(data stored in ACNUC7421 zone)

EMBL: AB001488.DINB

AB001488.DINB        Location/Qualifiers
FT   CDS             complement(141465..141983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /note="DNA DAMAGE-INDUCIBLE DINB PROTEIN, SIMILAR PRODUCT
FT                   IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:Q02886"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02886"
FT                   /protein_id="BAA19396.1"
FT                   /translation="MSDFAFKLYEYNVWANQQIFNRLKELPKEIYHQEIQSVFPSISHV
FT                   LSHVYLSDLGWIEVFSGKTLSDALALAEQLKEQTEAKEIEEMEDLFLRLSERYILFLQQ
FT                   KEQLNKPLQIQNPSSGIMKTTVSELLPHVVNHGTYHRGNITAMLRQAGYASAPTDYGLY
FT                   LFMTKTEKA"
     MSDFAFKLYE YNVWANQQIF NRLKELPKEI YHQEIQSVFP SISHVLSHVY LSDLGWIEVF        60
     SGKTLSDALA LAEQLKEQTE AKEIEEMEDL FLRLSERYIL FLQQKEQLNK PLQIQNPSSG       120
     IMKTTVSELL PHVVNHGTYH RGNITAMLRQ AGYASAPTDY GLYLFMTKTE KA               172
//

If you have problems or comments...

PBIL Back to PBIL home page