CTTTGATTAG     21480
     ATATTTCATC AACAGCTAAG ATACCAGTAC GTAGATCCCG ACCATTACCT AACGCTAAAT     21540
     GATGCGCAAT ACCTTCGTCA ATAATCCGTG GTTCGATGAT AAACAGCCGT ACCGTACGGC     21600
     GAGTTAACTC ACTTTTACGG CGGAAAAGTG CGCCAAGATA AGGAATATCA CCAAGCAAAG     21660
     GCACCTTACT AAGAGCAACA CTCAATTCGT CACGATAAAT ACCACCAATA ATCAAACTCT     21720
     GGCCATGTCC CACGCGAGCG ACAGTATCAA CGACCGTACG ACTGATAGTG GGGATTCCGT     21780
     CAATCCCTGA ACTATTCGGT TTTTGGTTCC CATCCTCAAT GTGTAGATTG AGACTGATTT     21840
     CTGACTTATC TCCTTGAGTC AGCACCCTTG GTGTCATACG CAGCATAGTG CCGTAGGTGA     21900
     TCCCTTTCAG TTCAGCCACT TCTTTACCTG TCACTTTGAC GTAATAGGTT TCATGGTGAT     21960
     CAATCACCGC TTGGGCATTT TCTTGTGTTA GCAGGGTCGG ACGTGAAACA ACTTGAGCCG     22020
     AACCTTCATT TTCAAGTAAA TTGACTCTTG CTAATAGGTA GTCAAGCCCG CGAGCATCAA     22080
     TCAAACTACC CAATGCACCG TTTGAAGCGA TGTTACTTTG ATCCCCGGTT GTTTTTATTA     22140
     CCACCTGATG ATTGTTGCCA GTACGAATGC CAACTCGCCA GTCCACACCT AATTCAGTAA     22200
     GTTGGTCGGC ATTTATATCG ACAATGGATA ACGCCACTTC AATACGAGCG CTAGGTTTAT     22260
     CAAGCGCATG AATTAACCGT TGATACATTG GCATACGCTC AGGAGAATCG CGCACTATTA     22320
     TCGCATTGAG CGATGGATCC GCTTCAACCT TGGCTTGAGC TGAAGCCCGG GTAGCGGCCT     22380
     GCGGTATTCT CTGATTATCC ACTGTCACTT GTTGGATTGT GGCATCGCTT AACACGCGTT     22440
     GAAGTATCGT TGCAACCCCA GGAGCAGCCA CTTCGTCATC ACGGTAATGA ATAGTTCGAT     22500
     CGCTCGCTGA TGCATATTTG AGAGGGAAAA TCTCAATCGC TAATGCCCCT GTTTTTTCAC     22560
     TGCGAATTTG CGTCTGTTGT TCCAATGCGG CTGCGGTCTG TTCAACCAAT TCAAGATAAC     22620
     GAGGAGGACC AGAGACGTAA ACAAGGCGGT TGCTAGCATC AGGGCGCCAG CCAAAACGAG     22680
     GCTCCCATAT ACCAGAACGT TGTAATGCCA GCTTTAACTC TGCGGCCTCA CTTTCCTGTA     22740
     AACGAATGAG ACGAGACGCT ACCTCACTAT TTTTAAAAAT GTAGAGCACA TTGCCATCAT     22800
     AGTACCAAAC CAAATTGTAA AGGGAGGCAA TATGCTGTAG GAAATCCTGA GGGTTATCAT     22860
     GCTCAAACTG GCCGGAAACT TTGTCATTAA TCTTATCGCT TACTACCACT GTAGCATCAT     22920
     AATTAGCGCT GAAATCAATT AATAAATCGC GTAAACTTTC CCCCTTCGCC ACATAAACAT     22980
     AAGGTATAGG CAACCAATCA AGTTCTTGCG CCCAGCTATA GTTAGAAAGT AACAGTAACG     23040
     TCCCGGTGAG TACGCGCTTG AAAAAAGAAT GTAGCGGAAA AGCCATATTA CTTAATTCCA     23100
     CCCCACGCGA GACGCTACAG AAAATGGTGT TAACTGAGGA ATTAAATGTT CTAGCAGAGC     23160
     CAGTTGTTTA TTTATTACTT CTTGCAATCC GTGAGTATCA AGCTCTTGTA GACGTAAACG     23220
     CGCCTCCAGT ACCAATTGAC CACAATCATC CAATACTAAA GTTTGAGGGT AACGTTTAGC     23280
     CCATGCCAAC GCTTGTTGCA TTAGGGAGCG AAGCAATGTG ACGTTAACGT TATTTCCTTC     23340
     ACGTAACATT GGTGCGTCAA TAGGAGTGCG TAATACCAGT TCTGAACCAT GCGGAGCCAG     23400
     CATGACAAGA TGCTTATCTA TAGTTAAACG GTAAACACCT TGTTTATCGG CAACAAACGG     23460
     TTTTCTTCCT AAACTGGCTG CCAAGTTTTT TAGTAAATTT TGCATTATTT CTCGGATGGT     23520
     TATATATAAA CTAAGTAATC CTGCGCCAAA TAAATAACCT ACTTCATGTC ATCGTGACAT     23580
     AAGGTTTCGC GGTTCAGCTC AAACTTCCAG ATATTCAAAA AAATGTTCAT GATAATTATC     23640
     AACCACCTGT ATAGCAATAG ATGATATTAC GTTAATCGAA CTAATGAGAC TTGCTCTATT     23700
     TGATGGAGGT CGTTTCTTGC GCCACCGCAC TTAATAAACC AGATAAGCTA TATTGATTAT     23760
     TAAACAACAT ATTATTGCCA TCCAGCGGCG AAACAATACT GTTCTATGTT TCGTTGAAAT     23820
     TTGGCTCATC CCATTGAATC TTCACAATCT AATCCCGTAT TTTACTTTAT AGTCCAAAAG     23880
     TGTCTTTTAA AAAAAACACA GATAATTTTA GCCTGTGGTT GCTATTTTAG TAAGACGGGC     23940
     TTGGCTTGGA GTGCATCCGA AGCGACGTCG ATAACTTTGA GTGAAATAAG ACTGACTCGA     24000
     GAACCCCGCT TCCATGGCAA TATCAACAAT ACTCATCTTA CCATTAAGAA GTAATTGGTG     24060
     AGCATAGAGA ATACGTCGCT CGCTTATCCA GGCGCGTGGT GAAATGCCAT AAACTGTACC     24120
     AAACAGTTCT TTGAATGTGG TTAATCCCAT GCCGAATTCT CGCGCAAATT TGCTTAGCTT     24180
     CCACCCTTGT AGATAATTTT CCTCCATAAA TTTTTGCAAC CGTTCTTCTG GGCGGTTGCC     24240
     TAAATGGCGC AGAGCCGAGA GAAATAAAGT CCCTTGCGAG CTAAAGGCAA GCAAAAGCAG     24300
     TAATTCCTCA ATACGCAGTT GCGTTAATAC TGACGGAAAA TCACTCCGTT CCAATATGGC     24360
     ACATAGATTT TGAATGGATT GTGATAATAT TGGTGAAATA TTAAAAATTA ACAATGGTTT     24420
     GGGTGTGGAG TTGTCTCGTC CAATTTCACT AAGCAAAGAA CCAAAGCGAT GCAAAAAAGT     24480
     ACTCAAAAAA CTGCCGGGTA ATGGAATCCA AAGTAATTGG CAGGGTTCTT TTGTACCACA     24540
     TCGAACAGCA TAGCTGCCAC GACGCAAAAA CAGCATATTC CCCTCATCTA AATCATATGT     24600
     CTGACCGCTG CTCTGCCATG AAATCTGACC TTGCAAAAGA ATATATAGGC CATCTTGTGA     24660
     ATGCTCAACA ACCTTAAATA TAGGTGTGAC CCATTCTAAT TTAATAATCT CTAGTGATGC     24720
     CATAAATGTT ATACTGTCCT AAAAATCTAA AACTTGTATA TATTTATCTA ATGAGGTGTA     24780
     TTGAGTTATT ATGCGTGCGA TGTACAACCA TCGATTAATG CAACCAAAAC CAATATAATA     24840
     AATCACCTAT CTGGTATTAG GTAACTGGCA ATTTGGATAA CATGTTTTAG GTATCATTTG     24900
     TAAAACGACT TTGTTTTTAC CAGTAAGCTT TTGCTGAGCC ACCGCCTGAA CTCCTCGCTC     24960
     TGGAAAAGAG AGGGTTGACC GTAGGTAAAG TTCACCTTCC CCGCGTTGAG CTGGATTCAG     25020
     TTTTATAGAA AAGAATAAAG GTAGGTTACC TGTTTCGAAA TGAGTGCGCT GAACCTCTCG     25080
     AACTTTCCCC TCATACAACC CAAACATACT AACATCAATG TGTGCTATGC GAGATAATGG     25140
     TCGTGACATA CGCACCTCCC CCACAATACG CTGAGCTGGC ATTGGGGGGG TAGCGCACCC     25200
     CACTAATAGA AAAGAAATGA TGAGTGCTAT AATACGACTC ACGCCAGTCC CTCCCTTGAG     25260
     TTCACACAAA GAAGATAGCT AGATGATAGC AATCCGAGTT CGCGCAATAT GTGGTGAAAT     25320
     TTATTATTGT AAAATAACAA CCCATTCCCA ATTATCTCAA CGGGTCCACC ACGAACTCAT     25380
     TTAATTTAGC TACTGCAATA TCACACCTTG CGCATATAAA GCCAAACATC CTTTCTTTCA     25440
     TAAAAAAAGG ATGTTTGGTT AGAATCGGAA TCAGCAAACA AACACATGTA ATAGTAATGA     25500
     CAATACTGTA TTATTTGTAT TCAACAAAAA AAGTCAAGAG ATTAATCCTA ATTAGTGCTA     25560
     GTTATGTTTA ATTGTAAAAT GCACAGGAGA AATACAATTA CCATACTGTA TATATGGTTT     25620
     TAAATCGCAT CATATATTCC TAATATAAGT GAACCTCTTG TTGGTTAACC ATATCGAATA     25680
     AATTACATAT TCCCAATAGC CGGTGTTAAT CACCCCATTT TTCCGATAAA AACATAGACT     25740
     AGAAAGTAGA GAAAATAGTA TAGACCAACA AAAATGTCAT CTGTTTTAAC CATATTCCTA     25800
     GTTACATTGC AGCCTATTAT AACATTTCGG AATGTTGTTT CTCGATATTT TGCCTTTCTA     25860
     GCCATCGTAG CACTTCAGCT GTGGCCTCTA TTTGCTCAGC CGGAATATAG TGATCGACGA     25920
     GCGCATCCCA ATAAAGAGCA CGGGCTAATG GGATACGTTG TAAAATAGGC ACCCCTTCTT     25980
     CTTCTGCTAT TTTGCGCACA GTCTGAACTT GGGCATCGGT ATATTTGAAT GTTACCAACG     26040
     GTAGTGGTGT TTCCCCTCGC TTGTAAAGAA TACCAATAGC AATATGGGTC GGATTAGCTA     26100
     CCACCACTGA TGAGCGTTTA ACATTTTCCC GCATGTTCCT CGATTGGATC TCTTGATGAA     26160
     ACTGACGACG CTTGCTTTTG ATTTCTGGGC TACCCTCCAT TTCTTTGTAC TCGCGTTTGA     26220
     TCTCATCCTT GCTCATTTTA AGTTCCTTAA TATATTGATA GTATTCAAAG GCATAGTCGG     26280
     CTATGGAGAT GACCACAAAG CCAACAGTAC AGATAACCAT CAACTGCCGG AGTATTTGCC     26340
     CCAATAAAGG GGTAATACAT TCAATTCCAC AGGTTGGCAA CTGCAAGAGT GTGACTAGAT     26400
     TTCCCTTAAT GATTATCCAG ATGAGTATAC TGAGCAAAAC AACCTTGAGA ATGGATTTGA     26460
     GAAACTCCAC TAAACTTTTG ATGGAAAAGA TACGCTTGGC ACCCTCTATT GGATTGATTT     26520
     TTTTAATATC CGGTTTAATT GCTTCACCAC TTATAAGAAA ACCATACTGC ACAACATGAG     26580
     ATGCGATCGC CATTAATGCC GCCACTGTTA ACAAAGGAAA ACAGAGATAA AAAAACTCGA     26640
     GCAACACATT GTCAACCACA TAGCTAAGCG CCTGCGAGAA AGGAAGATAG CTCTGCTCTG     26700
     CGGGGATTAG CATCAGCTTA CTAAAATGCT CGAAATAGTA GTCAGAAAGC CCCATTAACA     26760
     TCGCACTCAG CGCGACGATA AGCGCAGTAG AGACCACTTC ATTACTTTTC GCTACCTGTC     26820
     CCTTTTTGCG CGCATCACGG ATTTTCTTCG GGGTGGGTTG CTCTGTCTTT TCTCCGCTCA     26880
     TTACTTCTCC AAAACAGGGA TCAGTAAACT TATAGGATCC ATAACCAACA GCATTGCTTT     26940
     ACTGGCATGA CTCATCATTT GCATACAGTA GATAACCAAC AACAGGCTTG CTATCGCGCT     27000
     TTTTATCGGC ATAGCCAGCA CAAAGACGTT TAAAGAAGGC GCAAAACGAC TGATGAGTGC     27060
     AAGTCCAAAT TCAGCTAAAA ACATAGCGAT GAGTAAAGGA GCAGCCAATA CAGCGGCGAT     27120
     TAATAGTATC TGGCTGAATT GGTTATAAAA GAAATCAACC CACTGTTCAC TAACTGCAGG     27180
     GAAAAAGCTG GCCACCGGCC AATTTACATA GCTGTGAAAG AGGGCTGAAA GCAAAGAGAG     27240
     GAAAGCCCCT CCGCTGAAGA AAATTGTTAT TAACGTTTGA GTCAAAAGTA AACCAGTCGG     27300
     ACTAGTTTGA CTATCAAGTC CAGGATTGAG TAGAGATGCC ATCGCGGCAC CTCTTTGGTT     27360
     ATCTACAATA AATCCTGCGG ATTCTAAGGC CCAGAAAGGA ATGGTGGCCA CAAACCCAAT     27420
     CAATAACCCC AGTATGATCT CTTTGCCGAT AAGCAGCATC AACGTAAACG CATCAACCTC     27480
     AATATAAGGT TGGTTAGCGA CGGCAGGATA GACATAAAGA GCCAATGAAC AGACAATACC     27540
     ATTACGCAGC AATACTCCAC CGAGGAGCTG TTTACTTAAC ACTGGCAATA TAACAAAACA     27600
     AGCCATAAAA CGAGGCAACA GCAGGGTATA AGTGAGCAAT GGTCTTTGGA TTAAATCCGC     27660
     TATCATCTTA TGCCTTGTAT CTTCATCATG GTCATTTCTG CAAAACTGTG CAATTCATTA     27720
     CCAAGCCACG AGGCGGTAGC AAACAGTGTG ACCACCACAG CGATCAATTT GATAACGAAG     27780
     CCCAGAGTTT GCTCTTGGAT TTGCGTTAAA GCTTGTACTA AAGATACCAA AGTTCCTACC     27840
     ACCGCAGCCA CTAACACCGG CGGCATTGAA AGGACTAGCA CCAGCCATAA TGCCTGACTG     27900
     GTGAAGTGAA TTATGTCACC TTGACTCATG TCACCCTCCG TAGCTAATCA CCAGCCCATG     27960
     CGTGAGTCGT GTCCAGCCAT CAAGTAAAAC AAATAGCAGC AATTTAAATG GCAGTGAAAT     28020
     AGTCATGGGG GAAACCATCA TCATCCCCAT TGCCAACAAG ATATTGGAAA TAACCAGGTC     28080
     AATGACGATA AATGGTAAAT AGATGAGAAA GCCTATCTCA AATGCTCGAG TCAACTCACT     28140
     CACCGTAAAC GCAGGCAATA AAATGAACAG GCTGTCTGAC TCTAACCGGT CAGCATACTG     28200
     CTTGGGCCAT AACTGTTTAG TGCTGTCAAC AAAAAAAGAG TATTCTTGCG CTTGAATATG     28260
     CTGCTTAAGG AACATGCGAT AGGGGGCAAG CCCTTCATCA AAGAATTTCT CAACAGATTC     28320
     TATGTTCGTG AGGCTAACCT CATTAGCTTG TAAATAGTCT TGCGTCGCGA AGCCAACGGG     28380
     TGCCATTACA TAAAGACTAA GGATGATTGC TAAGCCATAC ATTGCCATGT TGGGGGGGAT     28440
     TTGCTGTACC CCAAGGGCAT TGCGGAGTAG TGAAAAGACC ACCGCAAATT TGACAAACGA     28500
     TGTAGCCATT ACCGAAATCA ATGGAAGCAG AGTCAGCAAA GATAAAACGA TGATGAGATT     28560
     AATTTCATCC GGTAACTGGA TCATGAAATC GTAACCTCTG TCAGGCGTTC AATTCGAACC     28620
     CCGAGGCGCC CTTGGATCTC GACCAATCGA CCATGTCCAA GCAACCGGCC GTTAGCCAGC     28680
     AAGCGCACTT CACCATCAAC AGGTGTTGTA AGATCAATAA GAGAACCCGG CTCCAGGCTA     28740
     GTGAGTGTGT GCCAATCTAA GATTTGCCGC CCCACTTCAA AGCTAACTTG AACTGGAAGT     28800
     TGGTTCAAAT CGGTCAATGG TTCGGGGTTA AGTTCGTCAG ATTCATGACT CATACCGATA     28860
     AACTCCAATT TATTTGATTG TAATTGAAAG TAGCCCCAAG GGTTCTCACC AACATAGGCG     28920
     AGTACTGGCG AATTAGGCCC ACTCCCCTCA GGGGCCAACA ACACATCACC TAATCGAAGG     28980
     GAATCAACCT CATCTAGAGT CAGGTATACT TTATGCCAAC GCAAAGAAAT AAGGATAGGC     29040
     AAAGGTATGC GCTCAGAATT GGGTCGTGCG GGTAACAGAG CGAACAGAGC CTCAGCTGAG     29100
     GTTAGCCAGA AGGAGATATG CGCATTATCT CGGGACAGCC GCAAACTCAA CAGAGGTTGC     29160
     GTGACAGAAA GAGACGCTGT CGCTATATCA TTACAGACCA GTTTCGGCAG GAAAACTGTC     29220
     TGGCGTTCCA ACAGCGCAAG TTGCAACTCT TTCGGCAGAG TAAAGAATGG AGCCCCTAGT     29280
     AAGTCGGCGG TTAACCAGTT AGCCAGATCA TTGCCAAAAC AGTAGAGCGT GAAGTGCGTT     29340
     CCCTTCCATT GTAACTGTAA TATACAGTTC AAAGACGAAG GAGGCTCAGA GACGGTAAGT     29400
     TCGAGTTTTC CCTCTTCCCA CAAGTAGTTT TGTTGATAAT GGCTGAGCCG TTGACGTAGC     29460
     GACAGTTCAC TTAATTTGGC CTGTGGCAAG GTTAACAAAC TCATTCTTCA GCCTCCCACT     29520
     CCTCATAGAC GTGGCGTTTC TGACGTGACT CCTGTTCACT GTCATCGCTA GCTTGAAAAT     29580
     CAAGTTGTGT TGGCTCAATG CGTTGTAATC GCTCAAGAAG ATCATAACTT CCCTGCGCTA     29640
     AAATTCTTAA AGCTTCCCGA CTGGCGATCA GTTCTACATG CAGTTTTCCC GGAATCTCAG     29700
     CAATACGAAC CATAATAGCC CCCAATTCAG GTAAGTTAAG GTGTAATTGG GTTACTTGGG     29760
     ATGAGCCGCC GCGCAGTTCT AGTTCTACCG CTAGTCGCTG TGCTAACTGT ATAAGTTGCT     29820
     CTGAGACTGA TGCCAGCCTG GTCGCGCGCA TTGTTGCTAA TAGGTGATCA CCCGGCGTGA     29880
     CAACCGGTGC TGTAAAAGAC AAGGAATACA TCTCCGGCAA GGTTTCTTCG CGCGGAAGTA     29940
     ACAGTTTTTC TGGTCGCGGT GGTTCGATGG TATCTTTGCT GCTATCAACG CCATCAGTAA     30000
     GATGTTGGGA CCGATCCGCC AGCTCGGTCA TGTCCAGTTG CTCTGACTGC ACTGTCGCTT     30060
     TGTACGGAAA ACGAGCAGAT TTTTCTGCTA CCTCAGTCAC AGGAGTAGCA CACCATCTTG     30120
     CTACCAAATG ATCATCCGGT GTGGCACTAA CTGCCGGGGG ACATATCTCT GGCAATGCTT     30180
     TTTGATGAAG AGCTAACGGT TCTTCTGCAA GGCATTTTTG CCTGCTATCG CGCTGGTTTT     30240
     TTGCTATACT GGCCGGAGTT TCCCTACCGA CAGACCATAC AATAACCTCT GCGCCGTCAG     30300
     CAGCCGGATT CAATGGCTGA ACAGTCGGCT TGCTATTCAA TTGAACTGGT TGAGCGGAAT     30360
     CGATAGGCGA TTGCTGAACA AATAACTCAT CATGTCCAGA CGGCTCGCAG GGGGATTCAC     30420
     TTGATGTCCC CGTTTCACAA GTCACCCCCT CTAAAAAGGG CGCCAATGGC ATGAGAGCAT     30480
     TAATAATACT CTCTACGCGG TCATCAAAAC GGCTATCCTG CTGGTATAAG TGCGCTCTAT     30540
     TGGTAGCACC TTCGGCAAGC GGAGATAAGT TGAAATCATG ATTATTCTGA TGGTTGTGTT     30600
     GAGGTTTTAA TCCTACCTCT TTCCTTCCGG GTTGAGACGT CGCCGCTAAT GGCGCATGCG     30660
     CACGCAAGCC ATCTCCTTTC TGACCTTCTT TTTTGCCAAG GTCATGCGGA CGTACAGGTT     30720
     TAAGCGACTC TTCTTTGGGA TGACAATTCC CCTTATTATT ATGCAACAGC GCTTGCTCAA     30780
     AATCGACACA TGCTTGCAAA GCATGATGCG GCTTCCCCAG AGGTTGATAC TCAGGTTCTA     30840
     ATGGGGAACG AGTGGTGATT TTATTCATTA GGCGTTCCTG TGATGCTGTA GAAACTCTTC     30900
     TTGTTCTTGT TCTTCCTGAT AATGTTGTTG ATTTAGCTCA TCTTCATCTT CTCGTCGCAC     30960
     TAGCTCGAGA AACTTATTTT CCTTATGACG AGCCTGTTGC AGCATCTTTT GGCATAACGT     31020
     AAGGCGCTCA CGCTCATTGG CTAAACGTTC CAATAATTTG GCGCACTCCA GTTCATAATT     31080
     GGCCTCCTTT TCACGTAGCG ACGCTATTTG TCGCTGCCAT TTCTCCAAAT CTTTACAATT     31140
     CAGTGTGGTG TTTTTTCGCT GATCAAATAG ACGTTGCTCC TCATCAATAC GCCACAAATG     31200
     GTAATCCTGA CTGGTTTGCA CCGCCTCTTG ATGACGTCGA TGAGCTGCCT GCAAGCAAGC     31260
     TTGCTGAGTC TTGATGGCTT TCTCCGCACG TTCAACGCGT AAAACTTTAA CCCGGTGCAG     31320
     GCGGCGTATC ATTGGGTCAG CGTCTCCAAT AAGTTCAGCG TCTCATTGAA ATGGCTTAAC     31380
     TCGTGCGTCC CCTGGCAGAG CCATCCTCGA ATCGCCCCCA TGCGTTCAAT CGCTTGATCG     31440
     GCCTCTTTGT CTTGCCCTTT CTGGTACTCC CCGATTTGCA ACAGCAATTC CACTTCTTCA     31500
     TATTTGGCCA ATAAACGGCG TAAGTCCCCC GCCCAGGTTT TGTGCTCCTT GCTGACAATT     31560
     TGATTCATCA CCCTGCTCGC TGAACGTAAT ACGTCAATGG CAGGATAATG ATTAGCTGCC     31620
     GCTAATTTCC GTGACAGAAT AATATGACCA TCAAGTATCG AACGTGTTTC GTCGGCCACG     31680
     GGTTCGGTCA TATCGTCCCC TTCGACCAGT ACGGTATAGA GAGCCGTAAT TGACCCTTTG     31740
     CTGGACTGAC CAGCCCTTTC CATCAAACGG GGTAAAGCGG CAAATACTGA CGGAGGATAA     31800
     CCGCGGCGAG TCGGTGGTTC TCCCGCAGCT AAGCCTATTT CACGCTGAGC ACGAGCAAAC     31860
     CGTGTTACAG AGTCCATAAG TAACAATACG CGTTTCCCTT GATCGCGAAA ATATTCAGCA     31920
     ATAGATGTCG CCACGAATCC AGCTTTGGCT CTTTCCAGTG AGGGCCGATC CGAGGTGGCC     31980
     ACCACGAGAA CCGCTTTGCG TAACCCCTCT TCGCCTAAAT CAGACTCAAT AAACTCACGC     32040
     ACTTCGCGTC CACGCTCACC AATAAGCGCC AGCACGGTTA CGTCTACTTC AGCACTACGA     32100
     ATAAGCGAAG CAAGCAGTGT ACTTTTCCCC CCCCCGGCGG CCGCGAAGAT GCCCATTCTT     32160
     TGCCCCTCGC CACAGGTAAG CAAACCGTCA ATAACCCGGA TCCCCAAAGA AAGTGGTGTG     32220
     GTAATAAGTT TTCGGCTCAT CGGCGCTGGG GCATCCTGAT AAACTGGGTA CCAAGCCGCC     32280
     GGTTCAGGGA GATGCCCCCC ATCGAAAGGC TGCCCTAAAC CATCCAACAC CTGTCCCAGC     32340
     AGATGTTCAC CCACCCCAAC CTGATGCATT GTCCCTGTCG GGCTAACTTC AGTATTAGAA     32400
     GATATCCCGT ACATTTCACC AAGTGGAATA AGTAATGCTT GATGTTGGGC AAAACCTATG     32460
     ACTTCAGCCT GTAAAGACAG GCTGTTGTCA GGGTTACGTA AGTAACATAA CTCACCGATG     32520
     CGCACACCTG GCACTACCGC TTTTAATAAC GTTCCTGTCA CTTGAGTGAC ACGTCCTCTA     32580
     ATTTGGATTA GGCGGCTACC TACAATGCCA TGACGAATAT GATGAGGTAT CTGATCTAGT     32640
     GAGAGCATAA ATCCATAATG GTTGAAATAT TAACCACTAT TTTAGTGACT AAAAACGCTA     32700
     AAAAATTGTA GCGGGAGCCG CGAGTTTTTA GAAAAATAGC CAAGCAGCAC TAAAATTTCT     32760
     CGGCTGATTT TGGCATCGAT AAGCAAGAAC TATTTTTATA ATCGCGGTAA TTGTAATTAT     32820
     AAACTGTTCA TCTCAGGGAG TAGTTATGAC GACGCTTCAT AACCTATCTT ATGGCAATAC     32880
     CCCGCTGCAT AATGAGCGTC CAGAGATTGC CAGTAGTCAG ATCGTAAATC AGACTCTGGG     32940
     TCAATTTCGG GGAGAATCTG TGCAGATAGT CAGCGGCACT CTGCAGTCTA TAGCTGATAT     33000
     GGCAGAAGAG GTAACATTTG TCTTCTCCGA GCGTAAGGAG CTCTCCCTCG ACAAACGCAA     33060
     ATTAAGTGAC AGCCAGGCTC GAGTTAGCGA CGTTGAGGAG CAGGTTAATC AATACCTTAG     33120
     CAAAGTTCCA GAGTTGGAAC AAAAACAGAA TGTGAGTGAG CTGCTCAGTC TGTTGAGTAA     33180
     CAGCCCCAAT ATAAGCTTGT CCCAGTTAAA GGCTTATCTG GAGGGGAAAT CAGAAGAACC     33240
     GAGTGAGCAA TTCAAAATGC TCTGCGGCTT GCGTGATGCC CTGAAAGGGC GCCCTGAATT     33300
     AGCACATCTT TCGCATTTGG TTGAACAAGC TCTGGTCAGC ATGGCTGAAG AGCAAGGAGA     33360
     AACCATTGTA TTGGGTGCCA GGATAACCCC GGAAGCGTAC AGAGAATCCC AGTCGGGTGT     33420
     TAATCCACTG CAGCCGCTCC GTGATACCTA CCGCGATGCA GTGATGGGTT ATCAAGGAAT     33480
     TTATGCGATC TGGAGTGATT TACAAAAACG TTTTCCTAAT GGGGATATAG ACTCGGTGAT     33540
     ATTATTCCTG CAAAAGGCGC TTAGTGCAGA TCTACAAAGT CAACAAAGCG GGTCTGGACG     33600
     GGAAAAATTA GGAATAGTTA TTAGTGACTT ACAGAAGCTA AAGGAGTTTG GTAGCGTGAG     33660
     TGACCAAGTT AAAGGATTTT GGCAATTTTT TTCAGAGGGT AAAACTAATG GCGTACGACC     33720
     TTTCTGAGTT TATGGGAGAT ATTGTCGCAC TGGTTGACAA GCGCTGGGCG GGGATTCATG     33780
     ACATTGAACA TCTTGCCAAC GCCTTTTCCC TTCCTACGCC TGAAATCAAA GTGCGTTTCT     33840
     ATCAAGATTT AAAAAGAATG TTTCGTCTTT TCCCTCTGGG GGTATTTAGC GATGAGGAGC     33900
     AACGGCAAAA TTTATTGCAA ATGTGTCAAA ATGCGATCGA TATGGCTATT GAGAGTGAAG     33960
     AGGAAGAATT GAGTGAGTTG GATTGAACCC ATCATTTCCC ATTTCTGCCA GGATCTGGGA     34020
     GTGCCAACAT CTAGCCCCCT TTCGCCTCTT ATTCAATTAG AGATGGCTCA ATCTGGCACG     34080
     CTGCAACTGG AACAACATGG TGCGACACTG ACATTGTGGT TAGCGCGTTC TCTTGCCTGG     34140
     CACCGGTGCG AAGATGCTAT GGTCAAAGCG CTAACGCTCA CGGCGGCCCA AAAGAGTGGC     34200
     GCTTTACCGC TGCGAGCGGG GTGGTTAGGG GAAAGTCAGC TGGTGTTATT TGTCTCGCTT     34260
     GATGAGCGTT CCTTAACCTT GCCCCTTTTA CATCAAGCTT TCGAACAGTT ACTGCGATTG     34320
     CAGCAAGAGG TGCTTGCGCC GTGAGTCGCA TAATAACTGC CCCCCATATT GGCATCGAAA     34380
     AACTGTCGGC GATTAGCCTG GAAGAGCTAT CCTGTGGCTT GCCTGAACGT TATGCCTTGC     34440
     CGCCTGATGG GCATCCAGTC GAACCACATT TAGAGCGCCT TTACCCTACA GCACAAAGCA     34500
     AGCGTAGCCT ATGGGACTTT GCTTCTCCCG GCTATACATT TCATGGATTA CATCGAGCTC     34560
     AAGATTATCG GCGCGAACTG GATACCTTGC AGTCACTGCT AACCACCAGT CAGTCCTCAG     34620
     AGCTACAAGC TGCCGCGGCG CTGCTTAAAT GCCAACAAGA TGATGATCGG TTACTGCAAA     34680
     TAATCCTTAA CCTGTTGCAC AAAGTATGAA TATTACTTTA ACCAAACGAC AACAGGAGTT     34740
     CTTGCTGCTC AACGGTTGGT TACAACTACA ATGTGGCCAT GCAGAGCGCG CATGTATTCT     34800
     ATTGGACGCC TTGCTGACGT TAAATCCTGA GCATTTAGCC GGTCGGCGTT GCCGATTAGT     34860
     CGCGCTACTT AATAATAACC AGGGAGAACG TGCCGAAAAA GAAGCGCAAT GGCTAATATC     34920
     ACATGACCCT TTACAGGCTG GGAATTGGCT CTGTTTGAGC CGCGCCCAAC AACTGAACGG     34980
     CGATCTTGAT AAGGCTCGCC ATGCTTATCA ACATTATTTG GAGTTGAAAG ATCATAATGA     35040
     ATCCCCATGA TCTTGAGTGG CTAAATCGTA TTGGCGAGCG TAAAGATATC ATGCTGGCAG     35100
     TGCTGCTGTT AGCTGTGGTA TTCATGATGG TCTTACCACT CCCCCCCCTT GTGTTGGACA     35160
     TTCTGATTGC TGTTAACATG ACCATTTCAG TGGTGTTGTT AATGATAGCG ATCTATATCA     35220
     ACTCTCCTTT ACAATTTTCA GCTTTCCCTG CGGTGCTACT CGTTACCACG TTATTTCGTC     35280
     TCGCACTTTC AGTTAGCACC ACCCGCATGA TCCTGCTACA AGCTGATGCG GGGCAGATTG     35340
     TTTACACCTT TGGTAATTTC GTCGTTGGCG GTAACCTCAT CGTCGGGATT GTCATCTTCC     35400
     TGATCATCAC TATTGTGCAA TTTTTAGTGA TAACGAAAGG CTCAGAACGT GTAGCAGAAG     35460
     TTAGTGCCAG ATTCTCTCTT GATGCGATGC CGGGTAAACA GATGAGTATC GATGGCGATA     35520
     TGCGAGCCGG GGTGATCGAT GTCAATGAAG CGCGTGAGCG ACGCGCGACG ATAGAAAAAG     35580
     AAAGCCAAAT GTTCGGTTCT ATGGACGGCG CCATGAAGTT CGTCAAAGGG GATGCAATAG     35640
     CCGGCCTCAT TATTATCTTT GTCAATATAT TAGGCGGCGT CACCATTGGT GTTACCCAAA     35700
     AAGGATTAGC GGCCGCTGAG GCACTGCAAC TCTATTCCAT CCTCACTGTC GGGGATGGGA     35760
     TGGTTTCTCA GGTACCTGCC CTGCTGATAG CTATTACCGC GGGTATTATC GTCACCCGCG     35820
     TCTCTTCAGA AGATTCATCA GATCTGGGTA GCGATATTGG CAAACAGGTT GTCGCTCAGC     35880
     CTAAAGCCAT GCTAATTGGT GGCGTACTGC TGTTGCTCTT TGGTCTTATC CCCGGCTTCC     35940
     CAACAGTCAC CTTTCTGATT TTGGCGCTAT TGGTAGGCTG TGGTGGTTAT ATGCTCAGCC     36000
     GTAAGCAGAG TCGTAATGAC GAGGCTAATC AAGACCTGCA ATCCATACTG ACGAGCGGTT     36060
     CTGGCGCCCC GGCTGCTCGA ACCAAAGCCA AAACAAGTGG GGCAAACAAG GGCCGACTAG     36120
     GGGAACAAGA AGCATTTGCT ATGACGGTTC CCTTGCTGAT TGATGTAGAT TCAAGCCAAC     36180
     AGGAAGCACT GGAAGCGATA GCACTAAATG ATGAGCTGGT TCGAGTGCGC CGTGCTCTTT     36240
     ATCTTGATCT TGGCGTACCT TTCCCTGGGA TCCATCTGCG TTTTAATGAG GGGATGGGTG     36300
     AAGGCGAATA TATTATTTCC TTGCAAGAAG TTCCAGTGGC GCGAGGTGAG CTTAAGGCAG     36360
     GTTATTTACT CGTGCGTGAA TCCGTCAGCC AACTCGAATT ACTGGGTATA CCCTATGAAA     36420
     AAGGGGAACA TTTGCTACCC GATCAGGAAG CTTTCTGGGT ATCGGTTGAA TATGAGGAGC     36480
     GCCTGGAAAA GTCTCAACTG GAATTTTTCT CTCATTCCCA AGTTCTAACC TGGCATCTTT     36540
     CTCATGTCCT ACGTGAATAT GCCGAAGATT TCATTGGTAT CCAAGAAACC CGCTATCTGC     36600
     TCGAACAGAT GGAAGGAGGC TATGGCGAAT TAATTAAAGA AGTACAAAGA ATCGTTCCCT     36660
     TACAACGAAT GACCGAAATA TTACAACGAT TAGTTGGAGA AGATATTTCT ATCCGTAATA     36720
     TGCGATCTAT TCTTGAAGCT ATGGTGGAAT GGGGACAAAA AGAGAAAGAC GTCGTTCAAC     36780
     TCACAGAATA TATCCGCAGT AGTCTAAAAC GTTATATCTG CTACAAATAC GCTAATGGCA     36840
     ACAATATATT GCCGGCTTAT CTTTTCGATC AAGAAGTAGA AGAAAAAATT CGTAGCGGTG     36900
     TGCGCCAAAC CAGTGCAGGG AGTTATTTGG CATTGGAGCC TGCTGTTACC GAGAGTTTAC     36960
     TTGAACAAGT TCGCAAGACT ATTGGCGATC TATCGCAAAT CCAGAGTAAA CCGGTGCTGA     37020
     TTGTTTCTAT GGATATTCGT CGCTATGTGC GCAAACTGAT TGAGAGCGAA TACTATGGCT     37080
     TGCCGGTACT TTCATACCAA GAGCTGACTC AGCAGATTAA TATCCAACCA CTTGGACGAA     37140
     TTTGCTTATG ATGGCAGATC CTTTAATTCC GTGGCTTACC GAACATGGCT TGGTTTGCCA     37200
     CCCTCATACT TTGTCTGGCA CCCCCATTTC TTTAGGTTCG GCCTTTCAAT TAGCTGGCCT     37260
     CAAGCTTGCC TGGCGCGTAG AAATTGAACA AAGGCGGGTT TGGATCGTGC TTATCCAACG     37320
     AGTGGAACAA CGTCGAGGGC TGAAAAATCC CTTCGCGGCA CTTTATATGT TAGCTAATGC     37380
     AGCGCGGGCC GTTCTTGGCC CTGACTATTA TCTGTATGGC AATGTCGATG TACTGGCGGG     37440
     GAGTTCTCTC AGTACGCAAC GGCTCGCTCA TTTTTATCGG CGTTGGACCG GGGCCAAAGA     37500
     ATTAAGCACC GGGTGGTTCT CACTAAAAGT ATCACAAGTC ATCACCTTAT CTAATATGAA     37560
     AAAGCGACAA AACAACGGCT TTGCCTGACA AGCTAAATAA AAATAACGTA ATAGAATAGG     37620
     AGGTAGATTA TGAAGTCTTC CCATTTTGAT GAATATGACA AAACGCTTAA ACAGGCAGAA     37680
     CTGGCAATAG CCGACAGCGA TCACCGCGCA AAATTATTGC AAGAAATGTG TGCTGATATC     37740
     GGCTTAACGC CTGAAGCCGT AATGAAGATA TTTGCGGGCC GTTCCGCCGA AGAGATAAAG     37800
     CCAGCGGAGC GCGAGTTGCT TGATGAAATT AAGCGTCAGA GGGAGAGGCA GCCTCAACAT     37860
     CCCTACGATG GGAAGAGACC AAGAAAACCA ACGATGATGC GAGGGCAAAT TATTTAATAT     37920
     GATTAGAGCC TACGAACAAA ACCCACAACA TTTTATTGAG GATCTAGAAA AAGTTAGGGT     37980
     GGAACAACTT ACTGGTCATG GTTCTTCAGT TTTAGAAGAA TTGGTTCAGT TAGTCAAAGA     38040
     TAAAAATATA GATATTTCCA TTAAATATGA TCCCAGAAAA GATTCGGAGG TTTTTGCCAA     38100
     TAGAGTAATT ACTGATGATA TCGAATTGCT CAAGAAAATC CTAGCTTATT TTCTACCCGA     38160
     GGATGCCATT CTTAAAGGCG GTCATTATGA CAACCAACTG CAAAATGGCA TCAAGCGAGT     38220
     AAAAGAGTTC CTTGAATCAT CGCCGAATAC ACAATGGGAA TTGCGGGCGT TCATGGCAGT     38280
     AATGCATTTC TCTTTAACCG CCGATCGTAT CGATGATGAT ATTTTGAAAG TGATTGTTGA     38340
     TTCAATGAAT CATCATGGTG ATGCCCGTAG CAAGTTGCGT GAAGAATTAG CTGAGCTTAC     38400
     CGCCGAATTA AAGATTTATT CAGTTATTCA AGCCGAAATT AATAAGCATC TGTCTAGTAG     38460
     TGGCACCATA AATATCCATG ATAAATCCAT TAATCTCATG GATAAAAATT TATATGGTTA     38520
     TACAGATGAA GAGATTTTTA AAGCCAGCGC AGAGTACAAA ATTCTCGAGA AAATGCCTCA     38580
     AACCACCATT CAGGTGGATG GGAGCGAGAA AAAAATAGTC TCGATAAAGG ACTTTCTTGG     38640
     AAGTGAGAAT AAAAGAACCG GGGCGTTGGG TAATCTGAAA AACTCATACT CTTATAATAA     38700
     AGATAATAAT GAATTATCTC ACTTTGCCAC CACCTGCTCG GATAAGTCCA GGCCGCTCAA     38760
     CGACTTGGTT AGCCAAAAAA CAACTCAGCT GTCTGATATT ACATCACGTT TTAATTCAGC     38820
     TATTGAAGCA CTGAACCGTT TCATTCAGAA ATATGATTCA GTGATGCAAC GTCTGCTAGA     38880
     TGACACGAGG TAATTATGCA ACAAGAGACG ACAGACACTC AAGAATACCA GCTGGCAATG     38940
     GAATCCTTCC TAAAAGGAGG GGGAACTATC GCCATGCTCA ACGAAATTTC AAGTGACACT     39000
     TTAGAGCAAC TCTACTCTCT TGCATTTAAC CAATACCAGT CAGGAAAATA CGAGGATGCT     39060
     CACAAGGTCT TTCAAGCTCT CTGTGTGCTA GACCACTATG ATTCACGTTT CTTTTTAGGG     39120
     CTAGGCGCTT GTCGTCAAGC CATGGGGCAA TACGACTTAG CGATTCATAG CTACAGCTAT     39180
     GGCGCCATAA TGGATATAAA AGAACCTCGT TTTCCGTTTC ATGCGGCCGA ATGTTTACTG     39240
     CAAAAGGGAG AGCTTGCTGA AGCAGAAAGT GGCTTGTTCT TGGCTCAAGA GCTTATCGCA     39300
     GACAAAACTG AGTTTAAGGA GCTTTCCACC CGAGTTAGCT CAATGTTAGA AGCAATTAAA     39360
     TTGAAAAAGG AGATGGAACA TGAGTGCGTT GATAACCCAT GACCGCTCAA CGCCAGTAAC     39420
     TGGAAGTCTA CTTCCCTACG TCGAGACACC AGCGCCCGCC CCCCTTCAGA CCCAACAAGT     39480
     CGCGGGAGAA CTGAAGGATA AAAATGGCGG GGTGAGTTCT CAGGGCGTAC AGCTCCCTGC     39540
     ACCACTAGCA GTGGTTGCCA GCCAAGTTAC TGAAGGACAA CAGCAAGAAG TCACTAAATT     39600
     ATTGGAGTCG GTCACCCGCG GCGCGGCAGG ATCTCAACTG ATATCAAATT ATGTTTCAGT     39660
     GCTAACGAAG TTTACGCTTG CTTCACCTGA TACATTTGAG ATTGAGTTAG GTAAGCTAGT     39720
     TTCTAATTTA GAAGAAGTAC GCAAAGACAT AAAAATCGCT GATATTCAGC GTCTTCATGA     39780
     ACAAAACATG AAGAAAATTG AAGAGAATCA AGAGAAAATC AAAGAAACAG AAGAGAATGC     39840
     CAAGCAAGTC AAGAAATCCG GCATCGCATC AAAGATTTTT GGCTGGCTCA GCGCCATAGC     39900
     CTCAGTGATT GTCGGTGCCA TCATGGTGGC CTCAGGGGTA GGAGCCGTTG CCGGTGCAAT     39960
     GATGGTTGCC TCAGGCGTAA TTGGGATGGC GAATATGGCA GTGAAACAAG CGGCGGAAGA     40020
     TGGCCTGATA TCCCAAGAGG CAATGAAAAT ATTAGGGCCG ATACTCACTG CGATTGAAGT     40080
     CGCATTGACT GTAGTTTCAA CCGTAATGAC CTTTGGCGGT TCGGCACTAA AATGCCTGGC     40140
     TAATATTGGC GCAAAACTCG GTGCTAACAC CGCAAGTCTT GTGGCTAAAG GAGCCGAGTT     40200
     TTCGGCCAAA GTTGCCCAAA TTTCGACAGG CATATCAAAC ACTGTCGGGA GTGCAGTGAC     40260
     TAAATTAGGG GGCAGTTTTG CTGGTTTAAC AATGAGCCAT GCAATCCGTA CAGGATCACA     40320
     GGCAACACAA GTCGCCGTTG GTGTGGGCAG CGGAATAACT CAGACCATCA ATAATAAAAA     40380
     GCAAGCTGAT TTACAACATA ATAACGCTGA TTTGGCCTTG AACAAGGCAG ACATGGCAGC     40440
     GTTACAAAGT ATTATTGACC GACTCAAAGA AGAGTTATCC CATTTGTCAG AGTCACATCA     40500
     ACAAGTGATG GAACTGATTT TCCAGATGAT TAATGCAAAA GGTGACATGC TGCATAATTT     40560
     GGCCGGCAGA CCCCATACTG TTTAAGTTTA AGGAGGAATA ACCATGACAA TAAATATCAA     40620
     GACAGACAGC CCAATTATCA CGACCGGTTC ACAGCTTGAT GCCATCACTA CAGAGACAGT     40680
     CAAGCAAAGC GGTGAGATTA AAAAAACAGA AGACACCCGT CATGAAGCAC AAGCAATAAA     40740
     GAGTAGCGAG GCAAGCTTAT CTCGGTCACA GGTGCCAGAA TTGATCAAAC CGAGCCAGGG     40800
     AATCAATGTT GCATTACTGA GTAAAAGCCA GGGTGATCTT AATGGTACTT TAAGTATCTT     40860
     GTTGTTGCTG TTGGAACTGG CACGTAAAGC GCGAGAAATG GGTTTGCAAC AAAGGGATAT     40920
     AGAAAATAAA GCTACTATTA CTGCCCAAAA GGAGCAGGTA GCGGAGATGG TCAGCGGTGC     40980
     AAAACTGATG ATCGCCATGG CGGTGGTGTC TGGCATCATG GCTGCTACTT CTACGGTTGC     41040
     TAGTGCTTTT TCTATAGCGA AAGAGGTGAA AATAGTTAAA CAGGAACAAA TTCTAAACAG     41100
     TAATATTGCT GGCCGCGAAC AACTTATTGA TACAAAAATG CAGCAAATGA GTAACATTGG     41160
     TGATAAAGCG GTAAGCAGAG AGGATATCGG GAGAATATGG AAACCAGAGC AGGTAGCGGA     41220
     TCAAAATAAG CTGGCATTAT TGGATAAAGA ATTCAGAATG ACCGACTCAA AAGCCAATGC     41280
     GTTTAATGCC GCAACGCAGC CGTTAGGACA AATGGCAAAC AGTGCGATTC AAGTTCATCA     41340
     AGGGTATTCT CAAGCCGAGG TCAAAGAGAA AGAAGTCAAT GCAAGTATTG CTGCCAACGA     41400
     GAAGCAAAAA GCCGAAGAGG CGATGAACTA TAATGATAAC TTTATGAAAG ATGTCCTGCG     41460
     CTTGATTGAA CAATATGTTA GCAGTCATAC TCACGCCATG AAAGCCGCTT TTGGTGTTGT     41520
     CTGACCATTG ATGACCTTGG TTAGTTAATT AACCGAAAGT TTTATTTTAC CTTACCCCTT     41580
     ATGGTGATAG AGCTTATCTA TATAAGGTAT AAGGTGCTGA AAAGCCCTGG ATTAATATTA     41640
     GTTAATCCAG GGTTGTGATT ATTAAATTAA AAATAATAAG TTAGGATCAT ATGACAATTA     41700
     AAATAAAAGA TTATTTACAT GTAGTAGCTC AAGACCTGAG CTGACAGTTA CCGGTTGTTG     41760
     AACGGCAATA CGCGGTCATT GAGCACGTCA GCGGCTGTGA TCGGCATTTT GCTCGTATAC     41820
     AGCGAGAGTG TTAGAAATGC TGTGTCATTC CAGTAATATG CAATCAAAAA AGAATGACAC     41880
     ATATCCCAAT AATGAGAGTC GGTGATTTTA CTCATTGATG GGGGGGAATA ATTAGGCTAA     41940
     AACAACCTCA ATGTTAAAGA GCCGATTCAT AAAGGTAGAT CCTTCCCGCA CTCAAGAGAC     42000
     TGTAAACAAT ATTGTGTAAT TGCCTGTTTT TGATATCTTC ACTCCAACAA CGGAGACAGG     42060
     CAAATTATGG ACGAAAAGAA ACTTAAAGCA CTTGCGGCTG AACTGGCTAA AGGTCTTAAA     42120
     ACCGAAGCCG ACCTTAATGC ATTTTCTCGT ATGCTAACAA AGCTTACCGT CGAAACAGCG     42180
     TTAAATGCAG AGCTTACCGA ACACCTCGGG CACGAGAAAA ATACCCCTAA ATCAGGCTCG     42240
     AATACCCGCA ACGGCTATTC GTCCAAAACA CTGCTATGCG ACGACGGCGA AATCGAGCTG     42300
     AATACGCCAC GCGACCGCGA AAACACCTTT GAACCGCAGC TGATAAAGAA AAATCAGACG     42360
     CGTATCACAC AGATGGACAG CCAGATTTTG TCCCTGTACG CCAAAGGCAT GACCACCCGC     42420
     GAAATCGTCG CCACCTTCAA AGAGATGTAT GACGCCGATG TGTCTCCCAC GCTGATATCT     42480
     AAAGTCACCG ATGCCGTAAA AGAGCAGGTT GCTGAATGGC AAAACCGCCA ACTGGATGCT     42540
     CTGTATCCCA TTGTTTATAT GGACTGCATT GTCGTAAAAG TCCGCCAGAA CGGTAGCGTG     42600
     ATAAACAAAG CAGTGTTCCT AGCGCTGGGC ATCAACACTG AAGGTCAGAA AGAGCTGCTG     42660
     GGCATGTGGC TGGCAGAAAA TGAAGGTGCG AAGTTCTGGC TAAGTGTGCT GACAGAGCTG     42720
     AAAAATCGCG GTCTTCAGGA CATTCTGATT GCCTGCGTGG ATGGCCTGAA GGGGTTCCCG     42780
     GATGCGATAA ACAGTGTTTA TCCGCAGACT CACATCCAGC TGTGCATCAT CCATATGGTA     42840
     CGCAACAGCC TGAAATATGT GTCATGGAAG GACTATAAAG CCGTCACCAG CGGTTTGAAA     42900
     ATGGTGTATC AGGCTCCGAC AGAAGAGGCG GCGCTGATGG CGCTGGATAA GTTTGCGGAG     42960
     GCCTGGGACG ACAAATACCC GCAAATTAGC AAAAGTTGGC GTACGCACTG GGAAAATCTC     43020
     AATACATTCT TCGGCTATCC GCCCGATATC CGCAAGGCTA TCTACACCAC GAATGCCATC     43080
     GAATCGGTGA ACAGCGTGAT CCGTGCAGCC ATTAAAAAGC GCAAAGTGTT CCCGACAGAC     43140
     GACTCAGTGC GGAAGGTTGT TTATTTGGCG ATCAAGGATG CATCAAAAAA ATGGAGTATG     43200
     CCGATCCAGA ACTGGCGGTT AGCGATGAGC CGTTTTATTA TCGAGTTCGG TGACCGCCTG     43260
     AGCGATCACC TTTAATACGG TGGCAGTTAC ACAGAATTAT GGACAGGCTC GCACTCAATA     43320
     TTCAGGTTCG TCACGGCGTA ACCAAATATC AAATTGACCT TTATTCAGTC GTTGCAATGT     43380
     TTCAAATCCC TGAAGCGTTG ACCAGGCACG GTTTGGCCGT TTGAAATCCC CGGCCGCGTT     43440
     TACCAATTTT TTGATGGGGG CATGGTCAGA CTCGATACGA TTATTCAGGT ATTTGACTTG     43500
     CCGCTGCTTT GCAGCATCCC GTATCTTTTC CTTCTTTCAT CAAACGAGTG ATAGCGTAAC     43560
     CGTATGACGA ATGTTTATCG GTATTGAGTA TTTTAGGCTG TCTTTCAACA GAATAGGGTT     43620
     TTAACACCCG TTTAATGAAT GGATAGGCGG TATTTTTATT TCGTTTAGGC GAAAAATAAA     43680
     AATCTAATGT AGTGCCGTGC TTATTGATGG CGCGATAGAG ATAAAACCAT TTTCCGTTGA     43740
     CCCTGATATA GATTTCATCG AGTTGCCATG AGGAGTCGGC ATCCGTAAAT TGATATCGTT     43800
     TCAATTTCTG ACGAGGTATA GGTGCATATT CAATAAACTA ACGGTAAATG GTAGAGCGAT     43860
     AAACGGAAAT CCCACGCTCT GACAGCATAT CGCTGACATT GGCATAACTC ATCGGGGGCA     43920
     AAATGTTCCC ACTTGAAATC ACCTGGGGCC ATGTGGATTC ACTGAAGAAG GGATGAATAG     43980
     CCTCAGTTTT CATGACAACT CCATTTTTTG CAACAAGCCC AAATATAGTG ATGCTGAAGT     44040
     GGCACAAACG CTGGATACCG CGCAAAAGCA CACCCTGACG GTTTCAAAAG GGGTACTGGA     44100
     TACGGCCAAA CAGTATACTA ACACCGTCAG CAGTAATACA TTGGACAGTG CCAATACCTA     44160
     TACCAATAAT AAAGCAGACT AACATTGAAG GATGCTAATA ATTATACTGT TCAGAAGGTA     44220
     AACAGAGATG CTATAAGTGG TGTTATAGAT CAGGAATTAT ATTGAGAAAC CATTGAAGAA     44280
     ACTAAAGAGC AAATGGCCGG TATTGAAACT ACTGCCCCAA AATACACTGA TTTAAAGTTT     44340
     AATGATATTT CCGGTAAGGT TGACTCTGCG GCCATACAAT ACTTCTGACA TATTTCTTCT     44400
     GGTTATTTAT GCATAAAAAT GGCCAAAAAC TTTCAATGGT AGAAGAGCTA AATTCGGATA     44460
     AATAACGCAT AAAAATTCCC GGCGAAAAAC TATATACATA TATAAATTTA ATATGTATGT     44520
     TTTTGTTTGC AGTGAAAAAC TCGATAATAA AAATATTTTC AGAAAGGCAT TCAATATGTT     44580
     CATAAATCCA AGAAATGTAT CTAATACTTT TTTGCAAGAA CCATTACGTC ATTCTTCTAA     44640
     TTTAACTGAG ATGCCGGTTG AGGCAGAAAA TGTTAAATCT AAGACTGAAT ATTATAATGC     44700
     ATGGTCGGAA TGGGAACGAA ATGCCCCTCC GGGGAATGGT GAACAGAGGG AAATGGCGGT     44760
     TTCAAGGTTA CGAGATTGCC TGGACCGACA AGCCCATGAG CTAGAACTAA ATAATCTGGG     44820
     GCTGAGTTCT TTGCCGGAAT TACCTCCGCA TTTAGAGAGT TTAGTGGCGT CATGTAATTC     44880
     TCTTACAGAA TTACCGGAAT TACCGCAGAG CCTGAAATCA CTTCTAGTTG ATAATAACAA     44940
     TCTGAAGGCA TTATCCGATT TACCACCTTT ACTGGAATAT TTAGGTGTCT CTAATAATCA     45000
     GCTGGAAAAA TTGCCAGAGT TGCAAAACTC GTCCTTCTTG AAAATTATTG ATGTTGATAA     45060
     CAATTCACTG AAAAAACTAC CTGATTTACC TCCTTCACTG GAGTTTATTG CTGCTGGTAA     45120
     TAATCAGCTG GAAGAATTGC CAGAGTTGCA AAACTTGCCC TTCTTGACTG CGATTTATGC     45180
     TGATAACAAT TCACTGAAAA AACTACCTGA TTTACCTCTT TCACTGGAAT CTATTGTTGC     45240
     TGGTAATAAT ATTCTGGAAG AATTGCCAGA GTTGCAAAAC TTGCCCTTCT TGACTACGAT     45300
     TTATGCTGAT AACAATTTAC TGAAAACATT ACCCGATTTA CCCCCTTCCC TGGAAGCACT     45360
     TAATGTCAGA GATAATTATT TAACTGATCT GCCAGAATTA CCGCAGAGTT TAACCTTCTT     45420
     AGATGTTTCT GAAAATATTT TTTCTGGATT ATCGGAATTG CCACCAAACT TGTATTATCT     45480
     CAATGCATCC AGCAATGAAA TAAGATCCTT ATGCGATTTA CCCCCTTCAC TGGAAGAACT     45540
     TAATGTCAGT AATAATAAGT TGATCGAACT GCCAGCGTTA CCTCCACGCT TAGAACGTTT     45600
     AATCGCTTCA TTTAATCATC TTGCTGAAGT ACCTGAATTG CCGCAAAACC TGAAACAGCT     45660
     CCACGTAGAG TACAACCCTC TGAGAGAGTT TCCCGATATA CCTGAGTCAG TGGAAGATCT     45720
     TCGGATGAAC TCTGAACGTG TAGTTGATCC ATATGAATTT GCTCATGAGA CTACAGACAA     45780
     ACTTGAAGAT GATGTATTTG AGTAGTACGC AAGAGCGTTC ATAATTCTGC GTCACGTTAA     45840
     AATATCATTA CAACGTAATC ACTTTATCGA GGCGACCTTC AAAATAAATC GCCAACTGTG     45900
     ACAATGCCAA ATTCCAGCTC TGGATTGGCA TTGTCCATCT TTCCTGCGCA TTCATTAATC     45960
     CCAGATACAG TGATTTCAAC AGACTGTTCT CATTAGGGAA AATGCCTTTC GTTTTTGTCA     46020
     GCTTTCTGAA CAGCCGATGT ACCGATTCAA TGGCATTTGT CATGTAAATG ACCTTGCGGA     46080
     TCGTTGTCGG ATACCGGAAG TAACACGACA AATTGGCCCA TTTTTTCCGC CACGACTGGA     46140
     GTACCACTGG ATATTGTTGG CCCCATTACC AGTTGAGGCT CAAAAGTTCC ATTGCGATCA     46200
     CGGGGCGTGG CGAGTTCAAA CGTACCAGTG GGAGTTTTGA CCGTTTTTCT GGACGAACCA     46260
     TTTTTGCGGT TGGCTTCGAT GTCCAGAGCC AGATGAGTCT GACCATGCCC CCATCAAAAA     46320
     ATTGGTAAAC GCGGCCGGGG ATTTCAAACG GCCAAACCGT GCCTGGTCAA CGCTTCAGGG     46380
     ATTTGAAACA TTGCGACGAC TGAATAAAGG TCAATTTGAT ATTTGGTTAC GCCGTGACGA     46440
     ACCTGAATAT CGAGTGCGGG AAGGATCTAC CTTTATGAAT CGGCTCTTTA ACATTGAGGT     46500
     TGTTTTAGCC TAATTATTCC CCCCCATCAA TGAGTAAAAT ACCGACTCTC ATTATTTGCA     46560
     GCAAACCTAT ATATTGCGCT GAATCATAGA TCACCCATCA TAACTGGGGA TAAAACCACT     46620
     TAATATGTTG TAACCCCACG GTTTCATATG AGTATTCTCC GATTACATAT ATGTTAGTTG     46680
     CCATGGATAA TCCGTAATGT TAAATAGAGT TATTTTCTGT GTCACAATCA TAAATAACAC     46740
     AATTGTTCTT TCAGAACTCA ACATTTTAAT ATACTGTAGC AATGGTATCA ATAGTCATAC     46800
     TTATTAAAAT GATATTTTCC TCACAGTTAA TTACACAGCG TGAAGTAATG ATATGGTGTT     46860
     TATTTTGTTA TTAAATGTCG TATCTTGTTT AATGGTTTTA TTTATGTGTT TAACTGATTT     46920
     CAATGTAAAA AATATTTTTT ACATTTAGTA AGTCATGTCA ATGATATTTG ATAAAGATAA     46980
     TTACTGCTTA ATTGATGGAT ATTTTTTGTT TTTTTAATCA ACGGTGGCGT CGCTATCGTC     47040
     TTAACGTTCA CAGAAGATAT CATTCTGCAT AGCTCCGCCA GCATCCAGGC AAGCATCTAC     47100
     TGTCAGAAAG TGCTCAACTT TCATACCAGC ATAAAAAGCA GCGCACAATG CGGTGGCTAT     47160
     CACTAGTCGT TTTTTCATTG CATAGTCCTC GTAGGTTAGA TTATGCCCCA TGAGCTGAGA     47220
     AGAGTGAGCT ATCGTTGTCT TGAGCTTTCT GTCCGGGGTA TCATCGAATT TTACTTTATT     47280
     TACATAGAAT TTATATTCTA TCATACCATA ATTAAACTTT ACTTGAATAA AAACATCGGT     47340
     GTGCTGACCA TATTCCTGAT ATGAATATAA TAATATAGCC TTAATGCTCA TGGTAATAAA     47400
     GTGCCCTACA GCAATTTCGG CGGGTTTGCT GCAAATAATG AGAGTCGTGA TTTTACTCAT     47460
     TGATGGGGGG GGAATAATTA GGCTAAAACA ACCTCAATGT TAAAGAGCCG ATTCATAAAG     47520
     GTAGATCCTT CCCGCACTCG ATATTTAGGT TCGTCACGGC GTAACCAAAT ATCAAATTGA     47580
     CCTTTATTCA GTCGTCGCAA TGTTTAAAAT CCCTGAAGCG TTGACCAGGC ACGGTTTGGC     47640
     CGTTTGAAAT CCCCGGCCGC GTTTACCAAT TTTTTGATGG GGGCATGGTC AGACTCAATA     47700
     CGATTATTCA GGTATTTGAC TTGCCGCTGC TTTGCAGCAT CCCGTATCTT TTCCTTCTTT     47760
     CAGTTTTCAT GACAACTCCA TTTTTTGCAA CAAGCCCATA GTGGGGACAA TGAACATTAA     47820
     CGCCGATCAT GAGAAAAACT TAAAAGTGAG CATTATATAT AAAATTCAAC TAATTGGAGG     47880
     AATCACCGAA ATACTTAATG GTGGGGTTAT TAACTGGGGG ATATTTAACT TGGTAGGATA     47940
     TTTCAAATCG TCTATATCAC TAATAAAAAT AATAATTATT GATAACACTA ATTTGGTCAT     48000
     GTTATATGTA AAAATTTGGA TAAATAATGA AAACTTCTTA ATTTATAGTG AATTAAAAAC     48060
     AAATGAGTTA TTATATAAAC CATATCTATT AAATTTAATA GATATTATTG TAACTATGTA     48120
     GTGAAATAAC TTTGTATGGT ACCGCGTATA TGATTGTTTA CATTTCAGAT GAATAATATG     48180
     GGTGATGTCG AGTTGGGCTG AAACTTAGTA TTTTGCGGTT CTTTTCTCTG CTCAATATCA     48240
     TCAATGAAAC GTTCTAACCA AGCCTGCATT TCATCGATAT CCAACCCTAC CAGTGATTGT     48300
     TGAGACCAGA GAATAGGTTT ACCGTCCAGT CTTCCTTGAA CATGGGCAGG CCAATGTTCG     48360
     CCAAACAAAT TATCGTTGGT TGGCAAATCA GCACCTAGCT CACTGAACAA CTGTACCCAT     48420
     TGTTGATGAT AACAAGCAAT CAGTACTTGG ATGTGCCCAT CCACTTCAAA TGTAAATGTA     48480
     TAAACGTCAT TTTCATTAAC TTGATGGTTC AAGCCAAGCT TCAGGAAAAG CTGTTGCATA     48540
     AGTTCTGTGA AGGTTGTCTG CATTAAACCT CCTTGGAGTC AAATGTTAAC ACTCTAAAAC     48600
     GCTGCCCCAC CCCCAGAGGA TAATGATACA TAGAATTACC CCAGAATGAG TTAGTAAACC     48660
     ATTTGCGGAA CTTTTCCTTA TCAGAAAAGT GGAATTCACC GAAATTGGGA TCGAAGAAAG     48720
     TAACACCACT CTTTTCGTTG ACATACGCCG CTATGGCGTG GGCTGACATT TGGCCTGAGA     48780
     GATGTATTTT TTTATAACCG TAACCTATCC CATGAGTATC AAGGATAGCG TTTAATAATT     48840
     GATCCAGCCC TTCTGATTCC GTCGTACCAG TAACATCAAC TGGACGCAGT AAGCAATGCC     48900
     GTTCAATCAT ACGTTCTGAT ATGCCATTTT TCTTGAACCA ATCTAGTGTT ACCTCATCTT     48960
     GATCAACGTC TGCTTTACAA CCATCTATTT GCAACTGTTT AATTGAGTAA AGTGTATCGA     49020
     TCTGGAATTT CCCCTTACGC CCGCCAACAT AGAGCTGGTC AAATAAGCTT TGGCCTTGTG     49080
     CATGGTTCCT GATCCAATGT GCACATAAAG CCTCACAGAC ACCGCTAGCA GTGTCTGAAT     49140
     GTTTTATTAT TTTATGAAGA AAAGCCCCTT TGGTCTGAGC AAACTTGAAA TTGATGTTAC     49200
     CTCCGTAATT TGCAACAGAC TCTCTCACCG CGGGCACACG AGTGCTGAGT ACAAAATGTA     49260
     TCATGCGATA CATAATCATA CTGAAGGTAA AGCTGCTGCG TTGGTTAGCT TTGCCGTCGC     49320
     TGGTCAACTT TCTATCCAGC ATAGAACGGC CTGACTGGTT ATGTTTTATG GTGGCTGATA     49380
     ACTTTTTCTG CAGGTTTGAG TGTGACAGTG CTGTTTCCAC TTTCACTCGG TGTGCGCCAA     49440
     TCACCCCTTC GGTGAGGGTA CTGATTGAAG GTTTTCACCG GCAGAATAAT TCGATAGTTG     49500
     AATATGGTAG TGTCCGTGAA TACTGTTCAT CTGTATAACC TATTTATGTT AGCCATTATT     49560
     TTGCTATACC GATAAATTGA ATATATCTGG ATTTTGACGT CTGGCAATGA ACGATAGAGC     49620
     CTACAATAAA TTATAACCAA TAGGTGACTC AGGGATTTTC TCTGAGTCAG AGTACATATT     49680
     GTACATTCGA TTAAATATTT TTTCAATAGT TAAAAGTTAC TTTTTATTAT AAAAATTCAA     49740
     CTTATGGGGA CAGTGATGTT ATGTTGATAG CGTCGGGGCG TCGCGGGGAG AGTTTATAAT     49800
     AAACTCTAAT GTGATAAAAA TCCATTCTAA TAATGATATA TTATACTATA TCTGTAGCTT     49860
     TAAAATAAAT AATTATAGAG TGGAGGATGC TTGAAATATT TCGATGCATG GGAAGCTCAT     49920
     TGAGAGTAGA TATTCTATTT TTATAAATTA CGGAGTGATT TTAATTATAC ACTCGTAGTG     49980
     ACGGTTATTA AATAGTGTAG TTTATAAAGT AAATTTGGGA GTAGTAACTA TGTTTATTAA     50040
     AGATACTTAT AACATGCGTG CTTTATGTAC CGCTCTTGAA CAGTCGGCTC CTGATACAAT     50100
     AATAAATACA TCTAAAGAAG AAAATAACAG TTACTACTGC GCTACTGCTC ATTTACTGAG     50160
     AACGGATGTT TGTTCATTGG TCAATAGAGT AGGGATTGAA CCACTTAAAA GTGGATCAAT     50220
     ATTATCTACT TTAGAAGAGT TATGGCAGGC TGTTGGTATA GTATATCGCT TATACGAATG     50280
     GCAACATGTC AGCGATATTG ACACCAATTT TAAGAAACTA CCCAATAATT CTGATTTTGG     50340
     TCTTGTGTTT TCTGTATTAG ATTGTGATAT AGAGTATGTG TTCATAGGGA AAAAAGACAG     50400
     TGAAGGGAAT ATAGAATTTT ATGATCCGAA AAACTCTCTA CTTATAGAGA ATGATGACAT     50460
     AAAAAAATAT TTATATGATG AAGATTTTCA TCGTTTTTGT ATTATGCTGA TCATCTCTAA     50520
     ATCTGAGTTG GAGGAATTGA GTCGCGAATC CTGCGATCAA GAATGTATTA TGGGATGAAG     50580
     CTATATTAAA GAGTTTGGGA TATGGTAGTT GATTATGTTA AAGGTTAATT ATCTGTAACA     50640
     TATAAAAAAC AGTGGTATGT AATCATCCTG CATAATCGTA CCATTCATAT TTAGAGATCT     50700
     TCCGGCATAC TGACCTTGCC AATGAAGGAG ATCGCTAAAC GGGTACACCG TATCTATTGC     50760
     CTCCTGAAAC TCAATATTCG CCGCAAAGGG AAACAACGCC TGCCAGCCTG TAACCCATCA     50820
     CCGCTGGCGG TACCGGAACG ACTTAACCTG AGCGGGTCGG TCGATTTTAT GCACAATGCA     50880
     CAATGCACTG AGCGGTGGGT GTCATTTCAG TACGTTATAA TGTCATGGAT GATTACAATC     50940
     GTGAAGCACT GGCGATTGTA ATCGATCTGA ACCTGCCAAC ACAGCGCCGT CATCAGAGTA     51000
     CTGGATCGCA TTGTGGTCAA CCGTGGCTAT GGGAGGTGCC ATGCCCTGTT TTAAATGGAA     51060
     GATGATATGA AGAAAAACAT GAAGTTAATA GCAATGACTG CCGTACTGTC CTCAGTATTA     51120
     GTCCTCTCCG GCTGTGGTGC GATGAGCACA GCAATCAAAA AAACGTAATC TGGAAGTGAA     51180
     AACGCAGATG AGTGAAACGA TCTGGTTAGA GCCGTCTTCA CAGAAAACCG TTTATCTACA     51240
     GATAAAAAAT ATCTCAGATA AAAATATGCT TGGCTTAGCC CCCCAAATCA CAAAAGCTGT     51300
     GCAGGATAAG GGGTATACCG TAACATCTTC CCCAGAAGAT GCACATTACT GGATCCAGGC     51360
     TAATGTCCTG AAAGCCGATA AAATGGATTT GCGTGAAGCT GAAGGATTTC TGAGTCAGGG     51420
     GTATCAGGGT GCTGCGCTGG GGGCCGCATT AGGGGCTGGT ATTACAGGCT ACAACTCTAA     51480
     CTCAGCGGGA GCCACGTTAG GAATTGGATT GGCGGCTGGT CTTGTTGGGA TGGCCGCGAA     51540
     TGCGATGGTC GAGGACATCA ATTATACTAT GGTGACGGAT GTCCAGATTT CCGAGAAAAC     51600
     GGACACCACC CTACAGACTG ACAATGTGGC GGCGCTGAAG CAAGGCACCT CTGGCTATAA     51660
     AGTTCAGACC AGCACACAGA CGGGCAACAA ACATCAATAC CAGACTCGCG TGGTTTCTTC     51720
     GGCTAACAAG GTCAACCTGA AATTTGAAGA AGCCCGGCCG GTTCTGGAAG ACCAGCTAGC     51780
     GAAGTCTATC GCTAATATCC TGTAAGCCAT AAGCATCCTG GTATGAAGAT GTACTGGGAT     51840
     GTAGTGGATC AGTAATACTG GACACCTCAA TAGCCTGTTA ATTTAATGAC AGCCAATTGA     51900
     GGTAATTGAT AATGACTCAA CCTAAACAGA CCAAACGCCG TTTTTCTCCT GAATTCAAAC     51960
     TGGAAGCTAT TGAGCAGGTC GTTAAGTATC AGCGGTCAAC CATCGAGGTT GCACGCGCTC     52020
     TGGAGCTGGA TCCCAGCCAA TTGCGTAAAT GGATACGCCA GTACAAAGAA GAAGTCAGCG     52080
     GGATGACGCC GGACAATCCT GCACTGACAC CAGAGCAACG TGAAATCCAG TCGCTCAGGG     52140
     CGCAGATTAA ACGGCTGGAA ATGGAAAAAG AAATACTAAA GCAGGCAGCT GTGTTGATGA     52200
     GCGAGTTCCC CATCAAATCT TTGCGTTAAC ACGGCTGAAA ACAAAATGGC CAGTGGTCGA     52260
     ATTGTGCCGC CTGCTCAAAA TAACGCGCAG TGTTTACTCT GCTTCGCTGA ATTTTCGGGT     52320
     TGATGTAAAA CGTCTGCAAC TGCGTGAATT GCATCAACAG AGCCGGGGAG CAGCCGGCAG     52380
     CAGAACACTG AGTCTGCTGA TGCGTCAGTC GGGTTATAAC GTGGTGCGCT GGCTGGCCCG     52440
     CAGGCTGATG CGGGAATGTG GTCTGGCGAG TCGCCAACCC GGAAAACCTC GTTACCGTGG     52500
     CGAACGGGAG GTGTCACTGG CATCGCCAGA CTTACTGAAA AGGCAGTTTA AGCCGTCGGA     52560
     GCCCAATCGT GTGTGGAGTG GATATATCAG CTATATCAAA GTCAATGGTG GCTGGTGCTA     52620
     CCTGGCACTG GTGATTGACC TTTACTCCCG TCGGATAGTG GGCAGTGCCA TATCGTCATC     52680
     CCCGGATGCT GAGCTGGTGT GTCGAGCCTA GCGTAATGCA CTGGAGACGC GCCCAAGGGA     52740
     AAAGAGGCTG CTGTTTCATT CGGATCAGGG AGGGCAGTAC AGGAGTAAGA AATCCAGGCA     52800
     GTTACTGTGG AGGACCGGAG TGATGCAGAG TATGAGCCGC AGGGGTAACT GCCTGGATAA     52860
     CTCACCAATG GAAAGAGTGT TCCGAAGCCT GAAAAGTGAA TGGCTGCTTG TAGGGGGCTA     52920
     TATGGATGTC CATCATGCGG TACGAGATAT CGGTGAATGG ATACAAAGTT ATTACAACAC     52980
     CCCCCCATCG GCACAATGGT GGATTACCGC CCTGTGAATA CGAAGAGCGG TGGAAAAAGG     53040
     CTACGAAGGT GTCCTGATTT TGTGATCCAC TACACTACAT TCAGGAGAGT TGGACCAGAA     53100
     ATCAGGTAAT AAGGTCCGGT CCACTCGCCT TCAAATTCAA CATGTAATTC ATTGTCAAAC     53160
     AGTCCCCAGA GCAGTAAAAC AGAGATCCGG TTCAACCTCA TACGCCGTGC CCTCGGCCAT     53220
     GATGCGGGCA ATCGATACCC ACTTTGCGGC GTTCAGGCTC TTGGGCAAAG CGACAGAACT     53280
     GCTCCCAGTT GCACGTATCG CGGATCCCCT CGGGGGAACA TTTGTCAGCC AGTCTTCCTG     53340
     GCTAGAATGT GTTTAGATTA TCCGTGGTGA TTCAGTGGTT GCACGGTATC AAGCAAAAAC     53400
     CAAGGACACT CTTAGTTTGA AAAGGCAGGT AATATACAGC TTCAGTTAAC CCATTTTACT     53460
     GACTGATATT TATCGTTTTT TGTAGCAAGA CGAGTGTTTT CGATTATGTA CGTATAGGAT     53520
     AAATTTTTAG TACCTATATA TTGGCATGCC CTGCTGTTAC CGACGAGCAA AAAGAAAGGT     53580
     CATCTACAGC AGATTAGGTA ACTGTCAAAC TTGGGGTATT TCCCATAGTC GTCATATAGA     53640
     CGGAAATGTG AACGTGCCCA GTTCGGCATT GAGGCTCTTA CGCTTCATCG CGATGCTTGG     53700
     TCACTGGCTG CGGCGAACGT TGATATTCTA TTTATATATC TTTGCGTTAT TTGGGTTGTT     53760
     TTGCGTATTT TTTGATGTTT TACTATAAAG ACGCAAATTT CATAGAGATA ATACATATGG     53820
     ACCTAAAGTC AACTCTTGAC CGCTGTATTG AACGTGGACA GTTCATGACT CAAGAAATTG     53880
     CTAAATCACA ATTCGGTAAT GACAGTCCGG CTGCTCGAAC GATTACTAGA CGCTGGCGTA     53940
     TTACTGAAGC TGCTGAACTT GTCGGAGTAA CACCACAAAC GATCCGTAAC TATGAAGACT     54000
     CAGGCAAACT GCCACCGCCT GATACAGCAA TGATTGGTCG TGTTGAGCAA CGAACTGGAT     54060
     ATTCCATCCA GCAAATTAAT GATATGCGTG ATGTGTTTAA AACAAGACTA TCCAAACCAA     54120
     AAGGCGAAAA TCCTGTTGTT CTTGCCATTG CAGCTCATAA AGGTGGTGCA TACAAGACAT     54180
     CGACATCTGT TCATATTGCT CAATGGATGG CGTTACAAGG GTTACGGGTT TTGTTGATTG     54240
     ATGCGACTGA TCCTCAAGCT ACGGCCTCTT TATATCATGG CTATGTTCCC GATCTGCATA     54300
     TACATGAAGA AGATACTTTG TTGCCTTATT ATCTTGGTCA ACGAGATGAT GCTGCTTATG     54360
     CGATAAAACC GACTTGCTGG CCAAATCTTG AAGTCATTCC TTCTTGTCTG GCAGTGCATC     54420
     GTATTGAGTC GGAAATTTAT GGCTTGCATG ATCAGGGGAA ATTACCTGTA GCCCCTCATC     54480
     TTTTATTACG TGCTGCTATT GAGTCAGTCT GGGATAGTTA TGATGTTGTG GTGTTAGATA     54540
     GTGCACCAAA CTTAGGTATT GGGACTATTA ATGTCGTGTG CGCTGCTGAT GTCATCGTAG     54600
     TGCCTACTCC GGCGGAGCTT TATGACTATG TTTCCACGTT GCAATTTTTC ACCATGCTTA     54660
     GGGATTTGAT GTCAAATATT GATCTCAACG GTTTTGAACC TGATGTGCGC GTTTTAATTA     54720
     CTAAATTTAG TAATGCGATC GGTAGTCAGT CTCAGTGGAT GGACGATCAG ATAAGGAATG     54780
     CATGGGGTGG AATGGTGTTG AAAGAAGTTG TTCGCGTGAC TGACGAAGTG GGGAAAGGCC     54840
     AAGTACGAAT GCGTACTGTA TTTGAACAGG CAGCTAACCA GCGTTCAACG CCAGCTGCTT     54900
     GGCGTAACGC TGTTTCGATT TGGGAGCCTG TTTGTGCAGA AATATTCAAT CGGCTGGTTA     54960
     AGCCTCGTTG GGAGAATGCA TGATGAAAAG GTCACCAGTG TTACGTAATG CGCCTTCAAT     55020
     TAATTTTGAT GATGCTAAAC CCGCAATCAG CAATGCAGAG CCCTCGGTTT CTGCTCCGGC     55080
     GGTGAGTCAG CTTGCTTCTC GAGTTAGTGG CATGAAAGGC AACACAATCG TATTACCTGT     55140
     TTGTGGAAGG AACGTTGCTT TTACGCTTAA AGTGATAGCA GCACCTGATG TTGAATCTAA     55200
     AACAATCGTT TTTAGTGGTA ATGAGCGAAA CCAAGCATTA TTAAGTGAGA CGTCGTTAGA     55260
     TGACTTGATC CCTTCATTTT TAACGTCAGG GCAGCAGATC CCCGCCTTTG CACGTGAACA     55320
     TAACGGGAAC ATCGAGGTTG CTGATGGAAG TCGCCGACGT AAAGCCGCGA TACTCACCGG     55380
     AAGTGACTAT AAGGTTCTGG TTGGTAACTT GAATGATGAG CAGATGCTAT GGCTGTCCCA     55440
     AATTGCTAAT GAGTATCGTC CGACGAGTGC TTATGAACGA GGCCTGCGTT ACGCCCAACG     55500
     GCTAATATCT GAATTTGAAG GTAATATTAG TAAATTGGCA GAGGCCGAGC ATCTCTCTCG     55560
     CAAAATTATT CAGCGTTGTA TTAAAACGGC TGGGCTGCCC CTTAAAACTA TTCAACTGTT     55620
     TGCTAACCCT AATGAATTAA GTGCTCGTAG TGGCGAAGCA TTAAGTAAAG CTTATGAAAA     55680
     TAATGTTGAT ACGCTAAAGC GAGTTACGCA TAAAATTATG AAGCAAAAAC AGGAAGGTCG     55740
     CCAGTTTACT ACGGAAGAAT TAATCGTATT GCTGATGCCT GAGAGAAAAC AGCCAGAGAA     55800
     CATTCATAAA AAAAGCTTTG GCAAAAATAT AGAAGCAAAA TATTCAAAAG ACAATGTTTC     55860
     TTTCTATCTC AAATCTGTGC CAGAGTCCTT GGTTAAACAA ATAGAAGAAC TCTTGAATAC     55920
     CTATGCAAAG GAACATTCTT TGTAGTGCCT GAATAAGATC AGAACAAGGT GGGTTGTCTG     55980
     CCCGCCTTTA TTTAGTGTAT ATCTATTGTT TTAGCTCATC CTTCGTAGAA GATCTCCTTC     56040
     TTTACAACTC ATTTCCTAAG CTGAACTGTG GCCCCAATCA CCAACGTTAG CATTGGATAT     56100
     CCAGGTGGGA CCGTGGTCCC AATTACTAAC GTTGGCATTG GATATCCAGG TGGGACCGTG     56160
     GTCCCAATTA CCAACGTTGG CATTGGATAT CCAAGTGGGA CCGTGGTCCC AATTACTAAC     56220
     ACTGGCATTG AACATCCTAG TGGAAATGTG ATTCGAATTG AAAGCGATTA AGTCGATGAG     56280
     CATTTTTTTA GTGATAGCTT TAGGGAGATT AAACTAGCGG ATATTTCATT ATGGAGATAA     56340
     TAATTTTCGC TTCATTTATC ACCCCTTCGC AATACTCTGT TCACCAAGTC ATACTATTCT     56400
     TAGCCCAGAG CTATTGATGC ATCAACAACT TGCATCAGAT GTTTACTGTT CGCGTGCGGC     56460
     GGTGTTTCAT CAAACATATC TATCTGACCT GGTCGACTGC CGACGTCATT AAGCATGATG     56520
     TCGGCTTTTT GATAGCGATA TCCATCCCGC CAGGTTGGAT ACGGCGATTT CATGTTAGTA     56580
     TCGATGTAAC AATGACGGCT CTATTGCATT AAGGCACAGT CTGGTAACAT GCTGTTTTTT     56640
     TTTATGATAT TGCCTGCACA TATCTTTAAT CAAAAAATTT TTTTGTCGCC TGCATTACCC     56700
     CATCGATGTT ATAGCTCAGT GTGTTCACTG GTATCTTGGC GATGCCCTGA GTTTTCTAAA     56760
     TCTAGAGGAA ATGATGACGA AACACGGTAT CTCTGTTGAG CATTACACAC TCCACAGTTG     56820
     GGTTATTCGT GTGGTGCCAT TACTGCATAA AGCTTTTTGC CGTTATAAAT GTACCGTGGG     56880
     TCGCCGGTGG CGAATGGATG AAGCCTCAAA GGTCAGTGGA AATACCTGTA CCGGGCGGTT     56940
     GATACTCGCG GTTAGACTAT CGATTTTCTG CTGACGGTAA AGCAGGATGC GGCGGCAGCA     57000
     CTGTGCCGAC TGGTATCAGG TCTCCCGGTA AATTCATATA TTAAAGTAGG CAGGGCTGGC     57060
     TCATTACAGA TTGTTTAGCT ATAATTGTAT TACTCAGTAA TACATAACGG AGGGGATATG     57120
     GCTCACGTAA CCAGCGTAAC ACTTGGAGAG CATTTGACAG GTTTTGTGGG GGAAATGATT     57180
     CAGTCTGGTC GTTATGGCAA TATATCAGAA GTGCTTCGTG ATGCCTTAAG GCTAATGGAA     57240
     GCACGTGAAC AGCGTGTTCA ACATGTACGC GATATGGTGC TTGCAGGAAC AAATGTACCT     57300
     GTGAGCCATC GTTTAATGGA TGAGATTTTT TCTGCTGCGG TGAAAGATAC TAGTGTATAA     57360
     ACTGTCTGAA CTAGCTGATG AGGATATTTA TAATATTGCC AGTTATACTA TCCGGCATTT     57420
     CGGTGTGACT CAGGCTAAGT TATACCATGA GAACTTGGCA AAGGTATTCG AGCTATTAGC     57480
     TAAAAATCCA GAGTTAGGGG CTGAGTGTAA CTGGATTTGC TCTGATATTC GCCGTTTTCA     57540
     GTATAAAAAG CACGGTATAT ACTATATAAC GCTTAGCAAT GATATTTTGA TTTCTCGAGT     57600
     GCTGCATCAA TCCATAGATA TAGATGTTCA GGATTTTCCA GAGCATGAGT AGTAATACAG     57660
     AAGAGAGATA AGTCAGAAAT TCTAACAATG AGCATGCTAA AAAACGATTC GCCCCTGAAA     57720
     GATCAGGGAC GAAGATATTC GCAATATTGA TAGAAAAAGG GGGAAACACT ATCCCCTTGT     57780
     TTTTATCCAT ATCACATCAA TGACAGTAAT TTCTGCATCT GTTGCGCCAG CCCTTTGATC     57840
     TCATTTGCTG CCTGCGTTAG ATCAACGCCA CTGGCGACGT ACGCGCTGGC CGCCCCACCA     57900
     ATAGTTCCCC ACTGCGAGAA GGGAATACCA CAAACAGGCG TGTTTAAGAT GGCACTGGCC     57960
     TCAGCTTGCA ATTCCCCACC ACAAAACTGC ATCAGCCCTT GGCATTGAGT GATACTGCCA     58020
     CGAAGAGGGC CGCTGCCCGT AGCGAACTGA TCATGATTTT TCTGCAGCAT CTCTGCATCC     58080
     AAGCTATTCA ACTGCTGCAT GTATTTTGGC AGCGTCTCAG CAGCAAGTTG CTTGATACTG     58140
     TCACTGAAAG ACGTAGGACT TGGCATTTGT GCAGGTGTGG GTGCTGGTGT CACCACCGGT     58200
     TTATGGCTCC CCTCCGAGAA CATGCGTTGG ATAAACCCAA TCACAGAGTG GGCCACTGAT     58260
     GATAACCTCT CAATGATACG GCTGGCTAAG CTGGAACCCT GAGGGCTTTC AGTGCGCCCG     58320
     GCCAGATTGT TTGCATATTG ATCACTTGTT TGCTGTGAGA CTGAGCGCCC AGACATTTCT     58380
     CCTACGCTGC TAGATCCTGA CACAGATGTC GGCAGGGGCA GTGATGTAGA AATAAATGAT     58440
     GATATTTTCA TGACTATTTA TTACCTTGGC TATTAAAACA AGGTTATCTT AGTGGGAAAA     58500
     TAGCCGATGG CTATATAAAA AATCGCTGCT GTTTTTGTTG TTATATTAGA CAAAACAAAA     58560
     ACTAAAAATT ATAGGCTAAA ATTGATGGTC TGCCGAGAGT GCTTTGGTTA AGTTGATATT     58620
     TTATCTAACT ATTATGAGAT CATAATGTAT TCATTTGAAC AAGCTATCAC TCAATTATTT     58680
     CAACAACTTT CGTTGTCTAT TCCAGATACT ATTGAACCGG TTATCGGTGT CAAAGTTGGG     58740
     GAATTCGCCT GCCATATAAC AGAGCATCCT GTCGGGCAAA TATTAATGTT TACCCTACCT     58800
     TCTCTTGACA ATAATGATGA AAAGGAAACC TTACTTAGCC ATAATATATT CAGTCAAGAT     58860
     ATATTAAAAC CCATCTTATC CTGGGACGAG GTTGGGGGGC ACCCAGTGTT ATGGAATCGA     58920
     CAACCATTGA ACAGCCTGGA TAATAACTCA CTATATACTC AGCTTGAGAT GCTGGTGCAG     58980
     GGGGCTGAAC GGCTACAAAC CTCATCACTA ATCTCACCAC CACGGTCATT TAGTTGAGTA     59040
     GATTTTTGGT TGTTGCCTTA TTATACGGAA TGACCTGCCC CCAGGATTAG ATACAACGCT     59100
     CACTTAGTAA TGTCGGATCC TTCACTATCA GAATTACCCT TTCTCCAGGC CGCCGCAAAT     59160
     TCAGACGGCG TCTGATAATT CAGCGTAGAG TGCGGGCGGC ACTCATTATA ATCCTGACGC     59220
     CATTCACTGA TGGTTTTCCT GGCATGACTG ACGTCACTGA ACCAGTGCTC ATTCAGGCAT     59280
     TCATCGCGAA AGCGTCCGTT AAAACTCTCA ATAAATCCGT TCTGTGTCGG CTTGCCGGGC     59340
     TGGATAAGTC GCAGTTCCAC GCCATGCTCA AAGGCCCATT GATCGAGCGC GCGGCAGGTA     59400
     AATTCCGGGC CCTGATCAGT TCTTATCGTC GCCGGATAGC CGCGAAACAG CGCAATGCTG     59460
     TCCAGAATAC GCGTGACCTG CACGCCTGAA ATCCCAAAGG CAACAGTGAC CGTCAGGCAT     59520
     TCCTTCGTGT AGTCGTCCAC GCAGGTAAGG CACTTTATCC TGCGACCGGT GGCCAATGCG     59580
     TCCATGACGA AATCCATCGA CCAGGTCAGA TTGGGCGCCG CCGGACGGAG CAGCGGCAGA     59640
     CGTTCTGTTG CCAGCCCTTT CCGACGCCTT CTGCGTTTTA CGCCCAGGCC ACTGAGGTGA     59700
     TAAAGCCGGT ACACGCGCTT ATGATTAACA TGAAGCCCTT CACGGTGTTA GCGCCAGTGA     59760
     TATAAGACGG TAATTCACCA TTAGTATTGT CCGCTCCACC CAACATGTTG TTTCCTTGAG     59820
     GTTCTCACAC CAGAAAGGAC ATCAACATGC TGAGCAGAGA GGACTTTTAC ATGATAAAGC     59880
     AAATGCGCCA GCAGGGGGCG TACATTATCG ATATTGCGAC TCAGGTGGGT TGCTCTGAAC     59940
     GAACTGTCAG ACGCTACCTC AAATACCCTG AACCGCCAGC CAGAAAGACT CGCCACAAAA     60000
     TGGTTAAGCT GAAACCGTTT ATGGACTACA TCGACATGCG CCTGGCAGAG AATGTCTGGA     60060
     ATAGCGAGGT CATCCTCGCG GAAATTAAGG CGATGGGCTA TACCGGCGGG CGTTCCATGC     60120
     TGCGTTACTA CATCCAGCCC AAACGTAAAA TGCGGCCATC AAAAAGAACG GTTCGCGTCG     60180
     AAACCCAGCC GGGATATCAG CTCCAGCACG ACTGGGGCGA AGTCGAGCTA GAGGTTGCTG     60240
     GGCAACGGTG TAAAGTTAAC TTCGCGGTTA ATACGCTGGG GTTCTCCCGA CGCTTCCATG     60300
     TCTTCGCTGC GCCAAAGCAG GATGCTGAAC ACACCTATGA GTCGCTGGTC CGTGCCTTCC     60360
     GTTACTTCGG CGGCAGTGTG AAAACCGTGC TGGTTGATAA CCAGAAAGCC GCGGTGCTGA     60420
     AAAATAACAA CGGAAAAGTG GTGTTCAACT CCGGGTTCCT CTTGTTGGCC GAACATTATG     60480
     ACTTCCTGCC ACGGGCCTGC CGCCCGCGCA GGGCCAGAAC CAAAGGTAAG GTGGAGCGGA     60540
     TGGTGAAATA TCTTAAGGAT AACGTCTTCG TCCGGTACCG CAGGTTCGAC AGCTTCACCC     60600
     ATGTTAACCA ACAGCTGGAG CAGTGGATGG CGGATGTTGC TGATAAACGC GAGCTTCGCC     60660
     AGTTCAGACA AACACCGGAA CAGCGCTTCG CGCTGGAACA GGAGCATCTG CAGCCGTTGC     60720
     CGGATACGGA CTTCGATACC AGCTACTTCG ACATCCGCCA TGTGTCCTGG GACAGCTATA     60780
     TCGAGGTTGG CGGCAATCGT TACAGTGTTC CCGAGGCTCT GTGCGGGCAA CCAGTCTCGA     60840
     TACGTATATC GCTGGATGAC GAGCTGCGGA GCTACAGTAA TGAGCAGCAG GTGGCCTCAC     60900
     ATCGACTCTG TTCAGCATCG TCTGGCTGGC AGACTGTGCC GGAGCACCAC GCCCCGCTCT     60960
     GGCAACAGGT CAGCATGGTA GAACATCGCC CACTGAGTGC TTATGAGGAG TTGCTGTGAT     61020
     GCATGAACTT GAAGCGCTGC TGAGTCGCCT GAAAATGGAG CACCTGAGCT ATCACGTTGA     61080
     AAGTCTGCTG GAGCAGGCGG CTAAAAAAGA GCTGAACTAC CGGGAGTTCC TGTGCATGGC     61140
     GCTGCAACAG GAGTGGAACG GCAGACATCA GCGCGGCATG GAGTCCCGAC TGAAGCAGGC     61200
     GCGTCTGCCG TGGGTCAAAA CGCTGGAGCA GTTCGACTTC ACCTTCCAGC CGGGCATCGA     61260
     TCGTAAGGTT GTCCGGGAGC TGGCCGGTCT GGCGTTTGTG GAGCGCTGCG AGAATGTGAT     61320
     CCTGCTGGGT CCTCCAGGTG TCGGGAAAAC CCATCTGGCC GTTGCTCTCG GCGTGAAAGC     61380
     AGCGGATGCA GGGCATCGGG TACTGTTCAT GCCACTTTAT GAAGACATTA CTAACATCGG     61440
     GGTGTACTAA TCAACGAGGA GCAGGTCAGG AAATAGCGAT AACCTATAAA TTTGTGGTGC     61500
     CAGTAATATC AGATTTCGCT CAGTAAAAGT TAACACCAAG TTGGAGTGTT GACTTTTATC     61560
     TCCTGTTTTT TTTTAATTTT TAATGTAAAA GACTTGTATT AAGTCCATTC ACTTGGTGGC     61620
     GTCGCCGCCT CCTCATTGGT AATGAGGAGT ACCGGAAGAG TTCTCAATGT GAATGGTTGA     61680
     GCTGTATAAG TTTGTTATAC TTTATATCCA CGGTGATACA ACGTTGGGGT AGCATCTGGG     61740
     AAGGAGAGAA ATAAAAAAAT TCTATATTTT TCTAATTTTA AAGGGTCAGT TATATGCGCA     61800
     CTTACAGTTC ATTACTTGAA GAATTTGCTA CAGAGCTAGG TCTTGAAGAA ATAGAAACAA     61860
     ATGAGTTAGG GCATGGGGCT GTTACCATTG ATAAAATATG GGTAGTACAT CTGGCACCTA     61920
     TCAATGAGAA GGAGTTAGTG GCTTTTATGC GGGCAGGGAT CTTGACTGGT CAGTCTCAAC     61980
     TTTATGATAT TTTGCGGAAA AACCTCTTTA GCCCACTATC TGGTGTAATT CGTTGTGCGC     62040
     TTGATAAAGA TGATCACTGG CTATTGTGGA GTCAGTTAAA CATTAATGAC ACCAGTGGGA     62100
     CGCAACTGGC GAGCGTATTG ACGTCGCTGG TTGATAAAGC TGTTACTCTT TCTTGTGAAC     62160
     CCACAATGAA GAAAGAGGAG GATGATCATC GTCCTTCATC ATCTCATTTA CTGGTTTAAT     62220
     TCTATAAAAG AAAAACGTAC GATATCCATT AATGGGTTTG GTTGAGACTG TAAACAAGAT     62280
     TGTATAATTG CCTGTTTTTG ATATCTTTAC TCCAACAACG GAGACAGGCA AATTTGATCC     62340
     CTCCCCAATA TCCGTACCAG GCTAAATCAG AGATCCGGAC CTTTTTGATG ACTTCGGGCA     62400
     AATTCTGCCG GAGTCAGGTT ATTTAACGAA GAATGCGGAT GAAAATGATT ATATTCTTGC     62460
     CGCCATTGTT CAATTTTCTC CTGAGCATCT TCCAGAGAAA GGAACCCGTG CACGTTCAGA     62520
     CATTCATCCC TCAGACTGCC ATTAAATGAC TCGATAAAGG CATTATCTGT AGGCTTTCCG     62580
     GGGCGTGAAC AGTCCATCGT GACCCTGTTT TCATACGCCC ATCGGTCCAT CGACTTCGAG     62640
     ATGAATTCGC TGCCGTTATC TGTCTGCAGC CTTTGTGGAA TACGCCCCAG CGAATGTTTT     62700
     AATCTGTCCA TGACAGCCAC AACATCATCT CCACGTAACC CCTGACCGAC CTCGATCGCC     62760
     AGACATTCAC GACTAAAATT ATCCACTATA GTTAGCGCCC TGACCCGACG CCCGTTGAAC     62820
     AGATTATCAG CAACGAAATC CATGCTCCAG CACTGCTCTA ACGCGGTCAC TTCTGGACGT     62880
     GCGTGCCTGT GCTTCGCTGT CACATGCCGC CGTGGACGTT TCGAACGTAG ATTGAGACCC     62940
     TCAAGACAGT AAATACGGTG CGTTTTCTTA TGGTTAACAA GCCAGCCTTC TCTCCGCAGC     63000
     AGGATATGAA TGCGCGGACA GCCATAACGG ATGCGCGTCT CCGCAATTTC CCGTATTCGC     63060
     TGAGTAATAG CCCGATCGTC ACGATGGCTA CGATAGTTGT ATACAGTGCG GCTCTGCATC     63120
     ATCAGCCTGC ACCCTCTGCG TACTCCGATA CGGTACGCCG CCAGCAGATA TTCCACGGCA     63180
     TCACGCTTCT GCAGCGGCCT CAGAACTTTT TTCGGATGAC ATCCTGCAGC ATTTCCTTAT     63240
     CCAGACTCAG ATCGGCCACC AGACGTTTGA GGCGCTGATT CTCATCCTCA AGCTGCCGAA     63300
     GACGGCGCAA TTCCGTGACA CCCATTCCCC CAAACTTCTT CTTCCAGTTG TAAAATGTCG     63360
     CTTCCGAAAT GCCCATCTTC CTACAGACTT CTTCCACTCG AGTACCCGTT TCAGCCTGTT     63420
     TGAGTGCAAA AGCGATTTGT TCTTCGGTAT AACGCGTCTT TTTCATAACG AATGACCCCT     63480
     TTTTGGACGG AAAAGAAGGG CCGAAAACTC TACTTTACAG CGGTACTGAA CTAAGGGGGA     63540
     AGATCAAGCA ATCCTTGTTT GTCGATTATT TTAAATTTGT TTTGACTCCT CCAATCTTTG     63600
     ATTCAATAGA CACGCATTCA ATGGTTTTTA TTATATCATC AATGCCGGCC CAGAGATTTT     63660
     CATTATTATT GTTCTTGTAA TTTGTTTTTA ATTGAGTATT CAAACTCCTC TCAATTCGCA     63720
     TCACTTCATC AATATGTTCA AGCTTACACT TTATTAAGTC ATCCCTAAGA GAAATATTTT     63780
     CCTTCTCAAG TTTAGATATT CTTTTCTCTA GCCGAGTTGT TATTTCTTTT TCCTTTCTAT     63840
     TTTTCTCTTT GTTGAAAAAT AAATCAAAGT AGTATTTTGC AAAAAATGTT AACATTACAC     63900
     TGAGTGTGTA AACCAGAAAT TGAATATTTG ATGGTCATGT GGATTTAGGA ATATAAAACC     63960
     CAACCGAAGC CATAAAAATA GCGGGAATTG CATATGATAA AAATGTATAA ATAGTCATTT     64020
     TTATTTATCT GCTTTAGTTT ACATAGTTGT GTTCTATCCC TTTGTCTTTA AAGCTATTAC     64080
     TTAGCTTTTT AGGGGCAATT CTAAGAAGTC CCATAGATGT TTCTAGTTCA TTGGAAAAAT     64140
     TTGGAATACC CTTTGAGGCA TCAAACACCA TGCTATATGT AAACTGAACC GTAAGTTCTT     64200
     TTCTTTCAAC GTCTAGCGAA TTTAAACTTG CCTTAATTCC GAGACATACT GAGTTAAAGG     64260
     AATTTGTTGC TTTATATACT GAAACTTCAT TTGGCTTTCC ATTGCTGAAA AAGTCAAAGT     64320
     TCTCGAAAGT AAAAAGATAT TTAATTTCAT AAATGTTTAA ACTGTCAGTT GTGAGGTCTG     64380
     AAAAATAATA ATCACCTTCA ATATAGGTAA ACTCACCATT ATTTTTATCA AGCATTTTTA     64440
     TATTCTTAAG AGATTCCACT TTTTCTAAAA TAGAGTATAA ATTATTCTGC AAATTCATTT     64500
     TACGCCCCTT AGCTGTTTAT TGTGATTCAT TGATGACTTT ATAAATAGTT GAACGAGCTA     64560
     TATTCATTTT TTTGGCTATT TCTGTCGCGC CCATCCCCTG TTCATGCAAT TCGAGTAGTT     64620
     CCTTTCTGTT GATTCTGCGC TTTCGTCCGA ATTTAACCCC CTTTAGCTTA GCCTCTTCTC     64680
     TCCCTTCATT TGTACGCTCC AGTATTCTCT GTCGTTCGGC TTGAGCCACT GCTGATAGAA     64740
     TAGTGACAAC CATTTTACCC ATTTCCCCAT CGGTACTGAT TCCGTCATCA ATAAACTGGA     64800
     TGGACACACC CTGGGCGTCA AACTCTTTTA TCAACTGGAT CATGTCGACG GTGTCGCGGC     64860
     CAAGACGGTC GAGCTTCTTC ACTAGAATGA CGTCACCTTC TTCCACCTTC ATACGCAGCA     64920
     GATCCAGCCC CTCCCTGTCG GCAGAGCTGC CGGATGCCTT ATCAGTAAAT ATACGATTTG     64980
     CTTTCACGCC CGCGTCTTTG AGTGTTTTGA TCTGAATATC GAGGGATTGC TGACTGGTTG     65040
     ATACCCGCGC GTAACCAAAA AGTCGCATAA AAATGTATCC TAAATCAAAT ATCGGACAAC     65100
     TGGTGTCTAT TATAACAAAA AAGCGATTAA ATAGACACAC AAACCGCACC ATTTCAGTGT     65160
     GTCCGACAAC TTATAATATT TCGGACGGTT AAAAAGTTGT TAACAAATAA CCGTCAGGCA     65220
     GGGAGGCCTG TATGCCAGTC GATTTTCTGA CCACTGAGCA AGAACAGAAT TACGGTTGTT     65280
     ACGTTGCAGA ACCCAATGAC GTGCAACTGG TGCGCTATTT TCATCTTGAC GAGCGGGATC     65340
     TTGCTTTCAT TTACCAGCGG CGGGGAAAGC ATAACCGCCT GGGAATAGCA CTTCAGCTCA     65400
     CAACGGCCCG TTTTCTGGGA ACCTTTATTA CGGATTTAAC CCAAGTTCTG CCAGGTGTTC     65460
     AGCATTTTGT CGCCGTACAG CTTAATATAC GCCGTCCGGA AGTCCTCTCC CGCTATGCCG     65520
     AGCGTGATAC CACTCGCAGG GAACATACCG CGCAGATAAA GGAATATTAC GGCTATCATG     65580
     AATTTGGTGA TTTTCCGTGG TCTTTCCGCC TGAAACGTCT GCTGTACACC CGTGCATGGC     65640
     TCAGCAATGA ACGCCCCGGT CTGATGTTTG ATTTTGCCAC TGCGTGGCTG CTTCAGAATA     65700
     AGATTCTGTT GCCCGGAGCA ACCACACTTG TACGTCTCGT CAGTGAAATA CGCGAAAGGG     65760
     CAAATCAGCG GCTCTGGAAA AAGCTGGCCG CCATTCATTA TCTGACCGAA CTAAACGGCA     65820
     CGAAAAAACG CCTCCTGGAT GATGCTCCTG AACATATTAT TACCGGCCCC TGGAAACGCC     65880
     TGGTGTACGA TGCGGAGGGC CGGATACAAC GTGCCGGTTA CTCGCTTTGT CTGCTGGAGC     65940
     GCCTTCAGGA TGCATTGAGA CGCCGGGACA TCTGGCTGAA AAATAGCGAT CGCTGGGGAG     66000
     ATCTCCGCGA GAAGTTGTTG CAGGGGGAAG AGTGGCAGGC TCAGCGGGTC CTCGTCTGCC     66060
     GGGCGTTGGG ACATCCCACC GATGGACATA AAGGCGTACA ACAGTTGGCG GTCCAACTGG     66120
     ATGAAACCTG GAGAGCAGTT GCATCCCGCT TTGAAGGAAA TACGGAAGTC CATATCTGCA     66180
     ATGACGGTAA ATATCCTTCC CTGACTATCA GCAGTCTGGA GAAATTGGAG GAGCCACTGT     66240
     CGTTGCTTCG TCTAAACAAT CGGGTCAGGC AACTGCTACC GCCGGTAGAT TTGACGGAAC     66300
     TGTTGCTTGA AATAGATGCC AGAACGGGAT TTACACGTGA GTTTACACAT GTCAGTGAAT     66360
     CCGGGGCTCG AGCGCAAGAT CTGCACATCA GCCTGTGCGC GGTACTGATG GCTGAAGCCT     66420
     GCAATATCGG GCTGGAACCG CTGATAAAGC ACAATATACC GGCACTGACG CGCCACCGGC     66480
     TCAGTTGGAT GAAACAGAAT TACCTTCAGG CAGAAACGCT GGTCAGCGCC AATGCCCGGT     66540
     TAGTTGATTT TCAGTCCACG CTGGAGCTTG CTCGCCGCTG GGGTGGCGGC GAGGTGGCTT     66600
     CAGTTGACGG TATGCGCTTT GTCACGCCAG TGAAAACGGT CAATTCCGGG CCGAACAGAA     66660
     AATATTTTGG CTCCGGGCGT GGCATCACCT GGTACAACTT CGTCTCTGAT CAGTACTCTG     66720
     GATTCCACGG CATCGTTGTC CCCGGCACAT TACGGGATTC CATTTTTGTG CTGGAAGGCC     66780
     TTCTGGAACA GCAGACAGGG CTGAATCCGG TTGAGATCAT GACAGACACA GGCGGTACCA     66840
     GCGACATTAT ATTTGGCCTG TTCTGGCTAC TTGGGTATCA GTTTTCCCCC CGTCTGGCTG     66900
     ATGCCGGTGA AGCTGTATTC TGGCGAGTGG ATAAATCGGC AAATTACGGA GCACTTGATG     66960
     AGCTTGCTCG TGGGTGTGCA GATCTGTCGA AGGCAGAAAA TCAGTGGGAT GAGATGATGC     67020
     GAACTGCGGG TTCGCTCAAG CTGGGCACCA TTCATGCTTC AGAACTCATT CGCTCACTAC     67080
     TGAAAAGCTC ACGGCCGTCA GGGCTGGCTC AGGCCATCAT GGCGGTGGGG CGTGTAAACA     67140
     AGACGCTGTA TCTTCTTAAT TATATTGATG ATGAAGATTA TCGTCGCCGG ATCCTGACGC     67200
     AACTCAATCG GGGAGAGAGC CGCCATGCCG TGGCACGTGC AATTTGTTAC GGGCAGCGCG     67260
     GTGAGATCAG AAAACGCTAC CGTGAGGGGC AGGAAGATCA ACTGGGCGCA TTGGGGCTGG     67320
     TCACTAACGC AGTGGTACTG TGGAACACGC TTTATATGCA GGAAGCACTG AGCTGGATGC     67380
     GCAGTAATGG AGAAGAAACC AGGGATGAGG ATATCGCCCG GTTATCTCCA CTGATGCACG     67440
     GGCATATCAA TATGCTGGGG CATTATACGT TCACGCTATC GGATGATATT TTAAACGGAG     67500
     AACTGAGAGC ATTAAATTTC AATTTAAACA ATGAATTATC TCCTTAACGT ACGTTTTCGT     67560
     CCCATTGGAC CTCAAAACCC ATCACCGGGT AGCCACGGTT GACCACAATG CGATCCAGTA     67620
     CTCTGATGAC GTGCTGTGTT GGCAGGTTCA GATCGATTTC AATCGCCAGC TTTTCACGAT     67680
     TGTAATCATC CACACAGATC AGTGCATCGT GCATAAAATC GACCGCCCCG CTCAGGTTAA     67740
     GTCGTTCCGG CACCGCCAGC GGTGATGGGG TACGAGCTGG CAGGCGTTGT TTCCCTTTGC     67800
     GGCGAATATT GAGTTTCAGG AGACAATAGA TACGGTGTAC CCGTTTATGG TTCCAGACAT     67860
     ATCCCCATCG CCTCAGGATT TGAAAAACCT TAAAGAAACC GTCGCGTGGA TAACGCTCGA     67920
     CCACTGATCT GGTGTTCAGT GAATCAGTTT TTTTCGCATG GTGAACTCCT CAAAATACAT     67980
     ATTCAGTATG TCGGAAATTC TCTAAAAGAG AATGGTTATT TTTGATGGTC ATTACAGTAC     68040
     AGATTATTTT ATATAATTTA TTACCCACTT TTTTTATATT TTTTGATAGA GGGAGGATAA     68100
     TAAATAAAAA AATTATAAAG TAATGGTTTC TTGCTGTTTT CTGGTGTTTT TCTCTATATT     68160
     TATGTTTTTT TGGTGAAAAT AAGTGTGTTG TCAGGTAATT TCAAAGGATT ATACAAAATA     68220
     TCCGGTTTGA GGTGAGGGAT TTTTTTTTAT ATTATCTGCA TAACACTTTT CGTGTTATCT     68280
     GAAAGTATTT TGTAGTGGGC TGACTCCGAC GATTCGATTA GAGATTACAA ACGATGCATA     68340
     TATTCAGTAG TTAATCGATA TCTTTTTAAG ATCGATTAGT GCTGTTTTTT GCATGATTAT     68400
     CAGAAAATAA GTCATAGATA ATCCTATCCC TCTTCTATGG GAGGCGTTCG CTTTAATTAA     68460
     TATATTTCTC AGATGTTATA ACTGAGCTTT TATTCACGGG AAATTAAAGA AATATAAAAG     68520
     GTGCTTACAA TGACTAAAGA TTTTAAGATC AGTGTCTCTG CGGCATTAAT ATCTGCGTTG     68580
     TTCTCATCTC CATATGCATT TGCCGAGGAG CCCGAGGATG GCAGCGATGG TATTCCTCGT     68640
     TTGTCAGCAG TTCAAATAAG CCCAAATGTT GATCCTAAAT TGGGTGTGGG ATTATATCCA     68700
     GCAAAACCAA TATTACGTCA AGAAAACCCA AAATTACCTC CACGAGGTCC ACAAGGTCCA     68760
     GAAAAAAAAG AGCTAGATTA GCAGAAGCAA TACAACCACA AGTACTAGGC GCAGGCGGGC     68820
     TCAATGCTCG CGCTAAGGAT CCCTATAGCA TTGCGATTGG TGCTACTGCT GAAGCAGCAA     68880
     AACCAGCAGC AATTGCTGTG GGCTCTGGTT CAATGGCAAC AGGCGTTGAT TCTGTTGCAA     68940
     TTGGTCCTTT AAGTAAGGCA TTGGGAGATT CGGCAGTTAC TTATGGGGTA AGTAGTACCG     69000
     CCCAGAAAGA TGGAGTAGCT ATCGGTGCGA AAGCATCAGC TTCGGATACT GGTGTCGCTG     69060
     TCGGTTTTAA CTCGAAAGTT GATGCACAAA ACTCTGTTGC CATTGGACAC TCTAGTCACG     69120
     TTGCGGCAGA TCATGGTTAT TCAATTGCAA TTGGGGATCA TTCTAAAACT GACCGAGAGA     69180
     ATAGTGTATC CATTGGTCAT GAAAGCCTTA ATCGCCAATT AACACATCTT GCGGCTGGCA     69240
     CTGAAGACAC TGATGCAGTG AATGTCGCGC AATTAAAGAA AGAAATGGCT GAAACATTGG     69300
     AAAATGCACG TAAAGAGACT TTGGCTCAGT CTAACGATGT TTTGGATGCG GCCAAAAAAC     69360
     ACTCAAATAG TGTTGCCAGA ACAACTTTAG AAACTGCTGA AGAACATGCA AATAAAAAAT     69420
     CAGCTGAAAC GTTAGTAAGC GCTAAAGTGT ATGCAGACAG CAATTCTTCT CAAACACTAA     69480
     AAACTGCAAA TAGCTATACC GATGTGACTG TAAGTAATTC GACTAAGAAA GCAACCCGTG     69540
     AATCTAATCA ATACACAGAT CATAAATTCA GTCAACTTGA CAACCGTTTA GATAAACTTG     69600
     ACAAACGAGT TGACAAAGGT TTAGCCAGTT CAGCCGCTTT AAACAGCTTG TTCCAGCCAT     69660
     ATGGTGTAGG GAAAGTAAAC TTTACTGCAG GTGTCGGGGG ATATCGTTCT AGTCAGGCAT     69720
     TAGCAATTGG TTCTGGCTAT CGTGTAAATG AGAGTGTCGC ATTTAAAGCC GGTGTGGCTT     69780
     ATGCCGGTTC CTCGAATGTC ATGTACAACG CATCATTTAA TATCGAGTGG TAATATCATT     69840
     TAGAAATTAA CAAGTCTATA GGAAAACACC GATTACATAA TCGTAATTGG TGTTTTATTA     69900
     ATATGCTAAT GAAAAATTTT TTAGTAATTC TGCTTTTTAT CATGGTTTCA GTTACATGGG     69960
     GAACTACATG GTTAGCGATG AAATTAACCG TCGAAACAAT CTCTCCGATA TTTGCTACGG     70020
     GCATCCGATT TATGTTGGCT GCGCCTGTAT TAATCCTAAT TACATCAACC CGCAAATTCA     70080
     GCGAAGCAGA GTAAACACTG CGCGTTATTT TGAGCAGGCG GCACAATTCG ACCACTGGCC     70140
     ATTTTGTTTT CAGCCGTGTT AACGCAAAGA TTTGATGGGG AACTCGCTCA TCAACACGGC     70200
     TGCCTGCTTT AGTATTTCTT TTTCCATTTC CAGCCGTTTA ATCTGCGCCC TGAGCGACTG     70260
     GATTTCACGT TGCTCTGGTG TCAGTGCAGG ATTGTCCGGC GTCACCCCGC TGACTTCTTC     70320
     TTTGTACTGG CGTATCCATT TACGCAATTG GCTGGGATCC AGCTCCAGAG CGCGTGCAAC     70380
     CTCGATGGTT GACCGCTGAT ACTTAACGAC CTGCTCAATA GCTTCCAGTT TGAATTCAGG     70440
     AGAAAAACGG CGTTATCCAG AACGTGAAGC GATTTACGCG GCGCTGGAGT AAACCAATGG     70500
     GCGGCATGGC CGCCCATTGG TTTACTTATC AGTACGCAGT GCCATTTTGC GGCCGCGCGA     70560
     AAACCCTTGT CACTCTAAGT AACGCGGAGG GTGAGTCGGT ACTGATTTCT CCGCAGCAGA     70620
     ATACCGCGCA GGATATTTCC CTGTTCATGC CCCGGGAACT GACGGTCAGT CAAGGTGATC     70680
     GGGTGCGATT TACCCGCTCA GACACAGACC GGGGTTATGT GGCCAATAGT CTGTGGGAAG     70740
     TGGCGGGTTT TACTGAAGAC GGTGCTGTGC GTTTTCGTCA GGGCGACCAG GAAAAGATTG     70800
     TCGATCCACA AAAGGCCACC GAAGACCGCC ATATTGACCT GGCCTACACG CTGACAGCCT     70860
     ATGGTGTGCA AGGGGCCAGT GAGCGGTTTG TCATCGCCCT GTTTGGGGCT GAAGGTGGCA     70920
     GAAAGAGGAT GGCCACTCTG CATCTCTTTA CGTGACATTG TCACGCGCCA AAGAGCATGT     70980
     CTAGGTCTAT ACGGACAACG TTGTTAAATG GTTGGGTCTT GCCGGGCAGT CAAATGCCGG     71040
     AAAAACCGCG CATTGTAGTG GATCAGTAAT ACCGGACACC CTCAATAGCC TGTTAATTTA     71100
     ATGACAGCCA ATTGAGGTAA TTGATAATGA CTCAACCTAA ACAGACCAAA CGCCGTTTTT     71160
     CTCCTGAATT CAAACTGGAA GCTATTGAGC AGGTCGTTAA GTATCAGCGG TCAACCATCG     71220
     AGGTTGCACG CGCTCTGGAG CTGGATCCCA GCCAATTGCG TAAATGGATA CGCCAGTACA     71280
     AAGAAGAAGT CAGCGGGATG ACGCCGGACA ATCCTGCACT GACACCAGAG CAACGTGAAA     71340
     TCCAGTCGCT CAGGGCGCAG ATTAAACGGC TGGAAATGGA AAAAGAAATA CTAAAGCAGG     71400
     CAGCTGTGTT GATGAGCGAG TTCCCCATCA AATCTTTGCG TTAACACGGC TGAAAACAAA     71460
     ATGGCCAGTG GTCGAATTGT GCCGCCTGCT CAAAATAACG CGCAGTG                   71507
//

If you have problems or comments...

PBIL Back to PBIL home page