(data stored in ACNUC7421 zone)

EMBL: AB001488.EXPZ

AB001488.EXPZ        Location/Qualifiers
FT   CDS             complement(137954..139597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="expZ"
FT                   /product="PROBABLE ATP-BINDING TRANSPORT PROTEIN"
FT                   /db_xref="GOA:P39115"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39115"
FT                   /protein_id="BAA19394.1"
FT                   /translation="MKEIVTLTNVSYEVKDQTVFKHVNASVQQGDIIGIIGKNGAGKST
FT                   LLHLIHNDLAPAQGQILRKDIKLALVEQETAAYSFADQTPAEKKLLEKWHVPLRDFHQL
FT                   SGGEKLKARLAKGLSEDADLLLLDEPTNHLDEKSLQFLIQQLKHYNGTVILVSHDRYFL
FT                   DEAATKIWSLEDQTLIEFKGNYSGYMKFREKKRLTQQREYEKQQKMVERIEAQMNGLAS
FT                   WSEKAHAQSTKKEGFKEYHRVKAKRTDAQIKSKQKRLEKELEKAKAEPVTPEYTVRFSI
FT                   DTTHKTGKRFLEVQNVTKAFGERTLFKNANFTIQHGEKVAIIGPNGSGKTTLLNIILGQ
FT                   ETAEGSVWVSPSANIGYLTQEVFDLPLEQTPEELFENETFKARGHVQNLMRHLGFTAAQ
FT                   WTEPIKHMSMGERVKIKLMAYILEEKDVLILDEPTNHLDLPSREQLEETLSQYSGTLLA
FT                   VSHDRYFLEKTTNSKLVISNNGIEKQLNDVPSERNEREELRLKLETERQEVLGKLSFMT
FT                   PNDKGYKELDQAFNELTKRIKELDHQDKKD"
     MKEIVTLTNV SYEVKDQTVF KHVNASVQQG DIIGIIGKNG AGKSTLLHLI HNDLAPAQGQ        60
     ILRKDIKLAL VEQETAAYSF ADQTPAEKKL LEKWHVPLRD FHQLSGGEKL KARLAKGLSE       120
     DADLLLLDEP TNHLDEKSLQ FLIQQLKHYN GTVILVSHDR YFLDEAATKI WSLEDQTLIE       180
     FKGNYSGYMK FREKKRLTQQ REYEKQQKMV ERIEAQMNGL ASWSEKAHAQ STKKEGFKEY       240
     HRVKAKRTDA QIKSKQKRLE KELEKAKAEP VTPEYTVRFS IDTTHKTGKR FLEVQNVTKA       300
     FGERTLFKNA NFTIQHGEKV AIIGPNGSGK TTLLNIILGQ ETAEGSVWVS PSANIGYLTQ       360
     EVFDLPLEQT PEELFENETF KARGHVQNLM RHLGFTAAQW TEPIKHMSMG ERVKIKLMAY       420
     ILEEKDVLIL DEPTNHLDLP SREQLEETLS QYSGTLLAVS HDRYFLEKTT NSKLVISNNG       480
     IEKQLNDVPS ERNEREELRL KLETERQEVL GKLSFMTPND KGYKELDQAF NELTKRIKEL       540
     DHQDKKD                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page