(data stored in ACNUC7421 zone)

EMBL: AB001488.GSIB

AB001488.GSIB        Location/Qualifiers
FT   CDS             27563..27934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /product="GLUCOSE STARVATION-INDUCIBLE PROTEIN B (GENERAL
FT                   STRESS PROTEIN B)"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26907"
FT                   /protein_id="BAA19277.1"
FT                   /translation="MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHD
FT                   KEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNH
FT                   DKEFYQEIGSKGGNARNND"
     MADNNKMSRE EAGRKGGETT SKNHDKEFYQ EIGQKGGEAT SKNHDKEFYQ EIGEKGGEAT        60
     SKNHDKEFYQ EIGEKGGEAT SENHDKEFYQ EIGRKGGEAT SKNHDKEFYQ EIGSKGGNAR       120
     NND                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page