(data stored in SCRATCH zone)

HOGENOMDNA: YERPP_2

ID   YERPP_2; SV 1; empty ; DNA; empty ; PRO; 137010 BP.
XX
AC   NC_009378;
XX
PR   Project: 58619;
XX
DE   Yersinia pestis Pestoides F plasmid MT, complete sequence.
XX
OS   Yersinia pestis Pestoides F
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-137010
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Di
RA   Bartolo,G., Chain,P., Malfatti,S., Shin,M., Vergez,L., Schmutz,J.,
RA   Larimer,F., Land,M., Hauser,L., Worsham,P., Chu,M., Bearden,S., Garcia,E.
RA   and Richardson,P.;
RT   "Complete sequence of plasmid MT of Yersinia pestis Pestoides F";
RL   Unpublished
XX
RN   [2]
RP   1-137010
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-APR-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-137010
RG   US DOE Joint Genome Institute
RA   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del
RA   Rio,T., Dalin,E., Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M.,
RA   Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Worsham,P., Chu,M.,
RA   Bearden,S., Garcia,E. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (05-FEB-2007) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000670.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773191
CC   Source DNA and bacteria available from Emilio Garcia
CC   (garcia12@llnl.gov)
CC   Contacts: Emilio Garcia (garcia12@llnl.gov)
CC   Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..137010
FT                   /strain="Pestoides F"
FT                   /mol_type="genomic DNA"
FT                   /organism="Yersinia pestis Pestoides F"
FT                   /plasmid="MT"
FT                   /db_xref="taxon:386656"
FT   gene            87..1109
FT                   /db_xref="GeneID:5061684"
FT                   /locus_tag="YPDSF_4029"
FT   CDS_pept        87..1109
FT                   /locus_tag="YPDSF_4029"
FT                   /gene_family="HOG000010171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597193"
FT                   /db_xref="InterPro:IPR007101"
FT                   /db_xref="GeneID:5061684"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVVRMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT                   /protein_id="YP_001154656.1"
FT   misc_feature    87..959
FT                   /note="Transposase and inactivated derivatives [DNA
FT                   replication, recombination, and repair]; Region: COG4584"
FT                   /db_xref="CDD:34222"
FT                   /locus_tag="YPDSF_4029"
FT   misc_feature    <111..209
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cl01116"
FT                   /db_xref="CDD:174535"
FT                   /locus_tag="YPDSF_4029"
FT   misc_feature    438..812
FT                   /note="Integrase core domain; Region: rve; cl01316"
FT                   /db_xref="CDD:154329"
FT                   /locus_tag="YPDSF_4029"
FT   gene            1109..1888
FT                   /db_xref="GeneID:5061741"
FT                   /locus_tag="YPDSF_4030"
FT   CDS_pept        1109..1888
FT                   /locus_tag="YPDSF_4030"
FT                   /gene_family="HOG000113193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase/IS protein"
FT                   /transl_table="11"
FT                   /note="SMART: ATPase (1.7e-13)"
FT                   /db_xref="GI:145597194"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:5061741"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT                   /protein_id="YP_001154657.1"
FT   misc_feature    1112..1885
FT                   /note="transposase/IS protein; Provisional; Region:
FT                   PRK09183"
FT                   /db_xref="CDD:169696"
FT                   /locus_tag="YPDSF_4030"
FT   misc_feature    1367..>1669
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_4030"
FT   misc_feature    1433..1456
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_4030"
FT   misc_feature    order(1436..1459,1619..1621)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_4030"
FT   misc_feature    1607..1624
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="YPDSF_4030"
FT   gene            complement(2022..2630)
FT                   /db_xref="GeneID:5061730"
FT                   /locus_tag="YPDSF_4031"
FT   CDS_pept        complement(2022..2630)
FT                   /locus_tag="YPDSF_4031"
FT                   /gene_family="HOG000118670" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597195"
FT                   /db_xref="GeneID:5061730"
FT                   /translation="MTFKMTDKARTLKVYNLLEGTNEYIGVGDAYIPPFTGLPANCTEI
FT                   EPPTTTEGFAAVFDFTKQEWSLEEDHRGKTLYSTETGEPVFIAELGPLPENVTYISPNG
FT                   EYQKWDGSAWVKDEEAEKTALVGEAEQNKSVLMKNVSQQISLLQDAIDLDMATDEEKET
FT                   LVALKKYRVLLNRVDTSLAPDIDWPILGNEEEDSANLIK"
FT                   /protein_id="YP_001154658.1"
FT   misc_feature    complement(2067..2417)
FT                   /note="Caudovirales tail fibre assembly protein; Region:
FT                   Caudo_TAP; pfam02413"
FT                   /db_xref="CDD:145517"
FT                   /locus_tag="YPDSF_4031"
FT   gene            complement(2932..5820)
FT                   /db_xref="GeneID:5061750"
FT                   /locus_tag="YPDSF_4032"
FT   CDS_pept        complement(2932..5820)
FT                   /locus_tag="YPDSF_4032"
FT                   /gene_family="HOG000120054" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage tail protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597196"
FT                   /db_xref="GeneID:5061750"
FT                   /translation="MWYREGTITFTQGSDALSGTGTYWNVTANGVLPGMIVIGPDNKLY
FT                   EIKRVISDTSLILAEPYTGETQKEVPCRIITTYEGDLTQFSARFTALMTRMSADSKTMR
FT                   SWLTAVDEVTLEREDGTEVTVKSLTQIVDEHNANQKWYTDNADAINAAGEKAREAAERA
FT                   LAAAQSSSEARAKADEAAQSSASASEYKTAAELSAAASKASEHGAAESAASSKASASAA
FT                   KTSEDNSAASETNAAESKAAAALSASSSANSASEALQYAESAKTSKEAAAASEAAAANS
FT                   ENEARTSKDTAVAAAAEASANATSADASRHDVDTNKAEVSRMKDEVFAARDSTIQYSEE
FT                   AKTAADTAAREAATKTSDQLLSAVKSEAEKANSASASAQGFADDAKRFRDEAQEIAEGS
FT                   KVNDATTSQQGVVQLSSATDSESETLASTPKAVKTVMDAVALKAPIDSPALSGAPTAPT
FT                   PAITAAGREIATAAFVASKVAQLVGSAPEALDTLNELAAALGNDPNFATTITNMLARKQ
FT                   PLDGTLTALSGRSPQGVIDYLGLLNTVNLAAGSIQKSQNGADIPDKRLFVKNIGAVSSA
FT                   RISFVKESGWYKLATVTMPQGASTALITLIGGAGYNAGLYDQAAISEIVLRSGNWNPVG
FT                   ITATLWQRSPAGAQGVAWINTSGDVYDIYVNVGQYSIDVIALSDCTNNASIVLFGTPEY
FT                   VATKPASSTNGANYILYSSVLPPPESYPVGAPIPWPNDVAPSGFAIMQGQTFDKSVYPK
FT                   LAAAYPSGVLPDMRGWMIKGKPTSRAVLSLEQDGIKSHAHNAAASSTDLGTKPTTTFDY
FT                   GTKTSSGFDYGTKSSNSTGAHAHSLSGSTSSSGAHAHTVTAHTQYPRSTDSRNQNAVGK
FT                   QYNTQQTTANAFNVWTSSAGDHAHSISGTAVSAGAHAHTVGIGAHAHSLSIGSHSHSVA
FT                   IGAHSHTITIAACGNAENTVKNIAYNYIVRLA"
FT                   /protein_id="YP_001154659.1"
FT   misc_feature    complement(<4162..>4653)
FT                   /note="Phage-related tail fibre protein [General function
FT                   prediction only]; Region: COG5301"
FT                   /db_xref="CDD:34890"
FT                   /locus_tag="YPDSF_4032"
FT   misc_feature    complement(4477..4608)
FT                   /note="Phage tail fibre repeat; Region: Phage_fiber_2;
FT                   pfam03406"
FT                   /db_xref="CDD:146180"
FT                   /locus_tag="YPDSF_4032"
FT   misc_feature    complement(3508..3651)
FT                   /note="Phage Tail Collar Domain; Region: Collar; pfam07484"
FT                   /db_xref="CDD:148855"
FT                   /locus_tag="YPDSF_4032"
FT   gene            complement(5901..6518)
FT                   /db_xref="GeneID:5061713"
FT                   /locus_tag="YPDSF_4033"
FT   CDS_pept        complement(5901..6518)
FT                   /locus_tag="YPDSF_4033"
FT                   /gene_family="HOG000219365" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597197"
FT                   /db_xref="GeneID:5061713"
FT                   /translation="MDETPVISAVRNAVRSLSGGISCEIQFDGLVMDDGVTPLFLPYTL
FT                   SESDTSPLAKKILEALESESSGGIAPYPEQGEYIERLKVEKLAVINDWRLRQECRTVYF
FT                   EWNGHRWDANDISKERLDISLKAAESGLPDNFFWTDADNNDVPVTQEQLKELGMRMTQT
FT                   LFDRKFGAHERQRVMKKDILEMCDPELIKNYQVGWGDGSARR"
FT                   /protein_id="YP_001154660.1"
FT   gene            complement(6536..11167)
FT                   /db_xref="GeneID:5061731"
FT                   /locus_tag="YPDSF_4034"
FT   CDS_pept        complement(6536..11167)
FT                   /locus_tag="YPDSF_4034"
FT                   /gene_family="HOG000266962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage tail protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597198"
FT                   /db_xref="GeneID:5061731"
FT                   /translation="MEQFKKKRLPLLIAGAGGKKSSGSSRTPVEADDTVNSRAMASILD
FT                   LLGEGVIGGLVDGAKSIFVDDLPILNEDGSSNFSGITWDFRDGSQDQTPMAGFDFVETP
FT                   KSVNIQLKRMHDVTIAIDNDEADRVRVILKFPSLRSIDKKTGDTNGTTVKYKFQIANGD
FT                   NAFKDAIAEGESASEIALTAKKTGVYYRSYELKLPKPGRAYKVRVLRLTDDSNTQYIFN
FT                   DTWVDSIGEIVDTPMNYPNSALVGLKVNSEQFGSSMPSRSYLVRGLKIRVPSNYDEHTN
FT                   TYIGVWDGTFKLLSSSNPAWILFDLLTNARYGLGQYVSESMIDLGQIYQIGRYCDEEID
FT                   NGFGGKEKRFAINTQITSRQDAYRLIQDIAGAFRGMVFWAGGMVNVMQDSPSDPVMMFT
FT                   NANVKDGMFSYKGSARKDRPSVALVTYNNKEDGYKQNIEYVEDQEAMRRYGERKTEVVA
FT                   FGCTSRGQAHRVGLWLLYTARMESDVISFTAGLDASFLMPGETVLIQNKYRAGKRNSGR
FT                   IVAFTKNSITLDAPVTLNKAGSYIRILNQEGEIVERDILETGEDITKVTFSKALNSGDM
FT                   PVMNGVWTITEPDLEPMRVRVINVAQGEAQGTFNVTVVQNNASKYEAIDNGATLIPENN
FT                   TVLDPTYSKPTNLQVTEGTYISSPGNLSIKLVATWEGKSAEYWISWRRSDENNVSNWQS
FT                   ARVTEEQFEILNIAENGQYDIQLYAVSFSGKKTDIISTVYQVKGTMTPPGSPTSLTAVG
FT                   DYRNVILNWVNPDSIDLDHINVYASQTNDLETAKLVAEAASTTFTHAGLGDSETWYYWV
FT                   RAVNKRGMLSPPNSNLGTEAMTRDVLSFLTGKITSSELGQELLEEIDAKASQDAVDAIN
FT                   KQMEESLKELDQSVADLDSKLEDTSGRIEQVQNDLKNEVSGTLDKVNDALQQVEDSNAA
FT                   LVELQETVSEQGKAIAGAVEAAHAALDNASALIAEEREARVEGDKANAKQIEAMKSSVD
FT                   DSVAAVEEMKKTVAEVERASAEASTNIEALAKTNIDLALRQDEDQHKQMVNNAKIATTQ
FT                   KTFADDMSAMASKVEEIRAEIGEDIRASILEETTARVEADKTIATHISKLEAQLNDDIS
FT                   AAIVSEQEARATADETLSRQITTLQAKVEGDISAALTEEQIARATADEALSKQITQLKA
FT                   QNGEDIKAAVAEETQARTDADGALASQISSLKAQTAEDIKAAVDTETKARTDADSALAG
FT                   QITNLQAQTGKDINAAITSEATARANADGALGKRIDTVKAEVDGNSALIQQQAKAIADT
FT                   DKKVSAAWTLKMETSTSGGQKYVAGIALGIDSTGLSQFLVQADRFGLVNSVNGKITTPF
FT                   VIENSVAYMNGAYIKDGTITNAKIGNVIQSNDYAAGSRGWIIPKDGSPEFNNGTFRGNI
FT                   AANSGTLNNVTIAQNCQILGKLHANQIDGDIVKAYMVNGSSIYIAPQTFARIIYVVNGY
FT                   YYNKPSEDINTYSWSRITEYTVNGVKQQIYGMREGSKNQSGLFGYYNLPAGQSATVDVY
FT                   TWHRQRKYDHRVNEPYLILVFKA"
FT                   /protein_id="YP_001154661.1"
FT   misc_feature    complement(8477..11092)
FT                   /note="Phage-related protein, tail component [Function
FT                   unknown]; Region: COG4733"
FT                   /db_xref="CDD:34348"
FT                   /locus_tag="YPDSF_4034"
FT   misc_feature    complement(8993..9241)
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="YPDSF_4034"
FT   misc_feature    complement(order(8996..8998,9041..9043))
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="YPDSF_4034"
FT   misc_feature    complement(7691..>8632)
FT                   /note="Chromosome segregation ATPases [Cell division and
FT                   chromosome partitioning]; Region: Smc; COG1196"
FT                   /db_xref="CDD:31389"
FT                   /locus_tag="YPDSF_4034"
FT   misc_feature    complement(7412..>7921)
FT                   /note="electron transport complex protein RnfC;
FT                   Provisional; Region: PRK05035"
FT                   /db_xref="CDD:167885"
FT                   /locus_tag="YPDSF_4034"
FT   misc_feature    complement(7112..7348)
FT                   /note="Domain of unknown function (DUF1983); Region:
FT                   DUF1983; pfam09327"
FT                   /db_xref="CDD:150106"
FT                   /locus_tag="YPDSF_4034"
FT   misc_feature    complement(6629..7015)
FT                   /note="Fibronectin type III protein; Region: DUF3672;
FT                   pfam12421"
FT                   /db_xref="CDD:152855"
FT                   /locus_tag="YPDSF_4034"
FT   gene            complement(11189..11776)
FT                   /db_xref="GeneID:5061737"
FT                   /locus_tag="YPDSF_4035"
FT   CDS_pept        complement(11189..11776)
FT                   /locus_tag="YPDSF_4035"
FT                   /gene_family="HOG000119566" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage tail protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597199"
FT                   /db_xref="GeneID:5061737"
FT                   /translation="MSELVHVQLGGPMARHFGRHWHLKVRNTKQALDLVEANRPGLKAW
FT                   MKRNMKTYDKYHIQITNKQGHKWSVDESEFQMMGQSDNIAKIRITPVPRGSGGKAFGWF
FT                   QTVVGALVMVASFWFPALAPLGLSLMMGGISQLISPQATNDSVRQADNSNSFYFDGPQN
FT                   TTNQGNPVQLIYGEEILVGSQVVSSSITIDQL"
FT                   /protein_id="YP_001154662.1"
FT   misc_feature    complement(11195..11752)
FT                   /note="Bacteriophage lambda tail assembly protein I;
FT                   Region: Lambda_tail_I; cl01945"
FT                   /db_xref="CDD:120982"
FT                   /locus_tag="YPDSF_4035"
FT   gene            complement(11764..12522)
FT                   /db_xref="GeneID:5061634"
FT                   /locus_tag="YPDSF_4036"
FT   CDS_pept        complement(11764..12522)
FT                   /locus_tag="YPDSF_4036"
FT                   /gene_family="HOG000119554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage tail protein"
FT                   /transl_table="11"
FT                   /note="SMART: Mov34/MPN/PAD-1: (7.6e-24)"
FT                   /db_xref="GI:145597200"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="GeneID:5061634"
FT                   /translation="MQEIYLTAIKRYPNEACGFLVRTTGEKYRFMEARNVSENPENTFV
FT                   MHADDIIAAEDAGDVVAIWHSHTDESADASDADRAGCEATEVPWLILAVRKNVEGDAPF
FT                   HFSEMNVITPDGFEMPYLGRPYVFGVFDCWMLCRDYLKREFNVELNPNPHLHIPSWYTG
FT                   DTDILDQNYRNEGLVRLAPGTEPQRGDVFFIQYGKMPDHCAVYIGDGMILHHQIDRLSC
FT                   RAYYGGMYQKHTTHHLRHRDLLKGDETCLS"
FT                   /protein_id="YP_001154663.1"
FT   misc_feature    complement(12172..12522)
FT                   /note="Mpr1p, Pad1p N-terminal (MPN) domains; Region: MPN;
FT                   cl13996"
FT                   /db_xref="CDD:164354"
FT                   /locus_tag="YPDSF_4036"
FT   misc_feature    complement(11827..12156)
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="YPDSF_4036"
FT   gene            complement(12554..13252)
FT                   /db_xref="GeneID:5061722"
FT                   /locus_tag="YPDSF_4037"
FT   CDS_pept        complement(12554..13252)
FT                   /locus_tag="YPDSF_4037"
FT                   /gene_family="HOG000119542" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage tail protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: Phage minor tail protein L: (2.6e-190)"
FT                   /db_xref="GI:145597201"
FT                   /db_xref="InterPro:IPR006487"
FT                   /db_xref="GeneID:5061722"
FT                   /translation="MGIKADIQSLSPSALIELFELDMSNTTSGGKLFFHAGTNELMEPV
FT                   VWQGVSYEPWPIKASGFDKTGQGTLPRPKIQVSNFAGTVSAEVQANDDLVGCRIIRKMT
FT                   LARFLDAANFKDGNPTADPNQHFPDEMWFVEQKTLETHEVVEFELSSVFDLMGVQLPYR
FT                   QIIKNTCPWKYRGPECGYTGPYFDKNNQQTTMSGADYCTKRYDSCNARRNYFANGVIHF
FT                   GGFIGATRYG"
FT                   /protein_id="YP_001154664.1"
FT   misc_feature    complement(12560..13237)
FT                   /note="Phage minor tail protein L; Region: Phage_tail_L;
FT                   cl01908"
FT                   /db_xref="CDD:141331"
FT                   /locus_tag="YPDSF_4037"
FT   gene            complement(13342..13677)
FT                   /db_xref="GeneID:5061757"
FT                   /locus_tag="YPDSF_4038"
FT   CDS_pept        complement(13342..13677)
FT                   /locus_tag="YPDSF_4038"
FT                   /gene_family="HOG000119530" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage tail protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597202"
FT                   /db_xref="GeneID:5061757"
FT                   /translation="MERLTFNWYPDYESEKTVKPNVTVLNFGDDYEQRQAKGLNRIKEE
FT                   WSLTFTRSYDVINAVDDFLTARAAVESFYWTNPRGKKMVVVCDSHTVKRYQGYLVLTAT
FT                   FRQIYEG"
FT                   /protein_id="YP_001154665.1"
FT   misc_feature    complement(13348..13677)
FT                   /note="Phage minor tail protein; Region: Phage_min_tail;
FT                   cl01940"
FT                   /db_xref="CDD:154665"
FT                   /locus_tag="YPDSF_4038"
FT   gene            complement(13719..18296)
FT                   /db_xref="GeneID:5061751"
FT                   /locus_tag="YPDSF_4039"
FT   CDS_pept        complement(13719..18296)
FT                   /locus_tag="YPDSF_4039"
FT                   /gene_family="HOG000266963" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597203"
FT                   /db_xref="GeneID:5061751"
FT                   /translation="MSQNVEFILSLEDKQFTASIDRAGKLLTRFGEQATKPAQKINNLE
FT                   RSLGSVSRIIGVLESKLDVTAEKLQDVAAGFELVSDVSRKTRGSITSLNSGLKTLIERV
FT                   DTTTSSVNKLTTSLRKVQSELNEFSDWATFAGKSASRFGTEVKEASASVSGMNTRLNTT
FT                   TKRLSNWGVTTSQAAEGLKKVRDQMDAVIGRQQLISKPVRVRTSSYGDGGGNGGGGRHS
FT                   GSYGHGGRSAESGVFSGLRGNIFLLGEIGDAARTVTDILFGWQKPIIEAASEMERMRVM
FT                   LRGLNKDKANPGKAAAEDMQYIVDMAQNAPFAMQALTDSFVKFRSAGLDPTDGSLKALV
FT                   DSVARFGGDSELLKRAAVAVQQMSGKGVVSMEELRQQLGEAVPNAMKAMADAAGITMGE
FT                   LTKAVSTGTVEAKQALSLMFVGLRAENENAAKDMMQTYTGALAQLQTSFTLFADRVGQA
FT                   GYLDSLTKGMKELASIMNSAEGISFANSLGSGLSTAIDGLRELAQWLAKNQELVISLGK
FT                   VVAAMVAFKLMRAGIAGVIGTAGQMVNTFTKMSTVLQAPFNLGATAVTRFNRAARMGLA
FT                   PIPSLIFAIRGAITGLQGAFAGLTAFIAANPIGAAFTVATVAVAGLITYMTMLRSETSK
FT                   VVDEIRKIPEAMTAAKRAQMAARAAELEKQIQRDQQALKTGESVNYYSTAAGPVAVKES
FT                   KEVVEARLKKNQEEYERTTGTMALGDGAVAKRLAKEAAESQIEKIRADNQVFSATFVKA
FT                   RQEALDKIQKINDDKSLSDDEKNKLLAPLREKVNKSYLEPAQKLVYDLSSRKNATEKQI
FT                   AHFSDMLEKAKKEGNTEQVQKLQGSIRGYQEHLEAVAQELTQAEFERDSAAKTGKGVMS
FT                   NQGTVLGLGTTDKAAQKALAQYMRNQMDSATYQRTLPDGTAMLDFEGKPIIGPKQLKTQ
FT                   LNLQKASSASSLEKMSDEERAAAIAALTKAREQDAAAAEKAGQRTANASQRAARKEENA
FT                   QRKLAAGYQKALDKADQLMGQMGESSKATVSFDQSLRDTTKSLTELANAVPNEFITQEM
FT                   IDKAKSRLADLANASDDYREMFNRRNVEQMISTWAPESDSIISAGYKPSREEKVADFND
FT                   TYNRNLKALMDLRDQASDPKIVALYTKQINQLVAAGNTALIKETGTATQKLALEYENLA
FT                   EQLENSWSNLFSNMTDTLTDFVMKGKLDFSSLAESILRDITNMVVKTQITLPLMNMLGM
FT                   GTTAAGSSQSGNLLSGVASAVANQGVRMNAVNGDKSVGEATKETSSSVSGLGQTTQQTT
FT                   SAIGSATNAIGNWVNGLFTSTEAKDAETKAVKTSIFSMQNLSSVTGALSAAFAMLGANM
FT                   SGSGNKWLSFGATIASGLVSAWAGGGFDNIGSGSSGSNSGFNNLTGSASDGTGGIPAIP
FT                   KFAKGGIFGKDGVVPLRAYQKGGIADSPQLALFGEGDMNEAYVPLPDGRSIPVTLNAEG
FT                   VKGGGVFSPVSIEINVNSDGSVSENSNSEGAWSQAAQRMKAIALETIAQEKRPGGSLNP
FT                   NSQRN"
FT                   /protein_id="YP_001154666.1"
FT   misc_feature    complement(<16233..17549)
FT                   /note="Mu-like prophage protein [General function
FT                   prediction only]; Region: COG3941; cl09192"
FT                   /db_xref="CDD:142184"
FT                   /locus_tag="YPDSF_4039"
FT   misc_feature    complement(<15714..16193)
FT                   /note="chromosome segregation protein SMC, primarily
FT                   archaeal type; Region: SMC_prok_A; TIGR02169"
FT                   /db_xref="CDD:162740"
FT                   /locus_tag="YPDSF_4039"
FT   misc_feature    complement(14634..14837)
FT                   /note="Lambda phage tail tape-measure protein
FT                   (Tape_meas_lam_C); Region: Tape_meas_lam_C; pfam09718"
FT                   /db_xref="CDD:150398"
FT                   /locus_tag="YPDSF_4039"
FT   gene            complement(18304..18537)
FT                   /db_xref="GeneID:5061740"
FT                   /locus_tag="YPDSF_4040"
FT   CDS_pept        complement(18304..18537)
FT                   /locus_tag="YPDSF_4040"
FT                   /gene_family="HOG000266964" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597204"
FT                   /db_xref="GeneID:5061740"
FT                   /translation="MFWMLSRNIDRLRAEEDVRNLQVARAAQADGEGVKAFMEGLQLRI
FT                   GRPVVTDKVYDPRKDKADPDAKEQLMQIFGRG"
FT                   /protein_id="YP_001154667.1"
FT   gene            complement(18654..18971)
FT                   /db_xref="GeneID:5061724"
FT                   /locus_tag="YPDSF_4041"
FT   CDS_pept        complement(18654..18971)
FT                   /locus_tag="YPDSF_4041"
FT                   /gene_family="HOG000266952" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597205"
FT                   /db_xref="GeneID:5061724"
FT                   /translation="MTKLLDLDSILPPKKSIKFGGQEYPIVEMTVGLFVSIKQMEGKDL
FT                   QNMSPVEQVTAYADLVRKVIPSVPDAVLEKLTVPQLQQIFTFAMEVIDEENEKAAGEGA
FT                   K"
FT                   /protein_id="YP_001154668.1"
FT   gene            complement(19031..19777)
FT                   /db_xref="GeneID:5061746"
FT                   /locus_tag="YPDSF_4042"
FT   CDS_pept        complement(19031..19777)
FT                   /locus_tag="YPDSF_4042"
FT                   /gene_family="HOG000266953" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="SMART: Bacterial Ig-like, group 2: (1.2e-25)"
FT                   /db_xref="GI:145597206"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="GeneID:5061746"
FT                   /translation="MSNTHVKNIKLGACKVSFGGVDLGYTKGGVQVEVATETLKVTVDQ
FT                   LGQTTISELVQGRNITITAPLAESVLQNMVDLMPGSTLSEEENSVTITSAQGVNLIDVA
FT                   KELVLTPQDTTDYVLTIPKAATAGNFTMTYQSDDVRVFSVQFTAYPDDDGVLGKMSGPK
FT                   PVKTVSISPESPEVKAGETVQLTAQITPADAGDKTGVWESDNQEKATVDQTGLVRGVAE
FT                   GSANISFTSNSGGKKATKAVTVNSAQ"
FT                   /protein_id="YP_001154669.1"
FT   misc_feature    complement(19034..19777)
FT                   /note="Bacterial surface proteins containing Ig-like
FT                   domains [Cell motility and secretion]; Region: COG5492"
FT                   /db_xref="CDD:35051"
FT                   /locus_tag="YPDSF_4042"
FT   misc_feature    complement(19067..19288)
FT                   /note="Bacterial Ig-like domain (group 2); Region: Big_2;
FT                   cl02708"
FT                   /db_xref="CDD:155068"
FT                   /locus_tag="YPDSF_4042"
FT   gene            complement(19852..20235)
FT                   /db_xref="GeneID:5061729"
FT                   /locus_tag="YPDSF_4043"
FT   CDS_pept        complement(19852..20235)
FT                   /locus_tag="YPDSF_4043"
FT                   /gene_family="HOG000266954" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597207"
FT                   /db_xref="GeneID:5061729"
FT                   /translation="MFIEAFASLMQKAKIGTVGTDIFCHYMPANVKSGVLLVTPNTGIT
FT                   IDHELKGFYHDSFTVIVRNATITKTVAKANKIMDMFPVEETVSDGVYFRLVRPMSMPIT
FT                   YPKNEGSLIEAGIPIEFAGYLLN"
FT                   /protein_id="YP_001154670.1"
FT   gene            complement(20237..20710)
FT                   /db_xref="GeneID:5061659"
FT                   /locus_tag="YPDSF_4044"
FT   CDS_pept        complement(20237..20710)
FT                   /locus_tag="YPDSF_4044"
FT                   /gene_family="HOG000266955" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597208"
FT                   /db_xref="GeneID:5061659"
FT                   /translation="MGLKYDAHHFKRAGDRLNNSQKAFKRYLIRDMEKLARLVERLARA
FT                   MAPLETGSLESAIFARVVKEGYTGLRIELSVSGAKPREGHPGVEVGDYAEYMELGKYRL
FT                   GYLSRMKSVTNPPVAGVKPRVGPLFLERAVQISEKQFTQTIAEAARKAGFTRG"
FT                   /protein_id="YP_001154671.1"
FT   gene            complement(20701..21045)
FT                   /db_xref="GeneID:5061727"
FT                   /locus_tag="YPDSF_4045"
FT   CDS_pept        complement(20701..21045)
FT                   /locus_tag="YPDSF_4045"
FT                   /gene_family="HOG000266956" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597209"
FT                   /db_xref="GeneID:5061727"
FT                   /translation="MNISWQAEIAIYRLGSKNVYGEAQLQFVRKTNVGVVKFEQSNEKS
FT                   SVRADSSGSRGKANLELFDAVLVIPLEAAVQLDDVLILEGQKLKVSSVHRRWGLRGRPG
FT                   HLEVGANIWV"
FT                   /protein_id="YP_001154672.1"
FT   gene            complement(21143..21976)
FT                   /db_xref="GeneID:5061744"
FT                   /locus_tag="YPDSF_4046"
FT   CDS_pept        complement(21143..21976)
FT                   /locus_tag="YPDSF_4046"
FT                   /gene_family="HOG000266957" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597210"
FT                   /db_xref="GeneID:5061744"
FT                   /translation="MAQIDTYRSGEAVSLSFAFNVLDIESATYTVRDGAGAIIVDNEPL
FT                   DITEGQMSIPVVVSAEHNLLSDKERDLRHVIVKAVASGLTHEERKMYVLLNSFELSIPG
FT                   QSFATVADAQMQAIDMLNGDTLLADGEGLMRKRLIEATRRVKTLPFSIRKVLRIDFDRY
FT                   DRPQNMLNVYDIPWGADGAYRHDLIDWEQMTPEKFDEFPDYFKQALMLAVVNEACEIAN
FT                   GNDVAAAREDGILSESIGETTNMYRTGKAANVQVARSTWRLLVSYINNRMIVRRA"
FT                   /protein_id="YP_001154673.1"
FT   gene            complement(21976..22410)
FT                   /db_xref="GeneID:5061753"
FT                   /locus_tag="YPDSF_4047"
FT   CDS_pept        complement(21976..22410)
FT                   /locus_tag="YPDSF_4047"
FT                   /gene_family="HOG000266958" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597211"
FT                   /db_xref="GeneID:5061753"
FT                   /translation="MKPAKIRLLEPQFLGYTGILCGIQFVDGISVAELRFIDQQRICAS
FT                   MRATTVEGKNVSPSAAYSSRNDLTADDIVETAAPDIVPMKRGTAEVEAKPVQRFTREEL
FT                   ESIADCEGIAGLRQIGNQIGVKAKGIVEMIEGILKAQGGE"
FT                   /protein_id="YP_001154674.1"
FT   gene            complement(22454..23116)
FT                   /db_xref="GeneID:5061760"
FT                   /locus_tag="YPDSF_4048"
FT   CDS_pept        complement(22454..23116)
FT                   /locus_tag="YPDSF_4048"
FT                   /gene_family="HOG000266960" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="SMART: Bacterial Ig-like, group 2: (1.2e-25)"
FT                   /db_xref="GI:145597212"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="GeneID:5061760"
FT                   /translation="MPEQKMKITEEAFSDFTGHMCRAGFTNSISNEPLSERQQNHLAAC
FT                   FRAIPFTQSVTITPTAPSVLVGKTVQLSAGITMSKSADSFTWTSDNDRVATVSGTGLVT
FT                   GVTPGKVKITATDKQTQLSASVEVIVKPVSVESVTVTPDSTSVEKGKSVKLRVDVQPSN
FT                   ATNKKVTWTSKNSDKATVDQNGNVAGVAVGTATIEVVSQDGSHKATATVEVTAAPAA"
FT                   /protein_id="YP_001154675.1"
FT   misc_feature    complement(<22496..23116)
FT                   /note="Bacterial surface proteins containing Ig-like
FT                   domains [Cell motility and secretion]; Region: COG5492"
FT                   /db_xref="CDD:35051"
FT                   /locus_tag="YPDSF_4048"
FT   misc_feature    complement(22502..22714)
FT                   /note="Bacterial Ig-like domain (group 2); Region: Big_2;
FT                   cl02708"
FT                   /db_xref="CDD:155068"
FT                   /locus_tag="YPDSF_4048"
FT   gene            complement(23191..24066)
FT                   /db_xref="GeneID:5061734"
FT                   /locus_tag="YPDSF_4049"
FT   CDS_pept        complement(23191..24066)
FT                   /locus_tag="YPDSF_4049"
FT                   /gene_family="HOG000266961" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597213"
FT                   /db_xref="GeneID:5061734"
FT                   /translation="MPLLRDEAEKLSNNELEQGVIETIIDRDDLFAVLPFMKINSKAYL
FT                   YNREATLSEATFIDVNDTITEGAATFTEHVAKLRILAGDVDVDKFLATTMSDTNNQLAI
FT                   QVRQKVKGLARAFRRNLILGDSTTNTKAFDGIPKLMHDDQKIDIEGASMTFSMFDELVD
FT                   AVKDLGADCIMMRSEHLRAYRALLRTVSLGPSEIMMENFGRPMLCHNGVPFIVNDFIPT
FT                   DAGKASIYCLHLSEENGVTGLYGGENAGIVVENIGTVQNKDATRTRVKWYCSLANKHDK
FT                   AIAALTNVKI"
FT                   /protein_id="YP_001154676.1"
FT   gene            complement(24093..24989)
FT                   /db_xref="GeneID:5061723"
FT                   /locus_tag="YPDSF_4050"
FT   CDS_pept        complement(24093..24989)
FT                   /locus_tag="YPDSF_4050"
FT                   /gene_family="HOG000266945" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597214"
FT                   /db_xref="GeneID:5061723"
FT                   /translation="MNLWQMLMARRGLMDAAEAHERGGAGGGAPAGDNEQGNQDPGKQG
FT                   EQKEQPKGDDDEYAGMTQEELLAELRKSKKAGADLLKENMKRKEKERTLADQLAQYGDI
FT                   DPARARQLLEAEQAAETARREAEQAELERRGEFDAVKKQMIEAHQAELAQRDERYSALE
FT                   SENAELKAQLVEMTVGASFSGSAFLRDKVLMTPAKARVIYGSHFEVGEDGSVVGFDKPA
FT                   GQKERAVLVDGEGKPLPFESAIERILRADPEADALLRSEAKQGAGSNSKPTHKVNQPKS
FT                   KSTMDKLTSGLGKIGLK"
FT                   /protein_id="YP_001154677.1"
FT   gene            complement(25012..26601)
FT                   /db_xref="GeneID:5061735"
FT                   /locus_tag="YPDSF_4051"
FT   CDS_pept        complement(25012..26601)
FT                   /locus_tag="YPDSF_4051"
FT                   /gene_family="HOG000266946" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597215"
FT                   /db_xref="GeneID:5061735"
FT                   /translation="MEKKQMELTDKQIKDLVARRHPEYEKKKEHWDFLASTYAGGRAWF
FT                   NDNIFRYFKEGDQEFKERLERAYRFNHTREVVNLINKYLFKEVIHRNTDEAPEQIRNFW
FT                   KRATRQNASIDAFMAAIDLQSSIYGRIWVVVDSTMNVDVESVADEKKNDARAYAYWISP
FT                   QQLLDVAWDEDGNMLWALIVEIARDDEDPFTSTGQEYQRYRLWTQNEWYLFREEVKKGS
FT                   GNSGRRQAKVVLEDSGEHNLGVVPVFPVDCIGESESPYFSPSLIDDIAYLDRAVANYLS
FT                   NLDAIIQDQTFSQLAIPVQSLLPGDENHTKVLEMGTKRVFTFDSESGNQPFYLSPDPKQ
FT                   AQMIITTIKTVINEIYHSVGVAGERTKQDNAQGIDNSSGAAKMYDFQRVNSLLVTKAER
FT                   LERAERQMMQLAAKWMGVELDEDHSLIAYPESFDIRGLTDEFAVAEKLSLLQAPDSVRR
FT                   HQMEMLIEKVFPNISEAMQKEFQKDLLKFPPKNDLNTLENKSVLTYDRDIAQESGQDQP
FT                   RGNGDSSTQETE"
FT                   /protein_id="YP_001154678.1"
FT   misc_feature    complement(25318..26391)
FT                   /note="Phage portal protein, SPP1 Gp6-like; Region:
FT                   Phage_prot_Gp6; pfam05133"
FT                   /db_xref="CDD:147355"
FT                   /locus_tag="YPDSF_4051"
FT   gene            complement(26620..27876)
FT                   /db_xref="GeneID:5061715"
FT                   /locus_tag="YPDSF_4052"
FT   CDS_pept        complement(26620..27876)
FT                   /locus_tag="YPDSF_4052"
FT                   /gene_family="HOG000266947" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597216"
FT                   /db_xref="GeneID:5061715"
FT                   /translation="MAIPSSLSLVQLHSGQMQVFQSPHRFKVVCAGRRWGKSRLSISTI
FT                   IRAAAKEKKQRVWYVAPTYQMARQILWDDLQEVLPRKWVRKKNDTTMTIVLKNGSEIAL
FT                   KGADKPDTLRGVALHFVVLDEFQDMKPDTWYKVLRPTLSSTRGGALIIGTPKGFSEFHK
FT                   LWTIGQNKDLQRKGQWKSWQFVTADSPFVPSAEIEAAKNDMDPKSFAQEYLASFENMSG
FT                   RVYYPFDRNVHVKPLQFNPKLPIWVGQDFNIDPMSSVILQPQPNGELWAVDEVVLFSSN
FT                   TAEVCDELERRFWRWKSQVTIFPDPAGAYRQHARGESDVDIFKEKGFLRVDYPKKHPPI
FT                   ADRVNAVNRMLMSASGETRLYIDPKCKHLIDSLEKVIYKPGSRDMDKTGGIEHSADALG
FT                   YPVHRRYPVKNRVILGGSR"
FT                   /protein_id="YP_001154679.1"
FT   misc_feature    complement(<27193..27849)
FT                   /note="large terminase protein; Provisional; Region: 17;
FT                   PHA02533"
FT                   /db_xref="CDD:164930"
FT                   /locus_tag="YPDSF_4052"
FT   misc_feature    complement(26668..27786)
FT                   /note="Terminase-like family; Region: Terminase_6;
FT                   pfam03237"
FT                   /db_xref="CDD:146059"
FT                   /locus_tag="YPDSF_4052"
FT   gene            complement(27879..28520)
FT                   /db_xref="GeneID:5061711"
FT                   /locus_tag="YPDSF_4053"
FT   CDS_pept        complement(27879..28520)
FT                   /locus_tag="YPDSF_4053"
FT                   /gene_family="HOG000266949" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597217"
FT                   /db_xref="GeneID:5061711"
FT                   /translation="MTVEKDESKTRLTPAEWAEAEAKWTSGEYTLSKLEEEYGIRRETL
FT                   SRHFKKRGLEKGADSVGKMVRESLKSDAELRAKARAEKIEERRTRYDDWAFALGRMVMH
FT                   EVATAKKDGKPLATIEDDLKSLQRASGTLAKCFEVSSKALGMDRAENEDDEIPNLVFGE
FT                   LTPSQVAQLRKEDDEPDLIDDDLLESLEEEALSEAEGDSDASGDESDGSV"
FT                   /protein_id="YP_001154680.1"
FT   gene            complement(28716..28982)
FT                   /db_xref="GeneID:5061658"
FT                   /locus_tag="YPDSF_4054"
FT   CDS_pept        complement(28716..28982)
FT                   /locus_tag="YPDSF_4054"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597218"
FT                   /db_xref="GeneID:5061658"
FT                   /translation="MTLTDKQKDIIKTINLGHERGHLLDLDELLEVLPYKTTKQSMQFS
FT                   IRALVKKGLVEKGMCRQRGDSGYHRRTLGLTTLGRARAKLLVM"
FT                   /protein_id="YP_001154681.1"
FT   gene            complement(28992..29882)
FT                   /db_xref="GeneID:5061756"
FT                   /locus_tag="YPDSF_4055"
FT   CDS_pept        complement(28992..29882)
FT                   /locus_tag="YPDSF_4055"
FT                   /gene_family="HOG000266950" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597219"
FT                   /db_xref="GeneID:5061756"
FT                   /translation="MTDIIIKRYRPEEFPRHLDFLERMTVTKGTVEDWHALKSLHYKTD
FT                   GKPFAPTYYRCELDDRLVGVVVMAYPKLLLAPRHRMFPKLKPTTNTTVANQYWGRYVNN
FT                   NFAVISRSVVDTQYRGVGVSYRMINLVSRMHDRPIIEIQSSMSKYNPFAMKAGFQFIRP
FT                   ERPKSYESALRVFQRHFRSDPGDNEAIVKELFAMSESRRRRALRDLVADYHKNSSLAKA
FT                   GRNRGTTIQDIADSLVDEASIVKLLKDIHNLSFTSPLYGVYRNPDFGRQLPDTLPLLAF
FT                   DKQPLNKPLEIALPA"
FT                   /protein_id="YP_001154682.1"
FT   misc_feature    complement(29013..>29882)
FT                   /note="ABC-type ATPase fused to a predicted
FT                   acetyltransferase domain [General function prediction
FT                   only]; Region: COG2401"
FT                   /db_xref="CDD:32537"
FT                   /locus_tag="YPDSF_4055"
FT   gene            complement(29888..30142)
FT                   /db_xref="GeneID:5061721"
FT                   /locus_tag="YPDSF_4056"
FT   CDS_pept        complement(29888..30142)
FT                   /locus_tag="YPDSF_4056"
FT                   /gene_family="HOG000266588" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597220"
FT                   /db_xref="GeneID:5061721"
FT                   /translation="MPDLKIVELKPSKEADNNNVEVIRLLEEALQHAREGKSQSLALLM
FT                   INNDGSVLDCWHNGGRPYVMVGAMESLRLDFINANIERR"
FT                   /protein_id="YP_001154683.1"
FT   gene            complement(30135..30773)
FT                   /db_xref="GeneID:5061739"
FT                   /locus_tag="YPDSF_4057"
FT   CDS_pept        complement(30135..30773)
FT                   /locus_tag="YPDSF_4057"
FT                   /gene_family="HOG000266951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="SMART: ATPase (1.5e-07)"
FT                   /db_xref="GI:145597221"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:5061739"
FT                   /translation="MSKYTINVSFQTRVNKTMRTLEIAESFGLGLDEKEWTLYDNLELE
FT                   VKQGDVVYITGQSGSGKSVVLRELQRQMKDEGLSVASIDDFTFNNEVNVIDQLGKTTSD
FT                   ALGLLSMAGLNDAYLFVRKPSEMSDGQKYRLKIAKLIESGAKVWAADEFGAVLDRVTAQ
FT                   VVASNLQRAARKVGATVMVATTHEDLKNALRPDMQITKHYKERVKVEYA"
FT                   /protein_id="YP_001154684.1"
FT   misc_feature    complement(30207..30707)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30174..30692)
FT                   /note="ABC-type transport system involved in cytochrome c
FT                   biogenesis, ATPase component [Posttranslational
FT                   modification, protein turnover, chaperones]; Region: CcmA;
FT                   COG4133"
FT                   /db_xref="CDD:33889"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30585..30608)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(order(30219..30221,30318..30323,30513..30515,
FT                   30582..30590,30594..30599))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30513..30518)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30366..30395)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30318..30335)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30300..30311)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   misc_feature    complement(30213..30233)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="YPDSF_4057"
FT   gene            complement(30770..31438)
FT                   /db_xref="GeneID:5061755"
FT                   /locus_tag="YPDSF_4058"
FT   CDS_pept        complement(30770..31438)
FT                   /locus_tag="YPDSF_4058"
FT                   /gene_family="HOG000266939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="SMART: ParB-like nuclease: (3.6e-24)"
FT                   /db_xref="GI:145597222"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:5061755"
FT                   /translation="MTKNFEIVYRNPAELIPYEMNAKKHDEQQIRDLAAAIKKRGFDQP
FT                   ITVDKHDVIITGHGRREAALLAGLERVPVIVRDDLSEEEVKAKRLEDNRLASIDYDAIK
FT                   LQQELESLVLGDVEVFGFEERELNVLVGSMTEEMETGALVLDLGEETERQKEEHTEISR
FT                   EVAAEEVRVIDVLGFKTLPAGSAIVVGDLLAHMEEITGECGVDAFVAYAEKVSSGELAA
FT                   "
FT                   /protein_id="YP_001154685.1"
FT   misc_feature    complement(31160..31417)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="YPDSF_4058"
FT   gene            complement(31438..32136)
FT                   /db_xref="GeneID:5061752"
FT                   /locus_tag="YPDSF_4059"
FT   CDS_pept        complement(31438..32136)
FT                   /locus_tag="YPDSF_4059"
FT                   /gene_family="HOG000266940" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="SMART: ParB-like nuclease: (6.6e-25)"
FT                   /db_xref="GI:145597223"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="GeneID:5061752"
FT                   /translation="MDCIRIMDVKITILQVEVANLRPNPWNTNSVGAQNFEKLKGSIEK
FT                   LGFFKPILARELDGGIFEILGGEHRWRAAMEQGISTVPVISVGKINDLVAKQMSLVDNE
FT                   RYGEDDQVALQRLIEEIQSEIDYRLSDIAPYDDEMAATLAKASVIDLEALEALSRGDDE
FT                   PIEEDKREKTERVGAEHQTMRFKVTFDASDRVADTIKTIIKEQGINTGNEMENAGEALV
FT                   WLVDYYKERM"
FT                   /protein_id="YP_001154686.1"
FT   misc_feature    complement(31441..32121)
FT                   /note="Stage 0 sporulation protein J (antagonist of Soj)
FT                   containing ParB-like nuclease domain [Transcription];
FT                   Region: Spo0J; COG1475"
FT                   /db_xref="CDD:31664"
FT                   /locus_tag="YPDSF_4059"
FT   misc_feature    complement(31828..32094)
FT                   /note="ParB-like nuclease domain; Region: ParBc; cl02129"
FT                   /db_xref="CDD:154762"
FT                   /locus_tag="YPDSF_4059"
FT   gene            32205..33764
FT                   /db_xref="GeneID:5061749"
FT                   /locus_tag="YPDSF_4060"
FT   CDS_pept        32205..33764
FT                   /locus_tag="YPDSF_4060"
FT                   /gene_family="HOG000266941" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="SMART: Helicase, C-terminal: (5.7e-16) DEAD/DEAH box
FT                   helicase, N-terminal: (1.5e-20)"
FT                   /db_xref="GI:145597224"
FT                   /db_xref="InterPro:IPR001410"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="GeneID:5061749"
FT                   /translation="MTVRIVSNAVNALISGADDNVKRLVQEMLSYEVEAGDWKGTSTMF
FT                   NWSKNAFPAGFAKPVAANLLKAGIKCVHVRKEKAPALGKPNPVVNPFPYNPDYAYQDQT
FT                   VETLVREGMMIAQIATGGGKSNVACKAAARIGRMTLFLTTRSVLMFQMAENFQKSIDYR
FT                   AENGEPWLKGQKVGVIGSGEFQVSRHINVATVQTLASFLEEPPRDASPEKKRYHLKRRE
FT                   LVKRFLSSVSLLILEEAHESSGSNFYDIARLCINADYRLALTATPFMKDSTEANMRLMA
FT                   VAGRIEIKVTEKYLIDRGILAKPYFLYHKIAYTPDEVRIRAELASKHLNFRVGMSTAYQ
FT                   KAYQLGIVYNLGRNEAIVREALMYKSHGLNCMTLVRLKRHGQILMEMMKESGLKVDFIY
FT                   GESNQTTRQAKLSSLAAGRIDVLIGSTILDVGVDVPSVGAVILGGGGKAEVEMRQRVGR
FT                   GLRAKKNQANVCFITDFIDVSNKYLMSHSYERKHIIDTTPGFAEGVLPVGSTFDFTVLN
FT                   RE"
FT                   /protein_id="YP_001154687.1"
FT   misc_feature    32544..33005
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="YPDSF_4060"
FT   misc_feature    32565..32579
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="YPDSF_4060"
FT   misc_feature    32913..32924
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="YPDSF_4060"
FT   misc_feature    33234..33620
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="YPDSF_4060"
FT   misc_feature    order(33330..33341,33399..33404,33477..33485)
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="YPDSF_4060"
FT   misc_feature    order(33501..33503,33564..33566,33576..33578,33585..33587)
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="YPDSF_4060"
FT   gene            33767..34045
FT                   /db_xref="GeneID:5061745"
FT                   /locus_tag="YPDSF_4061"
FT   CDS_pept        33767..34045
FT                   /locus_tag="YPDSF_4061"
FT                   /gene_family="HOG000266942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597225"
FT                   /db_xref="GeneID:5061745"
FT                   /translation="MSEKRAIHCQVQLTEKANDKLETFQNRLRERNIKLSKADVINLVL
FT                   SNMTMADFDKAATSLEASAKAREKVMKIYESSGMTKEDLADILKRLD"
FT                   /protein_id="YP_001154688.1"
FT   gene            34105..34527
FT                   /db_xref="GeneID:5061668"
FT                   /locus_tag="YPDSF_4062"
FT   CDS_pept        34105..34527
FT                   /locus_tag="YPDSF_4062"
FT                   /gene_family="HOG000219484" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="lipoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597226"
FT                   /db_xref="GeneID:5061668"
FT                   /translation="MKHVLLPLITIPVLLLSACSSRPVSVANAKPAPQARVFKYQTSAP
FT                   TTLVVMRDKGMIGAGCDASIFINGETVAKLETGEKATFHLDAGQWIVGASLEGAGLCAL
FT                   NPARQERETITKAGETKVFRVFTSNAGDIDILPTTL"
FT                   /protein_id="YP_001154689.1"
FT   sig_peptide     34105..34194
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.572 at
FT                   residue 30"
FT                   /locus_tag="YPDSF_4062"
FT                   /product="hypothetical protein"
FT   misc_feature    34153..34497
FT                   /note="Protein of unknown function (DUF2846); Region:
FT                   DUF2846; pfam11008"
FT                   /db_xref="CDD:151455"
FT                   /locus_tag="YPDSF_4062"
FT   gene            34532..35059
FT                   /db_xref="GeneID:5061708"
FT                   /locus_tag="YPDSF_4063"
FT   CDS_pept        34532..35059
FT                   /locus_tag="YPDSF_4063"
FT                   /gene_family="HOG000266943" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597227"
FT                   /db_xref="InterPro:IPR003223"
FT                   /db_xref="GeneID:5061708"
FT                   /translation="MTNKTDITYGIPAEVWPRDYSNVEKALMFWRKSLIPVRVTMEDGQ
FT                   VFCMYVQGLMSSRNKVDLCPAPFDKENRIRLPLERISTIESGVTEGIAHDFTGRTTVHP
FT                   DYVDNRPSRRDFFKICRQAHEMQKSIRVYMADGREIEGGSSGVDACQATLNMGDGRKTV
FT                   VMFDWVERILPF"
FT                   /protein_id="YP_001154690.1"
FT   misc_feature    34547..35047
FT                   /note="Repressor of phase-1 flagellin; Region:
FT                   Flag1_repress; pfam03614"
FT                   /db_xref="CDD:112432"
FT                   /locus_tag="YPDSF_4063"
FT   gene            35383..36033
FT                   /db_xref="GeneID:5061758"
FT                   /locus_tag="YPDSF_4064"
FT   CDS_pept        35383..36033
FT                   /locus_tag="YPDSF_4064"
FT                   /gene_family="HOG000266944" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597228"
FT                   /db_xref="GeneID:5061758"
FT                   /translation="MSNVAISKKSIIDAAVVIANELQVAANNATQTYNNHYQNGTHTKA
FT                   DKANMLAATTKLAYFTNNVLNAVNDEKLAGVFYYAIKASKQAPEAFFREAMTNSYSLEK
FT                   LVYLVKSIKSGKCVYSVADMSGSRVFALIEMINDELETFTNGAVFDLMNEAKKANEIKL
FT                   DAGYTQANQLINLCERLGLVEKIKGMGAAKNGSQQYRFIKNDFYNYLADAFKA"
FT                   /protein_id="YP_001154691.1"
FT   misc_feature    <35623..35949
FT                   /note="Protein of unknown function (DUF327); Region:
FT                   DUF327; cl00753"
FT                   /db_xref="CDD:120088"
FT                   /locus_tag="YPDSF_4064"
FT   gene            36118..36345
FT                   /db_xref="GeneID:5061754"
FT                   /locus_tag="YPDSF_4151"
FT   CDS_pept        36118..36345
FT                   /locus_tag="YPDSF_4151"
FT                   /gene_family="HOG000266933" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597315"
FT                   /db_xref="GeneID:5061754"
FT                   /translation="MVIFIAGVNIHNHTLVYDIAGLAGYALSSEVVDETTFKIDLNSAE
FT                   HRKRAGIKESDVLLMIQEFLNAGFKIHLEK"
FT                   /protein_id="YP_001154692.1"
FT   gene            36571..37029
FT                   /db_xref="GeneID:5061690"
FT                   /locus_tag="YPDSF_4065"
FT   CDS_pept        36571..37029
FT                   /locus_tag="YPDSF_4065"
FT                   /gene_family="HOG000235391" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597229"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="GeneID:5061690"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT                   /protein_id="YP_001154693.1"
FT   misc_feature    36604..36957
FT                   /note="Transposase IS200 like; Region: Transposase_17;
FT                   cl00848"
FT                   /db_xref="CDD:154036"
FT                   /locus_tag="YPDSF_4065"
FT   gene            complement(37705..38187)
FT                   /db_xref="GeneID:5061747"
FT                   /locus_tag="YPDSF_4066"
FT   CDS_pept        complement(37705..38187)
FT                   /locus_tag="YPDSF_4066"
FT                   /gene_family="HOG000266934" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597230"
FT                   /db_xref="GeneID:5061747"
FT                   /translation="MNFIATVNTPSHGHISVTFSDNDKSVLGAWRDNVTIELSGKEKQQ
FT                   ITNDIICNRRHKRVFEKAYVSTSGFGVFIFPVRSGRFCRSKLIEFATQIALWVKTESGF
FT                   DFTEQEAVGEGMRIANNAIKCKNVIYEAGIDSWSISCGDYVKEVYGKNRIHILAGK"
FT                   /protein_id="YP_001154694.1"
FT   gene            complement(38393..38674)
FT                   /db_xref="GeneID:5061742"
FT                   /locus_tag="YPDSF_4067"
FT   CDS_pept        complement(38393..38674)
FT                   /locus_tag="YPDSF_4067"
FT                   /gene_family="HOG000266935" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597231"
FT                   /db_xref="GeneID:5061742"
FT                   /translation="MTDFTISPKAENVWLESWLDLSSEEKREMDHIEQDEQCDARFFHF
FT                   EGSVYDIADFMRDDRFPGWHAGYPLNAFAMLMIRVDGSGDTIDVGLLH"
FT                   /protein_id="YP_001154695.1"
FT   gene            complement(38874..39332)
FT                   /db_xref="GeneID:5061736"
FT                   /locus_tag="YPDSF_4068"
FT   CDS_pept        complement(38874..39332)
FT                   /locus_tag="YPDSF_4068"
FT                   /gene_family="HOG000235391" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597232"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="GeneID:5061736"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT                   /protein_id="YP_001154696.1"
FT   misc_feature    complement(38946..39299)
FT                   /note="Transposase IS200 like; Region: Transposase_17;
FT                   cl00848"
FT                   /db_xref="CDD:154036"
FT                   /locus_tag="YPDSF_4068"
FT   gene            complement(39571..40326)
FT                   /db_xref="GeneID:5061732"
FT                   /locus_tag="YPDSF_4069"
FT   CDS_pept        complement(39571..40326)
FT                   /locus_tag="YPDSF_4069"
FT                   /gene_family="HOG000266936" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:145597233"
FT                   /db_xref="GeneID:5061732"
FT                   /translation="MVDQFHTLFQHPRRAIPDPALLRLRAKLIHEEAVTEGIPAAKNGD
FT                   MTALLDAMADFLYVGVGTMVAIKGGISTGMSYYTQEQSVDRFIHTIMVSGNTVFDDMAI
FT                   PFEEAKEAALMLNALADKLEAKPISDSELVQELRRVMNKIYVACMMTYRLADFLGIDIV
FT                   ELVAEIHRSNMTKLWPADAEERRVAVENCKYNKEDLGFRHAEGTDMMIGFRVSDGKILK
FT                   SPTYSDVDLTRFVEKAKSSSLYEMVKKQL"
FT                   /protein_id="YP_001154697.1"
FT   misc_feature    complement(40129..40323)
FT                   /note="Phosphoribosyl-ATP pyrophosphohydrolase; Region:
FT                   PRA-PH; cl00345"
FT                   /db_xref="CDD:174131"
FT                   /locus_tag="YPDSF_4069"
FT   misc_feature    complement(<39790..>40008)
FT                   /note="Phosphoribosyl-ATP pyrophosphohydrolase; Region:
FT                   PRA-PH; cl00345"
FT                   /db_xref="CDD:174131"
FT                   /locus_tag="YPDSF_4069"
FT   gene            complement(40525..41667)
FT                   /db_xref="GeneID:5061759"
FT                   /locus_tag="YPDSF_4070"