(data stored in ACNUC7421 zone)

EMBL: AB001488.CSPC

AB001488.CSPC        Location/Qualifiers
FT   CDS             92483..92683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /product="COLD SHOCK PROTEIN"
FT                   /note="CONSERVED IN MANY ORGANISMS."
FT                   /db_xref="GOA:P39158"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39158"
FT                   /protein_id="BAA19348.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQ
FT                   KVSFDVEQGARGAQAANVQKA"
     MEQGTVKWFN AEKGFGFIER ENGDDVFVHF SAIQSDGFKS LDEGQKVSFD VEQGARGAQA        60
     ANVQKA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page